BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19497_g1_i3 len=2538 path=[203:0-1256 1460:1257-1527 7907:1528-1547
202:1548-1572 1774:1573-1643 1845:1644-1667 1869:1668-2537]

Length=2538
                                                                      Score     E

ref|XP_009804282.1|  PREDICTED: uncharacterized protein LOC104249541    738   0.0      
ref|XP_009588493.1|  PREDICTED: uncharacterized protein LOC104086...    732   0.0      
ref|XP_011096308.1|  PREDICTED: uncharacterized protein LOC105175541    728   0.0      
emb|CDO99536.1|  unnamed protein product                                728   0.0      
ref|XP_004232879.1|  PREDICTED: uncharacterized protein LOC101250652    722   0.0      
ref|XP_006347035.1|  PREDICTED: uncharacterized protein LOC102590306    719   0.0      
ref|XP_011086071.1|  PREDICTED: uncharacterized protein LOC105167904    714   0.0      
ref|XP_009588492.1|  PREDICTED: uncharacterized protein LOC104086...    716   0.0      
ref|XP_004248111.1|  PREDICTED: uncharacterized protein LOC101247562    711   0.0      
ref|XP_006343239.1|  PREDICTED: uncharacterized protein LOC102601452    712   0.0      
ref|XP_004234118.1|  PREDICTED: uncharacterized protein LOC101259...    708   0.0      
ref|XP_007025606.1|  F3H9.11 protein isoform 1                          700   0.0      
ref|XP_006377366.1|  hypothetical protein POPTR_0011s05280g             699   0.0      
ref|XP_002305132.1|  hypothetical protein POPTR_0004s04400g             697   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011043387.1|  PREDICTED: uncharacterized protein LOC105138870    696   0.0      
ref|XP_006361032.1|  PREDICTED: uncharacterized protein LOC102582809    691   0.0      
ref|XP_009618811.1|  PREDICTED: uncharacterized protein LOC104110...    689   0.0      
ref|XP_007025608.1|  F3H9.11 protein isoform 3                          687   0.0      
ref|XP_011027825.1|  PREDICTED: uncharacterized protein LOC105128...    690   0.0      
gb|KDP20976.1|  hypothetical protein JCGZ_21447                         691   0.0      
ref|XP_010317441.1|  PREDICTED: uncharacterized protein LOC101259...    689   0.0      
ref|XP_008442599.1|  PREDICTED: uncharacterized protein LOC103486418    685   0.0      
ref|XP_007025610.1|  F3H9.11 protein isoform 5                          684   0.0      
ref|XP_004163444.1|  PREDICTED: uncharacterized LOC101209711            682   0.0      
gb|EYU43390.1|  hypothetical protein MIMGU_mgv1a021937mg                682   0.0      
ref|XP_008225103.1|  PREDICTED: uncharacterized protein LOC103324773    681   0.0      
ref|XP_009618813.1|  PREDICTED: uncharacterized protein LOC104110...    677   0.0      
ref|XP_009618812.1|  PREDICTED: uncharacterized protein LOC104110...    677   0.0      
ref|XP_002509470.1|  conserved hypothetical protein                     680   0.0      Ricinus communis
gb|KHG15814.1|  Protein strawberry notch 2                              679   0.0      
ref|XP_004294016.1|  PREDICTED: uncharacterized protein LOC101293376    678   0.0      
ref|XP_010052305.1|  PREDICTED: uncharacterized protein LOC104441...    678   0.0      
ref|XP_011027827.1|  PREDICTED: uncharacterized protein LOC105128...    674   0.0      
ref|XP_011027826.1|  PREDICTED: uncharacterized protein LOC105128...    674   0.0      
ref|XP_004146603.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    675   0.0      
ref|XP_009352913.1|  PREDICTED: uncharacterized protein LOC103944205    675   0.0      
ref|XP_010052304.1|  PREDICTED: uncharacterized protein LOC104441...    674   0.0      
gb|KHG15813.1|  Protein strawberry notch 2                              672   0.0      
ref|XP_002270005.2|  PREDICTED: uncharacterized protein LOC100256311    672   0.0      Vitis vinifera
ref|XP_006467795.1|  PREDICTED: uncharacterized protein LOC102625961    672   0.0      
gb|KGN64680.1|  hypothetical protein Csa_1G073870                       671   0.0      
ref|XP_008356005.1|  PREDICTED: uncharacterized protein LOC103419684    670   0.0      
ref|XP_003545980.1|  PREDICTED: uncharacterized protein LOC100792761    669   0.0      
gb|KDO75981.1|  hypothetical protein CISIN_1g006222mg                   670   0.0      
gb|KHF99460.1|  Protein strawberry notch                                667   0.0      
ref|XP_009340023.1|  PREDICTED: uncharacterized protein LOC103932167    667   0.0      
ref|XP_006449347.1|  hypothetical protein CICLE_v10014620mg             667   0.0      
ref|XP_010549320.1|  PREDICTED: uncharacterized protein LOC104820544    664   0.0      
ref|XP_010686493.1|  PREDICTED: uncharacterized protein LOC104900699    664   0.0      
ref|XP_003543045.1|  PREDICTED: uncharacterized protein LOC100804922    663   0.0      
gb|KHG29027.1|  hypothetical protein F383_16232                         661   0.0      
ref|XP_007148158.1|  hypothetical protein PHAVU_006G185100g             660   0.0      
ref|XP_007159328.1|  hypothetical protein PHAVU_002G228900g             659   0.0      
ref|XP_007211416.1|  hypothetical protein PRUPE_ppa003865mg             658   0.0      
emb|CBI23970.3|  unnamed protein product                                656   0.0      
ref|XP_010540448.1|  PREDICTED: uncharacterized protein LOC104814215    658   0.0      
ref|XP_010272447.1|  PREDICTED: uncharacterized protein LOC104608...    659   0.0      
ref|XP_010108182.1|  hypothetical protein L484_014507                   658   0.0      
gb|KDO75982.1|  hypothetical protein CISIN_1g006222mg                   660   0.0      
emb|CDY46616.1|  BnaA09g27430D                                          655   0.0      
ref|XP_006583820.1|  PREDICTED: uncharacterized protein LOC100783...    653   0.0      
gb|KHN07255.1|  hypothetical protein glysoja_027345                     653   0.0      
ref|XP_009113689.1|  PREDICTED: uncharacterized protein LOC103838975    653   0.0      
ref|XP_003542746.2|  PREDICTED: uncharacterized protein LOC100779...    652   0.0      
ref|XP_006415681.1|  hypothetical protein EUTSA_v10007204mg             651   0.0      
emb|CDY15686.1|  BnaA07g08570D                                          649   0.0      
ref|XP_009102925.1|  PREDICTED: uncharacterized protein LOC103829026    648   0.0      
emb|CDX94597.1|  BnaC07g10610D                                          648   0.0      
ref|XP_003593577.1|  hypothetical protein MTR_2g013690                  647   0.0      
emb|CDY35723.1|  BnaC03g58440D                                          646   0.0      
ref|XP_004505059.1|  PREDICTED: uncharacterized protein LOC101507527    646   0.0      
gb|KFK44701.1|  hypothetical protein AALP_AA1G291900                    647   0.0      
ref|NP_174145.1|  uncharacterized protein                               646   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303939.1|  hypothetical protein CARUB_v10008674mg             646   0.0      
ref|XP_002893514.1|  hypothetical protein ARALYDRAFT_473032             646   0.0      
ref|XP_010460602.1|  PREDICTED: uncharacterized protein LOC104741432    644   0.0      
gb|AAL32582.1|  Unknown protein                                         644   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX90137.1|  BnaA08g18470D                                          643   0.0      
ref|XP_004485783.1|  PREDICTED: uncharacterized protein LOC101495...    642   0.0      
ref|XP_010260203.1|  PREDICTED: uncharacterized protein LOC104599390    641   0.0      
emb|CAN81089.1|  hypothetical protein VITISV_008182                     640   0.0      Vitis vinifera
ref|XP_006583819.1|  PREDICTED: uncharacterized protein LOC100783...    639   0.0      
ref|XP_010499331.1|  PREDICTED: uncharacterized protein LOC104776879    639   0.0      
gb|KEH31064.1|  DUF616 family protein                                   636   0.0      
ref|XP_010478192.1|  PREDICTED: uncharacterized protein LOC104757163    637   0.0      
ref|XP_010272448.1|  PREDICTED: uncharacterized protein LOC104608...    637   0.0      
ref|XP_009109744.1|  PREDICTED: uncharacterized protein LOC103835341    635   0.0      
ref|XP_007025609.1|  F3H9.11 protein isoform 4                          628   0.0      
ref|XP_007025607.1|  F3H9.11 protein isoform 2                          628   0.0      
ref|XP_010915933.1|  PREDICTED: uncharacterized protein LOC105040886    628   0.0      
ref|XP_010924642.1|  PREDICTED: uncharacterized protein LOC105047426    625   0.0      
ref|XP_009394836.1|  PREDICTED: uncharacterized protein LOC103980235    618   0.0      
ref|XP_009141342.1|  PREDICTED: uncharacterized protein LOC103865...    615   0.0      
ref|XP_008792270.1|  PREDICTED: uncharacterized protein LOC103708934    617   0.0      
ref|XP_008383733.1|  PREDICTED: uncharacterized protein LOC103446403    613   0.0      
emb|CDY37692.1|  BnaA04g19760D                                          610   0.0      
ref|XP_009395983.1|  PREDICTED: uncharacterized protein LOC103981108    609   0.0      
emb|CDY53782.1|  BnaC04g44140D                                          606   0.0      
ref|XP_006410522.1|  hypothetical protein EUTSA_v10017801mg             607   0.0      
ref|XP_009410890.1|  PREDICTED: uncharacterized protein LOC103992775    607   0.0      
gb|KDO75983.1|  hypothetical protein CISIN_1g006222mg                   600   0.0      
ref|XP_008807992.1|  PREDICTED: uncharacterized protein LOC103720...    601   0.0      
ref|XP_008807991.1|  PREDICTED: uncharacterized protein LOC103720...    601   0.0      
gb|EPS72533.1|  hypothetical protein M569_02220                         592   0.0      
ref|XP_006594318.1|  PREDICTED: uncharacterized protein LOC100779...    594   0.0      
ref|XP_003568085.1|  PREDICTED: uncharacterized protein LOC100826...    582   0.0      
ref|XP_010231154.1|  PREDICTED: uncharacterized protein LOC100826...    578   0.0      
ref|XP_004485785.1|  PREDICTED: uncharacterized protein LOC101495...    575   0.0      
dbj|BAJ98309.1|  predicted protein                                      578   0.0      
ref|XP_008655198.1|  PREDICTED: hypothetical protein isoform X1         566   0.0      
ref|XP_008655199.1|  PREDICTED: hypothetical protein isoform X2         563   0.0      
ref|XP_010060563.1|  PREDICTED: uncharacterized protein LOC104448...    566   0.0      
ref|XP_008656460.1|  PREDICTED: uncharacterized protein LOC103635...    562   0.0      
ref|XP_008656458.1|  PREDICTED: uncharacterized protein LOC103635...    563   0.0      
ref|XP_010644196.1|  PREDICTED: uncharacterized protein LOC100246...    564   0.0      
ref|XP_004961478.1|  PREDICTED: uncharacterized protein LOC101776045    564   0.0      
dbj|BAH01178.1|  unnamed protein product                                563   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645802.1|  PREDICTED: uncharacterized protein LOC102719635    561   0.0      
ref|XP_009589865.1|  PREDICTED: uncharacterized protein LOC104087164    561   0.0      
ref|XP_010060562.1|  PREDICTED: uncharacterized protein LOC104448...    565   0.0      
ref|XP_010644198.1|  PREDICTED: uncharacterized protein LOC100246...    560   0.0      
ref|XP_009761252.1|  PREDICTED: uncharacterized protein LOC104213447    560   0.0      
ref|XP_010644197.1|  PREDICTED: uncharacterized protein LOC100246...    560   0.0      
ref|XP_002282417.1|  PREDICTED: uncharacterized protein LOC100246...    561   0.0      Vitis vinifera
ref|XP_008452456.1|  PREDICTED: uncharacterized protein LOC103493486    560   0.0      
gb|EMS60340.1|  hypothetical protein TRIUR3_08737                       558   0.0      
ref|XP_002440126.1|  hypothetical protein SORBIDRAFT_09g026520          557   0.0      Sorghum bicolor [broomcorn]
ref|NP_001056134.1|  Os05g0531500                                       556   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEE64464.1|  hypothetical protein OsJ_19313                          556   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004141362.1|  PREDICTED: uncharacterized protein LOC101219639    553   0.0      
ref|XP_010060565.1|  PREDICTED: uncharacterized protein LOC104448...    552   0.0      
ref|XP_002440091.1|  hypothetical protein SORBIDRAFT_09g025850          557   0.0      Sorghum bicolor [broomcorn]
emb|CDP05921.1|  unnamed protein product                                556   0.0      
gb|EEC79575.1|  hypothetical protein OsI_20740                          551   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_009798714.1|  PREDICTED: uncharacterized protein LOC104244891    548   0.0      
gb|KGN55129.1|  hypothetical protein Csa_4G637690                       555   0.0      
ref|XP_004961409.1|  PREDICTED: uncharacterized protein LOC101783074    554   0.0      
ref|XP_008656481.1|  PREDICTED: uncharacterized protein LOC103635...    554   0.0      
ref|XP_008649892.1|  PREDICTED: uncharacterized protein LOC103630624    551   0.0      
emb|CAN74978.1|  hypothetical protein VITISV_027198                     553   0.0      Vitis vinifera
gb|AFW78753.1|  hypothetical protein ZEAMMB73_662499                    548   0.0      
ref|XP_006855641.1|  hypothetical protein AMTR_s00044p00106410          553   0.0      
ref|XP_010916737.1|  PREDICTED: uncharacterized protein LOC105041464    549   0.0      
ref|XP_004244227.1|  PREDICTED: uncharacterized protein LOC101254...    550   0.0      
dbj|BAD44906.1|  hypothetical protein                                   551   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003568036.1|  PREDICTED: uncharacterized protein LOC100838689    548   0.0      
ref|XP_006655514.1|  PREDICTED: uncharacterized protein LOC102708343    547   0.0      
ref|XP_010231153.1|  PREDICTED: uncharacterized protein LOC100826...    548   0.0      
ref|XP_009141343.1|  PREDICTED: uncharacterized protein LOC103865...    546   0.0      
ref|XP_008656451.1|  PREDICTED: uncharacterized protein LOC103635853    542   0.0      
emb|CBI20302.3|  unnamed protein product                                546   0.0      
ref|XP_007149460.1|  hypothetical protein PHAVU_005G072000g             547   0.0      
ref|XP_006348249.1|  PREDICTED: uncharacterized protein LOC102589...    546   0.0      
ref|XP_011098310.1|  PREDICTED: uncharacterized protein LOC105176998    544   2e-180   
gb|EYU26382.1|  hypothetical protein MIMGU_mgv1a004380mg                541   6e-180   
ref|XP_010324363.1|  PREDICTED: uncharacterized protein LOC101254...    535   3e-179   
ref|XP_006370258.1|  hypothetical protein POPTR_0001s41050g             536   4e-179   
ref|XP_008795198.1|  PREDICTED: uncharacterized protein LOC103711007    538   7e-179   
gb|KHF99606.1|  Putative tRNA (Met) cytidine acetyltransferase          536   1e-177   
ref|XP_010694986.1|  PREDICTED: uncharacterized protein LOC104907715    536   2e-177   
ref|XP_002317500.2|  hypothetical protein POPTR_0011s11990g             534   3e-177   Populus trichocarpa [western balsam poplar]
gb|AFW82501.1|  hypothetical protein ZEAMMB73_312453                    534   3e-177   
ref|XP_002531719.1|  conserved hypothetical protein                     532   5e-177   Ricinus communis
ref|XP_010112976.1|  hypothetical protein L484_021497                   540   6e-177   
ref|XP_007021484.1|  Inner membrane protein oxaA                        535   9e-177   
gb|KDO62490.1|  hypothetical protein CISIN_1g007884mg                   533   3e-176   
ref|XP_011004637.1|  PREDICTED: uncharacterized protein LOC105111090    531   4e-176   
gb|KDO62491.1|  hypothetical protein CISIN_1g007884mg                   533   5e-176   
ref|XP_006451851.1|  hypothetical protein CICLE_v10007828mg             532   8e-176   
ref|XP_008226631.1|  PREDICTED: uncharacterized protein LOC103326206    530   5e-175   
gb|AFW82496.1|  hypothetical protein ZEAMMB73_098573                    527   1e-174   
ref|XP_003596749.1|  hypothetical protein MTR_2g085170                  529   1e-174   
ref|XP_008366979.1|  PREDICTED: uncharacterized protein LOC103430607    526   1e-173   
ref|XP_009356810.1|  PREDICTED: uncharacterized protein LOC103947615    525   2e-173   
ref|XP_004297916.1|  PREDICTED: uncharacterized protein LOC101306424    517   3e-172   
gb|EPS68952.1|  hypothetical protein M569_05814                         514   5e-171   
ref|XP_002964308.1|  hypothetical protein SELMODRAFT_62660              512   9e-171   
ref|XP_007211858.1|  hypothetical protein PRUPE_ppa004778mg             513   7e-170   
ref|XP_006451852.1|  hypothetical protein CICLE_v10007828mg             514   2e-169   
gb|KHG28984.1|  Putative tRNA (Met) cytidine acetyltransferase          506   7e-166   
gb|KDO75984.1|  hypothetical protein CISIN_1g006222mg                   500   8e-166   
gb|KHN36822.1|  hypothetical protein glysoja_001553                     504   4e-165   
gb|AFW82497.1|  hypothetical protein ZEAMMB73_098573                    501   5e-165   
ref|XP_008656482.1|  PREDICTED: uncharacterized protein LOC103635...    503   7e-165   
ref|XP_003541846.1|  PREDICTED: uncharacterized protein LOC100810247    504   9e-165   
ref|XP_010500933.1|  PREDICTED: uncharacterized protein LOC104778236    501   2e-164   
ref|NP_175712.2|  uncharacterized protein                               501   2e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479837.1|  PREDICTED: uncharacterized protein LOC104758641    499   8e-164   
ref|XP_011029487.1|  PREDICTED: uncharacterized protein LOC105129212    499   2e-163   
ref|XP_002894423.1|  hypothetical protein ARALYDRAFT_892330             498   3e-163   
ref|XP_010462161.1|  PREDICTED: uncharacterized protein LOC104742807    498   4e-163   
ref|XP_006307191.1|  hypothetical protein CARUB_v10008783mg             498   6e-163   
ref|XP_009107009.1|  PREDICTED: uncharacterized protein LOC103832699    496   2e-162   
gb|AAF87865.1|AC022520_9  Unknown protein                               493   1e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002967726.1|  hypothetical protein SELMODRAFT_169494             486   2e-161   
ref|XP_010542285.1|  PREDICTED: uncharacterized protein LOC104815...    494   3e-161   
emb|CDY02526.1|  BnaA08g01330D                                          492   5e-161   
ref|XP_006392838.1|  hypothetical protein EUTSA_v10011374mg             492   5e-161   
gb|KHG13812.1|  Serine/threonine-protein kinase SIK3                    493   1e-160   
ref|XP_001781072.1|  predicted protein                                  488   2e-160   
ref|XP_003539597.1|  PREDICTED: uncharacterized protein LOC100810...    493   2e-160   
gb|KHN28060.1|  hypothetical protein glysoja_007792                     492   2e-160   
emb|CDY65037.1|  BnaC03g78100D                                          490   3e-160   
ref|XP_010535101.1|  PREDICTED: uncharacterized protein LOC104810473    491   4e-160   
ref|XP_009147637.1|  PREDICTED: uncharacterized protein LOC103871160    489   4e-160   
ref|XP_006592911.1|  PREDICTED: uncharacterized protein LOC100810...    487   2e-159   
emb|CDY26015.1|  BnaC06g06090D                                          487   5e-159   
ref|XP_010542286.1|  PREDICTED: uncharacterized protein LOC104815...    483   1e-157   
ref|XP_004487707.1|  PREDICTED: uncharacterized protein LOC101515599    481   8e-157   
ref|XP_001755610.1|  predicted protein                                  465   5e-152   
gb|EMT07305.1|  hypothetical protein F775_32361                         462   2e-150   
gb|EMS52459.1|  hypothetical protein TRIUR3_08436                       435   5e-140   
emb|CDY46285.1|  BnaC05g21710D                                          400   9e-128   
gb|EYU27975.1|  hypothetical protein MIMGU_mgv1a0050832mg               330   5e-103   
ref|XP_002961111.1|  hypothetical protein SELMODRAFT_75600              328   1e-100   
ref|XP_002960842.1|  hypothetical protein SELMODRAFT_75446              327   2e-99    
ref|XP_002983830.1|  hypothetical protein SELMODRAFT_119385             326   2e-99    
ref|XP_008657707.1|  PREDICTED: uncharacterized protein LOC103637253    319   7e-99    
ref|NP_001168315.1|  hypothetical protein                               310   4e-93    Zea mays [maize]
gb|AAT47075.1|  unknown protein                                         306   1e-91    Oryza sativa Japonica Group [Japonica rice]
gb|EYU27976.1|  hypothetical protein MIMGU_mgv1a0050831mg               294   1e-88    
ref|XP_008656452.1|  PREDICTED: uncharacterized protein LOC103635855    293   4e-88    
gb|ACU18605.1|  unknown                                                 290   4e-88    Glycine max [soybeans]
ref|XP_010060564.1|  PREDICTED: uncharacterized protein LOC104448...    302   9e-88    
gb|KHN39565.1|  hypothetical protein glysoja_041089                     284   3e-86    
ref|XP_008461976.1|  PREDICTED: uncharacterized protein LOC103500457    292   2e-85    
ref|XP_004511213.1|  PREDICTED: uncharacterized protein LOC101512...    288   6e-85    
ref|XP_004511211.1|  PREDICTED: uncharacterized protein LOC101512...    288   5e-84    
ref|XP_007224020.1|  hypothetical protein PRUPE_ppa015084mg             287   1e-83    
ref|XP_010684362.1|  PREDICTED: uncharacterized protein LOC104898...    287   1e-83    
ref|XP_008221632.1|  PREDICTED: uncharacterized protein LOC103321591    286   1e-83    
ref|XP_004298435.1|  PREDICTED: uncharacterized protein LOC101306816    286   2e-83    
ref|XP_008352988.1|  PREDICTED: uncharacterized protein LOC103416523    286   2e-83    
ref|XP_008368244.1|  PREDICTED: uncharacterized protein LOC103431852    285   3e-83    
ref|XP_002976845.1|  hypothetical protein SELMODRAFT_416871             284   4e-83    
ref|XP_010257167.1|  PREDICTED: uncharacterized protein LOC104597382    285   4e-83    
ref|XP_002980574.1|  hypothetical protein SELMODRAFT_420226             284   5e-83    
gb|AET02842.2|  transmembrane protein                                   283   3e-82    
ref|XP_004139647.1|  PREDICTED: uncharacterized protein LOC101206756    283   3e-82    
ref|XP_003628366.1|  hypothetical protein MTR_8g055930                  283   6e-82    
ref|XP_002522418.1|  conserved hypothetical protein                     279   6e-82    Ricinus communis
ref|XP_004173659.1|  PREDICTED: uncharacterized LOC101206756            279   6e-82    
ref|XP_010044734.1|  PREDICTED: uncharacterized protein LOC104433624    283   6e-82    
ref|NP_001130321.1|  hypothetical protein                               283   7e-82    Zea mays [maize]
gb|EYU22427.1|  hypothetical protein MIMGU_mgv1a009507mg                278   9e-82    
ref|XP_007153601.1|  hypothetical protein PHAVU_003G049500g             282   1e-81    
gb|KGN44543.1|  hypothetical protein Csa_7G328310                       282   4e-81    
ref|XP_002454281.1|  hypothetical protein SORBIDRAFT_04g027980          280   8e-81    Sorghum bicolor [broomcorn]
emb|CBI31972.3|  unnamed protein product                                279   1e-80    
ref|XP_002274071.2|  PREDICTED: uncharacterized protein LOC100243155    279   1e-80    Vitis vinifera
ref|XP_010236119.1|  PREDICTED: uncharacterized protein LOC100822...    278   2e-80    
ref|XP_007046150.1|  Uncharacterized protein isoform 1                  278   3e-80    
ref|XP_010236118.1|  PREDICTED: uncharacterized protein LOC100822...    278   3e-80    
gb|KHN06852.1|  hypothetical protein glysoja_033093                     276   4e-80    
ref|XP_011021615.1|  PREDICTED: uncharacterized protein LOC105123...    277   4e-80    
ref|XP_002876849.1|  hypothetical protein ARALYDRAFT_484201             276   2e-79    
gb|AAT38717.1|  hypothetical protein SDM1_41t00007                      277   2e-79    Solanum demissum
gb|AAC32911.1|  unknown protein                                         273   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527893.1|  PREDICTED: uncharacterized protein LOC104805153    276   2e-79    
ref|XP_006438673.1|  hypothetical protein CICLE_v10033822mg             275   3e-79    
ref|XP_006586020.1|  PREDICTED: uncharacterized protein LOC100807...    276   3e-79    
ref|XP_009129109.1|  PREDICTED: uncharacterized protein LOC103853969    275   3e-79    
ref|XP_011071004.1|  PREDICTED: uncharacterized protein LOC105156543    275   3e-79    
ref|XP_006363219.1|  PREDICTED: uncharacterized protein LOC102585127    275   3e-79    
gb|ABO93017.1|  protein of unknown function                             276   4e-79    Solanum tuberosum [potatoes]
ref|XP_006483166.1|  PREDICTED: uncharacterized protein LOC102620...    274   4e-79    
ref|XP_010684363.1|  PREDICTED: uncharacterized protein LOC104898...    274   4e-79    
emb|CDY09347.1|  BnaA02g26630D                                          276   5e-79    
emb|CDY62178.1|  BnaCnng39430D                                          276   6e-79    
ref|XP_010478879.1|  PREDICTED: uncharacterized protein LOC104757787    279   8e-79    
ref|XP_010461271.1|  PREDICTED: uncharacterized protein LOC104742011    278   1e-78    
ref|XP_001777109.1|  predicted protein                                  270   1e-78    
ref|XP_006602299.1|  PREDICTED: uncharacterized protein LOC100794...    275   1e-78    
dbj|BAK06190.1|  predicted protein                                      269   1e-78    
ref|NP_178393.2|  uncharacterized protein                               273   1e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395750.1|  hypothetical protein EUTSA_v10004185mg             273   2e-78    
ref|XP_009596169.1|  PREDICTED: uncharacterized protein LOC104092...    271   2e-78    
ref|XP_009799919.1|  PREDICTED: uncharacterized protein LOC104245911    272   2e-78    
emb|CDP17244.1|  unnamed protein product                                280   2e-78    
gb|KDP41185.1|  hypothetical protein JCGZ_15592                         273   3e-78    
ref|XP_006306961.1|  hypothetical protein CARUB_v10008532mg             278   3e-78    
ref|XP_011097045.1|  PREDICTED: uncharacterized protein LOC105176...    279   3e-78    
ref|XP_009406136.1|  PREDICTED: uncharacterized protein LOC103989102    278   3e-78    
ref|XP_011097036.1|  PREDICTED: uncharacterized protein LOC105176...    279   3e-78    
ref|XP_010937100.1|  PREDICTED: uncharacterized protein LOC105056...    274   3e-78    
ref|XP_006292784.1|  hypothetical protein CARUB_v10019033mg             272   4e-78    
ref|XP_004238790.1|  PREDICTED: uncharacterized protein LOC101263705    272   4e-78    
gb|KFK45142.1|  hypothetical protein AALP_AA1G349100                    277   4e-78    
ref|XP_009596167.1|  PREDICTED: uncharacterized protein LOC104092...    271   8e-78    
ref|XP_010425064.1|  PREDICTED: uncharacterized protein LOC104710...    271   9e-78    
ref|XP_002963645.1|  hypothetical protein SELMODRAFT_141636             269   9e-78    
ref|XP_002974734.1|  hypothetical protein SELMODRAFT_174264             269   1e-77    
ref|XP_010425065.1|  PREDICTED: uncharacterized protein LOC104710...    271   1e-77    
ref|XP_009107925.1|  PREDICTED: uncharacterized protein LOC103833...    275   2e-77    
ref|XP_010677683.1|  PREDICTED: uncharacterized protein LOC104893259    277   2e-77    
ref|XP_009107924.1|  PREDICTED: uncharacterized protein LOC103833...    275   2e-77    
gb|KHN47978.1|  hypothetical protein glysoja_015448                     271   2e-77    
ref|XP_010514059.1|  PREDICTED: uncharacterized protein LOC104790...    270   3e-77    
ref|XP_010514060.1|  PREDICTED: uncharacterized protein LOC104790...    270   3e-77    
ref|XP_001771188.1|  predicted protein                                  265   3e-77    
ref|XP_006396046.1|  hypothetical protein EUTSA_v10006981mg             275   4e-77    
emb|CDP15600.1|  unnamed protein product                                269   5e-77    
ref|XP_006851237.1|  hypothetical protein AMTR_s00180p00023300          274   6e-77    
ref|XP_010502299.1|  PREDICTED: uncharacterized protein LOC104779...    269   7e-77    
ref|XP_002893826.1|  hypothetical protein ARALYDRAFT_891055             274   7e-77    
ref|XP_004290419.1|  PREDICTED: uncharacterized protein LOC101312505    272   9e-77    
ref|XP_010502300.1|  PREDICTED: uncharacterized protein LOC104779...    268   1e-76    
ref|NP_174715.2|  uncharacterized protein                               275   1e-76    
ref|XP_002315801.2|  hypothetical protein POPTR_0010s10410g             268   1e-76    
ref|XP_008790221.1|  PREDICTED: uncharacterized protein LOC103707490    273   1e-76    
ref|XP_010937103.1|  PREDICTED: uncharacterized protein LOC105056...    265   1e-76    
ref|XP_006580159.1|  PREDICTED: uncharacterized protein LOC100785...    268   1e-76    
gb|AAF79257.1|AC023279_6  F12K21.12                                     275   1e-76    
emb|CDY12038.1|  BnaAnng02230D                                          273   2e-76    
ref|XP_006827197.1|  hypothetical protein AMTR_s00010p00258180          273   2e-76    
ref|XP_010930673.1|  PREDICTED: uncharacterized protein LOC105051773    273   2e-76    
ref|XP_009114731.1|  PREDICTED: uncharacterized protein LOC103840004    272   2e-76    
emb|CDY70697.1|  BnaCnng69390D                                          265   2e-76    
ref|XP_004504321.1|  PREDICTED: uncharacterized protein LOC101505...    267   3e-76    
gb|EYU22851.1|  hypothetical protein MIMGU_mgv1a002395mg                273   4e-76    
emb|CDY46470.1|  BnaA08g06380D                                          276   4e-76    
ref|XP_004504320.1|  PREDICTED: uncharacterized protein LOC101505...    267   5e-76    
ref|XP_006580158.1|  PREDICTED: uncharacterized protein LOC100785...    267   5e-76    
ref|XP_010530154.1|  PREDICTED: uncharacterized protein LOC104806784    272   6e-76    
ref|XP_010421858.1|  PREDICTED: uncharacterized protein LOC104707250    273   6e-76    
ref|XP_006287116.1|  hypothetical protein CARUB_v10000277mg             274   7e-76    
emb|CDY54805.1|  BnaA06g40980D                                          267   7e-76    
ref|XP_003524955.2|  PREDICTED: uncharacterized protein LOC100785...    267   7e-76    
ref|XP_011088635.1|  PREDICTED: uncharacterized protein LOC105169811    267   8e-76    
ref|XP_009101941.1|  PREDICTED: uncharacterized protein LOC103828097    267   8e-76    
ref|XP_010455351.1|  PREDICTED: uncharacterized protein LOC104736960    272   8e-76    
gb|KHG23853.1|  hypothetical protein F383_03029                         271   1e-75    
ref|XP_002872453.1|  hypothetical protein ARALYDRAFT_911228             271   2e-75    
emb|CDX91769.1|  BnaC08g06880D                                          274   2e-75    
ref|XP_007019964.1|  Uncharacterized protein isoform 4                  268   2e-75    
ref|NP_192701.1|  uncharacterized protein                               271   2e-75    
ref|XP_010438288.1|  PREDICTED: uncharacterized protein LOC104721907    270   3e-75    
ref|XP_007159418.1|  hypothetical protein PHAVU_002G236800g             265   4e-75    
ref|XP_009420736.1|  PREDICTED: uncharacterized protein LOC104000...    265   4e-75    
ref|XP_011074927.1|  PREDICTED: uncharacterized protein LOC105159531    270   4e-75    
ref|XP_007159419.1|  hypothetical protein PHAVU_002G236800g             265   6e-75    
gb|KFK32064.1|  hypothetical protein AALP_AA6G194900                    270   6e-75    
ref|XP_010937098.1|  PREDICTED: uncharacterized protein LOC105056...    266   7e-75    
ref|XP_010937093.1|  PREDICTED: uncharacterized protein LOC105056...    266   9e-75    
ref|XP_010275791.1|  PREDICTED: uncharacterized protein LOC104610...    263   1e-74    
emb|CBI18176.3|  unnamed protein product                                267   1e-74    
ref|XP_010275790.1|  PREDICTED: uncharacterized protein LOC104610...    263   2e-74    
ref|XP_007019962.1|  Uncharacterized protein isoform 2                  268   2e-74    
ref|XP_010937101.1|  PREDICTED: uncharacterized protein LOC105056...    264   2e-74    
gb|EMS52110.1|  hypothetical protein TRIUR3_27049                       253   2e-74    
ref|XP_002966900.1|  hypothetical protein SELMODRAFT_408147             271   3e-74    
ref|XP_010911399.1|  PREDICTED: uncharacterized protein LOC105037429    266   3e-74    
ref|XP_008380997.1|  PREDICTED: uncharacterized protein LOC103443880    268   3e-74    
ref|XP_010937097.1|  PREDICTED: uncharacterized protein LOC105056...    264   3e-74    
ref|XP_010256362.1|  PREDICTED: uncharacterized protein LOC104596775    268   3e-74    
gb|AAU93583.1|  hypothetical protein SDM1_52t00007                      262   3e-74    
ref|XP_004496362.1|  PREDICTED: uncharacterized protein LOC101489831    268   4e-74    
gb|EPS62662.1|  hypothetical protein M569_12128                         266   4e-74    
ref|XP_011078677.1|  PREDICTED: uncharacterized protein LOC105162376    262   4e-74    
ref|XP_010425066.1|  PREDICTED: uncharacterized protein LOC104710...    260   4e-74    
emb|CDY64275.1|  BnaCnng43620D                                          262   4e-74    
ref|XP_006663275.1|  PREDICTED: uncharacterized protein LOC102706048    265   4e-74    
ref|XP_007019961.1|  Uncharacterized protein isoform 1                  269   5e-74    
ref|XP_008382013.1|  PREDICTED: uncharacterized protein LOC103444846    268   5e-74    
ref|XP_006857665.1|  hypothetical protein AMTR_s00061p00155550          258   5e-74    
ref|XP_011045763.1|  PREDICTED: uncharacterized protein LOC105140580    262   5e-74    
gb|KDP35574.1|  hypothetical protein JCGZ_09012                         261   5e-74    
ref|XP_003629727.1|  hypothetical protein MTR_8g085850                  261   6e-74    
ref|XP_004138816.1|  PREDICTED: uncharacterized protein LOC101218369    268   6e-74    
ref|XP_004978927.1|  PREDICTED: uncharacterized protein LOC101779824    266   7e-74    
ref|XP_009345949.1|  PREDICTED: uncharacterized protein LOC103937...    267   7e-74    
gb|KEH43551.1|  transmembrane protein                                   266   9e-74    
ref|XP_009375274.1|  PREDICTED: uncharacterized protein LOC103964107    267   9e-74    
ref|XP_002449181.1|  hypothetical protein SORBIDRAFT_05g006130          266   9e-74    
ref|XP_009345948.1|  PREDICTED: uncharacterized protein LOC103937...    267   1e-73    
gb|KEH43552.1|  transmembrane protein                                   266   1e-73    
ref|XP_011046607.1|  PREDICTED: uncharacterized protein LOC105141171    266   1e-73    
gb|KHN17089.1|  hypothetical protein glysoja_011563                     266   1e-73    
gb|KEH20661.1|  plant/F20M13-60 protein                                 261   1e-73    
emb|CAN72342.1|  hypothetical protein VITISV_029506                     266   1e-73    
ref|XP_003556200.1|  PREDICTED: uncharacterized protein LOC100797815    266   1e-73    
ref|NP_001147856.1|  LOC100281466                                       265   1e-73    
gb|EEC67838.1|  hypothetical protein OsI_35445                          265   1e-73    
ref|XP_006589455.1|  PREDICTED: uncharacterized protein LOC100810524    266   1e-73    
ref|XP_010538922.1|  PREDICTED: uncharacterized protein LOC104813100    265   1e-73    
ref|XP_004290742.1|  PREDICTED: uncharacterized protein LOC101293359    261   2e-73    
ref|XP_008670720.1|  PREDICTED: uncharacterized protein LOC103647...    265   2e-73    
ref|XP_010062008.1|  PREDICTED: uncharacterized protein LOC104449525    266   2e-73    
ref|XP_008670721.1|  PREDICTED: uncharacterized protein LOC103647...    265   2e-73    
gb|EEE51805.1|  hypothetical protein OsJ_33272                          265   2e-73    
ref|XP_002267682.1|  PREDICTED: uncharacterized protein LOC100248770    265   2e-73    
ref|XP_006376300.1|  hypothetical protein POPTR_0013s11800g             265   2e-73    
ref|XP_004966481.1|  PREDICTED: uncharacterized protein LOC101767861    259   2e-73    
gb|ABA91928.2|  expressed protein                                       265   2e-73    
ref|XP_007199717.1|  hypothetical protein PRUPE_ppa002175mg             265   3e-73    
ref|XP_008237312.1|  PREDICTED: uncharacterized protein LOC103336054    265   3e-73    
ref|XP_007143653.1|  hypothetical protein PHAVU_007G090000g             265   3e-73    
ref|XP_002312945.1|  hypothetical protein POPTR_0009s14010g             260   3e-73    
ref|NP_001169259.1|  hypothetical protein                               259   4e-73    
ref|XP_010502301.1|  PREDICTED: uncharacterized protein LOC104779...    258   4e-73    
ref|XP_010086832.1|  hypothetical protein L484_006061                   260   5e-73    
dbj|BAK02667.1|  predicted protein                                      263   6e-73    
ref|XP_008681437.1|  PREDICTED: uncharacterized protein LOC100273...    256   6e-73    
ref|XP_010935176.1|  PREDICTED: uncharacterized protein LOC105055138    259   6e-73    
ref|XP_009796946.1|  PREDICTED: uncharacterized protein LOC104243456    264   7e-73    
ref|XP_010690326.1|  PREDICTED: uncharacterized protein LOC104903891    259   7e-73    
ref|XP_008810917.1|  PREDICTED: uncharacterized protein LOC103722...    262   8e-73    
gb|EYU31798.1|  hypothetical protein MIMGU_mgv1a005120mg                258   1e-72    
emb|CAN59962.1|  hypothetical protein VITISV_003175                     257   1e-72    
ref|XP_008810916.1|  PREDICTED: uncharacterized protein LOC103722...    261   1e-72    
ref|XP_002306196.1|  hypothetical protein POPTR_0004s18410g             258   1e-72    
ref|XP_009609118.1|  PREDICTED: uncharacterized protein LOC104102965    263   1e-72    
ref|XP_010237852.1|  PREDICTED: uncharacterized protein LOC100845...    262   2e-72    
ref|XP_003577734.1|  PREDICTED: uncharacterized protein LOC100845...    262   2e-72    
ref|XP_010270992.1|  PREDICTED: uncharacterized protein LOC104607...    258   2e-72    
ref|XP_003630038.1|  hypothetical protein MTR_8g091120                  247   2e-72    
ref|XP_008806149.1|  PREDICTED: uncharacterized protein LOC103718913    257   3e-72    
ref|XP_006351149.1|  PREDICTED: uncharacterized protein LOC102587291    263   3e-72    
emb|CDP14543.1|  unnamed protein product                                257   3e-72    
ref|XP_002439040.1|  hypothetical protein SORBIDRAFT_10g030430          256   3e-72    
ref|NP_001141325.1|  uncharacterized protein LOC100273416               256   3e-72    
ref|XP_002521262.1|  conserved hypothetical protein                     257   4e-72    
ref|XP_008648100.1|  PREDICTED: hypothetical protein isoform X1         259   4e-72    
gb|KDO68147.1|  hypothetical protein CISIN_1g010800mg                   255   5e-72    
ref|XP_004250383.1|  PREDICTED: uncharacterized protein LOC101266589    262   5e-72    
ref|XP_006422543.1|  hypothetical protein CICLE_v10028256mg             256   5e-72    
gb|AFW82507.1|  hypothetical protein ZEAMMB73_022884                    253   5e-72    
ref|XP_009589340.1|  PREDICTED: uncharacterized protein LOC104086723    256   6e-72    
gb|AFW82508.1|  hypothetical protein ZEAMMB73_022884                    249   6e-72    
ref|XP_010066296.1|  PREDICTED: uncharacterized protein LOC104453...    255   6e-72    
gb|KHG28707.1|  Sept9                                                   254   6e-72    
ref|XP_006486694.1|  PREDICTED: uncharacterized protein LOC102617...    256   7e-72    
gb|AAT39285.2|  hypothetical protein SDM1_27t00016                      256   7e-72    
ref|XP_006282945.1|  hypothetical protein CARUB_v10007508mg             256   7e-72    
ref|XP_011038141.1|  PREDICTED: uncharacterized protein LOC105135119    261   9e-72    
gb|KDO68145.1|  hypothetical protein CISIN_1g010800mg                   256   9e-72    
gb|KDO82903.1|  hypothetical protein CISIN_1g0487822mg                  248   1e-71    
gb|KDP47102.1|  hypothetical protein JCGZ_03910                         261   1e-71    
ref|XP_010066295.1|  PREDICTED: uncharacterized protein LOC104453...    255   1e-71    
ref|XP_004158544.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    261   1e-71    
ref|XP_006855404.1|  hypothetical protein AMTR_s00057p00150120          255   2e-71    
gb|KEH20662.1|  plant/F20M13-60 protein                                 255   2e-71    
ref|XP_010937095.1|  PREDICTED: uncharacterized protein LOC105056...    256   2e-71    
ref|XP_009783509.1|  PREDICTED: uncharacterized protein LOC104232108    254   3e-71    
ref|XP_002526825.1|  conserved hypothetical protein                     260   3e-71    
ref|NP_001058611.1|  Os06g0724300                                       253   3e-71    
ref|XP_004231060.1|  PREDICTED: uncharacterized protein LOC101246191    254   3e-71    
ref|XP_006411641.1|  hypothetical protein EUTSA_v10024983mg             254   3e-71    
ref|XP_009340486.1|  PREDICTED: uncharacterized protein LOC103932582    254   3e-71    
emb|CDY03144.1|  BnaC06g08290D                                          258   4e-71    
ref|XP_008365069.1|  PREDICTED: uncharacterized protein LOC103428723    252   6e-71    
ref|XP_003563259.1|  PREDICTED: uncharacterized protein LOC100844441    252   7e-71    
ref|XP_006364501.1|  PREDICTED: uncharacterized protein LOC102594...    253   8e-71    
ref|XP_006656503.1|  PREDICTED: uncharacterized protein LOC102700347    249   9e-71    
ref|XP_011015583.1|  PREDICTED: uncharacterized protein LOC105119...    251   9e-71    
ref|XP_002866803.1|  hypothetical protein ARALYDRAFT_490610             253   1e-70    
ref|XP_011046638.1|  PREDICTED: uncharacterized protein LOC105141...    251   1e-70    
gb|KHG27170.1|  tRNA 2-thiocytidine biosynthesis TtcA                   250   1e-70    
ref|XP_010446358.1|  PREDICTED: uncharacterized protein LOC104729157    252   2e-70    
gb|EMS62016.1|  hypothetical protein TRIUR3_15714                       254   2e-70    
ref|XP_011015582.1|  PREDICTED: uncharacterized protein LOC105119...    251   3e-70    
ref|XP_008236056.1|  PREDICTED: uncharacterized protein LOC103334858    252   3e-70    
ref|XP_009420821.1|  PREDICTED: uncharacterized protein LOC104000478    251   4e-70    
gb|KDO68148.1|  hypothetical protein CISIN_1g010800mg                   246   4e-70    
ref|XP_011046637.1|  PREDICTED: uncharacterized protein LOC105141...    251   4e-70    
emb|CAB37506.1|  putative protein                                       249   4e-70    
ref|XP_006473199.1|  PREDICTED: uncharacterized protein LOC102626086    256   4e-70    
gb|KDO83926.1|  hypothetical protein CISIN_1g004949mg                   256   4e-70    
ref|XP_006434617.1|  hypothetical protein CICLE_v10000424mg             256   5e-70    
ref|XP_009420738.1|  PREDICTED: uncharacterized protein LOC104000...    250   5e-70    
ref|XP_007199800.1|  hypothetical protein PRUPE_ppa004849mg             250   6e-70    
ref|XP_008377717.1|  PREDICTED: uncharacterized protein LOC103440788    251   7e-70    
ref|XP_010431789.1|  PREDICTED: uncharacterized protein LOC104716132    250   7e-70    
ref|XP_009355631.1|  PREDICTED: uncharacterized protein LOC103946612    251   8e-70    
gb|AFW82562.1|  hypothetical protein ZEAMMB73_537168                    245   1e-69    
ref|XP_007041762.1|  Uncharacterized protein TCM_006575                 250   1e-69    
ref|XP_008451613.1|  PREDICTED: uncharacterized protein LOC103492844    250   1e-69    
gb|EPS58460.1|  hypothetical protein M569_16354                         244   2e-69    
gb|KDO68149.1|  hypothetical protein CISIN_1g010800mg                   244   2e-69    
ref|XP_010555210.1|  PREDICTED: uncharacterized protein LOC104824...    248   4e-69    
ref|NP_568044.1|  uncharacterized protein                               248   4e-69    
gb|KHG28706.1|  Sept9                                                   249   4e-69    
dbj|BAJ89420.1|  predicted protein                                      247   4e-69    
ref|XP_010555209.1|  PREDICTED: uncharacterized protein LOC104824...    248   4e-69    
ref|XP_008382095.1|  PREDICTED: uncharacterized protein LOC103444909    249   5e-69    
gb|AAX96728.1|  hypothetical protein LOC_Os11g09170                     252   5e-69    
ref|XP_008441215.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    253   7e-69    
ref|XP_009394023.1|  PREDICTED: uncharacterized protein LOC103979...    245   8e-69    
gb|EMS58139.1|  hypothetical protein TRIUR3_10634                       249   6e-68    
gb|EMT24775.1|  hypothetical protein F775_27062                         248   7e-68    
gb|EMS65438.1|  hypothetical protein TRIUR3_05242                       246   7e-68    
ref|XP_004148328.1|  PREDICTED: uncharacterized protein LOC101222025    245   9e-68    
ref|XP_004162918.1|  PREDICTED: uncharacterized protein LOC101225699    245   1e-67    
ref|XP_009394015.1|  PREDICTED: uncharacterized protein LOC103979...    244   1e-67    
ref|XP_009393987.1|  PREDICTED: uncharacterized protein LOC103979...    244   1e-67    
ref|XP_008371695.1|  PREDICTED: uncharacterized protein LOC103435075    234   1e-67    
ref|XP_010646607.1|  PREDICTED: uncharacterized protein LOC100255...    241   2e-66    
ref|XP_002280425.1|  PREDICTED: uncharacterized protein LOC100255...    241   2e-66    
gb|KDO83927.1|  hypothetical protein CISIN_1g004949mg                   246   2e-66    
gb|ACR35496.1|  unknown                                                 235   2e-66    



>ref|XP_009804282.1| PREDICTED: uncharacterized protein LOC104249541 [Nicotiana sylvestris]
Length=586

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/510 (75%), Positives = 421/510 (83%), Gaps = 22/510 (4%)
 Frame = +3

Query  579   QQHHFLSSSFPI------PPRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFV  740
             QQ  F +SS PI      P RKP K FKEKEG F RI KFA RK VG+LLLC VSAA F+
Sbjct  18    QQQLFQNSSSPIQTTPPIPSRKPPKLFKEKEGLFLRICKFAPRKNVGMLLLCVVSAAAFL  77

Query  741   WVLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRG-IASTDQ  917
             WVLYVGKG+DA       + ++A++ +R +  E   +N I + + +    N G  AST Q
Sbjct  78    WVLYVGKGDDA-------VELNASISNRMFPPE-TVQNYIFRNIESIKQTNVGRSASTIQ  129

Query  918   PPPLPR------VYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALM  1079
              PPLP       VYF GYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVE+AIALM
Sbjct  130   SPPLPFPSPPPPVYFKGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEQAIALM  189

Query  1080  PTAPSFSP-VLYLNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGV  1256
             P APSFSP V  L YIHEE  S+ EFGGS FGGYPSL QR++SYDI+ESMSVHCGFV+G+
Sbjct  190   PNAPSFSPGVNNLTYIHEENPSKTEFGGSDFGGYPSLMQRNDSYDIKESMSVHCGFVRGI  249

Query  1257  KPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEG  1436
             +PG  T F+IDD DL EME+C+GVVVASAIFGAFDLI QPKN SEYA++N CFYMFVDE 
Sbjct  250   RPGHRTGFNIDDSDLVEMESCQGVVVASAIFGAFDLIRQPKNTSEYAKKNACFYMFVDEE  309

Query  1437  TEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGK  1616
             TEAFLRNS +LNSS RIGLWRIVVVH+LPY D RRNGK+PKLLLHRLFPNARYSLWIDGK
Sbjct  310   TEAFLRNSSELNSSMRIGLWRIVVVHNLPYNDPRRNGKVPKLLLHRLFPNARYSLWIDGK  369

Query  1617  LELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKK  1796
             LELVVDPYQILERFLWR+NASFAISRHYKRFDVF EAEANK A KFDNASIDFQVEFYKK
Sbjct  370   LELVVDPYQILERFLWRKNASFAISRHYKRFDVFVEAEANKVAAKFDNASIDFQVEFYKK  429

Query  1797  EGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKI  1976
             EGLTP+S AK PITSDVPEGCVIIREH PISNLFTCLWFNEVDRFTPRDQISF+ VRDKI
Sbjct  430   EGLTPYSRAKLPITSDVPEGCVIIREHNPISNLFTCLWFNEVDRFTPRDQISFAVVRDKI  489

Query  1977  RSRTNWNVEMFLDCERRNFVVQGYHRDILE  2066
              S+TNW + MFLDCERRNFV+QGYHRD+LE
Sbjct  490   MSKTNWTLNMFLDCERRNFVIQGYHRDVLE  519



>ref|XP_009588493.1| PREDICTED: uncharacterized protein LOC104086046 isoform X2 [Nicotiana 
tomentosiformis]
Length=580

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/504 (76%), Positives = 419/504 (83%), Gaps = 17/504 (3%)
 Frame = +3

Query  579   QQHHFLSSSFPI------PPRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFV  740
             QQ  F +SS PI      P RKP K FKEKEG F RI KFA RK VG+LLLC VSAA F+
Sbjct  18    QQQLFQNSSSPIQTTPPIPSRKPPKLFKEKEGLFLRICKFAPRKNVGMLLLCVVSAAAFL  77

Query  741   WVLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRG-IASTDQ  917
             WVLYVGKGEDA       + ++ ++ +R +  E    N I++ + +    N G  AST Q
Sbjct  78    WVLYVGKGEDA-------VELNTSISNRMFPPE-TVHNYIYRNIESIKRTNVGRSASTIQ  129

Query  918   PPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSF  1097
              PP P VYF GYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVE+AIALMP APSF
Sbjct  130   SPP-PPVYFKGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEQAIALMPDAPSF  188

Query  1098  SP-VLYLNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRAT  1274
             SP V  L YIHEE  S+ EFGGS FGGYPSL QR++SYDIRE+MSVHCGFV+G +PG  T
Sbjct  189   SPGVSNLTYIHEENPSKTEFGGSDFGGYPSLMQRNDSYDIRETMSVHCGFVRGTRPGHRT  248

Query  1275  SFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLR  1454
              FDIDD DL EME+C+GVVVASAIFGAFDLI QPKN SEYA++N CFYMFVDE TEAFLR
Sbjct  249   GFDIDDSDLVEMESCQGVVVASAIFGAFDLIRQPKNTSEYAKKNACFYMFVDEETEAFLR  308

Query  1455  NSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVD  1634
             NS +LNSS RIGLWRIVVVH+LPY D RRNGK+PKLLLHRLFPNARYSLWIDGKLELVVD
Sbjct  309   NSSELNSSMRIGLWRIVVVHNLPYNDPRRNGKVPKLLLHRLFPNARYSLWIDGKLELVVD  368

Query  1635  PYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF  1814
             PYQILERFLWR+NASFAISRHYKRFDVF EAEANKAA KFDNASIDFQVEFYKKEGLTP+
Sbjct  369   PYQILERFLWRKNASFAISRHYKRFDVFVEAEANKAAAKFDNASIDFQVEFYKKEGLTPY  428

Query  1815  SAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNW  1994
             S AK PITSDVPEGCVIIREH PISNLFTCLWFNEVDRFTPRDQISF+ VRDKI S+TNW
Sbjct  429   SRAKLPITSDVPEGCVIIREHNPISNLFTCLWFNEVDRFTPRDQISFAIVRDKIMSKTNW  488

Query  1995  NVEMFLDCERRNFVVQGYHRDILE  2066
              V MFLDCERRNFV+QGYHRD+LE
Sbjct  489   TVNMFLDCERRNFVIQGYHRDVLE  512



>ref|XP_011096308.1| PREDICTED: uncharacterized protein LOC105175541 [Sesamum indicum]
Length=588

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/499 (73%), Positives = 412/499 (83%), Gaps = 18/499 (4%)
 Frame = +3

Query  594   LSSSFPIPPRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDA  773
             + ++ P+  RKP K  KEK+  FH I KFA RKKVG+LLLC VSAAVF WVLY+GKGEDA
Sbjct  31    IQTTPPLSSRKPPKMLKEKDRLFHWICKFAPRKKVGMLLLCLVSAAVFGWVLYLGKGEDA  90

Query  774   RGPEIPTISISA------TMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPR  935
                 +  I+I +      T     +S E  E        +A P      A          
Sbjct  91    LETIVQNINIQSGPIPGETNTSETFSYEVRELEGSANATIAPPPPPAPPA----------  140

Query  936   VYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-  1112
              +FTGYTLPPGNPCE FTLPPPPADKKRTGPRPCPVCYLP+E+AIALMP APSFSPVL  
Sbjct  141   -FFTGYTLPPGNPCESFTLPPPPADKKRTGPRPCPVCYLPLEDAIALMPNAPSFSPVLRN  199

Query  1113  LNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDD  1292
             L YIHEE L+++EFGGS FGGYPSLRQR++SYDIRESMSVHCGFVKGV+PGR T FDIDD
Sbjct  200   LEYIHEENLTKSEFGGSEFGGYPSLRQRNDSYDIRESMSVHCGFVKGVQPGRQTGFDIDD  259

Query  1293  KDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLN  1472
              DL EME C+GVVVASAIFGAFDLI QP+NISEY+++NVCF+MFVDE TEAFLRNS +L+
Sbjct  260   SDLLEMETCQGVVVASAIFGAFDLIRQPQNISEYSQKNVCFHMFVDEETEAFLRNSSELD  319

Query  1473  SSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILE  1652
              + ++GLWRI++VH+LPY+D RRNGK+PKLLLHRLFPNARYSLW+D KLELVVDP QILE
Sbjct  320   HNKKVGLWRIILVHNLPYSDPRRNGKVPKLLLHRLFPNARYSLWVDAKLELVVDPIQILE  379

Query  1653  RFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFP  1832
             RFLWR+N SFAISRHYKRFDVFEEAEANKAAGK+DNASIDFQ+EFYK EGLTP+S AKFP
Sbjct  380   RFLWRKNTSFAISRHYKRFDVFEEAEANKAAGKYDNASIDFQIEFYKNEGLTPYSVAKFP  439

Query  1833  ITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFL  2012
             ITSDVPEGCVI+REHIPISNLFTCLWFNEVDRFT RDQISFSTVRDKIRS+TN+ + MFL
Sbjct  440   ITSDVPEGCVIVREHIPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIRSKTNYTINMFL  499

Query  2013  DCERRNFVVQGYHRDILEH  2069
             DCERRNFVVQGYHRD+LEH
Sbjct  500   DCERRNFVVQGYHRDLLEH  518



>emb|CDO99536.1| unnamed protein product [Coffea canephora]
Length=597

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/516 (71%), Positives = 420/516 (81%), Gaps = 17/516 (3%)
 Frame = +3

Query  579   QQHHFL--------SSSFPIPPRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAV  734
             QQH F          ++ P+  RKP K  KEKE  F  IFKFA RKKVG+LLLCAVSAAV
Sbjct  18    QQHQFQFQNGSVPNQTTPPVNSRKPSKMLKEKERLFPWIFKFAPRKKVGMLLLCAVSAAV  77

Query  735   FVWVLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTD  914
             F+WVLYVGKGED+    +  I  ++T+    +S    E   +   + +K    +G A++ 
Sbjct  78    FMWVLYVGKGEDSAESTMKNIQFNSTLDYSGFSPLSVENETVKVKIPSKAIMGQGTATSG  137

Query  915   Q--------PPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAI  1070
             Q        PPP P VYFTGYTLPPGNPCEGFTLPPPPAD KRTGPRPCPVCYLP+E+ +
Sbjct  138   QLLSPPPPSPPPSPPVYFTGYTLPPGNPCEGFTLPPPPADPKRTGPRPCPVCYLPMEQVL  197

Query  1071  ALMPTAPSFSPVLY-LNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFV  1247
             +L PTAPSFSPVL  L YIHEE L++ EFGGS FGGYPSL QR++SYDIRESMSVHCGFV
Sbjct  198   SLKPTAPSFSPVLKNLTYIHEENLTKTEFGGSEFGGYPSLAQRNDSYDIRESMSVHCGFV  257

Query  1248  KGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFV  1427
             +GVKPG  T FDID+ DL +ME C+GVVVASAIFGAFDLI QPKNIS+Y++ENVCFYMFV
Sbjct  258   RGVKPGLGTGFDIDESDLHDMETCQGVVVASAIFGAFDLIRQPKNISDYSKENVCFYMFV  317

Query  1428  DEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWI  1607
             DE TEAFLRN   ++ + + GLWRIVVV +LPYTD RRNGK+PKLLLHRLFP+ARYSLWI
Sbjct  318   DEETEAFLRNFSAVDVNKKNGLWRIVVVRNLPYTDPRRNGKVPKLLLHRLFPSARYSLWI  377

Query  1608  DGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEF  1787
             DGKLELVVDPYQ+LERFLWR+NA+FAISRHY+RFDVF EAEANKAAGK+DNASIDFQ++F
Sbjct  378   DGKLELVVDPYQVLERFLWRKNATFAISRHYRRFDVFVEAEANKAAGKYDNASIDFQIDF  437

Query  1788  YKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVR  1967
             YKKEGLTP+S+AK  ITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFT RDQISFS+VR
Sbjct  438   YKKEGLTPYSSAKLRITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTSRDQISFSSVR  497

Query  1968  DKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             DKI S+TNW + MFLDCERRN+VVQGYHRD+LE R 
Sbjct  498   DKINSKTNWTINMFLDCERRNYVVQGYHRDVLESRG  533



>ref|XP_004232879.1| PREDICTED: uncharacterized protein LOC101250652 [Solanum lycopersicum]
Length=567

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/505 (73%), Positives = 412/505 (82%), Gaps = 19/505 (4%)
 Frame = +3

Query  579   QQHHFLSSSFP------IPPRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFV  740
             QQ  F +   P      +PPRKP K FKEKEG F  I KFA RKK+G++LLC VSAAVF+
Sbjct  18    QQQQFQNGGSPFQASPLVPPRKPPKMFKEKEGLFLWICKFAPRKKIGMMLLCVVSAAVFL  77

Query  741   WVLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQP  920
             WVLYVGKGED       T  +  +M      + P +   I    L + N+   IAS + P
Sbjct  78    WVLYVGKGED-------TQELIMSMNS---GVFPPDTGQIRHIDLIEKNDVEKIASIESP  127

Query  921   PPLPR--VYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPS  1094
             PP P    YF GYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVE+AIALMP APS
Sbjct  128   PPPPPPLAYFKGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEQAIALMPDAPS  187

Query  1095  FSP-VLYLNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRA  1271
             FSP V  L YIHEE LS +EFGGS FGGYPSL QR++SYDIRESMSVHCGFV+G +PG  
Sbjct  188   FSPGVSSLTYIHEENLSRSEFGGSEFGGYPSLMQRNDSYDIRESMSVHCGFVRGARPGHQ  247

Query  1272  TSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFL  1451
             T FDIDD +L  ME+C GVVVASAIFGAFDLI QP+NISEYA+ NVCFYMFVDE TE+FL
Sbjct  248   TGFDIDDSNLLAMESCRGVVVASAIFGAFDLIRQPQNISEYAKGNVCFYMFVDEETESFL  307

Query  1452  RNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVV  1631
             RNS +L+SS RIGLWRI VVH+LPY D RRNGK+PKLLLHRLFPNARYSLW+D KLELVV
Sbjct  308   RNSSELDSSMRIGLWRIAVVHNLPYDDPRRNGKVPKLLLHRLFPNARYSLWVDAKLELVV  367

Query  1632  DPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTP  1811
             DPYQILERFLWR+NASFAISRHY+R+DVF EA+ANKAA KFDNASIDFQV+FY+KEGLTP
Sbjct  368   DPYQILERFLWRKNASFAISRHYRRYDVFVEADANKAASKFDNASIDFQVDFYRKEGLTP  427

Query  1812  FSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN  1991
             ++ AK PI+SDVPEGCVII+EHIPISNLFTCLWFNEVDRFTPRDQISF+ VRDKIR +TN
Sbjct  428   YTRAKLPISSDVPEGCVIIKEHIPISNLFTCLWFNEVDRFTPRDQISFAIVRDKIREKTN  487

Query  1992  WNVEMFLDCERRNFVVQGYHRDILE  2066
             W + MFLDCERRNFV+QGYHRD+LE
Sbjct  488   WTLNMFLDCERRNFVIQGYHRDVLE  512



>ref|XP_006347035.1| PREDICTED: uncharacterized protein LOC102590306 [Solanum tuberosum]
Length=570

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/477 (75%), Positives = 399/477 (84%), Gaps = 11/477 (2%)
 Frame = +3

Query  639   FKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMK  818
             FKEKEG F  I KFA RKK+G++LLC VSAAVF+WVLYVGKGED       T  +  +M 
Sbjct  44    FKEKEGLFLWICKFAPRKKIGMMLLCVVSAAVFLWVLYVGKGED-------TQELIMSMN  96

Query  819   DREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPP  998
                  + P +   I      + N+   IAS + PPP P  +F GYTLPPGNPCEGFTLPP
Sbjct  97    S---GVFPPDTGQIRHIDSIEKNDVGKIASIESPPPPPLAHFKGYTLPPGNPCEGFTLPP  153

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSP-VLYLNYIHEETLsenefggsgfgg  1175
             PPADKKRTGPRPCPVCYLPVE+AIALMP APSFSP V  L YIHEE LS++EFGGS FGG
Sbjct  154   PPADKKRTGPRPCPVCYLPVEQAIALMPDAPSFSPGVSSLTYIHEENLSKSEFGGSEFGG  213

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             YPSL QR++SYD+RESMSVHCGFV+G +PG  T FDIDD +L  ME+C GVVVASAIFGA
Sbjct  214   YPSLMQRNDSYDVRESMSVHCGFVRGARPGHQTGFDIDDSNLLAMESCRGVVVASAIFGA  273

Query  1356  FDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDA  1535
             FDLI QP+NISEYA+ NVCFYMFVDE TE FLRNS +L+SS RIGLWRI VVH+LPY D 
Sbjct  274   FDLIRQPQNISEYAKGNVCFYMFVDEETENFLRNSSELDSSMRIGLWRIAVVHNLPYDDP  333

Query  1536  RRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDV  1715
             RRNGK+PKLLLHRLFPNARYSLW+D KLELVVDPYQILERFLWR+NASFAISRHY+RFDV
Sbjct  334   RRNGKVPKLLLHRLFPNARYSLWVDAKLELVVDPYQILERFLWRKNASFAISRHYRRFDV  393

Query  1716  FEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNL  1895
             F EAEANKAA KFDNASIDFQV+FY+KEGLTP++ AK PI+SDVPEGCVII+EHIPISNL
Sbjct  394   FVEAEANKAASKFDNASIDFQVDFYRKEGLTPYTRAKLPISSDVPEGCVIIKEHIPISNL  453

Query  1896  FTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILE  2066
             FTCLWFNEVDRFTPRDQISF+ VRDKIR +TNW + MFLDCERRNFV+QGYHRD+LE
Sbjct  454   FTCLWFNEVDRFTPRDQISFAIVRDKIREKTNWTLNMFLDCERRNFVIQGYHRDVLE  510



>ref|XP_011086071.1| PREDICTED: uncharacterized protein LOC105167904 [Sesamum indicum]
Length=582

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/509 (73%), Positives = 415/509 (82%), Gaps = 26/509 (5%)
 Frame = +3

Query  579   QQHHFLSSSFPI---PP--RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVW  743
             QQ    S SF I   PP  RKP K  KEK+  F  IF+FA RKKVG+LLLC VS AVF+W
Sbjct  18    QQVQNSSLSFSIQTSPPLSRKPSKMLKEKDRLFFWIFRFAPRKKVGMLLLCLVSLAVFMW  77

Query  744   VLYVGKGEDARGPEIPTISISATMKDREYSIEP----EEKNNIHKTLLAKPNNNRGIAST  911
             VL VGKGEDAR       SI+     R  +I P    EEK +I   + A P+    +  +
Sbjct  78    VLIVGKGEDARE------SIT-----RNVNIAPGPISEEKVSI---VGAPPSQIIEMEGS  123

Query  912   DQPPPL--PRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPT  1085
                 PL  P V+FTGY LPPGNPCE FTLPPPPADKKRTGPRPCPVCYLP+E+AIALMP 
Sbjct  124   ANATPLSPPTVFFTGYKLPPGNPCEHFTLPPPPADKKRTGPRPCPVCYLPLEDAIALMPN  183

Query  1086  APSFSPVLY-LNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKP  1262
             APSFSPVL  L Y+HEE LS++EFGGS FGGYPSL+QR +SYDIRESMSVHCGFV GVKP
Sbjct  184   APSFSPVLKDLTYVHEENLSKSEFGGSDFGGYPSLKQRSDSYDIRESMSVHCGFVGGVKP  243

Query  1263  GRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTE  1442
             G  T FDIDD DL EME C GVVVASAIFGAFDLI QPKN+SEY+++ VCF+MFVDE T+
Sbjct  244   GHQTGFDIDDSDLLEMEKCRGVVVASAIFGAFDLIRQPKNVSEYSQKTVCFHMFVDEETK  303

Query  1443  AFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLE  1622
             AFLRNS +L S  ++GLWR+ VV +LPY+D RRNGK+PKLLLHRLFPNARYSLWID KLE
Sbjct  304   AFLRNSSELGSDKKVGLWRVTVVRNLPYSDPRRNGKVPKLLLHRLFPNARYSLWIDAKLE  363

Query  1623  LVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEG  1802
             LVVDP QILERFLWR+NASFAISRHY+RFDVF EAEANKAAGK+DNASIDFQ++FYKKEG
Sbjct  364   LVVDPIQILERFLWRKNASFAISRHYRRFDVFVEAEANKAAGKYDNASIDFQIDFYKKEG  423

Query  1803  LTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRS  1982
             LTP+SAAK PITSDVPEGCVI+REHIPI+NLFTCLWFNEVDRFT RDQISFSTVRDKIRS
Sbjct  424   LTPYSAAKLPITSDVPEGCVIVREHIPITNLFTCLWFNEVDRFTSRDQISFSTVRDKIRS  483

Query  1983  RTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             +TN+ + MFLDCERRNFV+QGYHRD+LEH
Sbjct  484   KTNYTINMFLDCERRNFVIQGYHRDLLEH  512



>ref|XP_009588492.1| PREDICTED: uncharacterized protein LOC104086046 isoform X1 [Nicotiana 
tomentosiformis]
Length=613

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/537 (72%), Positives = 419/537 (78%), Gaps = 50/537 (9%)
 Frame = +3

Query  579   QQHHFLSSSFPI------PPRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFV  740
             QQ  F +SS PI      P RKP K FKEKEG F RI KFA RK VG+LLLC VSAA F+
Sbjct  18    QQQLFQNSSSPIQTTPPIPSRKPPKLFKEKEGLFLRICKFAPRKNVGMLLLCVVSAAAFL  77

Query  741   WVLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRG-IASTDQ  917
             WVLYVGKGEDA       + ++ ++ +R +  E    N I++ + +    N G  AST Q
Sbjct  78    WVLYVGKGEDA-------VELNTSISNRMFPPE-TVHNYIYRNIESIKRTNVGRSASTIQ  129

Query  918   PPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSF  1097
              PP P VYF GYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVE+AIALMP APSF
Sbjct  130   SPP-PPVYFKGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEQAIALMPDAPSF  188

Query  1098  SP-VLYLNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRAT  1274
             SP V  L YIHEE  S+ EFGGS FGGYPSL QR++SYDIRE+MSVHCGFV+G +PG  T
Sbjct  189   SPGVSNLTYIHEENPSKTEFGGSDFGGYPSLMQRNDSYDIRETMSVHCGFVRGTRPGHRT  248

Query  1275  SFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLR  1454
              FDIDD DL EME+C+GVVVASAIFGAFDLI QPKN SEYA++N CFYMFVDE TEAFLR
Sbjct  249   GFDIDDSDLVEMESCQGVVVASAIFGAFDLIRQPKNTSEYAKKNACFYMFVDEETEAFLR  308

Query  1455  NSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVD  1634
             NS +LNSS RIGLWRIVVVH+LPY D RRNGK+PKLLLHRLFPNARYSLWIDGKLELVVD
Sbjct  309   NSSELNSSMRIGLWRIVVVHNLPYNDPRRNGKVPKLLLHRLFPNARYSLWIDGKLELVVD  368

Query  1635  PYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF  1814
             PYQILERFLWR+NASFAISRHYKRFDVF EAEANKAA KFDNASIDFQVEFYKKEGLTP+
Sbjct  369   PYQILERFLWRKNASFAISRHYKRFDVFVEAEANKAAAKFDNASIDFQVEFYKKEGLTPY  428

Query  1815  SAAKFPIT---------------------------------SDVPEGCVIIREHIPISNL  1895
             S AK PIT                                 SDVPEGCVIIREH PISNL
Sbjct  429   SRAKLPITSGKSVILFFIFVYLLLVVPARFLSDNHTNVLFMSDVPEGCVIIREHNPISNL  488

Query  1896  FTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILE  2066
             FTCLWFNEVDRFTPRDQISF+ VRDKI S+TNW V MFLDCERRNFV+QGYHRD+LE
Sbjct  489   FTCLWFNEVDRFTPRDQISFAIVRDKIMSKTNWTVNMFLDCERRNFVIQGYHRDVLE  545



>ref|XP_004248111.1| PREDICTED: uncharacterized protein LOC101247562 [Solanum lycopersicum]
Length=526

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/537 (68%), Positives = 412/537 (77%), Gaps = 34/537 (6%)
 Frame = +3

Query  639   FKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGE-DARGPEIPT-ISISAT  812
             FKEKEG F  I KFA RKKVG+LLLCAVS AVF+WV+ + +GE     P I   +     
Sbjct  2     FKEKEGLFPGIHKFAPRKKVGMLLLCAVSLAVFLWVVLIDRGEAQESNPSIGNRLFREVG  61

Query  813   MKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTL  992
              KD   +IE  E+ N  ++ L           T QPPP   VYF GYTLPPGNPCE FTL
Sbjct  62    QKDNSTTIESVERTNAGQSAL-----------TIQPPP--PVYFKGYTLPPGNPCESFTL  108

Query  993   PPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSP-VLYLNYIHEETLsenefggsgf  1169
             PPPPADKKRTGPRPCPVCYLPVE+AIALMP APSFSP V  L YIHEE           F
Sbjct  109   PPPPADKKRTGPRPCPVCYLPVEQAIALMPDAPSFSPGVSNLTYIHEEN-----SEKPEF  163

Query  1170  ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIF  1349
             GGYPSL QR++SYD+RESM+VHCGFVKG++PG  T FDIDD DL EME+C GV+VASAIF
Sbjct  164   GGYPSLMQRNDSYDVRESMNVHCGFVKGIRPGHRTGFDIDDSDLNEMESCRGVIVASAIF  223

Query  1350  GAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYT  1529
             GAFDLI QPKNISEYA++NVCF+MFVDE TE FLRNS +L+ S RIGLWRIV VH+LPY 
Sbjct  224   GAFDLIRQPKNISEYAKKNVCFHMFVDEQTEVFLRNSSELDGSMRIGLWRIVTVHNLPYD  283

Query  1530  DARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRF  1709
             D RRNGK+PKLLLHRLFPNARYSLWID KLELVVDPYQILERFLWR+N SFAIS+HY+RF
Sbjct  284   DPRRNGKVPKLLLHRLFPNARYSLWIDAKLELVVDPYQILERFLWRKNVSFAISKHYRRF  343

Query  1710  DVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPIS  1889
             DVF EAEANKAAGKFDNASIDFQVEFYKKEGLT +SAAK PITSDVPEGCV++REHIP+S
Sbjct  344   DVFVEAEANKAAGKFDNASIDFQVEFYKKEGLTRYSAAKLPITSDVPEGCVVVREHIPVS  403

Query  1890  NLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             NLF CLWFNEVDRFTPRDQISF+ VRDKI S+TNW + MFLDCERRNFVVQGYHRDILEH
Sbjct  404   NLFACLWFNEVDRFTPRDQISFAIVRDKIMSKTNWTLNMFLDCERRNFVVQGYHRDILEH  463

Query  2070  RApppppppRATIR-------------DGVLKTSKYSGATTKLLARRIGDPRSRHRQ  2201
              +PPPPP     +                + K+S  +    K+ ++R  D + RHR+
Sbjct  464   WSPPPPPAAPEIVHPPPPVPDKTPQTTSNITKSSSVAEPLKKVPSKRGRDRKKRHRK  520



>ref|XP_006343239.1| PREDICTED: uncharacterized protein LOC102601452 [Solanum tuberosum]
Length=580

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/506 (76%), Positives = 412/506 (81%), Gaps = 22/506 (4%)
 Frame = +3

Query  579   QQHHFLSSSFPIP-----PRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVW  743
             QQ  F +SS PI      PRKP K FKEKEG F  I KFA RK VG+LLLC VSAA F+W
Sbjct  18    QQQLFQNSSSPIQTTPPIPRKPPKLFKEKEGLFLWICKFAPRKNVGMLLLCVVSAAAFLW  77

Query  744   VLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPP  923
             VLYVGKGE A        +     K     IE  +KNN+ ++           AST QPP
Sbjct  78    VLYVGKGEVAVEQSNRMFAPETVHKYTFRGIESIQKNNVGQS-----------ASTVQPP  126

Query  924   PLPR-----VYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTA  1088
             P P      VYF GYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVE+AIALMP A
Sbjct  127   PPPLPPSPPVYFKGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEQAIALMPDA  186

Query  1089  PSFSP-VLYLNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPG  1265
             PSFSP V  L YIHEE  S+ EFGGS FGGYPSL QR++SYDIRESM+VHCGFV+G++PG
Sbjct  187   PSFSPGVSNLTYIHEENQSKTEFGGSDFGGYPSLIQRNDSYDIRESMNVHCGFVRGIRPG  246

Query  1266  RATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEA  1445
               T FDIDD DL EME+C+GVVVASAIFGAFDLI QPKN SEYA++NVCFYMFVDE TEA
Sbjct  247   HQTGFDIDDSDLLEMESCQGVVVASAIFGAFDLIRQPKNTSEYAKKNVCFYMFVDEQTEA  306

Query  1446  FLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLEL  1625
             FLRNS +LNSS RIGLWRIVVVH+LPY D RRNGK+PKLLLHRLFPNARYSLWIDGKLEL
Sbjct  307   FLRNSSELNSSMRIGLWRIVVVHNLPYDDPRRNGKVPKLLLHRLFPNARYSLWIDGKLEL  366

Query  1626  VVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGL  1805
             VVDPYQILERFLWR+NASFAISRHYKRFDVF EAEANKAA KFDN SIDFQV+FYKKEGL
Sbjct  367   VVDPYQILERFLWRKNASFAISRHYKRFDVFVEAEANKAAAKFDNTSIDFQVDFYKKEGL  426

Query  1806  TPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSR  1985
             TP+S AK PITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISF+ VRDKI S+
Sbjct  427   TPYSRAKLPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFAIVRDKIMSK  486

Query  1986  TNWNVEMFLDCERRNFVVQGYHRDIL  2063
              NW V MFLDCERRNFV+QGYHRDIL
Sbjct  487   INWTVNMFLDCERRNFVIQGYHRDIL  512



>ref|XP_004234118.1| PREDICTED: uncharacterized protein LOC101259611 isoform X2 [Solanum 
lycopersicum]
Length=583

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/501 (75%), Positives = 404/501 (81%), Gaps = 9/501 (2%)
 Frame = +3

Query  579   QQHHFLSSSFPIP-----PRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVW  743
             QQ  F +SS PI      PRKP K FKEKEG F  I KFA RK VG+LLLC VSAA F+W
Sbjct  18    QQQLFQNSSSPIQTTSPIPRKPPKLFKEKEGLFLWICKFAPRKNVGMLLLCVVSAAAFLW  77

Query  744   VLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPP  923
             VLYVGKGE A        +     K     IE  +KNN+ +++                 
Sbjct  78    VLYVGKGEVAAEQSNRMFAPETVHKYIFSGIESIQKNNVGRSVSIVQPPPPPPPPPPL--  135

Query  924   PLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSP  1103
              LP VYF GYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVE+AIALM  APSFSP
Sbjct  136   -LPPVYFKGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEQAIALMSDAPSFSP  194

Query  1104  -VLYLNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSF  1280
              V  L YIHEE  S+ +FGGS FGGYPSL QR +SYDIRESM VHCGFV+GV+PG  T F
Sbjct  195   GVSNLTYIHEENQSKADFGGSNFGGYPSLFQRIDSYDIRESMRVHCGFVRGVRPGHQTGF  254

Query  1281  DIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNS  1460
             DIDD DL EME+C+GVVVASAIFGAFDLI QPKN SEYA++N CFYMFVDE TEAFLRNS
Sbjct  255   DIDDSDLLEMESCQGVVVASAIFGAFDLIRQPKNTSEYAKKNACFYMFVDEQTEAFLRNS  314

Query  1461  GDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPY  1640
              +LNSS RIGLWRIVVVH+LPY D RRNGK+PKLLLHRLFPNARYSLWIDGKLELVVDPY
Sbjct  315   SELNSSMRIGLWRIVVVHNLPYGDPRRNGKVPKLLLHRLFPNARYSLWIDGKLELVVDPY  374

Query  1641  QILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSA  1820
             QILERFLWR+NASFAISRHYKRFDVF EAEANKAA KFDNASIDFQVEFYKKEGL P+S 
Sbjct  375   QILERFLWRKNASFAISRHYKRFDVFVEAEANKAAAKFDNASIDFQVEFYKKEGLAPYSR  434

Query  1821  AKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNV  2000
             AK PITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISF+ VRDKI S+TNW V
Sbjct  435   AKLPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFAIVRDKIMSKTNWTV  494

Query  2001  EMFLDCERRNFVVQGYHRDIL  2063
              MFLDCERRNFV+QGYHRDIL
Sbjct  495   NMFLDCERRNFVIQGYHRDIL  515



>ref|XP_007025606.1| F3H9.11 protein isoform 1 [Theobroma cacao]
 gb|EOY28228.1| F3H9.11 protein isoform 1 [Theobroma cacao]
Length=586

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/486 (71%), Positives = 392/486 (81%), Gaps = 3/486 (1%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISI  803
             KP K FKEKE   H I KFA RKKVG+LLLCA+SAAVFVWVLYVGKGED     +P ++ 
Sbjct  36    KPSKMFKEKETLVHWICKFAGRKKVGMLLLCAISAAVFVWVLYVGKGEDQESDNVPKVND  95

Query  804   SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEG  983
             S  + +    +  E ++       + P    G      PPP P  YF GYTLPPG+PC  
Sbjct  96    SLPLNNSGSPLINEVQSVRIDNWTSLPVIVEGTEVRVMPPPPPS-YFLGYTLPPGHPCAT  154

Query  984   FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefgg  1160
             F+LPPPPADKKRTGPRPCPVCYLPVE+AIALMP  PSFSPV+  L YI+EE L++    G
Sbjct  155   FSLPPPPADKKRTGPRPCPVCYLPVEDAIALMPKVPSFSPVVKNLTYIYEENLNKETEFG  214

Query  1161  sgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVA  1337
                 GGYP+L+QRD+SYDIRESM+VHCGFVKG KPG  T FDIDD DL EME C GVVVA
Sbjct  215   GSDFGGYPTLKQRDDSYDIRESMNVHCGFVKGSKPGHGTGFDIDDNDLLEMEKCHGVVVA  274

Query  1338  SAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHD  1517
             SAIFGAFD+I QPKNISEY+++ +CFYMF DE TEA L+ +  L  S +IG+WRIVVV +
Sbjct  275   SAIFGAFDIIQQPKNISEYSKQTICFYMFADEETEADLKANRGLGESKKIGVWRIVVVRN  334

Query  1518  LPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRH  1697
             LPYTD RRNGKIPKLL HRLFPNAR+SLWIDGKLELV DPYQILERFLWR+NA+FAISRH
Sbjct  335   LPYTDGRRNGKIPKLLPHRLFPNARFSLWIDGKLELVADPYQILERFLWRKNATFAISRH  394

Query  1698  YKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREH  1877
             YKRFDVF+EAEANKAAGK+DNASIDFQV+FYKKEGLTP+S AK PITSDVPEGCVIIREH
Sbjct  395   YKRFDVFDEAEANKAAGKYDNASIDFQVDFYKKEGLTPYSEAKLPITSDVPEGCVIIREH  454

Query  1878  IPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRD  2057
             +PISNLFTCLWFN+VDRFT RDQISFSTVRDKI ++TNW+V MFLDCERRNFVVQ +H++
Sbjct  455   VPISNLFTCLWFNDVDRFTSRDQISFSTVRDKIAAKTNWSVNMFLDCERRNFVVQKHHKE  514

Query  2058  ILEHRA  2075
             +L H A
Sbjct  515   VLAHLA  520



>ref|XP_006377366.1| hypothetical protein POPTR_0011s05280g [Populus trichocarpa]
 gb|ERP55163.1| hypothetical protein POPTR_0011s05280g [Populus trichocarpa]
Length=591

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/509 (69%), Positives = 398/509 (78%), Gaps = 25/509 (5%)
 Frame = +3

Query  579   QQHHF--LSSSFPIPPR-----KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVF  737
             QQH+   + SS P P +     KP K FKEKE  FH IFKFA RKKVG+L LC +SAAVF
Sbjct  23    QQHNGNGVLSSAPFPMQTNGRTKPAKMFKEKESLFHWIFKFAGRKKVGMLFLCVISAAVF  82

Query  738   VWVLYVGKGEDAR-GPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTD  914
             VWVLYVGKGEDA+ G   PTIS+S T          E K +  + + +         S  
Sbjct  83    VWVLYVGKGEDAQEGGRPPTISLSDTSSLSRI----ENKTSFFQGIFSN-------ISLL  131

Query  915   QPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPS  1094
              PP     YF GYTLPPG+PC  FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PS
Sbjct  132   HPP----AYFLGYTLPPGHPCNRFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPS  187

Query  1095  FSPVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGR  1268
             FSPV+  L YI E+ LS     G    GGYP+L+QR +SYDIRESM VHCGFV+G +PG+
Sbjct  188   FSPVIKNLTYIQEDPLSREGEFGGSDFGGYPTLKQRSDSYDIRESMRVHCGFVQGKRPGQ  247

Query  1269  ATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAF  1448
              T FD+D  DL  ME C GVVVASAIFGAFD I QP+NISEY++  +CF+MFVDE TEA+
Sbjct  248   NTGFDMDKIDLDAMEQCHGVVVASAIFGAFDDIQQPRNISEYSKNTICFFMFVDEETEAY  307

Query  1449  LRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELV  1628
             L+N+  LN S ++G+WRIVVVH+LPYTD RRNGK+PKLL HR+FPNAR+SLWIDGKLELV
Sbjct  308   LKNNSGLNDSRKVGIWRIVVVHNLPYTDGRRNGKVPKLLSHRMFPNARFSLWIDGKLELV  367

Query  1629  VDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLT  1808
             VDPYQILERFLWR NA+FAISRHY+RFDVF EAEANKAAGK++NASIDFQVEFYKKEGLT
Sbjct  368   VDPYQILERFLWRENATFAISRHYRRFDVFIEAEANKAAGKYENASIDFQVEFYKKEGLT  427

Query  1809  PFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRT  1988
             P+S AKFPI SDVPEGCV+IREH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI  +T
Sbjct  428   PYSEAKFPIISDVPEGCVVIREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIHEKT  487

Query  1989  NWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             NW V MFLDC+RRNFVVQ YHRD+LE  A
Sbjct  488   NWTVNMFLDCQRRNFVVQKYHRDVLEQMA  516



>ref|XP_002305132.1| hypothetical protein POPTR_0004s04400g [Populus trichocarpa]
 gb|EEE85643.1| hypothetical protein POPTR_0004s04400g [Populus trichocarpa]
Length=591

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/487 (71%), Positives = 388/487 (80%), Gaps = 17/487 (3%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTIS  800
             KP K FKEKE  FH I KFA RKKVG+L LC +SAAVFVWVLYVGKGEDA+ G   P IS
Sbjct  45    KPAKMFKEKESLFHWIVKFAGRKKVGMLFLCVISAAVFVWVLYVGKGEDAQEGDRPPNIS  104

Query  801   ISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCE  980
             ++A++                  +  K +  +GI S    PP P  YF GYTLPPG+PC 
Sbjct  105   VNASVS--------------LSRIENKTSFLQGIISDISLPPPPPAYFLGYTLPPGHPCN  150

Query  981   GFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefg  1157
              FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PSFSPV+  L YIHE+ LS     
Sbjct  151   SFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSFSPVIKNLTYIHEDPLSGERDF  210

Query  1158  gsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVV  1334
             G    GGYP+L+ R +SYDIRESMSVHCGFV+G +PG+ T FD+D+ DL  ME C GVVV
Sbjct  211   GGSDFGGYPTLKHRSDSYDIRESMSVHCGFVQGKRPGQNTGFDMDEIDLEAMEQCHGVVV  270

Query  1335  ASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVH  1514
             ASAIFGAFD I QP NISEY++  VCF+MFVDE TEA+L+N+  L+ S +IGLWRIVV H
Sbjct  271   ASAIFGAFDDIQQPHNISEYSKNTVCFFMFVDEETEAYLKNNSGLDDSRKIGLWRIVVAH  330

Query  1515  DLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISR  1694
             +LPYTD RRNGK+PKLL HR+FPNAR+SLWIDGKLEL+VDPYQILER LWR+NA+FAISR
Sbjct  331   NLPYTDGRRNGKVPKLLSHRMFPNARFSLWIDGKLELLVDPYQILERHLWRKNATFAISR  390

Query  1695  HYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIRE  1874
             HY+RFDVF EAEANKAAGK++NASIDFQVEFYKKEGL P+S AK PITSDVPEGCV+IRE
Sbjct  391   HYRRFDVFMEAEANKAAGKYENASIDFQVEFYKKEGLIPYSEAKLPITSDVPEGCVVIRE  450

Query  1875  HIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHR  2054
             H+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI  +TNW V MFLDCERRNFVVQ YHR
Sbjct  451   HVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIHEKTNWTVNMFLDCERRNFVVQKYHR  510

Query  2055  DILEHRA  2075
             D+LE  A
Sbjct  511   DVLEQMA  517



>ref|XP_011043387.1| PREDICTED: uncharacterized protein LOC105138870 [Populus euphratica]
Length=589

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/513 (69%), Positives = 397/513 (77%), Gaps = 32/513 (6%)
 Frame = +3

Query  579   QQHH----FLSSSFPIPPR---KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVF  737
             QQH+      SS FP+      KP K FKEKE   H IFKFA RKKVG+L LC +SAAVF
Sbjct  23    QQHNGNGVLSSSPFPMQTNGRTKPAKMFKEKESLSHWIFKFAGRKKVGMLFLCVISAAVF  82

Query  738   VWVLYVGKGEDAR-GPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNN----RGI  902
             VWVLYVGKGEDA+ G   PTIS+S T                  + L++  NN    +G 
Sbjct  83    VWVLYVGKGEDAQEGGRPPTISLSDT------------------SSLSRIENNTSFFQGR  124

Query  903   ASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  1082
              S     P P  YF GYTLPPG+PC  FTLPPPPADKKRTGPR CPVCYLPVEEAIALMP
Sbjct  125   FSNISLLPPPPAYFLGYTLPPGHPCNSFTLPPPPADKKRTGPRSCPVCYLPVEEAIALMP  184

Query  1083  TAPSFSPVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGV  1256
               PSFSPV+  L YI E+ LS     G    GGYP+L+QR +SYDIRESM VHCGFV+G 
Sbjct  185   KVPSFSPVIKNLTYIQEDPLSREGEFGGSDFGGYPTLKQRSDSYDIRESMRVHCGFVQGK  244

Query  1257  KPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEG  1436
             +PG+ T FD+D  DL  ME C GVVVASAIFGAFD I QP+NISEY++  +CF+MFVDE 
Sbjct  245   RPGQNTGFDMDKIDLDAMEQCHGVVVASAIFGAFDDIQQPRNISEYSKNTICFFMFVDEE  304

Query  1437  TEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGK  1616
             TEA+L+N+  LN S ++G+WRIVVVH+LPYTD RRNGK+PKLL HR+FPNAR+SLWIDGK
Sbjct  305   TEAYLKNNSGLNDSRKVGIWRIVVVHNLPYTDGRRNGKVPKLLSHRMFPNARFSLWIDGK  364

Query  1617  LELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKK  1796
             LELVVDPYQILERFLWR NA+FAISRHY+RFDVF EA ANKAAGK++NASIDFQVEFYKK
Sbjct  365   LELVVDPYQILERFLWRENATFAISRHYRRFDVFIEAGANKAAGKYENASIDFQVEFYKK  424

Query  1797  EGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKI  1976
             EGLTP+S AKFPITSDVPEGCV+IREH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI
Sbjct  425   EGLTPYSEAKFPITSDVPEGCVVIREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKI  484

Query  1977  RSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
               +TNW V MFLDC+RRNFVVQ YHRD+LE  A
Sbjct  485   HEKTNWTVNMFLDCQRRNFVVQRYHRDVLEQMA  517



>ref|XP_006361032.1| PREDICTED: uncharacterized protein LOC102582809 [Solanum tuberosum]
Length=526

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/480 (74%), Positives = 392/480 (82%), Gaps = 21/480 (4%)
 Frame = +3

Query  639   FKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGE--DARGPEIPTISISAT  812
             FKEKEG F  I KFA RKKVG+LLLCAVS AVF+WV++V KGE  ++  P    +   A 
Sbjct  2     FKEKEGLFPGIHKFAPRKKVGMLLLCAVSLAVFLWVVFVDKGEAQESNPPIGNRLFQEAG  61

Query  813   MKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTL  992
              KD   +IE  E+ N  ++           AST +PPP   VYF GYTLP GNPCE FTL
Sbjct  62    QKDNSTTIESVERTNAGQS-----------ASTVKPPP--PVYFKGYTLPRGNPCESFTL  108

Query  993   PPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSP-VLYLNYIHEETLsenefggsgf  1169
             PPPPADKKRTGPRPCPVCYLPVE+AIALMP APSFSP V  L YIHEE           F
Sbjct  109   PPPPADKKRTGPRPCPVCYLPVEQAIALMPDAPSFSPGVSNLAYIHEEN-----SEKPEF  163

Query  1170  ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIF  1349
             GGYPSL QR++SYD+RESMSVHCGFVKG++PG  T FDIDD DL EME+C GVVVASAIF
Sbjct  164   GGYPSLMQRNDSYDVRESMSVHCGFVKGIRPGHQTGFDIDDSDLHEMESCRGVVVASAIF  223

Query  1350  GAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYT  1529
             GAFDLI QPKNISEYA++NVCF+MFVDE TE FLRNS +L+ S RIGLWRIV VH+LPY 
Sbjct  224   GAFDLIRQPKNISEYAKKNVCFHMFVDEQTEVFLRNSSELDGSMRIGLWRIVTVHNLPYD  283

Query  1530  DARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRF  1709
             D RRNGK+PKLLLHRLFPNARYSLWID KLELVVDPYQILERFLWR+N SFAIS+HY+RF
Sbjct  284   DPRRNGKVPKLLLHRLFPNARYSLWIDAKLELVVDPYQILERFLWRKNVSFAISKHYRRF  343

Query  1710  DVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPIS  1889
             DVF EAEANKAA KFDNASIDFQ+EFYKKEGLTP+SAAK PITSDVPEGCV++REHIP+S
Sbjct  344   DVFVEAEANKAAAKFDNASIDFQIEFYKKEGLTPYSAAKLPITSDVPEGCVVVREHIPVS  403

Query  1890  NLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             NLF CLWFNEVDRFTPRDQISF+ VRDKI S+TNW + MFLDCERRNFVVQGYHRDILEH
Sbjct  404   NLFACLWFNEVDRFTPRDQISFAIVRDKIMSKTNWTLNMFLDCERRNFVVQGYHRDILEH  463



>ref|XP_009618811.1| PREDICTED: uncharacterized protein LOC104110944 isoform X1 [Nicotiana 
tomentosiformis]
Length=531

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/530 (70%), Positives = 420/530 (79%), Gaps = 21/530 (4%)
 Frame = +3

Query  639   FKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMK  818
             +KEKEG    I KFA RKKVG+LLLCAVS AV VWVL+V KGEDA+        ++A++ 
Sbjct  2     YKEKEGLLPWIHKFAPRKKVGMLLLCAVSLAVLVWVLFVDKGEDAQ-------ELNASIT  54

Query  819   DREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPR--VYFTGYTLPPGNPCEGFTL  992
             +  ++ E  +K+N       +  N    AS  QP P P   VYF GYTLPPGNPCEGFTL
Sbjct  55    NSVFTPEAGQKDNSTYIESIEQTNVGQSASIVQPLPPPPPTVYFKGYTLPPGNPCEGFTL  114

Query  993   PPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSP-VLYLNYIHEETLsenefggsgf  1169
             PPPPADKKRTGPRPCPVCYLPVE+AIALMP APSFSP +  L YI EE L + EFGGS F
Sbjct  115   PPPPADKKRTGPRPCPVCYLPVEQAIALMPGAPSFSPGISNLTYIREENLRKTEFGGSEF  174

Query  1170  ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIF  1349
             GGYPSL QR++SYD+RESMSVHCGF++G++PG  T FDIDD DL EME+C+GVVVASAIF
Sbjct  175   GGYPSLMQRNDSYDLRESMSVHCGFIRGIRPGHQTGFDIDDSDLLEMESCQGVVVASAIF  234

Query  1350  GAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYT  1529
             GAFDLI QPKNISEYA++N CF MFVDE TE FLRNS +L+ + RIGLWRIV VH+LPY 
Sbjct  235   GAFDLIRQPKNISEYAKKNACFCMFVDEETEVFLRNSSELDGTMRIGLWRIVSVHNLPYD  294

Query  1530  DARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRF  1709
             D RRNGK+PKLLLHRLFPNARYSLWID KLELVVDPYQILERFLWR+NASFAISRHY+RF
Sbjct  295   DPRRNGKVPKLLLHRLFPNARYSLWIDAKLELVVDPYQILERFLWRKNASFAISRHYRRF  354

Query  1710  DVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPIS  1889
             DV+ EAEANKAA KFDNASIDFQVEFYKKEGLTP+S AK PITSDVPEGCVI+REH PIS
Sbjct  355   DVYVEAEANKAAAKFDNASIDFQVEFYKKEGLTPYSTAKLPITSDVPEGCVIVREHNPIS  414

Query  1890  NLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             NLF CLWFNEVDRFTPRDQISF+ VRDKI S+TNW V MFLDCERRNFVVQGYHRDILEH
Sbjct  415   NLFACLWFNEVDRFTPRDQISFAIVRDKIMSKTNWTVNMFLDCERRNFVVQGYHRDILEH  474

Query  2070  RApppppppRATIR------DGVLKTSKYSGATTKLLARRIGDPRSRHRQ  2201
              APPPPP     +       D  L+TS+   +++      + DPR R R 
Sbjct  475   WAPPPPPGATEIVHPPPPVVDETLQTSRNVTSSS-----YVTDPRKRERN  519



>ref|XP_007025608.1| F3H9.11 protein isoform 3 [Theobroma cacao]
 gb|EOY28230.1| F3H9.11 protein isoform 3 [Theobroma cacao]
Length=518

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/475 (72%), Positives = 384/475 (81%), Gaps = 3/475 (1%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISI  803
             KP K FKEKE   H I KFA RKKVG+LLLCA+SAAVFVWVLYVGKGED     +P ++ 
Sbjct  36    KPSKMFKEKETLVHWICKFAGRKKVGMLLLCAISAAVFVWVLYVGKGEDQESDNVPKVND  95

Query  804   SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEG  983
             S  + +    +  E ++       + P    G      PPP P  YF GYTLPPG+PC  
Sbjct  96    SLPLNNSGSPLINEVQSVRIDNWTSLPVIVEGTEVRVMPPPPPS-YFLGYTLPPGHPCAT  154

Query  984   FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefgg  1160
             F+LPPPPADKKRTGPRPCPVCYLPVE+AIALMP  PSFSPV+  L YI+EE L++    G
Sbjct  155   FSLPPPPADKKRTGPRPCPVCYLPVEDAIALMPKVPSFSPVVKNLTYIYEENLNKETEFG  214

Query  1161  sgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVA  1337
                 GGYP+L+QRD+SYDIRESM+VHCGFVKG KPG  T FDIDD DL EME C GVVVA
Sbjct  215   GSDFGGYPTLKQRDDSYDIRESMNVHCGFVKGSKPGHGTGFDIDDNDLLEMEKCHGVVVA  274

Query  1338  SAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHD  1517
             SAIFGAFD+I QPKNISEY+++ +CFYMF DE TEA L+ +  L  S +IG+WRIVVV +
Sbjct  275   SAIFGAFDIIQQPKNISEYSKQTICFYMFADEETEADLKANRGLGESKKIGVWRIVVVRN  334

Query  1518  LPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRH  1697
             LPYTD RRNGKIPKLL HRLFPNAR+SLWIDGKLELV DPYQILERFLWR+NA+FAISRH
Sbjct  335   LPYTDGRRNGKIPKLLPHRLFPNARFSLWIDGKLELVADPYQILERFLWRKNATFAISRH  394

Query  1698  YKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREH  1877
             YKRFDVF+EAEANKAAGK+DNASIDFQV+FYKKEGLTP+S AK PITSDVPEGCVIIREH
Sbjct  395   YKRFDVFDEAEANKAAGKYDNASIDFQVDFYKKEGLTPYSEAKLPITSDVPEGCVIIREH  454

Query  1878  IPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             +PISNLFTCLWFN+VDRFT RDQISFSTVRDKI ++TNW+V MFLDCERRNFVVQ
Sbjct  455   VPISNLFTCLWFNDVDRFTSRDQISFSTVRDKIAAKTNWSVNMFLDCERRNFVVQ  509



>ref|XP_011027825.1| PREDICTED: uncharacterized protein LOC105128029 isoform X1 [Populus 
euphratica]
Length=588

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/487 (70%), Positives = 387/487 (79%), Gaps = 17/487 (3%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTIS  800
             KP K FKEKE  FH I KFA RKKVG+L LC +SAAVFVWVLYVGKGEDA+ G   P IS
Sbjct  45    KPAKMFKEKESLFHWIVKFAGRKKVGMLFLCVISAAVFVWVLYVGKGEDAQEGDHPPNIS  104

Query  801   ISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCE  980
             ++A++                  +  K +  +GI S    PP P  YF GYTLPPG+PC 
Sbjct  105   VNASVS--------------LSRIENKTSFLQGIISDISLPPPPPAYFLGYTLPPGHPCN  150

Query  981   GFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefg  1157
              FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PSFSPV+  L YI+E+ LS     
Sbjct  151   SFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSFSPVIKNLTYIYEDPLSGERDF  210

Query  1158  gsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVV  1334
             G    GGYP+L+ R +SYDIRESMSVHCGFV+G +PG+ T FD+D+ DL  M+ C GVVV
Sbjct  211   GGSDFGGYPTLKHRSDSYDIRESMSVHCGFVQGKRPGQNTGFDMDEIDLEAMDQCHGVVV  270

Query  1335  ASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVH  1514
             ASAIFGAFD I QP NISEY++  VCF+MFVDE TEA+L+N+  L+ S +IGLWRIVVVH
Sbjct  271   ASAIFGAFDDIQQPHNISEYSKNTVCFFMFVDEETEAYLKNNSGLDDSRKIGLWRIVVVH  330

Query  1515  DLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISR  1694
             +LPY D RRNGK+PKLL HR+FPNAR+SLWIDGKLEL+VDPYQILER LWR+NA+FAISR
Sbjct  331   NLPYADGRRNGKVPKLLSHRMFPNARFSLWIDGKLELIVDPYQILERHLWRKNATFAISR  390

Query  1695  HYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIRE  1874
             HY+RFDVF EAEANKAAGK++NASIDFQVEFYKKEGLTP+S AK PITSDVPEGCV+IRE
Sbjct  391   HYRRFDVFMEAEANKAAGKYENASIDFQVEFYKKEGLTPYSEAKLPITSDVPEGCVVIRE  450

Query  1875  HIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHR  2054
             H+ ISNLFTCLWFNEVDRFT RDQISFS VRDKI  +TNW V MFLDCERRNFVVQ YHR
Sbjct  451   HVAISNLFTCLWFNEVDRFTSRDQISFSIVRDKIHEKTNWTVNMFLDCERRNFVVQKYHR  510

Query  2055  DILEHRA  2075
             D+LE  A
Sbjct  511   DVLEQIA  517



>gb|KDP20976.1| hypothetical protein JCGZ_21447 [Jatropha curcas]
Length=619

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/507 (69%), Positives = 400/507 (79%), Gaps = 9/507 (2%)
 Frame = +3

Query  579   QQHHFLSSSFPIPPR-----KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVW  743
             QQH        +P +     KP K FKEKE  FH I KFA RKKVG+L LC +SAAVF+W
Sbjct  24    QQHQQNGGGAHLPGQMIGRNKPAKMFKEKERLFHWICKFAGRKKVGMLFLCIISAAVFIW  83

Query  744   VLYVGKGEDAR-GPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQP  920
             VLYVGKGED++ G  +P+ISI         S+   E + I +  L  P       S    
Sbjct  84    VLYVGKGEDSQEGDHVPSISIRINSTLNNSSLN-NETDKIEELALPPPPPPPPPPSPLTT  142

Query  921   PPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFS  1100
             PP P  YF GYTLPPG+PC  FTLPPPPADKKRTGPRPCPVCYLPVEEAIAL P  PSFS
Sbjct  143   PPPPSQYFLGYTLPPGHPCNSFTLPPPPADKKRTGPRPCPVCYLPVEEAIALTPKLPSFS  202

Query  1101  PVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRAT  1274
             PV+  L YI+E+ LS +   G    GGYP+L QR + ++IRESMSVHCGFV+G KPG+ T
Sbjct  203   PVVKNLTYIYEDPLSRDAEFGGSDFGGYPTLHQRSDYFEIRESMSVHCGFVRGKKPGQNT  262

Query  1275  SFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLR  1454
              FD+D+ DL  ME C GVVVASAIFGAFD I QP NISEY+R+NVCF+MFVDE TEA+L+
Sbjct  263   GFDMDETDLAAMEQCNGVVVASAIFGAFDEIQQPSNISEYSRKNVCFFMFVDEETEAYLK  322

Query  1455  NSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVD  1634
                 L+S+ +IG+WRIVVVH+LPY+D RRNGK+PKLL HR+FPNAR+SLWIDGKLELVVD
Sbjct  323   KKSGLDSNRKIGIWRIVVVHNLPYSDGRRNGKVPKLLSHRMFPNARFSLWIDGKLELVVD  382

Query  1635  PYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF  1814
             PYQILER LWR+NASFAISRHYKRFDVF EAEANKAAGK+DNASIDFQ++FYKKEGL PF
Sbjct  383   PYQILERHLWRKNASFAISRHYKRFDVFVEAEANKAAGKYDNASIDFQIDFYKKEGLRPF  442

Query  1815  SAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNW  1994
             S+AKFPITSDVPEGCVIIREH+PISNLFTCLWFNEVDRFT RDQISFSTVRDK++++TNW
Sbjct  443   SSAKFPITSDVPEGCVIIREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKVQAKTNW  502

Query  1995  NVEMFLDCERRNFVVQGYHRDILEHRA  2075
              V MFLDCERRNFVVQ YHRD+LEH A
Sbjct  503   TVNMFLDCERRNFVVQKYHRDVLEHMA  529



>ref|XP_010317441.1| PREDICTED: uncharacterized protein LOC101259611 isoform X1 [Solanum 
lycopersicum]
Length=624

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/542 (70%), Positives = 404/542 (75%), Gaps = 50/542 (9%)
 Frame = +3

Query  579   QQHHFLSSSFPIP-----PRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVW  743
             QQ  F +SS PI      PRKP K FKEKEG F  I KFA RK VG+LLLC VSAA F+W
Sbjct  18    QQQLFQNSSSPIQTTSPIPRKPPKLFKEKEGLFLWICKFAPRKNVGMLLLCVVSAAAFLW  77

Query  744   VLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPP  923
             VLYVGKGE A        +     K     IE  +KNN+ +++                 
Sbjct  78    VLYVGKGEVAAEQSNRMFAPETVHKYIFSGIESIQKNNVGRSVSIVQPPPPPPPPPPL--  135

Query  924   PLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSP  1103
              LP VYF GYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVE+AIALM  APSFSP
Sbjct  136   -LPPVYFKGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEQAIALMSDAPSFSP  194

Query  1104  -VLYLNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSF  1280
              V  L YIHEE  S+ +FGGS FGGYPSL QR +SYDIRESM VHCGFV+GV+PG  T F
Sbjct  195   GVSNLTYIHEENQSKADFGGSNFGGYPSLFQRIDSYDIRESMRVHCGFVRGVRPGHQTGF  254

Query  1281  DIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNS  1460
             DIDD DL EME+C+GVVVASAIFGAFDLI QPKN SEYA++N CFYMFVDE TEAFLRNS
Sbjct  255   DIDDSDLLEMESCQGVVVASAIFGAFDLIRQPKNTSEYAKKNACFYMFVDEQTEAFLRNS  314

Query  1461  GDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPY  1640
              +LNSS RIGLWRIVVVH+LPY D RRNGK+PKLLLHRLFPNARYSLWIDGKLELVVDPY
Sbjct  315   SELNSSMRIGLWRIVVVHNLPYGDPRRNGKVPKLLLHRLFPNARYSLWIDGKLELVVDPY  374

Query  1641  QILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSA  1820
             QILERFLWR+NASFAISRHYKRFDVF EAEANKAA KFDNASIDFQVEFYKKEGL P+S 
Sbjct  375   QILERFLWRKNASFAISRHYKRFDVFVEAEANKAAAKFDNASIDFQVEFYKKEGLAPYSR  434

Query  1821  AKFPITS-----------------------------------------DVPEGCVIIREH  1877
             AK PITS                                         DVPEGCVIIREH
Sbjct  435   AKLPITSGKCVIIFFLIFVTFFLLFPSHQLNVATDFSLITILTYYSYADVPEGCVIIREH  494

Query  1878  IPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRD  2057
             IPISNLFTCLWFNEVDRFTPRDQISF+ VRDKI S+TNW V MFLDCERRNFV+QGYHRD
Sbjct  495   IPISNLFTCLWFNEVDRFTPRDQISFAIVRDKIMSKTNWTVNMFLDCERRNFVIQGYHRD  554

Query  2058  IL  2063
             IL
Sbjct  555   IL  556



>ref|XP_008442599.1| PREDICTED: uncharacterized protein LOC103486418 [Cucumis melo]
Length=584

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/490 (70%), Positives = 390/490 (80%), Gaps = 6/490 (1%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTI  797
             RKP K  KEK+  F  I KF  RKKVG+LLLC VSAAVF+WVLYVGKGED R G +I  +
Sbjct  31    RKPSKMMKEKDYLFPWICKFVGRKKVGMLLLCVVSAAVFLWVLYVGKGEDTREGQQIQRV  90

Query  798   SI--SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGN  971
             SI  S  M  RE S E +  +N   +L      +        PPP P   F GYTLPPG+
Sbjct  91    SINNSLVMSFRESSAE-DIMDNSSSSLAKGIETSSSAPPPPPPPPPPPALFLGYTLPPGH  149

Query  972   PCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsen  1148
             PC  F LPPPPADKKRTGPRPCPVCYLPVEEA+ALMP A S SPVL  L+YI+EE L   
Sbjct  150   PCNNFALPPPPADKKRTGPRPCPVCYLPVEEAVALMPNASSDSPVLKNLDYIYEENLRRE  209

Query  1149  efggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
                G    GGYP+L QR +S+DIRESM VHCGFV G+KPGR T FDI+D DL +ME C G
Sbjct  210   TEFGGSDFGGYPTLAQRTDSFDIRESMRVHCGFVGGIKPGRNTGFDINDDDLHDMEQCRG  269

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             VVVASAIFG FD+I+QP NIS+YA+  VCF+MF+DE TEA L+ +G L SS +IGLWRI+
Sbjct  270   VVVASAIFGNFDVINQPSNISDYAKNTVCFFMFIDEETEASLKEAGILESSKKIGLWRII  329

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             VVH+LPY DARR GKIPKLL+HR+FPNARYSLW+DGKLELVVDPYQ+LERFLWR+NA+FA
Sbjct  330   VVHNLPYKDARRTGKIPKLLVHRMFPNARYSLWLDGKLELVVDPYQLLERFLWRKNATFA  389

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVI  1865
             ISRHYKRFDVF EA+ANKAAGK+DNASIDFQ++FY KEGLTP+S AK PITSDVPEGCVI
Sbjct  390   ISRHYKRFDVFMEADANKAAGKYDNASIDFQIDFYVKEGLTPYSEAKLPITSDVPEGCVI  449

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQG  2045
             IREH+PISNLF+CLWFNEVDRFT RDQISFSTVRDKI ++TNW + MFLDCERRNFV+Q 
Sbjct  450   IREHVPISNLFSCLWFNEVDRFTSRDQISFSTVRDKIMAKTNWTINMFLDCERRNFVIQK  509

Query  2046  YHRDILEHRA  2075
             YHRD+LE +A
Sbjct  510   YHRDVLEQKA  519



>ref|XP_007025610.1| F3H9.11 protein isoform 5 [Theobroma cacao]
 gb|EOY28232.1| F3H9.11 protein isoform 5 [Theobroma cacao]
Length=616

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/516 (67%), Positives = 392/516 (76%), Gaps = 33/516 (6%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISI  803
             KP K FKEKE   H I KFA RKKVG+LLLCA+SAAVFVWVLYVGKGED     +P ++ 
Sbjct  36    KPSKMFKEKETLVHWICKFAGRKKVGMLLLCAISAAVFVWVLYVGKGEDQESDNVPKVND  95

Query  804   SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEG  983
             S  + +    +  E ++       + P    G      PPP P  YF GYTLPPG+PC  
Sbjct  96    SLPLNNSGSPLINEVQSVRIDNWTSLPVIVEGTEVRVMPPPPPS-YFLGYTLPPGHPCAT  154

Query  984   FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefgg  1160
             F+LPPPPADKKRTGPRPCPVCYLPVE+AIALMP  PSFSPV+  L YI+EE L++    G
Sbjct  155   FSLPPPPADKKRTGPRPCPVCYLPVEDAIALMPKVPSFSPVVKNLTYIYEENLNKETEFG  214

Query  1161  sgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVA  1337
                 GGYP+L+QRD+SYDIRESM+VHCGFVKG KPG  T FDIDD DL EME C GVVVA
Sbjct  215   GSDFGGYPTLKQRDDSYDIRESMNVHCGFVKGSKPGHGTGFDIDDNDLLEMEKCHGVVVA  274

Query  1338  SAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHD  1517
             SAIFGAFD+I QPKNISEY+++ +CFYMF DE TEA L+ +  L  S +IG+WRIVVV +
Sbjct  275   SAIFGAFDIIQQPKNISEYSKQTICFYMFADEETEADLKANRGLGESKKIGVWRIVVVRN  334

Query  1518  LPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRH  1697
             LPYTD RRNGKIPKLL HRLFPNAR+SLWIDGKLELV DPYQILERFLWR+NA+FAISRH
Sbjct  335   LPYTDGRRNGKIPKLLPHRLFPNARFSLWIDGKLELVADPYQILERFLWRKNATFAISRH  394

Query  1698  YKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITS------------  1841
             YKRFDVF+EAEANKAAGK+DNASIDFQV+FYKKEGLTP+S AK PITS            
Sbjct  395   YKRFDVFDEAEANKAAGKYDNASIDFQVDFYKKEGLTPYSEAKLPITSGRVQDACSCFIL  454

Query  1842  ------------------DVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVR  1967
                               DVPEGCVIIREH+PISNLFTCLWFN+VDRFT RDQISFSTVR
Sbjct  455   FGYASFSLMNFALMAGSADVPEGCVIIREHVPISNLFTCLWFNDVDRFTSRDQISFSTVR  514

Query  1968  DKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             DKI ++TNW+V MFLDCERRNFVVQ +H+++L H A
Sbjct  515   DKIAAKTNWSVNMFLDCERRNFVVQKHHKEVLAHLA  550



>ref|XP_004163444.1| PREDICTED: uncharacterized LOC101209711 [Cucumis sativus]
Length=583

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/490 (69%), Positives = 390/490 (80%), Gaps = 7/490 (1%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTI  797
             RKP K  KEK+  F  I KF  RKKVG+LLLC VSAAVF+WVLYVGKGED R G  I  +
Sbjct  31    RKPSKMMKEKDYLFPWICKFVGRKKVGMLLLCVVSAAVFLWVLYVGKGEDTREGQHIQRV  90

Query  798   SI--SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGN  971
             SI  S  M  RE S E    N+   + +AK      +A    PPP P     GYTLPPG+
Sbjct  91    SINNSIVMTFRESSAEDIMDNS--SSSMAKGIETSSLAPPPPPPPPPPPPPPGYTLPPGH  148

Query  972   PCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsen  1148
             PC  F LPPPPADKKRTGPRPCPVCYLPVEEA+ALMP A S SPVL  L+YI+EE L   
Sbjct  149   PCNNFALPPPPADKKRTGPRPCPVCYLPVEEAVALMPNASSDSPVLKKLDYIYEENLRRE  208

Query  1149  efggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
                G    GGYP++ QR +S+DIRESM VHCGFV G+KPGR T FDI+D DL +ME C G
Sbjct  209   TEFGGSDFGGYPTIAQRTDSFDIRESMRVHCGFVGGIKPGRNTGFDINDDDLHDMEQCRG  268

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             VVVASAIFG FD+I+QP NISEYA+  VCF+MF+DE TEA L+ +G L SS +IGLWRI+
Sbjct  269   VVVASAIFGNFDVINQPTNISEYAKNTVCFFMFIDEETEASLKETGILESSKKIGLWRII  328

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             VVH+LPY DARR GKIPKLL+HR+FPNARYSLWIDGKLELVVDPYQ+LERFLWR+NA+FA
Sbjct  329   VVHNLPYKDARRTGKIPKLLVHRMFPNARYSLWIDGKLELVVDPYQLLERFLWRKNATFA  388

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVI  1865
             IS+HYKRFDVF EA+ANKAAGK+DNASIDFQ++FY KEGLTP+S AK PITSDVPEGCVI
Sbjct  389   ISKHYKRFDVFMEADANKAAGKYDNASIDFQIDFYVKEGLTPYSEAKLPITSDVPEGCVI  448

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQG  2045
             +REH+PISNLF+CLWFNEVDRFT RDQISF+TVRDKI ++TNW + MFLDCERRNFV+Q 
Sbjct  449   LREHVPISNLFSCLWFNEVDRFTSRDQISFATVRDKIMAKTNWTINMFLDCERRNFVIQK  508

Query  2046  YHRDILEHRA  2075
             YHRD+LE +A
Sbjct  509   YHRDVLEQKA  518



>gb|EYU43390.1| hypothetical protein MIMGU_mgv1a021937mg [Erythranthe guttata]
Length=577

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/484 (73%), Positives = 401/484 (83%), Gaps = 8/484 (2%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTIS  800
             RKP K  KEK+  FHRIFKFA RKKVG+LLLC  S AVFVWVL VGKG+DAR       S
Sbjct  37    RKPPKMLKEKDKLFHRIFKFAPRKKVGMLLLCLASLAVFVWVLAVGKGQDARE------S  90

Query  801   ISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCE  980
             I + ++     +  EEK ++ +T  ++        +   PPP P VYFTGY LPPGNPCE
Sbjct  91    ILSNIRTVPGPLS-EEKVSVSETSSSRITAIERSVNVTLPPPPPPVYFTGYKLPPGNPCE  149

Query  981   GFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefg  1157
              FTLPPPPADKKRTGPRPCPVCYLP+E+A+ LMP APSFSPVL  L YIH+E L+++EFG
Sbjct  150   HFTLPPPPADKKRTGPRPCPVCYLPLEDAVTLMPNAPSFSPVLKDLTYIHDENLTKSEFG  209

Query  1158  gsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVA  1337
             GS FGGYPSL QR +SYDIRESMSVHCGFVKGVKPG  T FDID+ DL EME+C+GVVVA
Sbjct  210   GSEFGGYPSLGQRSDSYDIRESMSVHCGFVKGVKPGHGTGFDIDESDLLEMESCQGVVVA  269

Query  1338  SAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHD  1517
             SA+FGAFDLI QPKNISEY++ NVCF+MFVDE TE FLRNS  + S +++GLWRI+VV +
Sbjct  270   SAVFGAFDLIRQPKNISEYSKRNVCFHMFVDEETEGFLRNSSLVGSDNKVGLWRIIVVRN  329

Query  1518  LPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRH  1697
             LPY+D RRNGK+PKLLLHRLFP  RYSLW+D KLELVVDP QILERFLWR+NASFAISRH
Sbjct  330   LPYSDPRRNGKVPKLLLHRLFPKTRYSLWVDAKLELVVDPIQILERFLWRKNASFAISRH  389

Query  1698  YKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREH  1877
             YKRFDVF EAEANKAA K+DNASIDFQ++FYK EGLTP+S  K PITSDVPEGCVI++EH
Sbjct  390   YKRFDVFVEAEANKAAAKYDNASIDFQIDFYKNEGLTPYSVEKLPITSDVPEGCVIVKEH  449

Query  1878  IPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRD  2057
             IPI+NLFTCLWFNEVDRFT RDQISFSTVRDKI S+TN+ + MFLDCERRNFVVQGYHRD
Sbjct  450   IPIANLFTCLWFNEVDRFTSRDQISFSTVRDKIHSKTNYTINMFLDCERRNFVVQGYHRD  509

Query  2058  ILEH  2069
             +LEH
Sbjct  510   LLEH  513



>ref|XP_008225103.1| PREDICTED: uncharacterized protein LOC103324773 [Prunus mume]
Length=582

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/485 (71%), Positives = 386/485 (80%), Gaps = 13/485 (3%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTIS  800
             RKP K  KEKE  FH I KFA RKKVG+L LC +SAAVFVWVLY+GKGED +G  +  IS
Sbjct  34    RKPSKMLKEKERLFHWICKFAGRKKVGMLFLCLISAAVFVWVLYIGKGEDEQGISVENIS  93

Query  801   ISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCE  980
             ++ ++     +I        H      P +N    S   PPP P V F GYTLPPG+PC 
Sbjct  94    VNNSI-----TISYLGSLQTHG-----PQSNNVTFSLALPPPPPAV-FLGYTLPPGHPCN  142

Query  981   GFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefg  1157
              FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PS SPVL  L YI+EE LS     
Sbjct  143   LFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKFPSDSPVLKNLTYIYEENLSRETEF  202

Query  1158  gsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVV  1334
             G    GGYP+L+QR +SYDIRESMSVHCGFV G KPGR T +D+D+ DL +ME C GVVV
Sbjct  203   GGSDFGGYPTLKQRSDSYDIRESMSVHCGFVGGSKPGRNTGYDMDEVDLHDMEQCHGVVV  262

Query  1335  ASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVH  1514
             ASAIFG FD I+QP NIS+Y++E VCFYMF+DE TEA+LR+SG L S  ++G+WR VVVH
Sbjct  263   ASAIFGNFDEINQPTNISDYSKETVCFYMFIDEVTEAYLRSSGKLGSDRKVGIWRTVVVH  322

Query  1515  DLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISR  1694
             + PYTD RR GKIPKLL+HR+FPNAR+SLWIDGKLELVVDPYQILERFLWR+NA+FAIS+
Sbjct  323   NPPYTDGRRTGKIPKLLVHRMFPNARFSLWIDGKLELVVDPYQILERFLWRKNATFAISK  382

Query  1695  HYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIRE  1874
             HYKRFDVF EAEANKAAGK++NASIDFQ+EFYKKEGL P+S AK PI SDVPEGCVIIRE
Sbjct  383   HYKRFDVFTEAEANKAAGKYNNASIDFQIEFYKKEGLAPYSEAKLPIISDVPEGCVIIRE  442

Query  1875  HIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHR  2054
             H+PISNLFTCLWFNEVDRFT RDQISFSTVRD IR RTNW + MF DCERRNFVVQ YHR
Sbjct  443   HVPISNLFTCLWFNEVDRFTSRDQISFSTVRDHIRERTNWTINMFYDCERRNFVVQKYHR  502

Query  2055  DILEH  2069
             D+LEH
Sbjct  503   DVLEH  507



>ref|XP_009618813.1| PREDICTED: uncharacterized protein LOC104110944 isoform X3 [Nicotiana 
tomentosiformis]
Length=512

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/528 (69%), Positives = 406/528 (77%), Gaps = 36/528 (7%)
 Frame = +3

Query  639   FKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMK  818
             +KEKEG    I KFA RKKVG+LLLCAVS AV VWVL+V K               A  K
Sbjct  2     YKEKEGLLPWIHKFAPRKKVGMLLLCAVSLAVLVWVLFVDK---------------AGQK  46

Query  819   DREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPP  998
             D    IE  E+ N+ ++            +         VYF GYTLPPGNPCEGFTLPP
Sbjct  47    DNSTYIESIEQTNVGQSASIVQPLPPPPPT---------VYFKGYTLPPGNPCEGFTLPP  97

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSP-VLYLNYIHEETLsenefggsgfgg  1175
             PPADKKRTGPRPCPVCYLPVE+AIALMP APSFSP +  L YI EE L + EFGGS FGG
Sbjct  98    PPADKKRTGPRPCPVCYLPVEQAIALMPGAPSFSPGISNLTYIREENLRKTEFGGSEFGG  157

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             YPSL QR++SYD+RESMSVHCGF++G++PG  T FDIDD DL EME+C+GVVVASAIFGA
Sbjct  158   YPSLMQRNDSYDLRESMSVHCGFIRGIRPGHQTGFDIDDSDLLEMESCQGVVVASAIFGA  217

Query  1356  FDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDA  1535
             FDLI QPKNISEYA++N CF MFVDE TE FLRNS +L+ + RIGLWRIV VH+LPY D 
Sbjct  218   FDLIRQPKNISEYAKKNACFCMFVDEETEVFLRNSSELDGTMRIGLWRIVSVHNLPYDDP  277

Query  1536  RRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDV  1715
             RRNGK+PKLLLHRLFPNARYSLWID KLELVVDPYQILERFLWR+NASFAISRHY+RFDV
Sbjct  278   RRNGKVPKLLLHRLFPNARYSLWIDAKLELVVDPYQILERFLWRKNASFAISRHYRRFDV  337

Query  1716  FEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNL  1895
             + EAEANKAA KFDNASIDFQVEFYKKEGLTP+S AK PITSDVPEGCVI+REH PISNL
Sbjct  338   YVEAEANKAAAKFDNASIDFQVEFYKKEGLTPYSTAKLPITSDVPEGCVIVREHNPISNL  397

Query  1896  FTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             F CLWFNEVDRFTPRDQISF+ VRDKI S+TNW V MFLDCERRNFVVQGYHRDILEH A
Sbjct  398   FACLWFNEVDRFTPRDQISFAIVRDKIMSKTNWTVNMFLDCERRNFVVQGYHRDILEHWA  457

Query  2076  pppppppRATIR------DGVLKTSKYSGATTKLLARRIGDPRSRHRQ  2201
             PPPPP     +       D  L+TS+   +++      + DPR R R 
Sbjct  458   PPPPPGATEIVHPPPPVVDETLQTSRNVTSSSY-----VTDPRKRERN  500



>ref|XP_009618812.1| PREDICTED: uncharacterized protein LOC104110944 isoform X2 [Nicotiana 
tomentosiformis]
Length=513

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/528 (69%), Positives = 406/528 (77%), Gaps = 35/528 (7%)
 Frame = +3

Query  639   FKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMK  818
             +KEKEG    I KFA RKKVG+LLLCAVS AV VWVL+V K               A  K
Sbjct  2     YKEKEGLLPWIHKFAPRKKVGMLLLCAVSLAVLVWVLFVDK--------------EAGQK  47

Query  819   DREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPP  998
             D    IE  E+ N+ ++            +         VYF GYTLPPGNPCEGFTLPP
Sbjct  48    DNSTYIESIEQTNVGQSASIVQPLPPPPPT---------VYFKGYTLPPGNPCEGFTLPP  98

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSP-VLYLNYIHEETLsenefggsgfgg  1175
             PPADKKRTGPRPCPVCYLPVE+AIALMP APSFSP +  L YI EE L + EFGGS FGG
Sbjct  99    PPADKKRTGPRPCPVCYLPVEQAIALMPGAPSFSPGISNLTYIREENLRKTEFGGSEFGG  158

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             YPSL QR++SYD+RESMSVHCGF++G++PG  T FDIDD DL EME+C+GVVVASAIFGA
Sbjct  159   YPSLMQRNDSYDLRESMSVHCGFIRGIRPGHQTGFDIDDSDLLEMESCQGVVVASAIFGA  218

Query  1356  FDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDA  1535
             FDLI QPKNISEYA++N CF MFVDE TE FLRNS +L+ + RIGLWRIV VH+LPY D 
Sbjct  219   FDLIRQPKNISEYAKKNACFCMFVDEETEVFLRNSSELDGTMRIGLWRIVSVHNLPYDDP  278

Query  1536  RRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDV  1715
             RRNGK+PKLLLHRLFPNARYSLWID KLELVVDPYQILERFLWR+NASFAISRHY+RFDV
Sbjct  279   RRNGKVPKLLLHRLFPNARYSLWIDAKLELVVDPYQILERFLWRKNASFAISRHYRRFDV  338

Query  1716  FEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNL  1895
             + EAEANKAA KFDNASIDFQVEFYKKEGLTP+S AK PITSDVPEGCVI+REH PISNL
Sbjct  339   YVEAEANKAAAKFDNASIDFQVEFYKKEGLTPYSTAKLPITSDVPEGCVIVREHNPISNL  398

Query  1896  FTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             F CLWFNEVDRFTPRDQISF+ VRDKI S+TNW V MFLDCERRNFVVQGYHRDILEH A
Sbjct  399   FACLWFNEVDRFTPRDQISFAIVRDKIMSKTNWTVNMFLDCERRNFVVQGYHRDILEHWA  458

Query  2076  pppppppRATIR------DGVLKTSKYSGATTKLLARRIGDPRSRHRQ  2201
             PPPPP     +       D  L+TS+   +++      + DPR R R 
Sbjct  459   PPPPPGATEIVHPPPPVVDETLQTSRNVTSSSY-----VTDPRKRERN  501



>ref|XP_002509470.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50857.1| conserved hypothetical protein [Ricinus communis]
Length=587

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/487 (69%), Positives = 391/487 (80%), Gaps = 12/487 (2%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTIS  800
             KP K  KEKE  FH I K   RKKVG+L LC +SAAVFVWVLYVGKGED++ G  +  I+
Sbjct  44    KPAKMLKEKERLFHWICKIVGRKKVGMLFLCIISAAVFVWVLYVGKGEDSQEGDHVSNIT  103

Query  801   ISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCE  980
              +++     Y       N  ++T ++K  N         PPP P  YF GYTLPPG+PC 
Sbjct  104   FNSS-----YPFS----NTENRTSISKNFNLLPPQPQPPPPPPPTPYFLGYTLPPGHPCN  154

Query  981   GFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefg  1157
              FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PS+SPV+  L YI+E+ LS +   
Sbjct  155   SFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKFPSYSPVVKNLTYIYEDPLSRDGEF  214

Query  1158  gsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVV  1334
             G    GGYP+L+QR ESYDIR+SM+VHCGFV+G +PGR+T FD+D+ DL  ME C GVVV
Sbjct  215   GGSDFGGYPTLKQRSESYDIRDSMNVHCGFVRGQRPGRSTGFDMDETDLAAMEQCHGVVV  274

Query  1335  ASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVH  1514
             ASAIFGAFD I QP NIS Y+++ VCF+MFVDE TEA+L+ +G L+SS  +G+WRIV+V 
Sbjct  275   ASAIFGAFDDIQQPSNISMYSKQTVCFFMFVDEETEAYLKKNGGLDSSRMVGVWRIVLVR  334

Query  1515  DLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISR  1694
             +LPY D RRNGK+PKLL HRLFPN RYSLWIDGKLELVVDP+QILER LWR+NASFAISR
Sbjct  335   NLPYADGRRNGKVPKLLSHRLFPNTRYSLWIDGKLELVVDPHQILERHLWRKNASFAISR  394

Query  1695  HYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIRE  1874
             HYKRFDVF EAEANKAAGK+DNASIDFQ++FYKKEGLTP+S AK PITSDVPEGCVIIRE
Sbjct  395   HYKRFDVFVEAEANKAAGKYDNASIDFQIDFYKKEGLTPYSEAKLPITSDVPEGCVIIRE  454

Query  1875  HIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHR  2054
             H+PISNLFTCLWFNEVDRFT RDQISFSTVRDK++++TNW V MFLDCERRNFVVQ YHR
Sbjct  455   HVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKVQAKTNWTVNMFLDCERRNFVVQKYHR  514

Query  2055  DILEHRA  2075
             D+LEH A
Sbjct  515   DVLEHMA  521



>gb|KHG15814.1| Protein strawberry notch 2 [Gossypium arboreum]
Length=594

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/511 (67%), Positives = 397/511 (78%), Gaps = 13/511 (3%)
 Frame = +3

Query  579   QQHHFLSSSFPIPPR-KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYV  755
             Q    L    P+  R KP K FKEKE   H I K A RKKVG+LLL  +SAAVFVWV+YV
Sbjct  21    QNSVLLPIQVPLATRSKPSKVFKEKETLVHWICKLAGRKKVGMLLLSVISAAVFVWVVYV  80

Query  756   GKGEDARGPEIPTISISATMKDREYSI--EPEEKNNIHKTLLAKPNNNRGIASTDQPPPL  929
             GKGE      +  ++ S  + +  + +  E +     + T L   ++  G      PPP 
Sbjct  81    GKGEYQDSDNVRKVNDSLPINNSGFPLIYEVQSVKIDNWTSLVASDSVEGTEVRKMPPPP  140

Query  930   PRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL  1109
             P  YF GYTLPPG+PC  F+LPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PSFSP+L
Sbjct  141   PS-YFLGYTLPPGHPCYTFSLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSFSPIL  199

Query  1110  Y-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFD  1283
               L YI+EE L++++  G    GGYP+L+QRD+SYDIRESM++ CGFVKG KPGR + FD
Sbjct  200   KNLTYIYEENLNKDKEFGGSDFGGYPTLKQRDDSYDIRESMNLRCGFVKGSKPGRGSGFD  259

Query  1284  IDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSG  1463
             I+D DL +ME C GVVVASAIFGAFD+I QPKNISEY+++ +CFYMFVDE TEA L+ + 
Sbjct  260   INDDDLLKMEQCHGVVVASAIFGAFDIIQQPKNISEYSKQTICFYMFVDEETEADLKLNS  319

Query  1464  DLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQ  1643
              L+ S +IG+WRIVV H+LPYTD RRNGKIPKLL HRLFPNAR+SLWIDGKLEL+VDPYQ
Sbjct  320   GLDESKKIGVWRIVVAHNLPYTDGRRNGKIPKLLTHRLFPNARFSLWIDGKLELIVDPYQ  379

Query  1644  ILER-------FLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEG  1802
             ILER       FLWR+NA+FAISRHYKRFDVF+EAEANKAAGK+DNASI+FQV FYKKEG
Sbjct  380   ILERYFRILSRFLWRKNATFAISRHYKRFDVFDEAEANKAAGKYDNASINFQVNFYKKEG  439

Query  1803  LTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRS  1982
             LTP+S AK PITSDVPEGCVIIREH+P+SNLFTCLWFNEVD FT RDQISFSTVRDKI +
Sbjct  440   LTPYSEAKLPITSDVPEGCVIIREHVPMSNLFTCLWFNEVDLFTSRDQISFSTVRDKIAA  499

Query  1983  RTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             +TNW + MFLDCERRNFVVQ YH+D+L H A
Sbjct  500   KTNWTLNMFLDCERRNFVVQKYHKDVLAHMA  530



>ref|XP_004294016.1| PREDICTED: uncharacterized protein LOC101293376 [Fragaria vesca 
subsp. vesca]
Length=588

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/489 (69%), Positives = 389/489 (80%), Gaps = 18/489 (4%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTI  797
             RKP K  KEKE  +H I KFA RKKVG+LLLC +SAAVF WVLYVGKGED + G     I
Sbjct  45    RKPSKMLKEKERLYHSICKFAGRKKVGMLLLCVISAAVFGWVLYVGKGEDPQEGITRQNI  104

Query  798   SISATMKDRE-YSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNP  974
             S++ ++  R   S+   EK + + +L   P                  +F GYTLPPG+P
Sbjct  105   SLNNSIVIRNPESLAQTEKQSYNVSLALPPPPP--------------AFFLGYTLPPGHP  150

Query  975   CEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsene  1151
             C  FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PS+SP+L  L YI+EE LS   
Sbjct  151   CNIFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSYSPILKNLTYIYEENLSRET  210

Query  1152  fggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGV  1328
               G    GGYP+L+QR++SYDIRESMSVHCGFV+G KPGR T +D+D+ DL +ME C GV
Sbjct  211   EFGGSDFGGYPTLKQRNDSYDIRESMSVHCGFVRGSKPGRNTGYDMDEDDLHDMEQCHGV  270

Query  1329  VVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVV  1508
             VVASAIF  FD I+QP+NIS+Y+R+ VCFYMF+DE TEA+L+NSG L+SS +IG+WR VV
Sbjct  271   VVASAIFANFDEINQPRNISDYSRQTVCFYMFIDEVTEAYLKNSGKLDSSKKIGIWRTVV  330

Query  1509  VHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAI  1688
             +H+ PY D RR GKIPKLL+HR+FPNAR+SLWIDGKLELVVDPYQILERFLWR+NA+FAI
Sbjct  331   IHNPPYKDGRRTGKIPKLLVHRMFPNARFSLWIDGKLELVVDPYQILERFLWRKNATFAI  390

Query  1689  SRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVII  1868
             SRHYKRFDVF EAEANK AGK+DNASIDFQVEFYKKEGLTP+S AK PITSDVPEGCVII
Sbjct  391   SRHYKRFDVFMEAEANKVAGKYDNASIDFQVEFYKKEGLTPYSEAKLPITSDVPEGCVII  450

Query  1869  REHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGY  2048
             REH+PISNLFTCLWFNEVDRFT RDQISFSTVRD I  +TNW + MF DCERRNFVVQ Y
Sbjct  451   REHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDHITEKTNWTINMFFDCERRNFVVQKY  510

Query  2049  HRDILEHRA  2075
             H+D+LEH A
Sbjct  511   HKDVLEHMA  519



>ref|XP_010052305.1| PREDICTED: uncharacterized protein LOC104441010 isoform X2 [Eucalyptus 
grandis]
 gb|KCW76238.1| hypothetical protein EUGRSUZ_D00618 [Eucalyptus grandis]
Length=598

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/489 (71%), Positives = 389/489 (80%), Gaps = 11/489 (2%)
 Frame = +3

Query  633   KTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISAT  812
             K  KEKE  FH I KFA RKKVG+L LC +SAAVF WV+YVG G+    P++    +  T
Sbjct  46    KMPKEKERLFHWIMKFAGRKKVGMLFLCLISAAVFGWVMYVGNGKGEDAPDVDNSFVRFT  105

Query  813   MKDREYS------IEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNP  974
               +   S      I  E+ +N     L   +   G      PPP P+ +F GYTLP G+ 
Sbjct  106   NNNMTISNPVSSPINGEQISN--DASLVDRDGRDGNKIMPLPPP-PQTFFLGYTLPQGHQ  162

Query  975   CEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLs-en  1148
             C  FTLPPPPADKKRTGPRPCPVCYLPVEEAI LMP  PS SPV+  L Y++EE LS + 
Sbjct  163   CNSFTLPPPPADKKRTGPRPCPVCYLPVEEAIDLMPKDPSPSPVVKDLTYVYEENLSRDG  222

Query  1149  efggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGV  1328
             EFGGS FGGYP+LRQR++SYDIRESM+VHCGFVKG KPGR T FD+D+ DL EME C GV
Sbjct  223   EFGGSEFGGYPTLRQRNDSYDIRESMTVHCGFVKGSKPGRQTGFDMDESDLLEMEQCRGV  282

Query  1329  VVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVV  1508
             VVASAIFG FD I QP NISEYAR+NVCFYMFVDE TE FL+N+  ++ + R GLWRIVV
Sbjct  283   VVASAIFGNFDEIQQPTNISEYARKNVCFYMFVDEETEGFLKNASAIDENKRSGLWRIVV  342

Query  1509  VHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAI  1688
             VH+LPY D RR GKIPKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLWR+NA+FAI
Sbjct  343   VHNLPYPDPRRTGKIPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLWRKNATFAI  402

Query  1689  SRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVII  1868
             SRHY+RFDVF EAEANKAAGK++NASIDFQV+FYKKEGLTP+S AK PITSDVPEGCVII
Sbjct  403   SRHYRRFDVFTEAEANKAAGKYNNASIDFQVDFYKKEGLTPYSDAKLPITSDVPEGCVII  462

Query  1869  REHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGY  2048
             REHIPISNLFTCLWFNEVDRFT RDQISFSTVRDKI S+TNW + MFLDCERRNFVVQ Y
Sbjct  463   REHIPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIASKTNWTINMFLDCERRNFVVQKY  522

Query  2049  HRDILEHRA  2075
             HRD+L+H A
Sbjct  523   HRDVLDHMA  531



>ref|XP_011027827.1| PREDICTED: uncharacterized protein LOC105128029 isoform X3 [Populus 
euphratica]
Length=507

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/476 (70%), Positives = 379/476 (80%), Gaps = 17/476 (4%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTIS  800
             KP K FKEKE  FH I KFA RKKVG+L LC +SAAVFVWVLYVGKGEDA+ G   P IS
Sbjct  45    KPAKMFKEKESLFHWIVKFAGRKKVGMLFLCVISAAVFVWVLYVGKGEDAQEGDHPPNIS  104

Query  801   ISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCE  980
             ++A++                  +  K +  +GI S    PP P  YF GYTLPPG+PC 
Sbjct  105   VNASVS--------------LSRIENKTSFLQGIISDISLPPPPPAYFLGYTLPPGHPCN  150

Query  981   GFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefg  1157
              FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PSFSPV+  L YI+E+ LS     
Sbjct  151   SFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSFSPVIKNLTYIYEDPLSGERDF  210

Query  1158  gsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVV  1334
             G    GGYP+L+ R +SYDIRESMSVHCGFV+G +PG+ T FD+D+ DL  M+ C GVVV
Sbjct  211   GGSDFGGYPTLKHRSDSYDIRESMSVHCGFVQGKRPGQNTGFDMDEIDLEAMDQCHGVVV  270

Query  1335  ASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVH  1514
             ASAIFGAFD I QP NISEY++  VCF+MFVDE TEA+L+N+  L+ S +IGLWRIVVVH
Sbjct  271   ASAIFGAFDDIQQPHNISEYSKNTVCFFMFVDEETEAYLKNNSGLDDSRKIGLWRIVVVH  330

Query  1515  DLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISR  1694
             +LPY D RRNGK+PKLL HR+FPNAR+SLWIDGKLEL+VDPYQILER LWR+NA+FAISR
Sbjct  331   NLPYADGRRNGKVPKLLSHRMFPNARFSLWIDGKLELIVDPYQILERHLWRKNATFAISR  390

Query  1695  HYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIRE  1874
             HY+RFDVF EAEANKAAGK++NASIDFQVEFYKKEGLTP+S AK PITSDVPEGCV+IRE
Sbjct  391   HYRRFDVFMEAEANKAAGKYENASIDFQVEFYKKEGLTPYSEAKLPITSDVPEGCVVIRE  450

Query  1875  HIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             H+ ISNLFTCLWFNEVDRFT RDQISFS VRDKI  +TNW V MFLDCERRNFVVQ
Sbjct  451   HVAISNLFTCLWFNEVDRFTSRDQISFSIVRDKIHEKTNWTVNMFLDCERRNFVVQ  506



>ref|XP_011027826.1| PREDICTED: uncharacterized protein LOC105128029 isoform X2 [Populus 
euphratica]
Length=542

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/476 (71%), Positives = 381/476 (80%), Gaps = 17/476 (4%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTIS  800
             KP K FKEKE  FH I KFA RKKVG+L LC +SAAVFVWVLYVGKGEDA+ G   P IS
Sbjct  45    KPAKMFKEKESLFHWIVKFAGRKKVGMLFLCVISAAVFVWVLYVGKGEDAQEGDHPPNIS  104

Query  801   ISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCE  980
             ++A++     S+   E          K +  +GI S    PP P  YF GYTLPPG+PC 
Sbjct  105   VNASV-----SLSRIEN---------KTSFLQGIISDISLPPPPPAYFLGYTLPPGHPCN  150

Query  981   GFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefg  1157
              FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PSFSPV+  L YI+E+ LS     
Sbjct  151   SFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSFSPVIKNLTYIYEDPLSGERDF  210

Query  1158  gsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVV  1334
             G    GGYP+L+ R +SYDIRESMSVHCGFV+G +PG+ T FD+D+ DL  M+ C GVVV
Sbjct  211   GGSDFGGYPTLKHRSDSYDIRESMSVHCGFVQGKRPGQNTGFDMDEIDLEAMDQCHGVVV  270

Query  1335  ASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVH  1514
             ASAIFGAFD I QP NISEY++  VCF+MFVDE TEA+L+N+  L+ S +IGLWRIVVVH
Sbjct  271   ASAIFGAFDDIQQPHNISEYSKNTVCFFMFVDEETEAYLKNNSGLDDSRKIGLWRIVVVH  330

Query  1515  DLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISR  1694
             +LPY D RRNGK+PKLL HR+FPNAR+SLWIDGKLEL+VDPYQILER LWR+NA+FAISR
Sbjct  331   NLPYADGRRNGKVPKLLSHRMFPNARFSLWIDGKLELIVDPYQILERHLWRKNATFAISR  390

Query  1695  HYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIRE  1874
             HY+RFDVF EAEANKAAGK++NASIDFQVEFYKKEGLTP+S AK PITSDVPEGCV+IRE
Sbjct  391   HYRRFDVFMEAEANKAAGKYENASIDFQVEFYKKEGLTPYSEAKLPITSDVPEGCVVIRE  450

Query  1875  HIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             H+ ISNLFTCLWFNEVDRFT RDQISFS VRDKI  +TNW V MFLDCERRNFVVQ
Sbjct  451   HVAISNLFTCLWFNEVDRFTSRDQISFSIVRDKIHEKTNWTVNMFLDCERRNFVVQ  506



>ref|XP_004146603.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101209711 
[Cucumis sativus]
Length=581

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/493 (69%), Positives = 391/493 (79%), Gaps = 15/493 (3%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTI  797
             RKP K  KEK+  F  I KF  RKKVG+LLLC VSAAVF+WVLYVGKGED R G  I  +
Sbjct  31    RKPSKMMKEKDYLFPWICKFVGRKKVGMLLLCVVSAAVFLWVLYVGKGEDTREGQHIQRV  90

Query  798   SI--SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFT---GYTLP  962
             SI  S  M  RE S E    N+   + +AK     GI ++   PP P        GYTLP
Sbjct  91    SINNSIVMTFRESSAEDIMDNS--SSSMAK-----GIETSSLAPPPPPPPPASALGYTLP  143

Query  963   PGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETL  1139
             PG+PC  F LPPPPADKKRTGPRPCPVCYLPVEEA+ALMP A S SPVL  L+YI+EE L
Sbjct  144   PGHPCNNFALPPPPADKKRTGPRPCPVCYLPVEEAVALMPNASSDSPVLKKLDYIYEENL  203

Query  1140  senefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEA  1316
                   G    GGYP++ QR +S+DIRESM VHCGFV G+KPGR T FDI+D DL +ME 
Sbjct  204   RRETEFGGSDFGGYPTIAQRTDSFDIRESMRVHCGFVGGIKPGRNTGFDINDDDLHDMEQ  263

Query  1317  CEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLW  1496
             C GVVVASAIFG FD+I+QP NISEYA+  VCF+MF+DE TEA L+ +G L SS +IGLW
Sbjct  264   CRGVVVASAIFGNFDVINQPTNISEYAKNTVCFFMFIDEETEASLKETGILESSKKIGLW  323

Query  1497  RIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNA  1676
             RI+VVH+LPY DARR GKIPKLL+HR+FPNARYSLWIDGKLELVVDPYQ+LERFLWR+NA
Sbjct  324   RIIVVHNLPYKDARRTGKIPKLLVHRMFPNARYSLWIDGKLELVVDPYQLLERFLWRKNA  383

Query  1677  SFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEG  1856
             +FAIS+HYKRFDVF EA+ANKAAGK+DNASIDFQ++FY KEGLTP+S AK PITSDVPEG
Sbjct  384   TFAISKHYKRFDVFMEADANKAAGKYDNASIDFQIDFYVKEGLTPYSEAKLPITSDVPEG  443

Query  1857  CVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFV  2036
             CVI+REH+PISNLF+CLWFNEVDRFT RDQISF+TVRDKI ++TNW + MFLDCERRNFV
Sbjct  444   CVILREHVPISNLFSCLWFNEVDRFTSRDQISFATVRDKIMAKTNWTINMFLDCERRNFV  503

Query  2037  VQGYHRDILEHRA  2075
             +Q YHRD+LE +A
Sbjct  504   IQKYHRDVLEQKA  516



>ref|XP_009352913.1| PREDICTED: uncharacterized protein LOC103944205 [Pyrus x bretschneideri]
Length=590

 Score =   675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/504 (68%), Positives = 392/504 (78%), Gaps = 15/504 (3%)
 Frame = +3

Query  579   QQHHFLSSSFPIPP----RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWV  746
             Q H+ ++S   + P    RKP K  KEKE  FH I KFA RKKVG+LLLC +SAAVFVWV
Sbjct  19    QLHNNINSINGVLPIQSARKPSKMLKEKERLFHWICKFAGRKKVGMLLLCLISAAVFVWV  78

Query  747   LYVGKGEDARGPEIPTI-SISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPP  923
             LYVGKGED  G ++  + +IS          E   K+        + NN   + +   PP
Sbjct  79    LYVGKGED--GQDVVNVGNISVNNSITSSFSESSRKHG------PQSNNMTFLLALPPPP  130

Query  924   PLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSP  1103
             P P   F GYTLPPG+PC  FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PS+SP
Sbjct  131   PPPPAVFLGYTLPPGHPCNTFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSYSP  190

Query  1104  VLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATS  1277
             VL  L YI+EE LS     G    GGYP+L+QR +SYDIRESMSVHCGFV+G KPGR T 
Sbjct  191   VLKNLTYIYEENLSRKTEFGGSEFGGYPTLKQRSDSYDIRESMSVHCGFVRGSKPGRNTG  250

Query  1278  FDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRN  1457
             +D+D+ DL +ME C GVVVASAIFG FD I+QP+ IS+Y++E VCFYMF+D+ TE +LR 
Sbjct  251   YDLDEIDLNDMEQCNGVVVASAIFGNFDEINQPRKISDYSKETVCFYMFIDDVTETYLRT  310

Query  1458  SGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDP  1637
             SG + S  ++G+WR VVVH+ PYTD RR GKIPKLL+HR+FPNAR+SLWIDGKLELVVDP
Sbjct  311   SGKMGSDRKVGIWRTVVVHNPPYTDGRRTGKIPKLLVHRMFPNARFSLWIDGKLELVVDP  370

Query  1638  YQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFS  1817
             YQILERFLWR+NA+FAISRHYKRFDVF EAEANKAAGK+DNASIDFQVEFYKKEGLTP+S
Sbjct  371   YQILERFLWRKNATFAISRHYKRFDVFTEAEANKAAGKYDNASIDFQVEFYKKEGLTPYS  430

Query  1818  AAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWN  1997
               K PITSDVPEGCVIIREH+PISNL  CLWF+EVDRFT RDQISFSTVRD IR +TNW 
Sbjct  431   EEKLPITSDVPEGCVIIREHVPISNLAACLWFHEVDRFTSRDQISFSTVRDHIREKTNWT  490

Query  1998  VEMFLDCERRNFVVQGYHRDILEH  2069
             + MF DCERRNFVVQ YHRD+LEH
Sbjct  491   INMFYDCERRNFVVQKYHRDVLEH  514



>ref|XP_010052304.1| PREDICTED: uncharacterized protein LOC104441010 isoform X1 [Eucalyptus 
grandis]
Length=602

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/492 (71%), Positives = 390/492 (79%), Gaps = 19/492 (4%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKG------EDARGPEIPTISI  803
             KEKE  FH I KFA RKKVG+L LC +SAAVF WV+YVG G      EDA  P++    +
Sbjct  49    KEKERLFHWIMKFAGRKKVGMLFLCLISAAVFGWVMYVGNGKALFSGEDA--PDVDNSFV  106

Query  804   SATMKDREYS------IEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPP  965
               T  +   S      I  E+ +N     L   +   G      PPP P+ +F GYTLP 
Sbjct  107   RFTNNNMTISNPVSSPINGEQISN--DASLVDRDGRDGNKIMPLPPP-PQTFFLGYTLPQ  163

Query  966   GNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLs  1142
             G+ C  FTLPPPPADKKRTGPRPCPVCYLPVEEAI LMP  PS SPV+  L Y++EE LS
Sbjct  164   GHQCNSFTLPPPPADKKRTGPRPCPVCYLPVEEAIDLMPKDPSPSPVVKDLTYVYEENLS  223

Query  1143  -enefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEAC  1319
              + EFGGS FGGYP+LRQR++SYDIRESM+VHCGFVKG KPGR T FD+D+ DL EME C
Sbjct  224   RDGEFGGSEFGGYPTLRQRNDSYDIRESMTVHCGFVKGSKPGRQTGFDMDESDLLEMEQC  283

Query  1320  EGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWR  1499
              GVVVASAIFG FD I QP NISEYAR+NVCFYMFVDE TE FL+N+  ++ + R GLWR
Sbjct  284   RGVVVASAIFGNFDEIQQPTNISEYARKNVCFYMFVDEETEGFLKNASAIDENKRSGLWR  343

Query  1500  IVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNAS  1679
             IVVVH+LPY D RR GKIPKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLWR+NA+
Sbjct  344   IVVVHNLPYPDPRRTGKIPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLWRKNAT  403

Query  1680  FAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGC  1859
             FAISRHY+RFDVF EAEANKAAGK++NASIDFQV+FYKKEGLTP+S AK PITSDVPEGC
Sbjct  404   FAISRHYRRFDVFTEAEANKAAGKYNNASIDFQVDFYKKEGLTPYSDAKLPITSDVPEGC  463

Query  1860  VIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVV  2039
             VIIREHIPISNLFTCLWFNEVDRFT RDQISFSTVRDKI S+TNW + MFLDCERRNFVV
Sbjct  464   VIIREHIPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIASKTNWTINMFLDCERRNFVV  523

Query  2040  QGYHRDILEHRA  2075
             Q YHRD+L+H A
Sbjct  524   QKYHRDVLDHMA  535



>gb|KHG15813.1| Protein strawberry notch 2 [Gossypium arboreum]
Length=599

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/516 (66%), Positives = 397/516 (77%), Gaps = 18/516 (3%)
 Frame = +3

Query  579   QQHHFLSSSFPIPPR-KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYV  755
             Q    L    P+  R KP K FKEKE   H I K A RKKVG+LLL  +SAAVFVWV+YV
Sbjct  21    QNSVLLPIQVPLATRSKPSKVFKEKETLVHWICKLAGRKKVGMLLLSVISAAVFVWVVYV  80

Query  756   GKGEDARGPEIPTISISATMKDREYSI--EPEEKNNIHKTLLAKPNNNRGIASTDQPPPL  929
             GKGE      +  ++ S  + +  + +  E +     + T L   ++  G      PPP 
Sbjct  81    GKGEYQDSDNVRKVNDSLPINNSGFPLIYEVQSVKIDNWTSLVASDSVEGTEVRKMPPPP  140

Query  930   PRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL  1109
             P  YF GYTLPPG+PC  F+LPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PSFSP+L
Sbjct  141   PS-YFLGYTLPPGHPCYTFSLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSFSPIL  199

Query  1110  Y-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFD  1283
               L YI+EE L++++  G    GGYP+L+QRD+SYDIRESM++ CGFVKG KPGR + FD
Sbjct  200   KNLTYIYEENLNKDKEFGGSDFGGYPTLKQRDDSYDIRESMNLRCGFVKGSKPGRGSGFD  259

Query  1284  IDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSG  1463
             I+D DL +ME C GVVVASAIFGAFD+I QPKNISEY+++ +CFYMFVDE TEA L+ + 
Sbjct  260   INDDDLLKMEQCHGVVVASAIFGAFDIIQQPKNISEYSKQTICFYMFVDEETEADLKLNS  319

Query  1464  DLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQ  1643
              L+ S +IG+WRIVV H+LPYTD RRNGKIPKLL HRLFPNAR+SLWIDGKLEL+VDPYQ
Sbjct  320   GLDESKKIGVWRIVVAHNLPYTDGRRNGKIPKLLTHRLFPNARFSLWIDGKLELIVDPYQ  379

Query  1644  ILE-------RFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEG  1802
             ILE       RFLWR+NA+FAISRHYKRFDVF+EAEANKAAGK+DNASI+FQV FYKKEG
Sbjct  380   ILERYFRILSRFLWRKNATFAISRHYKRFDVFDEAEANKAAGKYDNASINFQVNFYKKEG  439

Query  1803  LTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRS  1982
             LTP+S AK PITSDVPEGCVIIREH+P+SNLFTCLWFNEVD FT RDQISFSTVRDKI +
Sbjct  440   LTPYSEAKLPITSDVPEGCVIIREHVPMSNLFTCLWFNEVDLFTSRDQISFSTVRDKIAA  499

Query  1983  RTNWNVEMFLDCERRNFVVQ-----GYHRDILEHRA  2075
             +TNW + MFLDCERRNFVVQ      YH+D+L H A
Sbjct  500   KTNWTLNMFLDCERRNFVVQVFIFSKYHKDVLAHMA  535



>ref|XP_002270005.2| PREDICTED: uncharacterized protein LOC100256311 [Vitis vinifera]
Length=618

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/505 (70%), Positives = 399/505 (79%), Gaps = 18/505 (4%)
 Frame = +3

Query  609   PIPP--------RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKG  764
             P+PP        RKP K  KEKE + H I KFA RKKVG+LLLC VSAAVFVWVLYVGKG
Sbjct  38    PLPPPLPGYSLGRKPPKMVKEKERFVHWICKFAGRKKVGMLLLCVVSAAVFVWVLYVGKG  97

Query  765   EDARGPEIPTIS------ISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPP  926
             EDAR  E+ ++         A +  + +S    +   ++ +   +  +         PPP
Sbjct  98    EDAR--EVDSVGKLGANGSPAFVYTKSFSTRSLDLYRMNNSSFVRSESVAQPPPPPPPPP  155

Query  927   LPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPV  1106
              P   F GY LPPG+PCE F LPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PS SP+
Sbjct  156   PPAPVFLGYNLPPGHPCENFALPPPPADKKRTGPRPCPVCYLPVEEAIALMPKYPSPSPL  215

Query  1107  LY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSF  1280
             L  L +++EE L++ +  G    GGYPSL QR  SYDIRESM+VHCGFV+G KPG+ T F
Sbjct  216   LNNLTFVYEENLTKGDSFGGSDFGGYPSLDQRANSYDIRESMTVHCGFVRGAKPGQRTGF  275

Query  1281  DIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNS  1460
             ++DD DL EME C GVVVASAIFG +D+I QPKNIS+ A+ENVCFYMFVDE TEA L+NS
Sbjct  276   NMDDSDLFEMEQCHGVVVASAIFGNYDVIQQPKNISDAAKENVCFYMFVDEETEAHLKNS  335

Query  1461  GDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPY  1640
               L+ + R+GLWRIVVVH+LPY DARRNGK+PKLLLHR+FPNARYSLWIDGKLELVVDP+
Sbjct  336   SGLDDNKRVGLWRIVVVHNLPYNDARRNGKVPKLLLHRMFPNARYSLWIDGKLELVVDPF  395

Query  1641  QILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSA  1820
             QILERFLWR+NASFAISRHY+RFDVF EAEANKAA K+DNASIDFQVEFYK EGLTP+S 
Sbjct  396   QILERFLWRKNASFAISRHYRRFDVFVEAEANKAAAKYDNASIDFQVEFYKSEGLTPYSE  455

Query  1821  AKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNV  2000
             AK PITSDVPEGCVI+REHIPISNLFTCLWFNEVDRFT RDQISFSTVRDKIR++TNW V
Sbjct  456   AKLPITSDVPEGCVIVREHIPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIRAKTNWTV  515

Query  2001  EMFLDCERRNFVVQGYHRDILEHRA  2075
              MFLDCERRNFVVQGYHRD+LEH A
Sbjct  516   NMFLDCERRNFVVQGYHRDVLEHMA  540



>ref|XP_006467795.1| PREDICTED: uncharacterized protein LOC102625961 [Citrus sinensis]
Length=618

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/501 (68%), Positives = 390/501 (78%), Gaps = 25/501 (5%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTIS  800
             KP K FKEKEG  + I KFA RKKVG+LLLC +SAAVF+WVLYVGKGEDA+ G ++P + 
Sbjct  38    KPSKMFKEKEGLLYWICKFAGRKKVGMLLLCVISAAVFLWVLYVGKGEDAQEGDQVPNLR  97

Query  801   ISATMKDREYSIEP------------------EEKNNIHKTLLA--KPNNNRGIASTDQP  920
             ++ ++        P                  E +N+I  ++ A  K  + R I ST  P
Sbjct  98    LNDSLSINYSESSPIYREQTKKMYNETSFNNIESQNSIANSVEAMDKMVSVRPIESTVFP  157

Query  921   PPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFS  1100
             PP P  YF GYTLPPG+PC  FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PSFS
Sbjct  158   PPPPS-YFLGYTLPPGHPCNSFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSFS  216

Query  1101  PVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRAT  1274
             PVL  L YI E  L+     G    GGYP L QR+ SYDIRESMSVHCGFVKG KPGR T
Sbjct  217   PVLKNLTYITEPVLNREAEFGGSDFGGYPPLAQRNNSYDIRESMSVHCGFVKG-KPGRGT  275

Query  1275  SFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLR  1454
              +D+D++D+ +ME C G+VV SAIFGAFD I+QP NISEY+R+ VCF MFVDE TEA+L+
Sbjct  276   GYDLDEEDILDMEQCHGIVVVSAIFGAFDDINQPSNISEYSRKTVCFVMFVDEETEAYLK  335

Query  1455  NSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVD  1634
              +  L+ + +IG+WRIVV+H+ PY+DARR GKIPKLL HRLFPNAR+SLWIDGKLELVVD
Sbjct  336   ANSGLDRTKKIGIWRIVVIHNPPYSDARRTGKIPKLLAHRLFPNARFSLWIDGKLELVVD  395

Query  1635  PYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF  1814
             PYQILER LWR+NA+FAISRHYKRFDV  EAEANKAA K+DNASIDFQ+EFYK EGLTP+
Sbjct  396   PYQILERHLWRKNATFAISRHYKRFDVLVEAEANKAAKKYDNASIDFQIEFYKNEGLTPY  455

Query  1815  SAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNW  1994
             S AK PITSDVPEGCVIIREH+PISNLF CLWFNEVDRFT RDQISFSTVRDK+ ++TNW
Sbjct  456   SEAKLPITSDVPEGCVIIREHVPISNLFVCLWFNEVDRFTSRDQISFSTVRDKLWAKTNW  515

Query  1995  NVEMFLDCERRNFVVQGYHRD  2057
              V MFLDCERRNFVVQ YHRD
Sbjct  516   TVNMFLDCERRNFVVQKYHRD  536



>gb|KGN64680.1| hypothetical protein Csa_1G073870 [Cucumis sativus]
Length=609

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/516 (67%), Positives = 394/516 (76%), Gaps = 33/516 (6%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTI  797
             RKP K  KEK+  F  I KF  RKKVG+LLLC VSAAVF+WVLYVGKGED R G  I  +
Sbjct  31    RKPSKMMKEKDYLFPWICKFVGRKKVGMLLLCVVSAAVFLWVLYVGKGEDTREGQHIQRV  90

Query  798   SI--SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIA----------------------  905
             SI  S  M  RE S E    N+   + +AK      +A                      
Sbjct  91    SINNSIVMTFRESSAEDIMDNS--SSSMAKGIETSSLAPPPPPPPPPPPPPPPPALFLGY  148

Query  906   ----STDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIA  1073
                     PPP P   F GYTLPPG+PC  F LPPPPADKKRTGPRPCPVCYLPVEEA+A
Sbjct  149   TLPPGHPPPPPPPPALFLGYTLPPGHPCNNFALPPPPADKKRTGPRPCPVCYLPVEEAVA  208

Query  1074  LMPTAPSFSPVL-YLNYIHEETLsenef-ggsgfggYPSLRQRDESYDIRESMSVHCGFV  1247
             LMP A S SPVL  L+YI+EE L      GGS FGGYP++ QR +S+DIRESM VHCGFV
Sbjct  209   LMPNASSDSPVLKKLDYIYEENLRRETEFGGSDFGGYPTIAQRTDSFDIRESMRVHCGFV  268

Query  1248  KGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFV  1427
              G+KPGR T FDI+D DL +ME C GVVVASAIFG FD+I+QP NISEYA+  VCF+MF+
Sbjct  269   GGIKPGRNTGFDINDDDLHDMEQCRGVVVASAIFGNFDVINQPTNISEYAKNTVCFFMFI  328

Query  1428  DEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWI  1607
             DE TEA L+ +G L SS +IGLWRI+VVH+LPY DARR GKIPKLL+HR+FPNARYSLWI
Sbjct  329   DEETEASLKETGILESSKKIGLWRIIVVHNLPYKDARRTGKIPKLLVHRMFPNARYSLWI  388

Query  1608  DGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEF  1787
             DGKLELVVDPYQ+LERFLWR+NA+FAIS+HYKRFDVF EA+ANKAAGK+DNASIDFQ++F
Sbjct  389   DGKLELVVDPYQLLERFLWRKNATFAISKHYKRFDVFMEADANKAAGKYDNASIDFQIDF  448

Query  1788  YKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVR  1967
             Y KEGLTP+S AK PITSDVPEGCVI+REH+PISNLF+CLWFNEVDRFT RDQISF+TVR
Sbjct  449   YVKEGLTPYSEAKLPITSDVPEGCVILREHVPISNLFSCLWFNEVDRFTSRDQISFATVR  508

Query  1968  DKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             DKI ++TNW + MFLDCERRNFV+Q YHRD+LE +A
Sbjct  509   DKIMAKTNWTINMFLDCERRNFVIQKYHRDVLEQKA  544



>ref|XP_008356005.1| PREDICTED: uncharacterized protein LOC103419684 [Malus domestica]
Length=585

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/489 (67%), Positives = 377/489 (77%), Gaps = 16/489 (3%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTIS  800
             RKP K  KEK+  FH IFKFA RKKVG+LLLC +SAAVFVWVLYVGKGED +        
Sbjct  38    RKPSKMLKEKDRLFHWIFKFAGRKKVGMLLLCLISAAVFVWVLYVGKGEDGQDVVNVXNI  97

Query  801   ISATMKDREYSIEPEEK--NNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNP  974
                      +S    +    +I+ T                        F GYTLPPG+P
Sbjct  98    SVNNSIPLSFSESSRQHGAQSINMTFXLALPPPPPAV------------FLGYTLPPGHP  145

Query  975   CEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsene  1151
             C  FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PS+SPVL  L YI+EE LS + 
Sbjct  146   CNTFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSYSPVLKNLTYIYEENLSRDT  205

Query  1152  fggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGV  1328
               G    GGYP+L+QR++SYDIRESMSVHCGFV+G KPGR T +D+D+ DL +ME C GV
Sbjct  206   EFGGSDFGGYPTLKQRNDSYDIRESMSVHCGFVRGSKPGRNTGYDMDEVDLNDMEQCNGV  265

Query  1329  VVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVV  1508
             VVASAIFG FD I+QP+NIS+Y++E VCFYMF+D  TEA+LR SG + S  ++G+WR VV
Sbjct  266   VVASAIFGNFDEINQPRNISDYSKETVCFYMFIDNVTEAYLRTSGKMGSDRKVGIWRTVV  325

Query  1509  VHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAI  1688
             VH+ PYTD RR GKIPKLL+HR+FPNAR+SLWIDGKLELVVDPYQILERFLWR+NA+FAI
Sbjct  326   VHNPPYTDGRRTGKIPKLLVHRMFPNARFSLWIDGKLELVVDPYQILERFLWRKNATFAI  385

Query  1689  SRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVII  1868
             SRHYKRFDVF EAEANKAAGK+DNASIDFQVEFYKKEGLTP+S  K PITSDVPEGCVI+
Sbjct  386   SRHYKRFDVFTEAEANKAAGKYDNASIDFQVEFYKKEGLTPYSEEKLPITSDVPEGCVIL  445

Query  1869  REHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGY  2048
             REH+PISNL  CLWF+EVDRFT RDQISFS VRD IR++TNW + MF DCERRNFVVQ Y
Sbjct  446   REHVPISNLAXCLWFHEVDRFTSRDQISFSIVRDHIRAKTNWTISMFYDCERRNFVVQKY  505

Query  2049  HRDILEHRA  2075
             HRD+ EH A
Sbjct  506   HRDVWEHMA  514



>ref|XP_003545980.1| PREDICTED: uncharacterized protein LOC100792761 [Glycine max]
Length=570

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/488 (68%), Positives = 389/488 (80%), Gaps = 15/488 (3%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTI  797
             RKP KT KEK+ +FH IFKF  RKKVG+L L  +SAAVF+WVLYVGKGED++ G  +   
Sbjct  35    RKPPKTLKEKDRFFHWIFKFTGRKKVGMLFLFTISAAVFIWVLYVGKGEDSQEGNSVHNT  94

Query  798   SISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPC  977
             S++  M   +             +L+A+ N   G  +    PP P  YF GYTLP G+PC
Sbjct  95    SVNGNMSIGD-----------SPSLIARANI-MGFTTISVLPPPPPSYFLGYTLPSGHPC  142

Query  978   EGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenef  1154
               FTLPPPPADKKRTGPRPCPVCYLP++EAIAL+P  PS SPVL  L +I+EETL  +  
Sbjct  143   NSFTLPPPPADKKRTGPRPCPVCYLPMDEAIALVPKFPSPSPVLKNLTFIYEETLIRDGE  202

Query  1155  ggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVV  1331
              G    GG+P+LRQR+ES+DIRESMSVHCGFV+G KPGR T FD+D+ DL EME C GVV
Sbjct  203   FGGSDFGGFPTLRQRNESFDIRESMSVHCGFVRGTKPGRNTGFDMDEDDLLEMEQCHGVV  262

Query  1332  VASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVV  1511
             VASAIFG FD I++P NIS+Y++E VCF MFVDE TE +LR+SG L +S +IGLWRI+V 
Sbjct  263   VASAIFGNFDEINEPTNISDYSKETVCFLMFVDEETEKYLRSSGRLGTSKKIGLWRIIVA  322

Query  1512  HDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAIS  1691
             H+LPYTDARR GKIPKLLLHR+ PNARYS+W+DGKLELVVDPYQILERFLWR+NA+FAIS
Sbjct  323   HNLPYTDARRTGKIPKLLLHRMVPNARYSIWLDGKLELVVDPYQILERFLWRKNATFAIS  382

Query  1692  RHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIR  1871
             +HY+RFDVF EAEANKAAGK+ NASIDFQ++FYK EGLTP++ AK P+ SDVPEGCVI+R
Sbjct  383   KHYRRFDVFVEAEANKAAGKYGNASIDFQIDFYKNEGLTPYTEAKLPLISDVPEGCVIVR  442

Query  1872  EHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYH  2051
             EH+PISNLFTCLWFNEVDRFT RDQISFSTVRDK+ SR +++  MFLDCERRNFVVQ YH
Sbjct  443   EHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKLLSRVDFHFLMFLDCERRNFVVQKYH  502

Query  2052  RDILEHRA  2075
             RDILE  A
Sbjct  503   RDILERLA  510



>gb|KDO75981.1| hypothetical protein CISIN_1g006222mg [Citrus sinensis]
Length=618

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/501 (68%), Positives = 389/501 (78%), Gaps = 25/501 (5%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTIS  800
             KP K FKEKEG  + I KFA RKKVG+LLLC +SAAVF+WVLYVGKGEDA+ G ++P + 
Sbjct  38    KPSKMFKEKEGLLYWICKFAGRKKVGMLLLCVISAAVFLWVLYVGKGEDAQEGDQVPNLR  97

Query  801   ISATMKDREYSIEP------------------EEKNNIHKTLLA--KPNNNRGIASTDQP  920
             ++ ++        P                  E +N+I  ++ A  K  + R I ST  P
Sbjct  98    LNDSLSINYSESSPIYREQTKKMYNETSFNNIESQNSIANSVEAMDKMVSVRPIESTVFP  157

Query  921   PPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFS  1100
             PP P  YF GYTLPPG+PC  FTLPPPPADKKRTGPRPCPVCYLPVEE IALMP  PSFS
Sbjct  158   PPPPS-YFLGYTLPPGHPCNSFTLPPPPADKKRTGPRPCPVCYLPVEEVIALMPKVPSFS  216

Query  1101  PVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRAT  1274
             PVL  L YI E  L+     G    GGYP L QR+ SYDIRESMSVHCGFVKG KPGR T
Sbjct  217   PVLKNLTYITEPVLNREAEFGGSDFGGYPPLAQRNNSYDIRESMSVHCGFVKG-KPGRGT  275

Query  1275  SFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLR  1454
              +D+D++D+ +ME C G+VV SAIFGAFD I+QP NISEY+R+ VCF MFVDE TEA+L+
Sbjct  276   GYDLDEEDILDMEQCHGIVVVSAIFGAFDDINQPSNISEYSRKTVCFVMFVDEETEAYLK  335

Query  1455  NSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVD  1634
              +  L+ + +IG+WRIVV+H+ PY+DARR GKIPKLL HRLFPNAR+SLWIDGKLELVVD
Sbjct  336   ANSGLDRTKKIGIWRIVVIHNPPYSDARRTGKIPKLLAHRLFPNARFSLWIDGKLELVVD  395

Query  1635  PYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF  1814
             PYQILER LWR+NA+FAISRHYKRFDV  EAEANKAA K+DNASIDFQ+EFYK EGLTP+
Sbjct  396   PYQILERHLWRKNATFAISRHYKRFDVLVEAEANKAAKKYDNASIDFQIEFYKNEGLTPY  455

Query  1815  SAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNW  1994
             S AK PITSDVPEGCVIIREH+PISNLF CLWFNEVDRFT RDQISFSTVRDK+ ++TNW
Sbjct  456   SEAKLPITSDVPEGCVIIREHVPISNLFVCLWFNEVDRFTSRDQISFSTVRDKLWAKTNW  515

Query  1995  NVEMFLDCERRNFVVQGYHRD  2057
              V MFLDCERRNFVVQ YHRD
Sbjct  516   TVNMFLDCERRNFVVQKYHRD  536



>gb|KHF99460.1| Protein strawberry notch [Gossypium arboreum]
Length=567

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/479 (70%), Positives = 378/479 (79%), Gaps = 11/479 (2%)
 Frame = +3

Query  633   KTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISAT  812
             K  KEKE   H I KFA RKKVG+LLLC +SAAVFVWV+Y G  ED        ++ +  
Sbjct  40    KMLKEKETLIHWICKFAGRKKVGMLLLCVISAAVFVWVVYFG--EDQENDNSSKVNDNLA  97

Query  813   MKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTL  992
             + +   ++    + + + T L+       +     PPP    YF GYTLPPG+PC  FTL
Sbjct  98    LNNPLINVVQSIRID-NWTSLSVSVKETKVGVMHPPPP---SYFLGYTLPPGHPCNTFTL  153

Query  993   PPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEETLsenefggsgf  1169
             PPPPADKKRTGPRPCPVCYLPVEEA+ALMP  PSFSPV+  L YI EE L+     G   
Sbjct  154   PPPPADKKRTGPRPCPVCYLPVEEAVALMPKVPSFSPVIKILTYIFEENLNRETEFGGSD  213

Query  1170  -ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAI  1346
              GGYP+L+QR++SYDIRESM++HCGFVKG KPGR T FDIDD DL EME C GVVVASAI
Sbjct  214   FGGYPTLKQRNDSYDIRESMNMHCGFVKGRKPGRGTGFDIDDSDLLEMEQCNGVVVASAI  273

Query  1347  FGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPY  1526
             FGAFD+I QP+NISEY+++ VCFYMFVDE TEA LR   +   + +IG+WRIV+V DLPY
Sbjct  274   FGAFDIIQQPRNISEYSKQTVCFYMFVDEETEADLRGKYE---NKKIGVWRIVLVRDLPY  330

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
             TD RRNGKIPKLLLHRLFPNARYSLWIDGKLELV DPYQILERFLWR+NA+ AISRHYKR
Sbjct  331   TDGRRNGKIPKLLLHRLFPNARYSLWIDGKLELVADPYQILERFLWRKNATLAISRHYKR  390

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPI  1886
             FDVF EAEANKAAGK+DNASID QVEFYK+EGLTP+S AK PITSDVPEGCVIIREHIPI
Sbjct  391   FDVFIEAEANKAAGKYDNASIDHQVEFYKREGLTPYSEAKHPITSDVPEGCVIIREHIPI  450

Query  1887  SNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             SNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERRNFV+Q YH+D+L
Sbjct  451   SNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVNMFLDCERRNFVIQKYHKDVL  509



>ref|XP_009340023.1| PREDICTED: uncharacterized protein LOC103932167 [Pyrus x bretschneideri]
 ref|XP_009340084.1| PREDICTED: uncharacterized protein LOC103932167 [Pyrus x bretschneideri]
Length=590

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/493 (68%), Positives = 381/493 (77%), Gaps = 24/493 (5%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGP-EIPTI  797
             RKP K  KEK+  FH I KFA RKKVG+LLLC +SAAVFVWVLYVGKGED +    +  I
Sbjct  38    RKPSKMLKEKDRLFHWICKFAGRKKVGMLLLCLISAAVFVWVLYVGKGEDGQDVVNVGNI  97

Query  798   SISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFT-----GYTLP  962
             S+                NN   +  ++ +   G  S     PL           GYTLP
Sbjct  98    SV----------------NNSITSSFSESSRQHGAQSISMTFPLALPPPPPAAFLGYTLP  141

Query  963   PGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETL  1139
             PG+PC  FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PS+SPVL  L YI+EE L
Sbjct  142   PGHPCNTFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSYSPVLKNLTYIYEENL  201

Query  1140  senefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEA  1316
             S +   G    GGYP+L+QR +SYDIRESMSVHCGFV+G KPGR T +D+D+ DL +ME 
Sbjct  202   SRDTEFGGSDFGGYPTLKQRSDSYDIRESMSVHCGFVRGSKPGRNTGYDLDEVDLNDMEQ  261

Query  1317  CEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLW  1496
             C GVVVASAIFG FD I+QP+NIS+Y++E VCFYMF+D  TEA+LR SG + S  ++G+W
Sbjct  262   CNGVVVASAIFGNFDEINQPRNISDYSKETVCFYMFIDNVTEAYLRTSGKMGSDQKVGIW  321

Query  1497  RIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNA  1676
             R VVVH+ PYTD RR GKIPKLL+HR+FPNAR+SLWIDGKLELVVDPYQILERFLWR+NA
Sbjct  322   RTVVVHNPPYTDGRRTGKIPKLLVHRMFPNARFSLWIDGKLELVVDPYQILERFLWRKNA  381

Query  1677  SFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEG  1856
             +FAISRHYKRFDVF EAEANKAAGK+DNASIDFQVEFYK+EGLTP+S  K PITSDVPEG
Sbjct  382   TFAISRHYKRFDVFTEAEANKAAGKYDNASIDFQVEFYKREGLTPYSEEKLPITSDVPEG  441

Query  1857  CVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFV  2036
             CVIIREH+PISNL  CLWF+EVDRFT RDQISF  VRD IR++TNW + MF DCERRNFV
Sbjct  442   CVIIREHVPISNLAACLWFHEVDRFTSRDQISFCIVRDHIRAKTNWTISMFYDCERRNFV  501

Query  2037  VQGYHRDILEHRA  2075
             VQ YHRD+LEH A
Sbjct  502   VQKYHRDVLEHMA  514



>ref|XP_006449347.1| hypothetical protein CICLE_v10014620mg [Citrus clementina]
 gb|ESR62587.1| hypothetical protein CICLE_v10014620mg [Citrus clementina]
Length=618

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/501 (67%), Positives = 388/501 (77%), Gaps = 25/501 (5%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTIS  800
             KP K FKEKEG  + I KFA RKKVG+LLLC +SAAVF+WVLYVGKGEDA+ G ++P + 
Sbjct  38    KPSKMFKEKEGLVYWICKFAGRKKVGMLLLCVISAAVFLWVLYVGKGEDAQEGDQVPNLR  97

Query  801   ISATMKDREYSIEP------------------EEKNNIHKTL--LAKPNNNRGIASTDQP  920
             ++ ++        P                  E +N+I  ++  + K  + R I ST  P
Sbjct  98    LNDSLSINYSESSPIYREQTKKMYNETSFNNIESQNSIANSVEPMDKMVSVRPIESTVFP  157

Query  921   PPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFS  1100
             PP P  YF GYTLPPG+PC  FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PSFS
Sbjct  158   PPPPS-YFLGYTLPPGHPCNSFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSFS  216

Query  1101  PVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRAT  1274
             PVL  L YI E  L+     G    GGYP L QR+ SYDIRESMSVHCGFVKG KPGR  
Sbjct  217   PVLKNLTYITEPVLNREAEFGGSDFGGYPPLAQRNNSYDIRESMSVHCGFVKG-KPGRGM  275

Query  1275  SFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLR  1454
              +D+D++D+  ME C G+VV SAIFGAFD I+QP NISEY+R+ VCF MFVDE TEA+L+
Sbjct  276   GYDLDEEDILYMEQCHGIVVVSAIFGAFDDINQPSNISEYSRKTVCFVMFVDEETEAYLK  335

Query  1455  NSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVD  1634
              +  L+   +IG+WRIVV+H+ PY+DARR GKIPKLL HRLFPNAR+SLWIDGKLELVVD
Sbjct  336   ANSGLDRMKKIGIWRIVVIHNPPYSDARRTGKIPKLLAHRLFPNARFSLWIDGKLELVVD  395

Query  1635  PYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF  1814
             PYQILER LWR+NA+FAISRHYKRFDVF EAEANKAA K+DNASI+FQ+EFYK EGLTP+
Sbjct  396   PYQILERHLWRKNATFAISRHYKRFDVFVEAEANKAAKKYDNASIEFQIEFYKNEGLTPY  455

Query  1815  SAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNW  1994
             S AK PITSDVPEGCVIIREH+PISNLF CLWFNEVDRFT RDQISFSTVRDK+ ++TNW
Sbjct  456   SEAKLPITSDVPEGCVIIREHVPISNLFVCLWFNEVDRFTSRDQISFSTVRDKLWAKTNW  515

Query  1995  NVEMFLDCERRNFVVQGYHRD  2057
              V MFLDCERRNFVVQ YHRD
Sbjct  516   TVNMFLDCERRNFVVQKYHRD  536



>ref|XP_010549320.1| PREDICTED: uncharacterized protein LOC104820544 [Tarenaya hassleriana]
Length=574

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/482 (67%), Positives = 386/482 (80%), Gaps = 17/482 (4%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR---GPEIPT  794
             K  K  K++EG  H I KFA RKKVG+LLLC +SA VFVWVLYVGKGEDA+   GP+   
Sbjct  36    KQSKMQKDREGIVHWICKFAGRKKVGMLLLCLISAIVFVWVLYVGKGEDAQEVQGPQSLQ  95

Query  795   ISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNP  974
             ++ ++T+ D +      ++++ ++ L +       +      PP P  YF GYTLP G+P
Sbjct  96    LNGNSTVNDLD-----SQQSSYNRNLSS-------VVDISVFPPPPPSYFLGYTLPQGHP  143

Query  975   CEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEETLsene  1151
             C  FTLPPPPADKKRTGPRPCPVCYLPVEEA+ALMP  PSFSPVL  L+YI+E+ +++  
Sbjct  144   CNSFTLPPPPADKKRTGPRPCPVCYLPVEEAVALMPKVPSFSPVLKSLSYIYEQPINKET  203

Query  1152  fggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGV  1328
               G    GGYP+L+QR++S+DI+E+MSVHCGFVKG +PGR T FDID+ DL EME C G+
Sbjct  204   EFGGSEFGGYPTLKQRNDSFDIKETMSVHCGFVKGPQPGRGTGFDIDEADLLEMEQCRGI  263

Query  1329  VVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVV  1508
             VVASA+FGAFD + +P+NIS+ + E  CFYMFVDE T  FL+    LNS+ +IG+WRIVV
Sbjct  264   VVASAVFGAFDDVKEPQNISKQSEETACFYMFVDEETREFLKRERGLNSTKKIGIWRIVV  323

Query  1509  VHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAI  1688
             V +LPY+D RRNGK+PKLL+HRLFPNAR+S+WIDGKLELVVDPYQILERFLWR+NA+FAI
Sbjct  324   VQNLPYSDGRRNGKVPKLLVHRLFPNARFSIWIDGKLELVVDPYQILERFLWRKNATFAI  383

Query  1689  SRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVII  1868
             SRHY+RFDV  EAEANKAAGK+DNASIDFQV FYK EGLTP+S AK PITSDVPEGCVII
Sbjct  384   SRHYRRFDVLVEAEANKAAGKYDNASIDFQVNFYKNEGLTPYSVAKLPITSDVPEGCVII  443

Query  1869  REHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGY  2048
             REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW + MFLDCERRNFV+Q Y
Sbjct  444   REHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKISAKTNWTLNMFLDCERRNFVIQRY  503

Query  2049  HR  2054
             HR
Sbjct  504   HR  505



>ref|XP_010686493.1| PREDICTED: uncharacterized protein LOC104900699 [Beta vulgaris 
subsp. vulgaris]
Length=593

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/486 (69%), Positives = 391/486 (80%), Gaps = 15/486 (3%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPE-IPTI  797
             RKP+K  KEKE  FH + K   RKKVG+L LC  SAAVF+WVLYVGKGED+RG E   +I
Sbjct  45    RKPVKMMKEKERLFHWLCKSIGRKKVGMLFLCLASAAVFIWVLYVGKGEDSRGTEGAASI  104

Query  798   SISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPP-----LPRVYFTGYTLP  962
             +++     R  ++  +           +PNN+   AS +   P      PR YF GY LP
Sbjct  105   TLNNNTSSRIDNLSIKYN---------QPNNSSNPASIESSTPNALQVTPRKYFPGYILP  155

Query  963   PGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLYLNYIHEETLs  1142
             PGNPCE F+LPPPPADKKRTGPRPCPVCYL  E+AI+LMP APS+SPVL L Y++EE  S
Sbjct  156   PGNPCERFSLPPPPADKKRTGPRPCPVCYLDQEQAISLMPDAPSYSPVLNLTYVYEENSS  215

Query  1143  enefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
             + EFGGS FGGYPSL QRD+SYDIRESM VHCGFVKG KPGR T FDIDD DL +ME C 
Sbjct  216   KTEFGGSEFGGYPSLMQRDDSYDIRESMHVHCGFVKGQKPGRGTGFDIDDADLADMEQCN  275

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
             G+VVASAIFG +DL+ QPKN SE A++NVCF+MF+DE TEA ++N+  L+ S ++GLWRI
Sbjct  276   GIVVASAIFGNYDLLQQPKNTSEEAKKNVCFFMFLDEETEAAMKNASILDGSKKVGLWRI  335

Query  1503  VVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASF  1682
             VV+H+LPY D RRNGK+PKLLLHRLFP ARYS+W+DGKL+LV DPY+ILERFLWR+NA+F
Sbjct  336   VVIHNLPYIDPRRNGKVPKLLLHRLFPYARYSIWMDGKLQLVEDPYRILERFLWRQNATF  395

Query  1683  AISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCV  1862
             AISRHY+RFDVF EAEANKAA K+DN+SIDFQ++FYKKEGLTP+S AK PITSDVPEGCV
Sbjct  396   AISRHYRRFDVFVEAEANKAAAKYDNSSIDFQIDFYKKEGLTPYSLAKLPITSDVPEGCV  455

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             I+REH+PIS+LF+CLWFNEVDRFT RDQISFSTVRDKI  + NWNV MFLDCERRNFVVQ
Sbjct  456   ILREHVPISDLFSCLWFNEVDRFTSRDQISFSTVRDKISKQVNWNVSMFLDCERRNFVVQ  515

Query  2043  GYHRDI  2060
             GYH D+
Sbjct  516   GYHMDV  521



>ref|XP_003543045.1| PREDICTED: uncharacterized protein LOC100804922 [Glycine max]
 gb|KHN08520.1| hypothetical protein glysoja_014285 [Glycine soja]
Length=570

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/485 (68%), Positives = 388/485 (80%), Gaps = 15/485 (3%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTI  797
             RKP KT KEK+ +F  IFKFA RKKVG+L L  +SAAVF+WVLYVGK ED++ G  +  I
Sbjct  35    RKPTKTLKEKDRFFLWIFKFAGRKKVGMLCLFTISAAVFIWVLYVGKDEDSQEGNSVHNI  94

Query  798   SISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPC  977
             S++  M     SI       +  +L+A  N  +G  +    PP P  YF GYTLP G+PC
Sbjct  95    SVNGNM-----SI------GVSPSLIAGANI-KGFTTISVLPPPPPSYFLGYTLPSGHPC  142

Query  978   EGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenef  1154
               FTLPPPPADKKRTGPRPCPVCYLPV+EAIALMP  PS SPVL  L +I+EETLS +  
Sbjct  143   NTFTLPPPPADKKRTGPRPCPVCYLPVDEAIALMPKFPSPSPVLKNLAFIYEETLSRDGE  202

Query  1155  ggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVV  1331
              G    GGYP+LRQR+ES+DIRESMSVHCGFV+G KPGR T FD+D+ DL EME C GVV
Sbjct  203   FGGSDFGGYPTLRQRNESFDIRESMSVHCGFVRGTKPGRNTGFDMDEDDLLEMEQCHGVV  262

Query  1332  VASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVV  1511
             VASAIFG FD I++P NIS+Y++E VCF MFVDE TE +LR SG L +  +IGLWRI+V 
Sbjct  263   VASAIFGNFDEINEPTNISDYSKETVCFLMFVDEETEKYLRISGRLGTRKKIGLWRIIVA  322

Query  1512  HDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAIS  1691
             H+LPYTD RR GKIPKLLLHR+ PNA YS+W+DGKLELVVDPYQILERFLWR+NA+FAIS
Sbjct  323   HNLPYTDPRRTGKIPKLLLHRMVPNAHYSIWLDGKLELVVDPYQILERFLWRKNATFAIS  382

Query  1692  RHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIR  1871
             +HY+RFDVF EAEANKAAGK++NASIDFQ+EFYK EGLTP++ AK P+ SDVPEGCVI+R
Sbjct  383   KHYRRFDVFVEAEANKAAGKYENASIDFQIEFYKNEGLTPYTEAKLPLISDVPEGCVIVR  442

Query  1872  EHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYH  2051
             EH+PIS+LFTCLWFNEVDRFT RDQISFSTVRDK+ SR +++  MFLDCERRNFVVQ YH
Sbjct  443   EHVPISDLFTCLWFNEVDRFTSRDQISFSTVRDKLLSRVDFHFLMFLDCERRNFVVQKYH  502

Query  2052  RDILE  2066
             RDILE
Sbjct  503   RDILE  507



>gb|KHG29027.1| hypothetical protein F383_16232 [Gossypium arboreum]
Length=562

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/489 (68%), Positives = 383/489 (78%), Gaps = 11/489 (2%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISI  803
             KP KTFKEKE + H I KFA RKKVG LLLCA+SAA+FVWVLY+GK E      +P   +
Sbjct  36    KPFKTFKEKETFLHWICKFAGRKKVGSLLLCAISAAIFVWVLYLGKDEVQGSYNVPLPKV  95

Query  804   SATM---KDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNP  974
             + ++     R   I   + + IH  L   P +  G   ++ PPP    YF  YTLP  +P
Sbjct  96    NDSLPLNNSRSPLINGLQNSRIH-NLTYSPVDAEG---SEVPPP--PSYFLRYTLPAEHP  149

Query  975   CEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsene  1151
             C  FTLPPPPADKKRTGPRPCPVCYL V+EA+ALMP  PSFSPVL  L YI+EE L++  
Sbjct  150   CNTFTLPPPPADKKRTGPRPCPVCYLSVDEAVALMPKVPSFSPVLKNLTYIYEENLNKET  209

Query  1152  fggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGV  1328
               G    GGYP+L+QRD+SYDIRESM+VHCGFVKG KPG  T FDID+ DL EME C GV
Sbjct  210   EFGGSNFGGYPTLKQRDDSYDIRESMNVHCGFVKGTKPGHETGFDIDNSDLLEMEQCHGV  269

Query  1329  VVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVV  1508
             VVASAIFGAFD + QPKNIS+Y+ + VCFYMFVDE T++ L     LN S +IGLWRIVV
Sbjct  270   VVASAIFGAFDNMLQPKNISKYSEQTVCFYMFVDEETKSDLETEHGLNESKKIGLWRIVV  329

Query  1509  VHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAI  1688
              H+LPYT+  RNGKIPKLLLHRLFPNAR+SLWIDGKL+L+VDPYQILERFLWR+NA+FAI
Sbjct  330   AHNLPYTNGSRNGKIPKLLLHRLFPNARFSLWIDGKLQLLVDPYQILERFLWRKNATFAI  389

Query  1689  SRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVII  1868
             SRHY RFDVFEEAEANKAA K+DNASIDFQV+FYKKEGLTP+S AK PITSDVPEGC II
Sbjct  390   SRHYIRFDVFEEAEANKAAHKYDNASIDFQVDFYKKEGLTPYSEAKLPITSDVPEGCAII  449

Query  1869  REHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGY  2048
             REH+PISNLFTCLWFNE+DRFT RDQ+SFSTVRD++ ++TNW V MFLDCERRNFVVQ +
Sbjct  450   REHVPISNLFTCLWFNEIDRFTSRDQLSFSTVRDRVAAKTNWMVNMFLDCERRNFVVQQH  509

Query  2049  HRDILEHRA  2075
             H+ +L   A
Sbjct  510   HKGVLAMLA  518



>ref|XP_007148158.1| hypothetical protein PHAVU_006G185100g [Phaseolus vulgaris]
 gb|ESW20152.1| hypothetical protein PHAVU_006G185100g [Phaseolus vulgaris]
Length=579

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/490 (68%), Positives = 390/490 (80%), Gaps = 15/490 (3%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEI-PT  794
             RKP K  K+K+ +FH IFKFA RKKVG+L L A+SAAVF+WVLY+GKGED++ G  +   
Sbjct  35    RKPSKMLKDKDRFFHWIFKFAGRKKVGMLFLFAISAAVFIWVLYLGKGEDSQEGNGVHNN  94

Query  795   ISISATMKDREYSIEPEEKNNI-HKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGN  971
             IS++ +M   +        N +   T+L  P       S          YF GY+LPPG+
Sbjct  95    ISLNESMSIVDSPSVISTSNILGFSTILVLPPPPPPPPS----------YFLGYSLPPGH  144

Query  972   PCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsen  1148
             PC  FTLPPPPADKKRTGPRPCPVCYLPV EAIALMP  PS SPVL  L +I+EETLS +
Sbjct  145   PCNSFTLPPPPADKKRTGPRPCPVCYLPVVEAIALMPKLPSPSPVLKNLAFIYEETLSRD  204

Query  1149  efggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
                G    GGYP+LRQR+ES+DIRESMSVHCGFV+G KPGR T FD+D+ DL EME C G
Sbjct  205   GEFGGSDFGGYPTLRQRNESFDIRESMSVHCGFVRGTKPGRNTGFDMDEDDLLEMEQCHG  264

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             +VVASAIFG FD I++PKNIS+Y++E VCF MFVD+ TE +LR+SG L  S +IGLWRI+
Sbjct  265   IVVASAIFGNFDEINEPKNISDYSKETVCFLMFVDDETEKYLRSSGRLGISKKIGLWRII  324

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             V H+LPYTDARR+GKIPKLLLHR+ PNARYS+W+DGKLELVVDPYQILERFLWR+NA+FA
Sbjct  325   VAHNLPYTDARRSGKIPKLLLHRMVPNARYSIWLDGKLELVVDPYQILERFLWRKNATFA  384

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVI  1865
             IS+HYKRFDVF EAEANKAAGK+DNASIDFQ+EFYK EGLTP++ AK P+ SDVPEGCVI
Sbjct  385   ISKHYKRFDVFVEAEANKAAGKYDNASIDFQIEFYKNEGLTPYTEAKLPLISDVPEGCVI  444

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQG  2045
             +REH+PISNLFTCLWFNEVDRFT RDQISFS VRDK+ SR +++  MFLDCERRNFVVQ 
Sbjct  445   VREHVPISNLFTCLWFNEVDRFTSRDQISFSIVRDKLLSRVDFHFLMFLDCERRNFVVQK  504

Query  2046  YHRDILEHRA  2075
             YHRDILE  A
Sbjct  505   YHRDILERLA  514



>ref|XP_007159328.1| hypothetical protein PHAVU_002G228900g [Phaseolus vulgaris]
 gb|ESW31322.1| hypothetical protein PHAVU_002G228900g [Phaseolus vulgaris]
Length=566

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/477 (69%), Positives = 383/477 (80%), Gaps = 17/477 (4%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTISISATMK  818
             KEKE  F  I KFA RKKVG+L LC +SAAVF+WVLYVGKGED++ G  +P+IS +A+M 
Sbjct  36    KEKERLFLWICKFAGRKKVGMLFLCLISAAVFIWVLYVGKGEDSQEGNTVPSISDNASMS  95

Query  819   DREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPP  998
               + + E      +  T                PPP    YF GY LPPG+PC  FTLPP
Sbjct  96    TSDSTSEISTTKAMGLT-----------TKLSSPPP---GYFLGYYLPPGHPCNSFTLPP  141

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLse-nefggsgfg  1172
             PPADKKRTGPRPCPVCYLPVEEAI LMP  PS SPVL  L Y++EE LS   EFGGS FG
Sbjct  142   PPADKKRTGPRPCPVCYLPVEEAIGLMPKFPSPSPVLRNLTYVYEENLSRDGEFGGSEFG  201

Query  1173  gYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFG  1352
             GYP+L+QR++S+DIRESMSVHCGF++G+KPG  T FDID+ DL EME C GVVVASAIFG
Sbjct  202   GYPTLKQRNDSFDIRESMSVHCGFLRGIKPGHKTGFDIDEADLSEMEQCNGVVVASAIFG  261

Query  1353  AFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTD  1532
              FD I++PKN+S+Y+R+ VCF MFVDE TE +L +SG L SS +IGLWRI+V  +LPY D
Sbjct  262   NFDEINEPKNVSDYSRKTVCFLMFVDEETEKYLGSSGRLGSSKKIGLWRIIVARNLPYAD  321

Query  1533  ARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFD  1712
             ARR GKIPKLLLHR+ PNARYS+W+DGKLELVVDPYQILERFLWR+NA+FAIS+HY+RFD
Sbjct  322   ARRTGKIPKLLLHRMVPNARYSIWLDGKLELVVDPYQILERFLWRKNATFAISKHYRRFD  381

Query  1713  VFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISN  1892
             V  EAEANKAAGK++NASIDFQ+EFYKKEGLTP++ AK P+ SDVPEGCVI+REH+PISN
Sbjct  382   VLVEAEANKAAGKYENASIDFQIEFYKKEGLTPYTEAKLPLISDVPEGCVIVREHVPISN  441

Query  1893  LFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             LFTCLWFNEVDRFT RDQISFSTVRDKI SR +++  MFLDCERRNFVVQ YHRD+L
Sbjct  442   LFTCLWFNEVDRFTSRDQISFSTVRDKILSRVDFHFHMFLDCERRNFVVQKYHRDLL  498



>ref|XP_007211416.1| hypothetical protein PRUPE_ppa003865mg [Prunus persica]
 gb|EMJ12615.1| hypothetical protein PRUPE_ppa003865mg [Prunus persica]
Length=543

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/485 (68%), Positives = 365/485 (75%), Gaps = 53/485 (11%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTIS  800
             RKP K  KEKE  FH I KFA RKKVG+L LC +SAAVFVWVLYVGK             
Sbjct  34    RKPSKMLKEKERLFHWICKFAGRKKVGMLFLCLISAAVFVWVLYVGKA------------  81

Query  801   ISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCE  980
                                                    PPP P V F GYTLPPG+PC 
Sbjct  82    --------------------------------------LPPPPPAV-FLGYTLPPGHPCN  102

Query  981   GFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefg  1157
              FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PS SPVL  L YI+EE LS     
Sbjct  103   LFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSDSPVLKNLTYIYEENLSRETEF  162

Query  1158  gsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVV  1334
             G    GGYP+L+QR +SYDIRESMSVHCGFV G KPGR T +D+D+ DL +ME C GVVV
Sbjct  163   GGSDFGGYPTLQQRSDSYDIRESMSVHCGFVGGSKPGRNTGYDMDEVDLHDMEQCHGVVV  222

Query  1335  ASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVH  1514
             ASAIFG FD I+QP NIS+Y++E VCFYMF+DE TEA+LR+SG L S  ++G+WR VVVH
Sbjct  223   ASAIFGNFDEINQPTNISDYSKETVCFYMFIDEVTEAYLRSSGKLGSDRKVGIWRTVVVH  282

Query  1515  DLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISR  1694
             + PYTD RR GKIPKLL+HR+FPNAR+SLWIDGKLELVVDPYQILERFLWR+N +FAIS+
Sbjct  283   NPPYTDGRRTGKIPKLLVHRMFPNARFSLWIDGKLELVVDPYQILERFLWRKNVTFAISK  342

Query  1695  HYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIRE  1874
             HYKRFDVF EAEANKAAGK+ NASIDFQ+EFYKKEGLTP+S AK PI SDVPEGCVIIRE
Sbjct  343   HYKRFDVFTEAEANKAAGKYKNASIDFQIEFYKKEGLTPYSEAKLPIISDVPEGCVIIRE  402

Query  1875  HIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHR  2054
             H+PISNL TCLWFNEVDRFT RDQISFSTVRD IR RTNW + MF DCERRNFVVQ YHR
Sbjct  403   HVPISNLLTCLWFNEVDRFTSRDQISFSTVRDHIRERTNWTINMFYDCERRNFVVQKYHR  462

Query  2055  DILEH  2069
             D+LEH
Sbjct  463   DVLEH  467



>emb|CBI23970.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/480 (71%), Positives = 376/480 (78%), Gaps = 38/480 (8%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMKD  821
             KEKE + H I KFA RKKVG+LLLC VSAAVFVWVLYVGKGEDAR  E+ T         
Sbjct  3     KEKERFVHWICKFAGRKKVGMLLLCVVSAAVFVWVLYVGKGEDAR--EVDTQPPPPPPPP  60

Query  822   REYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPP  1001
                +                                    F GY LPPG+PCE F LPPP
Sbjct  61    PPPA----------------------------------PVFLGYNLPPGHPCENFALPPP  86

Query  1002  PADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgf-gg  1175
             PADKKRTGPRPCPVCYLPVEEAIALMP  PS SP+L  L +++EE L++ +  G    GG
Sbjct  87    PADKKRTGPRPCPVCYLPVEEAIALMPKYPSPSPLLNNLTFVYEENLTKGDSFGGSDFGG  146

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             YPSL QR  SYDIRESM+VHCGFV+G KPG+ T F++DD DL EME C GVVVASAIFG 
Sbjct  147   YPSLDQRANSYDIRESMTVHCGFVRGAKPGQRTGFNMDDSDLFEMEQCHGVVVASAIFGN  206

Query  1356  FDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDA  1535
             +D+I QPKNIS+ A+ENVCFYMFVDE TEA L+NS  L+ + R+GLWRIVVVH+LPY DA
Sbjct  207   YDVIQQPKNISDAAKENVCFYMFVDEETEAHLKNSSGLDDNKRVGLWRIVVVHNLPYNDA  266

Query  1536  RRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDV  1715
             RRNGK+PKLLLHR+FPNARYSLWIDGKLELVVDP+QILERFLWR+NASFAISRHY+RFDV
Sbjct  267   RRNGKVPKLLLHRMFPNARYSLWIDGKLELVVDPFQILERFLWRKNASFAISRHYRRFDV  326

Query  1716  FEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNL  1895
             F EAEANKAA K+DNASIDFQVEFYK EGLTP+S AK PITSDVPEGCVI+REHIPISNL
Sbjct  327   FVEAEANKAAAKYDNASIDFQVEFYKSEGLTPYSEAKLPITSDVPEGCVIVREHIPISNL  386

Query  1896  FTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             FTCLWFNEVDRFT RDQISFSTVRDKIR++TNW V MFLDCERRNFVVQGYHRD+LEH A
Sbjct  387   FTCLWFNEVDRFTSRDQISFSTVRDKIRAKTNWTVNMFLDCERRNFVVQGYHRDVLEHMA  446



>ref|XP_010540448.1| PREDICTED: uncharacterized protein LOC104814215 [Tarenaya hassleriana]
Length=575

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/486 (68%), Positives = 386/486 (79%), Gaps = 24/486 (5%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR---GPEIPT  794
             KP K  K++EG  H I KFA RKKVG+LLLC +SA VFVWVLYVGKGEDAR   GP    
Sbjct  36    KPSKMQKDREGIVHWICKFAGRKKVGMLLLCLISAIVFVWVLYVGKGEDAREVQGPSSLQ  95

Query  795   IS-ISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPP---PLPRVYFTGYTLP  962
             ++ I++T+ D      P+ +         K + NR ++S+       P P  YF GYTLP
Sbjct  96    LNVINSTVND------PDTQ---------KISYNRNLSSSIDISVYPPPPPPYFLGYTLP  140

Query  963   PGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETL  1139
              G+PC  FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP APSFSPVL  L+YI+E+ L
Sbjct  141   QGHPCNSFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKAPSFSPVLKDLSYIYEQPL  200

Query  1140  senefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEA  1316
             ++    G    GGYPSL+QR++S+DI+++MSVHCGFVKG +PGR T FDID+ DL +ME 
Sbjct  201   NKETEFGGSEFGGYPSLKQRNDSFDIKDTMSVHCGFVKGPQPGRGTGFDIDESDLRDMEQ  260

Query  1317  CEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLW  1496
             C G+VVASA+FGAFD + +PK IS+++ E VCFYMFVDE T  FL+    L+ + +IG W
Sbjct  261   CHGIVVASAVFGAFDDVKEPKRISKHSEETVCFYMFVDEETREFLKRERGLDDTKKIGKW  320

Query  1497  RIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNA  1676
             RIVVV +LPY+D RRNGKIPKLL+HRLFPNAR+S+WIDGKLELVVDPYQILERFLWR+NA
Sbjct  321   RIVVVQNLPYSDGRRNGKIPKLLVHRLFPNARFSIWIDGKLELVVDPYQILERFLWRKNA  380

Query  1677  SFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEG  1856
             +FAISRHYKRFDV  EAEANKAAGK+DNASIDFQV FYK EGLTP+S AK PITSDVPEG
Sbjct  381   TFAISRHYKRFDVLVEAEANKAAGKYDNASIDFQVNFYKNEGLTPYSEAKLPITSDVPEG  440

Query  1857  CVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFV  2036
             CVIIREH+PISNLFTCLWFNEVDRFT RDQISFST+RDK+ S+T W + MFLDCERRNFV
Sbjct  441   CVIIREHVPISNLFTCLWFNEVDRFTSRDQISFSTIRDKVTSKTKWTLNMFLDCERRNFV  500

Query  2037  VQGYHR  2054
             VQ YHR
Sbjct  501   VQRYHR  506



>ref|XP_010272447.1| PREDICTED: uncharacterized protein LOC104608221 isoform X1 [Nelumbo 
nucifera]
Length=610

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/506 (65%), Positives = 395/506 (78%), Gaps = 19/506 (4%)
 Frame = +3

Query  615   PPRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVL-YVGKGEDARGPEIP  791
             PP+  L   +EKE + HRI KFA R++VG+LLL  +S  VF+ VL  V K ED       
Sbjct  38    PPKMLLSGSREKEKFLHRICKFAGRRRVGMLLLVVISGVVFMSVLSVVSKDEDTTEGVSH  97

Query  792   TISISATMKDREYSI--------------EPEEKNNIHKTLLAKPNNNR--GIASTDQPP  923
                +S  +K  +                   ++KN+I +  ++    N+         PP
Sbjct  98    HTRMSQNIKQNDSMAIKYPRPSLVHGEQESKKDKNSILQNAISISGQNKMQPPPPPPPPP  157

Query  924   PLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSP  1103
             P P +   G  LPPG+PCE FTLPPPPADKKRTGPRPCPVCYLPVE+AI  MP +PS SP
Sbjct  158   PPPPLIVGGTALPPGHPCEKFTLPPPPADKKRTGPRPCPVCYLPVEQAIVFMPKSPSTSP  217

Query  1104  VLY-LNYIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATS  1277
             VL  L+Y++EE  +    FGGS FGGYPSL+QR++S++I+ESM VHCGF++G KPGR T 
Sbjct  218   VLRNLSYVYEENPIRTEPFGGSEFGGYPSLKQRNDSFNIKESMVVHCGFIRGKKPGRGTG  277

Query  1278  FDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRN  1457
             FDIDD D  EME C+G+VVASAIFG +D++ QPK+IS+ A++N+CFYMFVDEGTEA++RN
Sbjct  278   FDIDDVDFFEMEQCQGIVVASAIFGNYDILQQPKSISDAAKKNICFYMFVDEGTEAYMRN  337

Query  1458  SGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDP  1637
             S  L+SS+++GLWRIVVVH+LPY DARRNGK+PKLLLHR+FPNARYS+WIDGKLELVVDP
Sbjct  338   SSVLDSSNKVGLWRIVVVHNLPYIDARRNGKVPKLLLHRIFPNARYSIWIDGKLELVVDP  397

Query  1638  YQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFS  1817
             YQILERFLWR+ ASFAISRHY+RFDVF+EAEANKAAGK+DNASID+QVEFYK+EGLTP+S
Sbjct  398   YQILERFLWRKKASFAISRHYRRFDVFQEAEANKAAGKYDNASIDYQVEFYKREGLTPYS  457

Query  1818  AAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWN  1997
              AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQISFSTVRDKI S+  W+
Sbjct  458   EAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQISFSTVRDKIMSKVKWS  517

Query  1998  VEMFLDCERRNFVVQGYHRDILEHRA  2075
             + MFLDCERRNFVVQGYHRDILEH A
Sbjct  518   INMFLDCERRNFVVQGYHRDILEHMA  543



>ref|XP_010108182.1| hypothetical protein L484_014507 [Morus notabilis]
 gb|EXC18107.1| hypothetical protein L484_014507 [Morus notabilis]
Length=587

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/487 (67%), Positives = 382/487 (78%), Gaps = 14/487 (3%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTIS  800
             RKP K FKEK+ + H I KFA RK VG+ LLC +S AVF  VLYVGKGED++      I+
Sbjct  32    RKPTKMFKEKDRFVHWIVKFAGRKGVGMFLLCLISTAVFGLVLYVGKGEDSQANPAHNIA  91

Query  801   ISATMKDREYSIEP---EEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGN  971
             I+ T         P   E++N  +           G+ S   PPP P V F GYTLPPG+
Sbjct  92    INNTAGLGFIEFSPTYGEQRNGFYSV---------GVNSVVLPPPPPAV-FLGYTLPPGH  141

Query  972   PCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLYLNYIHEETLsene  1151
             PC  F+LPPPPADKKRTGPRPCPVCYLPVEEA+ALMP  PS SPV  L YI+EE LS   
Sbjct  142   PCNSFSLPPPPADKKRTGPRPCPVCYLPVEEAVALMPKVPSPSPVKNLTYIYEENLSRET  201

Query  1152  fggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGV  1328
               G    GGYP+L  R +SYDIRESMSVHCGFV+G KPGR T FDID+ DL  M+ C GV
Sbjct  202   EFGGSEFGGYPTLAHRADSYDIRESMSVHCGFVRGAKPGRNTGFDIDEIDLLAMDQCHGV  261

Query  1329  VVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVV  1508
             VVASAIFG FD I+QPKNISEY++E VCFYMF+DE TE +++ +G ++S+ +IG+WR++V
Sbjct  262   VVASAIFGNFDEINQPKNISEYSKETVCFYMFIDEITEDYVKKTGAMDSNRKIGVWRVIV  321

Query  1509  VHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAI  1688
             V +LPY D RR GKIPKLL+HRLFPNAR+SLWIDGKLELVVDPYQ+LERFLWR+NA+FAI
Sbjct  322   VRNLPYEDGRRTGKIPKLLMHRLFPNARFSLWIDGKLELVVDPYQVLERFLWRKNATFAI  381

Query  1689  SRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVII  1868
             SRHYKRFDVF EAEANK AGK+DNASIDFQV+FY+KEGLTP++  K PITSDVPEGCVI+
Sbjct  382   SRHYKRFDVFVEAEANKVAGKYDNASIDFQVDFYRKEGLTPYTPEKLPITSDVPEGCVIL  441

Query  1869  REHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGY  2048
             REH+PISNLFTCLWFNEVDRFT RDQISFST RDKIR++TN+ V MFLDCERRNFVVQ Y
Sbjct  442   REHVPISNLFTCLWFNEVDRFTSRDQISFSTARDKIRAKTNYTVNMFLDCERRNFVVQKY  501

Query  2049  HRDILEH  2069
             HR+++E 
Sbjct  502   HREVMEQ  508



>gb|KDO75982.1| hypothetical protein CISIN_1g006222mg [Citrus sinensis]
Length=656

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/496 (68%), Positives = 385/496 (78%), Gaps = 25/496 (5%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTIS  800
             KP K FKEKEG  + I KFA RKKVG+LLLC +SAAVF+WVLYVGKGEDA+ G ++P + 
Sbjct  38    KPSKMFKEKEGLLYWICKFAGRKKVGMLLLCVISAAVFLWVLYVGKGEDAQEGDQVPNLR  97

Query  801   ISATMKDREYSIEP------------------EEKNNIHKTLLA--KPNNNRGIASTDQP  920
             ++ ++        P                  E +N+I  ++ A  K  + R I ST  P
Sbjct  98    LNDSLSINYSESSPIYREQTKKMYNETSFNNIESQNSIANSVEAMDKMVSVRPIESTVFP  157

Query  921   PPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFS  1100
             PP P  YF GYTLPPG+PC  FTLPPPPADKKRTGPRPCPVCYLPVEE IALMP  PSFS
Sbjct  158   PPPPS-YFLGYTLPPGHPCNSFTLPPPPADKKRTGPRPCPVCYLPVEEVIALMPKVPSFS  216

Query  1101  PVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRAT  1274
             PVL  L YI E  L+     G    GGYP L QR+ SYDIRESMSVHCGFVKG KPGR T
Sbjct  217   PVLKNLTYITEPVLNREAEFGGSDFGGYPPLAQRNNSYDIRESMSVHCGFVKG-KPGRGT  275

Query  1275  SFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLR  1454
              +D+D++D+ +ME C G+VV SAIFGAFD I+QP NISEY+R+ VCF MFVDE TEA+L+
Sbjct  276   GYDLDEEDILDMEQCHGIVVVSAIFGAFDDINQPSNISEYSRKTVCFVMFVDEETEAYLK  335

Query  1455  NSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVD  1634
              +  L+ + +IG+WRIVV+H+ PY+DARR GKIPKLL HRLFPNAR+SLWIDGKLELVVD
Sbjct  336   ANSGLDRTKKIGIWRIVVIHNPPYSDARRTGKIPKLLAHRLFPNARFSLWIDGKLELVVD  395

Query  1635  PYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF  1814
             PYQILER LWR+NA+FAISRHYKRFDV  EAEANKAA K+DNASIDFQ+EFYK EGLTP+
Sbjct  396   PYQILERHLWRKNATFAISRHYKRFDVLVEAEANKAAKKYDNASIDFQIEFYKNEGLTPY  455

Query  1815  SAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNW  1994
             S AK PITSDVPEGCVIIREH+PISNLF CLWFNEVDRFT RDQISFSTVRDK+ ++TNW
Sbjct  456   SEAKLPITSDVPEGCVIIREHVPISNLFVCLWFNEVDRFTSRDQISFSTVRDKLWAKTNW  515

Query  1995  NVEMFLDCERRNFVVQ  2042
              V MFLDCERRNFVVQ
Sbjct  516   TVNMFLDCERRNFVVQ  531



>emb|CDY46616.1| BnaA09g27430D [Brassica napus]
Length=583

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/481 (67%), Positives = 381/481 (79%), Gaps = 10/481 (2%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIP-TIS  800
             KP K  KE+EG+ H I KFA RKKVG+LLL  +SA VF+ VLY GKGED +  ++P ++ 
Sbjct  35    KPSKMHKEREGFVHWICKFAGRKKVGMLLLFLISAVVFLRVLYAGKGEDGQEVQVPPSLH  94

Query  801   ISAT-MKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPC  977
              + T + +    +   E  N++   ++      G      PPP   ++F GYTLP G+PC
Sbjct  95    FNGTSVVNHSILLPTNEDQNVNIRNIS----TLGTHVILSPPP--PIHFLGYTLPQGHPC  148

Query  978   EGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenef  1154
               FTLPPPPAD+KRTGPRPCPVCYLPVEEA+ALMP APSFSP+L  L YIHE+ L+    
Sbjct  149   HTFTLPPPPADRKRTGPRPCPVCYLPVEEAVALMPNAPSFSPLLKNLTYIHEDPLNRETE  208

Query  1155  ggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVV  1331
              G    GGYP+L+ R+ S+DI+E+M+VHCGFVKG +PGR T FDID+ DL EM+ C G+V
Sbjct  209   FGGSDFGGYPTLKHRNHSFDIKETMTVHCGFVKGPQPGRNTGFDIDEADLLEMQQCRGIV  268

Query  1332  VASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVV  1511
             VASA+F AFD +  PKNIS+Y+ E VCFYMFVDEGTE+ L+    LN + ++G+WR+VVV
Sbjct  269   VASAVFDAFDDVKAPKNISKYSEETVCFYMFVDEGTESILKRERGLNGNKKVGIWRVVVV  328

Query  1512  HDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAIS  1691
             H+LPY D RRNGK+PKLL+HRLFPNARYSLWIDGKLELVVDP+QILERFLWR+NA+FAIS
Sbjct  329   HNLPYLDGRRNGKVPKLLVHRLFPNARYSLWIDGKLELVVDPHQILERFLWRKNATFAIS  388

Query  1692  RHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIR  1871
             RHY+RFDVF EAEANKAAGK+DNASIDFQVEFYK EGLTP+S AK PITSDVPEGCVI+R
Sbjct  389   RHYRRFDVFVEAEANKAAGKYDNASIDFQVEFYKNEGLTPYSVAKLPITSDVPEGCVILR  448

Query  1872  EHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYH  2051
             EH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++ NW V MFLDCERRNFVVQ YH
Sbjct  449   EHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKANWTVSMFLDCERRNFVVQRYH  508

Query  2052  R  2054
             R
Sbjct  509   R  509



>ref|XP_006583820.1| PREDICTED: uncharacterized protein LOC100783387 isoform X2 [Glycine 
max]
Length=564

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/530 (64%), Positives = 400/530 (75%), Gaps = 22/530 (4%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTISISATMK  818
             KEKE  F  I KFA RKKVG+L LC +SAAVFVWVLYVGKGED++ G  +  I+++ ++ 
Sbjct  36    KEKERLFLWICKFAGRKKVGMLFLCLISAAVFVWVLYVGKGEDSQDGNTVTNINVNESVS  95

Query  819   DREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPP  998
               + + E    N +            G+       P P  YF GY LPPG+PC  FTLPP
Sbjct  96    TSDSTFENSMTNAM------------GLTKRLVLLPPPTGYFLGYHLPPGHPCNSFTLPP  143

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEETLsenefggsgf-g  1172
             PPADKKRTGPRPCPVCYLPVEEAI LMP  PS SPVL  L Y++EE LS +   G    G
Sbjct  144   PPADKKRTGPRPCPVCYLPVEEAIGLMPALPSPSPVLGNLTYVYEENLSRDGEFGGSDFG  203

Query  1173  gYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFG  1352
             GYP+L+QR++S+DIRESM+VHCGFV+G+KPGR T FDID  DL EME C+GVVVASAIFG
Sbjct  204   GYPTLKQRNDSFDIRESMTVHCGFVRGIKPGRNTGFDIDGADLFEMEQCDGVVVASAIFG  263

Query  1353  AFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTD  1532
              FD+I++P NIS+Y+R+ VCF MFVDE TE +L +SG L  S +IGLWR +V  +LPY D
Sbjct  264   NFDVINEPNNISDYSRKTVCFLMFVDEQTEKYLISSGKLGISKKIGLWRTIVARNLPYPD  323

Query  1533  ARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFD  1712
             ARR GKIPKLLLHRL PNARYS+W+DGKLELVVDPYQILERFLWR+NA+FAIS+HY+RFD
Sbjct  324   ARRTGKIPKLLLHRLVPNARYSIWLDGKLELVVDPYQILERFLWRKNATFAISKHYRRFD  383

Query  1713  VFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISN  1892
             VF EAEANKAAGK+DNASIDFQ+EFYKKEGLTP++ AK P+ SDVPEGCVI+REH+PISN
Sbjct  384   VFIEAEANKAAGKYDNASIDFQIEFYKKEGLTPYTEAKLPLISDVPEGCVIVREHVPISN  443

Query  1893  LFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRD-ILEH  2069
             LF CLWFNEVDRFT RDQISFSTVRDKI SR +++  MFLDCERRNFVVQ YHRD +L  
Sbjct  444   LFACLWFNEVDRFTSRDQISFSTVRDKILSRVDFHFNMFLDCERRNFVVQKYHRDLLLRL  503

Query  2070  RApppppppRATIRDGVLKTSKYSGATTKLL---ARRIGDPRS---RHRQ  2201
               P  PPPP       VL+TS   GA + +     RR  D R+   RHR+
Sbjct  504   APPASPPPPSPPPPLPVLETSPEKGANSPIRRGPGRRGKDRRAGSRRHRK  553



>gb|KHN07255.1| hypothetical protein glysoja_027345 [Glycine soja]
Length=565

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/530 (64%), Positives = 400/530 (75%), Gaps = 22/530 (4%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTISISATMK  818
             KEKE  F  I KFA RKKVG+L LC +SAAVFVWVLYVGKGED++ G  +  I+++ ++ 
Sbjct  37    KEKERLFLWICKFAGRKKVGMLFLCLISAAVFVWVLYVGKGEDSQDGNTVTNINVNESVS  96

Query  819   DREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPP  998
               + + E    N +            G+       P P  YF GY LPPG+PC  FTLPP
Sbjct  97    KSDSTFENSMTNAM------------GLTKRLVLLPPPTGYFLGYHLPPGHPCNSFTLPP  144

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEETLsenefggsgf-g  1172
             PPADKKRTGPRPCPVCYLPVEEAI LMP  PS SPVL  L Y++EE LS +   G    G
Sbjct  145   PPADKKRTGPRPCPVCYLPVEEAIGLMPALPSPSPVLGNLTYVYEENLSRDGEFGGSDFG  204

Query  1173  gYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFG  1352
             GYP+L+QR++S+DIRESM+VHCGFV+G+KPGR T FDID  DL EME C+GVVVASAIFG
Sbjct  205   GYPTLKQRNDSFDIRESMTVHCGFVRGIKPGRNTGFDIDGADLFEMEQCDGVVVASAIFG  264

Query  1353  AFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTD  1532
              FD+I++P NIS+Y+R+ VCF MFVDE TE +L +SG L  S +IGLWR +V  +LPY D
Sbjct  265   NFDVINEPNNISDYSRKTVCFLMFVDEQTEKYLISSGKLGISKKIGLWRTIVARNLPYPD  324

Query  1533  ARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFD  1712
             ARR GKIPKLLLHRL PNARYS+W+DGKLELVVDPYQILERFLWR+NA+FAIS+HY+RFD
Sbjct  325   ARRTGKIPKLLLHRLVPNARYSIWLDGKLELVVDPYQILERFLWRKNATFAISKHYRRFD  384

Query  1713  VFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISN  1892
             VF EAEANKAAGK+DNASIDFQ+EFYKKEGLTP++ AK P+ SDVPEGCVI+REH+PISN
Sbjct  385   VFIEAEANKAAGKYDNASIDFQIEFYKKEGLTPYTEAKLPLISDVPEGCVIVREHVPISN  444

Query  1893  LFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRD-ILEH  2069
             LF CLWFNEVDRFT RDQISFSTVRDKI SR +++  MFLDCERRNFVVQ YHRD +L  
Sbjct  445   LFACLWFNEVDRFTSRDQISFSTVRDKILSRVDFHFNMFLDCERRNFVVQKYHRDLLLRL  504

Query  2070  RApppppppRATIRDGVLKTSKYSGATTKLL---ARRIGDPRS---RHRQ  2201
               P  PPPP       VL+TS   GA + +     RR  D R+   RHR+
Sbjct  505   APPASPPPPSPPPPLPVLETSPEKGANSPIRRGPGRRGKDRRAGSRRHRK  554



>ref|XP_009113689.1| PREDICTED: uncharacterized protein LOC103838975 [Brassica rapa]
Length=583

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/481 (66%), Positives = 380/481 (79%), Gaps = 10/481 (2%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIP-TIS  800
             KP K  KE+EG+ H I KFA RKKVG+LLL  +SA VF+ VLY GKGED +  ++P ++ 
Sbjct  35    KPSKMHKEREGFVHWICKFAGRKKVGMLLLFLISAVVFLRVLYAGKGEDGQEVQVPPSLH  94

Query  801   ISAT-MKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPC  977
              + T + +    +   E  N++   ++      G      PPP   ++F GYTLP G+PC
Sbjct  95    FNGTSVVNHSILLPTNEDQNVNIRNIS----TLGTHVILSPPP--PIHFLGYTLPQGHPC  148

Query  978   EGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenef  1154
               FTLPPPPAD+KRTGPRPCPVCYLPVEEA+ALMP APSFSP+L  L YIHE+ L+    
Sbjct  149   HTFTLPPPPADRKRTGPRPCPVCYLPVEEAVALMPNAPSFSPLLKNLTYIHEDPLNRETE  208

Query  1155  ggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVV  1331
              G    GGYP+L+ R+ S+DI+E+M+VHCGFVKG +PGR T FDI + DL EM+ C G+V
Sbjct  209   FGGSDFGGYPTLKHRNHSFDIKETMTVHCGFVKGPQPGRNTGFDIHEADLLEMQQCRGIV  268

Query  1332  VASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVV  1511
             VASA+F AFD +  PKNIS+Y+ E VCFYMFVDEGTE+ L+    LN + ++G+WR+VVV
Sbjct  269   VASAVFDAFDDVKAPKNISKYSEETVCFYMFVDEGTESILKRERGLNGNKKVGIWRVVVV  328

Query  1512  HDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAIS  1691
             H+LPY D RRNGK+PKLL+HRLFPNARYSLWIDGKLELVVDP+QILERFLWR+NA+FAIS
Sbjct  329   HNLPYLDGRRNGKVPKLLVHRLFPNARYSLWIDGKLELVVDPHQILERFLWRKNATFAIS  388

Query  1692  RHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIR  1871
             RHY+RFDVF EAEANKAAGK+DNASIDFQVEFYK EGLTP+S AK PITSDVPEGCVI+R
Sbjct  389   RHYRRFDVFVEAEANKAAGKYDNASIDFQVEFYKNEGLTPYSVAKLPITSDVPEGCVILR  448

Query  1872  EHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYH  2051
             EH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++ NW V MFLDCERRNFVVQ YH
Sbjct  449   EHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKANWTVSMFLDCERRNFVVQRYH  508

Query  2052  R  2054
             R
Sbjct  509   R  509



>ref|XP_003542746.2| PREDICTED: uncharacterized protein LOC100779951 isoform X1 [Glycine 
max]
 gb|KHN10002.1| hypothetical protein glysoja_026902 [Glycine soja]
Length=567

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/477 (67%), Positives = 377/477 (79%), Gaps = 15/477 (3%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTISISATMK  818
             KEKE  F  I KFA RKKVG+L LC +SAAVF+WVLYVGK ED++ G  + +I+++ ++ 
Sbjct  37    KEKERLFLWICKFAGRKKVGMLFLCLISAAVFIWVLYVGKAEDSQDGNTVSSINVNESVS  96

Query  819   DREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPP  998
               + + E    N +            G+      PP P  YF GY LPPG+PC  FTLPP
Sbjct  97    ASDSTSENSTTNAM------------GLTKRSVLPPPPAGYFLGYRLPPGHPCNSFTLPP  144

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEETLsenefggsgf-g  1172
             PPADKKRTGPRPCPVCYLPVEEAI LMP  PS SPVL  L Y++EE LS +   G    G
Sbjct  145   PPADKKRTGPRPCPVCYLPVEEAIGLMPALPSPSPVLGNLTYVYEENLSRDGEFGGSDFG  204

Query  1173  gYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFG  1352
             GYP+L+QR++S+DIRESMSVHCGFV+G+KPGR T FDID+ D  EME C GVVVASAIFG
Sbjct  205   GYPTLKQRNDSFDIRESMSVHCGFVRGIKPGRNTGFDIDEADHFEMEQCNGVVVASAIFG  264

Query  1353  AFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTD  1532
              FD I++P NIS+Y+R+ VCF MFVDE TE +L +SG L  S +IGLWRI+V  +LPY D
Sbjct  265   NFDEINEPNNISDYSRKTVCFLMFVDEETEKYLISSGKLGISKKIGLWRIIVARNLPYPD  324

Query  1533  ARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFD  1712
             ARR GKIPKLLLHRL PNARYS+W+DGKLELVVDPYQILERFLWR+NA+FAIS+HY+RFD
Sbjct  325   ARRTGKIPKLLLHRLVPNARYSIWLDGKLELVVDPYQILERFLWRKNATFAISKHYRRFD  384

Query  1713  VFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISN  1892
             VF EAEANKAAGK++NASIDFQ+EFYK EGLTP++ AK P+ SDVPEGCVI+REH+PISN
Sbjct  385   VFIEAEANKAAGKYENASIDFQIEFYKNEGLTPYTEAKLPLISDVPEGCVIVREHVPISN  444

Query  1893  LFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             LFTCLWFNEVDRFT RDQISFSTVRDKI SR +++  MFLDCERRNFVVQ YHRD+L
Sbjct  445   LFTCLWFNEVDRFTSRDQISFSTVRDKILSRVDFHFNMFLDCERRNFVVQKYHRDLL  501



>ref|XP_006415681.1| hypothetical protein EUTSA_v10007204mg [Eutrema salsugineum]
 gb|ESQ34034.1| hypothetical protein EUTSA_v10007204mg [Eutrema salsugineum]
Length=573

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/481 (67%), Positives = 382/481 (79%), Gaps = 10/481 (2%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIP-TIS  800
             KP K  KE+EG  H I KFA RKKVG+LLL  +SA VFV VLYVGKGED +  ++P ++ 
Sbjct  34    KPSKMQKEREGIVHWICKFAGRKKVGMLLLFLISAVVFVRVLYVGKGEDGQEVQVPPSLH  93

Query  801   ISATMKDREYSIEP-EEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPC  977
              + +      ++ P  E  NI+   ++    N  ++      P P ++F GYTLP G+PC
Sbjct  94    FNGSSVVNHSNMLPTNEDQNINIRNISFLGTNVLVS------PTPPMHFLGYTLPQGHPC  147

Query  978   EGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenef  1154
               FTLPPPPAD+KRTGPRPCPVCYLPVEEAIALMP APSFSPVL  L YI+EE L+    
Sbjct  148   NSFTLPPPPADRKRTGPRPCPVCYLPVEEAIALMPNAPSFSPVLKNLTYIYEEPLNRETE  207

Query  1155  ggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVV  1331
              G    GGYP+L+ R++S+DI+E+MSVHCGFVKG +PGR T FDID+ DL EM+ C G+V
Sbjct  208   FGGSDFGGYPTLKHRNDSFDIKETMSVHCGFVKGPQPGRNTGFDIDEADLLEMKQCRGIV  267

Query  1332  VASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVV  1511
             VASA+F AFD +  P+NIS+Y+ E VCFYMFVDE TE+ L+    L+ + ++G+WR+VVV
Sbjct  268   VASAVFDAFDDVKAPQNISKYSEETVCFYMFVDEETESILKKERGLDGNKKVGIWRVVVV  327

Query  1512  HDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAIS  1691
             H+LPY+D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLWR+NA+FAIS
Sbjct  328   HNLPYSDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLWRKNATFAIS  387

Query  1692  RHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIR  1871
              HY+RFDVF EAEANKAAGK+DNASIDFQV+FYK EGLTP+S AK PI SDVPEGCVI+R
Sbjct  388   IHYRRFDVFVEAEANKAAGKYDNASIDFQVDFYKNEGLTPYSVAKLPIPSDVPEGCVILR  447

Query  1872  EHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYH  2051
             EH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERRNFVVQ YH
Sbjct  448   EHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCERRNFVVQRYH  507

Query  2052  R  2054
             R
Sbjct  508   R  508



>emb|CDY15686.1| BnaA07g08570D [Brassica napus]
Length=581

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/483 (67%), Positives = 384/483 (80%), Gaps = 18/483 (4%)
 Frame = +3

Query  624   KPLKTFKEKE--GWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIP-T  794
             KP K  KE+E  G  H I KFA RKKVG+LLL  +SA VF+ VL+VGKGED +  ++P +
Sbjct  36    KPSKMHKEREREGVVHWICKFAGRKKVGMLLLFLISAVVFLRVLFVGKGEDGQEVQVPPS  95

Query  795   ISISATMKDREYSIEPEEKN-NIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGN  971
             +  + T      S+  EE+N NI          N        PPPL   +F GYTLP G+
Sbjct  96    LHFNGTSVVNHSSMFNEEQNINIR---------NISFNVVFSPPPL---HFLGYTLPQGH  143

Query  972   PCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsen  1148
             PC  FTLPPPPAD+KRTGPRPCPVCYLPVEEAIALMP+APSFSPVL  L YI+EE L+ +
Sbjct  144   PCHTFTLPPPPADRKRTGPRPCPVCYLPVEEAIALMPSAPSFSPVLKNLTYIYEEPLNRD  203

Query  1149  efggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
                G    GGYP+L+ R++S+DI+E+M++HCGFVKG +PGR T FD+D+ DL EM+ C G
Sbjct  204   TEFGGSDFGGYPTLKHRNDSFDIKETMNLHCGFVKGPQPGRNTGFDMDEADLLEMKQCRG  263

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             VVVASA+F AFD +  P+NIS+Y+ E VCFYMFVDE TE+ L+    LN + ++G+WR+V
Sbjct  264   VVVASAVFDAFDDVKAPQNISKYSEETVCFYMFVDEETESILKRERGLNDTKKVGIWRVV  323

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             VVH+LPY+D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLWR+NA+FA
Sbjct  324   VVHNLPYSDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLWRKNATFA  383

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVI  1865
             IS+HY+RFDVF EAEANKAAGK+DNASIDFQV+FYK EGLTP+S AK PITSDVPEGCVI
Sbjct  384   ISKHYRRFDVFVEAEANKAAGKYDNASIDFQVDFYKNEGLTPYSVAKLPITSDVPEGCVI  443

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQG  2045
             +REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERRNFV+Q 
Sbjct  444   LREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCERRNFVIQR  503

Query  2046  YHR  2054
             YHR
Sbjct  504   YHR  506



>ref|XP_009102925.1| PREDICTED: uncharacterized protein LOC103829026 [Brassica rapa]
Length=582

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/483 (67%), Positives = 384/483 (80%), Gaps = 18/483 (4%)
 Frame = +3

Query  624   KPLKTFKEKE--GWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIP-T  794
             KP K  KE+E  G  H I KFA RKKVG+LLL  +SA VF+ VL+VGKGED +  ++P +
Sbjct  37    KPSKMHKEREREGVVHWICKFAGRKKVGMLLLFLISAVVFLRVLFVGKGEDGQEVQVPPS  96

Query  795   ISISATMKDREYSIEPEEKN-NIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGN  971
             +  + +      S+  EE+N NI          N        PPPL   +F GYTLP G+
Sbjct  97    LHFNGSSVVNHSSMFNEEQNINIR---------NISFNVVFSPPPL---HFLGYTLPQGH  144

Query  972   PCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsen  1148
             PC  FTLPPPPAD+KRTGPRPCPVCYLPVEEAIALMP+APSFSPVL  L YI+EE L+ +
Sbjct  145   PCHTFTLPPPPADRKRTGPRPCPVCYLPVEEAIALMPSAPSFSPVLKNLTYIYEEPLNRD  204

Query  1149  efggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
                G    GGYP+L+ R++S+DI+E+M++HCGFVKG +PGR T FD+D+ DL EM+ C G
Sbjct  205   TEFGGSDFGGYPTLKHRNDSFDIKETMNLHCGFVKGPQPGRNTGFDMDEADLLEMKQCRG  264

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             VVVASA+F AFD +  P+NIS+Y+ E VCFYMFVDE TEA L+    LN + ++G+WR+V
Sbjct  265   VVVASAVFDAFDDVKAPQNISKYSEETVCFYMFVDEETEAILKRERGLNDTKKVGIWRVV  324

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             VVH+LPY+D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLWR+NA+FA
Sbjct  325   VVHNLPYSDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLWRKNATFA  384

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVI  1865
             IS+HY+RFDVF EAEANKAAGK+DNASIDFQV+FYK EGLTP+S AK PITSDVPEGCVI
Sbjct  385   ISKHYRRFDVFVEAEANKAAGKYDNASIDFQVDFYKNEGLTPYSVAKLPITSDVPEGCVI  444

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQG  2045
             +REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERRNFV+Q 
Sbjct  445   LREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCERRNFVIQR  504

Query  2046  YHR  2054
             YHR
Sbjct  505   YHR  507



>emb|CDX94597.1| BnaC07g10610D [Brassica napus]
Length=583

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/483 (67%), Positives = 387/483 (80%), Gaps = 16/483 (3%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIP-TIS  800
             KP K  KE+EG  H I KFA RKKVG+LLL  +SA VF+ VL+VGKGED +  ++P ++ 
Sbjct  36    KPSKMHKEREGVVHWICKFAGRKKVGMLLLFLISAVVFLRVLFVGKGEDGQEVQVPPSLH  95

Query  801   ISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIAST---DQPPPLPRVYFTGYTLPPGN  971
              + +      S+  EE+N           N R I+       PPP P ++F GYTLP G+
Sbjct  96    FNGSSVVNHSSMFNEEQNI----------NIRNISFNVVFSPPPPPPPMHFLGYTLPQGH  145

Query  972   PCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsen  1148
             PC  FTLPPPPAD+KRTGPRPCPVCYLPVEEAIALMP+APSFSPVL  L YI+EE L+ +
Sbjct  146   PCHTFTLPPPPADRKRTGPRPCPVCYLPVEEAIALMPSAPSFSPVLKNLTYIYEEPLNRD  205

Query  1149  efggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
                G    GGYP+L+ R++S+DI+E+M+VHCGFVKG +PGR T FD+++ DL EM+ C G
Sbjct  206   TEFGGSDFGGYPTLKHRNDSFDIKETMNVHCGFVKGPQPGRNTGFDMNEADLLEMKQCRG  265

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             VVVASA+F AFD +  P+NIS+Y+ E VCFYMFVDE TE+ L+    LN + ++G+WR+V
Sbjct  266   VVVASAVFDAFDDVKAPQNISKYSEETVCFYMFVDEETESILKRERGLNDTKKVGIWRVV  325

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             VVH+LPY+D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLWR+NA+FA
Sbjct  326   VVHNLPYSDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLWRKNATFA  385

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVI  1865
             IS+HY+RFDVF EAEANKAAGK+DNASIDFQV+FYK EGLTP+S AKFPITSDVPEGCVI
Sbjct  386   ISKHYRRFDVFVEAEANKAAGKYDNASIDFQVDFYKNEGLTPYSVAKFPITSDVPEGCVI  445

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQG  2045
             +REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERRNFV+Q 
Sbjct  446   LREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCERRNFVIQR  505

Query  2046  YHR  2054
             YHR
Sbjct  506   YHR  508



>ref|XP_003593577.1| hypothetical protein MTR_2g013690 [Medicago truncatula]
 gb|AES63828.1| DUF616 family protein [Medicago truncatula]
Length=570

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/490 (67%), Positives = 387/490 (79%), Gaps = 17/490 (3%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTI  797
             RKP K  KEKE  FH I KFA RKKVG+L LC +SAAVF+WVLYVGKGED++ G  +  I
Sbjct  31    RKPSKMLKEKEKLFHWICKFAGRKKVGMLFLCVISAAVFIWVLYVGKGEDSQEGNGVQNI  90

Query  798   SISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPC  977
             S++ +M     SI          T++        +A+    PP P  YF GY LPPG+PC
Sbjct  91    SVNDSM-----SINNSPAMISTATIV-------DLATNLVLPPSPPSYFLGYNLPPGHPC  138

Query  978   EGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenef  1154
               FTLPPPPADKKRTGPRPCPVCYLPV+EAI LMP  PS SPVL  L + +EE    +  
Sbjct  139   NSFTLPPPPADKKRTGPRPCPVCYLPVDEAIGLMPKFPSPSPVLKNLTFTYEEKEKLSRD  198

Query  1155  ggsgfg---gYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
             G  G     GYP+LRQR++S+DIRESM VHCGFV+G+KPGR T FDID+ DL +ME C+G
Sbjct  199   GEFGGSDFGGYPTLRQRNDSFDIRESMCVHCGFVRGIKPGRNTGFDIDEDDLLDMEQCQG  258

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             +VVASA+FG FD +++PKNISE++++ VCF MFVDE TE +LR+SG L +S +IGLWRI+
Sbjct  259   IVVASAVFGNFDEVNEPKNISEHSKQTVCFLMFVDEETEKYLRSSGRLGTSKKIGLWRII  318

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             V H+LPYTDARR GKIPKLLLHR+ PNARYS+W+DGKLELVVDPYQILERFLWR NA+FA
Sbjct  319   VAHNLPYTDARRTGKIPKLLLHRMAPNARYSIWLDGKLELVVDPYQILERFLWRNNATFA  378

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVI  1865
             IS+HY+RFDVF EAEANKAA K+DNASIDFQ+EFYKKEGLTP++ AKFP+ SDVPEGCVI
Sbjct  379   ISKHYRRFDVFVEAEANKAAAKYDNASIDFQIEFYKKEGLTPYTEAKFPLISDVPEGCVI  438

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQG  2045
             IREH+PISNLFTCLWFNEVDRFT RDQISFSTVRDK  S+ +++  MFLDCERRNFVVQ 
Sbjct  439   IREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKFLSKVDFHFNMFLDCERRNFVVQK  498

Query  2046  YHRDILEHRA  2075
             YHR +LEH A
Sbjct  499   YHRGVLEHLA  508



>emb|CDY35723.1| BnaC03g58440D [Brassica napus]
Length=574

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/479 (66%), Positives = 381/479 (80%), Gaps = 13/479 (3%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISI  803
             KP K  KE+EG   RI KFA RKKVG+LLL  +SA VF+ VL+VGKGED + P  P++  
Sbjct  32    KPSKMHKEREG--RRICKFAGRKKVGMLLLFLISAVVFLRVLFVGKGEDGQVP--PSLHF  87

Query  804   SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEG  983
             + T       + P    N  +T+  +  +  G+ +   PP    ++F GYTLP G+PC  
Sbjct  88    NGTFVVNHSYMLP---TNEEETISIRNISFLGLNAVLSPP----MHFLGYTLPQGHPCNS  140

Query  984   FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefgg  1160
             FTLPPPPAD+KRTGPR CPVCYLPVEEAIALMP APSFSP+L  L YI+EE L+ +   G
Sbjct  141   FTLPPPPADRKRTGPRSCPVCYLPVEEAIALMPNAPSFSPLLKNLTYIYEEPLNRDTEFG  200

Query  1161  sgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVA  1337
                 GGYP+L+ R++S++I+E+MSVHCGFVKG +PGR T FDID+ DL EM+ C G+VVA
Sbjct  201   GSDFGGYPTLKHRNDSFEIKETMSVHCGFVKGPQPGRNTGFDIDEADLLEMKQCRGIVVA  260

Query  1338  SAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHD  1517
             SA+F AFD +  P+NIS+Y+ E VCFYMFVDE TE+ L+    LN + ++G+WR+VVVH+
Sbjct  261   SAVFDAFDDVKAPQNISKYSEETVCFYMFVDEETESILKRERGLNGNKKVGIWRVVVVHN  320

Query  1518  LPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRH  1697
             LPY+D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDP+QILERFLWR+NA+FAIS+H
Sbjct  321   LPYSDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPHQILERFLWRKNATFAISKH  380

Query  1698  YKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREH  1877
             YKRFDV  EAEANKAAGK+DNASIDFQVEFYK EGLTP+S AK PITSDVPEGCVI+REH
Sbjct  381   YKRFDVLVEAEANKAAGKYDNASIDFQVEFYKNEGLTPYSVAKLPITSDVPEGCVILREH  440

Query  1878  IPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHR  2054
             +PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERRNFVVQ YHR
Sbjct  441   VPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCERRNFVVQRYHR  499



>ref|XP_004505059.1| PREDICTED: uncharacterized protein LOC101507527 [Cicer arietinum]
Length=570

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/475 (68%), Positives = 377/475 (79%), Gaps = 22/475 (5%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTISISATMK  818
             KEKE  F  IFKFA RKKVG+L LC +SA VFVWVLYVGKGED+R G  + TIS++ ++ 
Sbjct  46    KEKEQLFLWIFKFAGRKKVGMLFLCLISAVVFVWVLYVGKGEDSREGNAVQTISVNESVS  105

Query  819   DREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPP  998
               + S E    N     LL              PPP    YF GY LP G+PC  FTLPP
Sbjct  106   MSDSSSEISTANF---ALLP-------------PPP---SYFLGYHLPTGHPCNSFTLPP  146

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgf-g  1172
             PPADKKRTGPRPCPVCYLPVEEAIA MPT PS SPVL  L Y++EE LS  +  G    G
Sbjct  147   PPADKKRTGPRPCPVCYLPVEEAIARMPTLPSLSPVLQNLTYVYEENLSRGDEFGGSEFG  206

Query  1173  gYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFG  1352
             GYP+L+QR+ES+D+ ESMSVHCGFV+G KPGR T FDID+ DL EM+ C GVVVASA+FG
Sbjct  207   GYPTLKQRNESFDVHESMSVHCGFVRGTKPGRNTGFDIDEDDLLEMDQCNGVVVASAVFG  266

Query  1353  AFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTD  1532
              FD I++PKNIS+Y+R+ VCF+MFVDE TE +LR+SG L  S +IGLWRI+V  +LPY D
Sbjct  267   NFDEINEPKNISDYSRKTVCFFMFVDEETEQYLRSSGRLGISKKIGLWRIIVARNLPYAD  326

Query  1533  ARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFD  1712
             ARR GKIPKLLLHR+ PNA YS+W+DGKLELVVDPYQILERFLWR+NA+FAIS+HY+RFD
Sbjct  327   ARRTGKIPKLLLHRMVPNACYSIWLDGKLELVVDPYQILERFLWRKNATFAISKHYRRFD  386

Query  1713  VFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISN  1892
             VF EAEANKAAGK++NASIDFQ+EFYKKEGLTP++ AK P+ SDVPEGCVI+REH+PISN
Sbjct  387   VFVEAEANKAAGKYENASIDFQIEFYKKEGLTPYTEAKLPLISDVPEGCVIVREHVPISN  446

Query  1893  LFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRD  2057
             LFTCLWFNEVDRFT RDQ+SFSTVRDKI SR +++  MFLDCERRNFV+Q YHRD
Sbjct  447   LFTCLWFNEVDRFTSRDQLSFSTVRDKILSRVDFHFNMFLDCERRNFVIQKYHRD  501



>gb|KFK44701.1| hypothetical protein AALP_AA1G291900 [Arabis alpina]
Length=590

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/482 (66%), Positives = 382/482 (79%), Gaps = 9/482 (2%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDA---RGPEIPT  794
             K  K  KE++G  H I KFA RKKVG+LLL  +SA VF+ VLYVGKGED+   +GP    
Sbjct  38    KASKMQKERDGIVHWICKFAGRKKVGMLLLFLISAVVFLRVLYVGKGEDSSEVQGPRSLH  97

Query  795   ISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNP  974
              + ++ +      +   E+ + +K  ++    +  + S+   PP P ++F GYTLP G+P
Sbjct  98    FNGTSGVNYSNMLLPTNEEEDSNKHNISFVAKDVVVYSS---PPAP-MHFLGYTLPQGHP  153

Query  975   CEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsene  1151
             C  FTLPPPPAD+KRTGPRPCPVCYLPVEEAIALMP APSFSPVL  L YI+EE L+   
Sbjct  154   CNSFTLPPPPADRKRTGPRPCPVCYLPVEEAIALMPNAPSFSPVLKNLTYIYEEPLNRET  213

Query  1152  fggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGV  1328
               G    GGYP+LR R++S+DI+E+MSVHCGFVKG +PGR T FDID+ DL EM+ C G+
Sbjct  214   EFGGSDFGGYPTLRHRNDSFDIKETMSVHCGFVKGPQPGRDTGFDIDESDLLEMKQCRGI  273

Query  1329  VVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVV  1508
             VVASA+F AFD +  P+NIS+Y+ E VCFYMFVDE TE  L+    L+ + ++G+WR+VV
Sbjct  274   VVASAVFDAFDDVKAPQNISKYSEETVCFYMFVDEETETILKRERGLDGNKKVGIWRVVV  333

Query  1509  VHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAI  1688
             VH+LPY+D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLWR+NA+FAI
Sbjct  334   VHNLPYSDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLWRKNATFAI  393

Query  1689  SRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVII  1868
             S+HYKRFDV  EAEANKAAGK+DNASIDFQV+FYK EGLTP+S AK PITSDVPEGCVI+
Sbjct  394   SKHYKRFDVLVEAEANKAAGKYDNASIDFQVDFYKNEGLTPYSVAKLPITSDVPEGCVIL  453

Query  1869  REHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGY  2048
             REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERRNFVVQ Y
Sbjct  454   REHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCERRNFVVQRY  513

Query  2049  HR  2054
             HR
Sbjct  514   HR  515



>ref|NP_174145.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF98431.1|AC021044_10 Unknown protein [Arabidopsis thaliana]
 gb|AEE30935.1| uncharacterized protein AT1G28240 [Arabidopsis thaliana]
Length=581

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/490 (66%), Positives = 385/490 (79%), Gaps = 28/490 (6%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTIS  800
             KP K  K++EG  H I KFA RKKVG+LLL  +SA VF+ VLYVGKGED++ G   P++ 
Sbjct  35    KPSKMQKDREGIVHWICKFAGRKKVGMLLLFLISAVVFLRVLYVGKGEDSQEGQGPPSLH  94

Query  801   ISATMKDREYS--IEPEEKNNIH--------KTLLAKPNNNRGIASTDQPPPLPRVYFTG  950
              + +     YS  ++  E+ N++        K ++  P           PPP   ++F G
Sbjct  95    FNGS-SGVNYSNMLQTNEELNMNIGNISFKAKEVIVFP-----------PPP---IHFLG  139

Query  951   YTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIH  1127
             Y+LP G+PC  FTLPPPPAD+KRTGPRPCPVCYLPVEEA+ALMP APSFSPVL  L YI+
Sbjct  140   YSLPQGHPCNSFTLPPPPADRKRTGPRPCPVCYLPVEEAVALMPNAPSFSPVLKNLTYIY  199

Query  1128  EETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLG  1304
             EE L+     G    GGYP+L+ R++S+DI+E+MSVHCGFVKG +PGR T FDID+ DL 
Sbjct  200   EEPLNRETEFGGSDFGGYPTLKHRNDSFDIKETMSVHCGFVKGPQPGRNTGFDIDEADLL  259

Query  1305  EMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSR  1484
             EM+ C G+VVASA+F AFD +  P+NIS+YA E VCFYMFVDE TE+ L+    L+ + +
Sbjct  260   EMKQCRGIVVASAVFDAFDDVKAPQNISKYAEETVCFYMFVDEETESILKRERGLDGNKK  319

Query  1485  IGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLW  1664
             +G+WR+VVVH+LPY+D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLW
Sbjct  320   VGIWRVVVVHNLPYSDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLW  379

Query  1665  RRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSD  1844
             R+NA+FAISRHYKRFDV  EAEANKAAGK+DNASIDFQV+FYK EGLTP+S AK PITSD
Sbjct  380   RKNATFAISRHYKRFDVLVEAEANKAAGKYDNASIDFQVDFYKNEGLTPYSVAKLPITSD  439

Query  1845  VPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCER  2024
             VPEGCVI+REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCER
Sbjct  440   VPEGCVILREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCER  499

Query  2025  RNFVVQGYHR  2054
             RNFVVQ YHR
Sbjct  500   RNFVVQRYHR  509



>ref|XP_006303939.1| hypothetical protein CARUB_v10008674mg [Capsella rubella]
 gb|EOA36837.1| hypothetical protein CARUB_v10008674mg [Capsella rubella]
Length=584

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/489 (66%), Positives = 379/489 (78%), Gaps = 26/489 (5%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR---GPEIPT  794
             KP K  KE+EG  H I KF  RKKVG+LLL  +SA VF+ VLYVGKGED +   GP  P+
Sbjct  36    KPSKMQKEREGIVHWICKFVGRKKVGMLLLFLISAVVFLRVLYVGKGEDGQEVQGP--PS  93

Query  795   ISISATMKDREYS---IEPEEKNNIHKTLLAKPNNNRGIASTD----QPPPLPRVYFTGY  953
             +  + T      S   +  E+  N+          N  I + D     PPP   VYF GY
Sbjct  94    LHFNGTSGVNYSSMLQVNDEQNMNV---------GNISIKAKDVIVFPPPP---VYFLGY  141

Query  954   TLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHE  1130
             +LP G+PC  FTLPPPPAD+KRTGPRPCPVCYLPVEEA+A MP APSFSPVL  L YI+E
Sbjct  142   SLPQGHPCNSFTLPPPPADRKRTGPRPCPVCYLPVEEAVAFMPNAPSFSPVLKNLTYIYE  201

Query  1131  ETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGE  1307
             E L+     G    GGYP+LR R++S+DI+E+MSVHCGFVKG +PGR T FDID+ DL +
Sbjct  202   EPLNRETEFGGSDFGGYPTLRHRNDSFDIKETMSVHCGFVKGPQPGRNTGFDIDEADLLD  261

Query  1308  MEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRI  1487
             M+ C G+VVASA+F AFD +  P+NIS+Y+ + VCFYMFVDE TE  L+    L+ + ++
Sbjct  262   MKQCRGIVVASAVFDAFDDVKAPQNISKYSEQTVCFYMFVDEETELILKKERGLDGNKKV  321

Query  1488  GLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWR  1667
             G+WR+VVVH+LPY+D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLWR
Sbjct  322   GIWRVVVVHNLPYSDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLWR  381

Query  1668  RNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDV  1847
             +NA+FAISRHYKRFDV  EAEANKAAGK+DNASIDFQV+FYK EGLTP+S AK PITSDV
Sbjct  382   KNATFAISRHYKRFDVLVEAEANKAAGKYDNASIDFQVDFYKNEGLTPYSVAKLPITSDV  441

Query  1848  PEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERR  2027
             PEGCVI+REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERR
Sbjct  442   PEGCVILREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCERR  501

Query  2028  NFVVQGYHR  2054
             NFVVQ YHR
Sbjct  502   NFVVQRYHR  510



>ref|XP_002893514.1| hypothetical protein ARALYDRAFT_473032 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69773.1| hypothetical protein ARALYDRAFT_473032 [Arabidopsis lyrata subsp. 
lyrata]
Length=578

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/484 (66%), Positives = 383/484 (79%), Gaps = 15/484 (3%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKG---EDARGPEIPT  794
             KP K  K++EG  H I KFA RKKVG+LLL  +SA VF+ VLYVGKG   ED +GP  P+
Sbjct  35    KPSKMQKDREGIVHWICKFAGRKKVGMLLLFLISAVVFLRVLYVGKGNQCEDGQGP--PS  92

Query  795   ISISATMKDREYS--IEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPG  968
             +  + T     YS  ++  E+ N++   ++       +      PP P ++F GY+LP G
Sbjct  93    LHFNGT-SGVNYSNMLQTNEEQNMNIGNISFKAKEVIVF-----PPPPPMHFLGYSLPQG  146

Query  969   NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLse  1145
             +PC  FTLPPPPAD+KRTGPRPCPVCYLPVEEA+ALMP APSFSPVL  L YI EE L+ 
Sbjct  147   HPCNSFTLPPPPADRKRTGPRPCPVCYLPVEEAVALMPNAPSFSPVLKNLTYICEEPLNR  206

Query  1146  nefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
                 G    GGYP+L+ R++S+DI+E+MSVHCGFVKG +PGR T FDID+ DL EM+ C 
Sbjct  207   ETEFGGSDFGGYPTLKDRNDSFDIKETMSVHCGFVKGPQPGRNTGFDIDEADLLEMKQCR  266

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
             G+VVASA+F AFD +  P+NIS+YA E VCFY+FVDE TE+ L+    L+ + ++G+WR+
Sbjct  267   GIVVASAVFDAFDDVKAPQNISKYAEETVCFYIFVDEETESILKRERGLDGNKKVGIWRV  326

Query  1503  VVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASF  1682
             VVVH+LPY+D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLWR+NA+F
Sbjct  327   VVVHNLPYSDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLWRKNATF  386

Query  1683  AISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCV  1862
             AISRHYKRFDV  EAEANKAAGK+DNASIDFQV+FYK EGLTP+S AK PITSDVPEGCV
Sbjct  387   AISRHYKRFDVLVEAEANKAAGKYDNASIDFQVDFYKNEGLTPYSVAKLPITSDVPEGCV  446

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             I+REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERRNFVVQ
Sbjct  447   ILREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCERRNFVVQ  506

Query  2043  GYHR  2054
              YHR
Sbjct  507   RYHR  510



>ref|XP_010460602.1| PREDICTED: uncharacterized protein LOC104741432 [Camelina sativa]
Length=584

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/483 (66%), Positives = 376/483 (78%), Gaps = 14/483 (3%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR---GPEIPT  794
             KP K  KE+EG  H I KF  RKKVG+LLL  +SA VF+ VLYVGKGED +   GP    
Sbjct  36    KPSKMQKEREGIVHWICKFVGRKKVGMLLLFLISAVVFLRVLYVGKGEDGQEVQGPPSLH  95

Query  795   ISISATMK-DREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGN  971
              + SA +       I  E+  NI    L   +          PPP+   +F GYTLP G+
Sbjct  96    FNGSAGVNFSNMLQINEEQNMNIGNISLKAKD-----VVVFPPPPM---HFLGYTLPQGH  147

Query  972   PCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsen  1148
             PC  F+LPPPPAD+KRTGPRPCPVCYLPVE+A++ MP+APSFSPVL  L YI+EE L+ +
Sbjct  148   PCNSFSLPPPPADRKRTGPRPCPVCYLPVEDAVSFMPSAPSFSPVLKNLTYIYEEPLNRD  207

Query  1149  efggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
                G    GGYP+LR R++S+DI+E+MSVHCGFVKG +PGR T FDID+ DL EM+ C G
Sbjct  208   TEFGGSDFGGYPTLRHRNDSFDIKETMSVHCGFVKGPQPGRNTRFDIDEADLLEMKQCRG  267

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             +VVASA+F AFD +  P+NIS+Y+ E VCFYMFVDE TE  L+    L+ + ++G+WR+V
Sbjct  268   IVVASAVFDAFDDVKAPQNISKYSEETVCFYMFVDEETETILKKERGLDENKKVGIWRVV  327

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             VVH+LPY D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLWR+NA+FA
Sbjct  328   VVHNLPYLDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLWRKNATFA  387

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVI  1865
             ISRHYKRFDV  EAEANKAAGK+DNASIDFQV+FYK EGLTP+S AK PITSDVPEGCVI
Sbjct  388   ISRHYKRFDVLVEAEANKAAGKYDNASIDFQVDFYKNEGLTPYSVAKLPITSDVPEGCVI  447

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQG  2045
             +REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERRNFVVQ 
Sbjct  448   LREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCERRNFVVQR  507

Query  2046  YHR  2054
             YHR
Sbjct  508   YHR  510



>gb|AAL32582.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN72102.1| Unknown protein [Arabidopsis thaliana]
Length=581

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/490 (66%), Positives = 384/490 (78%), Gaps = 28/490 (6%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTIS  800
             KP K  K++EG  H I KFA RKKVG+LLL  +SA VF+ VLYVGKGED++ G   P++ 
Sbjct  35    KPSKMQKDREGIVHWICKFAGRKKVGMLLLFLISAVVFLRVLYVGKGEDSQEGQGPPSLH  94

Query  801   ISATMKDREYS--IEPEEKNNIH--------KTLLAKPNNNRGIASTDQPPPLPRVYFTG  950
              + +     YS  ++  E+ N++        K ++  P           PPP   ++F G
Sbjct  95    FNGS-SGVNYSNMLQTNEELNMNIGNISFKAKEVIVFP-----------PPP---IHFLG  139

Query  951   YTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIH  1127
             Y+LP G+PC  FTLPPPPAD+KRTGPRPCPVCYLPVE A+ALMP APSFSPVL  L YI+
Sbjct  140   YSLPQGHPCNSFTLPPPPADRKRTGPRPCPVCYLPVEGAVALMPNAPSFSPVLKNLTYIY  199

Query  1128  EETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLG  1304
             EE L+     G    GGYP+L+ R++S+DI+E+MSVHCGFVKG +PGR T FDID+ DL 
Sbjct  200   EEPLNRETEFGGSDFGGYPTLKHRNDSFDIKETMSVHCGFVKGPQPGRNTGFDIDEADLL  259

Query  1305  EMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSR  1484
             EM+ C G+VVASA+F AFD +  P+NIS+YA E VCFYMFVDE TE+ L+    L+ + +
Sbjct  260   EMKQCRGIVVASAVFDAFDDVKAPQNISKYAEETVCFYMFVDEETESILKRERGLDGNKK  319

Query  1485  IGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLW  1664
             +G+WR+VVVH+LPY+D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLW
Sbjct  320   VGIWRVVVVHNLPYSDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLW  379

Query  1665  RRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSD  1844
             R+NA+FAISRHYKRFDV  EAEANKAAGK+DNASIDFQV+FYK EGLTP+S AK PITSD
Sbjct  380   RKNATFAISRHYKRFDVLVEAEANKAAGKYDNASIDFQVDFYKNEGLTPYSVAKLPITSD  439

Query  1845  VPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCER  2024
             VPEGCVI+REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCER
Sbjct  440   VPEGCVILREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCER  499

Query  2025  RNFVVQGYHR  2054
             RNFVVQ YHR
Sbjct  500   RNFVVQRYHR  509



>emb|CDX90137.1| BnaA08g18470D [Brassica napus]
Length=579

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/485 (66%), Positives = 381/485 (79%), Gaps = 20/485 (4%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHR--IFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTI  797
             KP K  KE+E       I K A RKKVG+LLL  +SA VF+ VL+VGKGED + P  P++
Sbjct  32    KPSKMHKEREAGLLLPWICKLAGRKKVGMLLLFLISAVVFLRVLFVGKGEDGQVP--PSL  89

Query  798   SISAT-MKDREYSI---EPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPP  965
               + T + +  Y +   E EE  NI            G+ +   PP    ++F GYTLP 
Sbjct  90    HFNGTFVVNHSYMLPTNEEEESINIRNISFL------GLNAVLSPP----MHFLGYTLPQ  139

Query  966   GNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLs  1142
             G+PC  FTLPPPPAD+KRTGPRPCPVCYLPVEEAIALMP APSFSP+L  L Y++EE L+
Sbjct  140   GHPCNSFTLPPPPADRKRTGPRPCPVCYLPVEEAIALMPNAPSFSPLLKNLTYVYEEPLN  199

Query  1143  enefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEAC  1319
              +   G    GGYP+L+ R++S++IRE+MSVHCGFVKG +PGR T FDID+ DL EM+ C
Sbjct  200   RDTEFGGSDFGGYPTLKHRNDSFEIRETMSVHCGFVKGPQPGRNTGFDIDEADLLEMKQC  259

Query  1320  EGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWR  1499
              G+VVASA+F AFD +  P+NIS+Y+ E VCFYMFVDE TE+ L+    LNS+ ++G+WR
Sbjct  260   RGIVVASAVFDAFDDVKAPQNISKYSEETVCFYMFVDEETESILKRERGLNSNKKVGIWR  319

Query  1500  IVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNAS  1679
             +VVVH+LPY+D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDP+QILERFLWR+NA+
Sbjct  320   VVVVHNLPYSDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPHQILERFLWRKNAT  379

Query  1680  FAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGC  1859
             FAIS+HYKRFDV  EAEANKAAGK+DNASIDFQVEFYK EGLTP+S AK PITSDVPEGC
Sbjct  380   FAISKHYKRFDVLVEAEANKAAGKYDNASIDFQVEFYKNEGLTPYSVAKLPITSDVPEGC  439

Query  1860  VIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVV  2039
             VI+REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERRNFVV
Sbjct  440   VILREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCERRNFVV  499

Query  2040  QGYHR  2054
             Q YHR
Sbjct  500   QRYHR  504



>ref|XP_004485783.1| PREDICTED: uncharacterized protein LOC101495908 isoform X1 [Cicer 
arietinum]
 ref|XP_004485784.1| PREDICTED: uncharacterized protein LOC101495908 isoform X2 [Cicer 
arietinum]
Length=573

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/488 (68%), Positives = 383/488 (78%), Gaps = 15/488 (3%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTI  797
             RK  K FKEKE  FH I KFA RKKVG+L LC +SAAVFVWVLYVGKGED + G  +  I
Sbjct  31    RKQSKMFKEKERLFHWICKFAGRKKVGMLFLCVISAAVFVWVLYVGKGEDTQEGNGVENI  90

Query  798   SISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPC  977
             S++ +M     S  P          +       G A+    P  P  YF GY LPPG+PC
Sbjct  91    SVNESM---SISNSPS---------MISTAKIMGFATNLVLPLSPPNYFLGYNLPPGHPC  138

Query  978   EGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEETLsenef  1154
               FTLPPPPADKKRTGPRPCPVCYLPV+EAI LMP  PS SPVL  L +I+EE LS +  
Sbjct  139   NSFTLPPPPADKKRTGPRPCPVCYLPVDEAIGLMPKFPSPSPVLNKLTFIYEENLSRDGE  198

Query  1155  ggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVV  1331
              G    GGYP+L QR++S+DIRESM+VHCGFV+G+KPGR T FDID+ DL +ME C G+V
Sbjct  199   FGGSDFGGYPTLGQRNDSFDIRESMNVHCGFVRGIKPGRNTGFDIDEDDLLDMEQCRGIV  258

Query  1332  VASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVV  1511
             VASA+FG FD I++PKNISEY+++ VCF MFVDE TE +LR+SG L +S +IGLWRI+V 
Sbjct  259   VASAVFGNFDEINEPKNISEYSKQTVCFLMFVDEETEKYLRSSGRLGTSKKIGLWRIIVA  318

Query  1512  HDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAIS  1691
              +LPYTDARR+GKIPKLLLHR+ PNARYS+W+DGKLELVVDPYQILERFLWR NA+FAIS
Sbjct  319   RNLPYTDARRSGKIPKLLLHRMTPNARYSIWLDGKLELVVDPYQILERFLWRNNATFAIS  378

Query  1692  RHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIR  1871
             +HY+RFDVF EAEANKAA K+DNASIDFQ+EFYK EGLTP++ AK P+ SDVPEGCVIIR
Sbjct  379   KHYRRFDVFVEAEANKAAAKYDNASIDFQIEFYKNEGLTPYTEAKLPLISDVPEGCVIIR  438

Query  1872  EHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYH  2051
             EH+PISNLFTCLWFNEVDRFT RDQISFSTVRDK  SR +++  MFLDCERRNFVVQ YH
Sbjct  439   EHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKFLSRVDFHFHMFLDCERRNFVVQKYH  498

Query  2052  RDILEHRA  2075
             RD+LE  A
Sbjct  499   RDVLERLA  506



>ref|XP_010260203.1| PREDICTED: uncharacterized protein LOC104599390 [Nelumbo nucifera]
Length=593

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/521 (65%), Positives = 408/521 (78%), Gaps = 26/521 (5%)
 Frame = +3

Query  582   QHHFLSS------SFPIPPRKPLKT----FKEKEGWFHRIFKFAARKKVGLLLLCAVSAA  731
             Q H  +S      + P+  RKP K     ++EKE +  RIFKFA R++VG+LLL  VS  
Sbjct  17    QQHLQNSVVLPIQTTPVTLRKPSKMLLPGYREKEKFLPRIFKFAGRRRVGMLLLLVVSVV  76

Query  732   VFVWVLYV-GKGEDARGPEI----------PTISISATMKDREYSIEPEEKNNIHKTLLA  878
             VF+ VL V  K EDA    +          P+ SI+++  +    I  E+ N    + L+
Sbjct  77    VFISVLSVVNKDEDASEGVVHHTRMTQNIRPSDSIASSYPESSL-IHGEQYNKKDASSLS  135

Query  879   KPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPV  1058
             K   +R I +    PPLP V   G  L P +PCE FTLPPPPADKKRTGPRPCPVCY+PV
Sbjct  136   KTVVSR-IGANRLKPPLPPV-IMGTALLPSHPCEKFTLPPPPADKKRTGPRPCPVCYIPV  193

Query  1059  EEAIALMPTAPSFSPVLY-LNYIHEE-TLsenefggsgfggYPSLRQRDESYDIRESMSV  1232
             E+A+ALMP +PS SPVL  L+Y++EE ++    FGGS FGGYPSL+QR++S+DI+ESM+V
Sbjct  194   EQAMALMPKSPSMSPVLRNLSYVYEENSIRTEPFGGSEFGGYPSLKQRNDSFDIKESMNV  253

Query  1233  HCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVC  1412
             HCGFV+G KPG  T FDIDD DL EME C+G+VVASAIFG +D+I QPKNISE A++NVC
Sbjct  254   HCGFVRGRKPGHQTGFDIDDTDLLEMEQCQGIVVASAIFGNYDIIQQPKNISEAAKKNVC  313

Query  1413  FYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNAR  1592
             F+MFVDE TE ++RNS  L+ S+++GLWRIVVVH+LPY DARRNGK+PKLLLHR+FPN++
Sbjct  314   FFMFVDEETETYMRNSSVLDGSTKVGLWRIVVVHNLPYADARRNGKVPKLLLHRIFPNSQ  373

Query  1593  YSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASID  1772
             +S+WIDGKLELVVDPYQILERFLWR+NASFAISRHY+RFDVF+EAEANKAAGK+DNASID
Sbjct  374   FSIWIDGKLELVVDPYQILERFLWRKNASFAISRHYRRFDVFQEAEANKAAGKYDNASID  433

Query  1773  FQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQIS  1952
             +Q+EFYKKEGLTP+S AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVD FT RDQ+S
Sbjct  434   YQIEFYKKEGLTPYSQAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDHFTSRDQLS  493

Query  1953  FSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             FSTVRDKI S+ NW++ MFLDCERRNFVVQ YHRD+LEH A
Sbjct  494   FSTVRDKIMSKVNWSINMFLDCERRNFVVQAYHRDLLEHMA  534



>emb|CAN81089.1| hypothetical protein VITISV_008182 [Vitis vinifera]
Length=570

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/507 (68%), Positives = 387/507 (76%), Gaps = 33/507 (7%)
 Frame = +3

Query  609   PIPP--------RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKG  764
             P+PP        RKP K  KEKE + H I KFA RKKVG+LLLC VSAAVFVWVLYVGKG
Sbjct  38    PLPPPLPGYSLGRKPPKMVKEKERFVHWICKFAGRKKVGMLLLCVVSAAVFVWVLYVGKG  97

Query  765   EDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTD------QPPP  926
             EDAR  +    S+     +   +    +  +     L + NN+  + S         PPP
Sbjct  98    EDAREVD----SVGKLGANGSPAFVYTKSFSTRSLDLYRMNNSSFVRSESVAQPPPPPPP  153

Query  927   LPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPR-------------PCPVCYLPVEEA  1067
              P   F GY LPPG+PCE F LPPPPADKKRTGPR              CPVCYLPVEEA
Sbjct  154   PPAPVFLGYNLPPGHPCENFALPPPPADKKRTGPRHLQIAEFLLPYVSACPVCYLPVEEA  213

Query  1068  IALMPTAPSFSPVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCG  1241
             IALMP  PS SP+L  L +++EE L++ +  G    GGYPSL QR  SYDIRESM+VHCG
Sbjct  214   IALMPKYPSPSPLLNNLTFVYEENLTKGDSFGGSDFGGYPSLEQRANSYDIRESMTVHCG  273

Query  1242  FVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYM  1421
             FV+G KPG+ T F++DD DL EME C GVVVASAIFG +D+I QPKNIS+ A+ENVCFYM
Sbjct  274   FVRGAKPGQXTGFBMDDSDLFEMEQCHGVVVASAIFGNYDVIQQPKNISDAAKENVCFYM  333

Query  1422  FVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSL  1601
             FVDE TEA L+NS  L+ + R+GLWRIVVVH+LPY DARRNGK+PKLLLHR+FPNARYSL
Sbjct  334   FVDEETEAHLKNSSGLDDNKRVGLWRIVVVHNLPYNDARRNGKVPKLLLHRMFPNARYSL  393

Query  1602  WIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQV  1781
             WIDGKLELVVDP+QILERFLWR+NASFAISRHY+RFDVF EAEANKAA K+DNASIDFQV
Sbjct  394   WIDGKLELVVDPFQILERFLWRKNASFAISRHYRRFDVFVEAEANKAAAKYDNASIDFQV  453

Query  1782  EFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFST  1961
             EFYK EGLTP+S AK PITSDVPEGCVI+REHIPISNLFTCLWFNEVDRFT RDQISFST
Sbjct  454   EFYKSEGLTPYSEAKLPITSDVPEGCVIVREHIPISNLFTCLWFNEVDRFTSRDQISFST  513

Query  1962  VRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             VRDKIR++TNW V MFLDCERRNFVVQ
Sbjct  514   VRDKIRAKTNWTVNMFLDCERRNFVVQ  540



>ref|XP_006583819.1| PREDICTED: uncharacterized protein LOC100783387 isoform X1 [Glycine 
max]
Length=590

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/556 (61%), Positives = 400/556 (72%), Gaps = 48/556 (9%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-GPEIPTISISATMK  818
             KEKE  F  I KFA RKKVG+L LC +SAAVFVWVLYVGKGED++ G  +  I+++ ++ 
Sbjct  36    KEKERLFLWICKFAGRKKVGMLFLCLISAAVFVWVLYVGKGEDSQDGNTVTNINVNESVS  95

Query  819   DREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPP  998
               + + E    N +            G+       P P  YF GY LPPG+PC  FTLPP
Sbjct  96    TSDSTFENSMTNAM------------GLTKRLVLLPPPTGYFLGYHLPPGHPCNSFTLPP  143

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEETLsenefggsgf-g  1172
             PPADKKRTGPRPCPVCYLPVEEAI LMP  PS SPVL  L Y++EE LS +   G    G
Sbjct  144   PPADKKRTGPRPCPVCYLPVEEAIGLMPALPSPSPVLGNLTYVYEENLSRDGEFGGSDFG  203

Query  1173  gYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFG  1352
             GYP+L+QR++S+DIRESM+VHCGFV+G+KPGR T FDID  DL EME C+GVVVASAIFG
Sbjct  204   GYPTLKQRNDSFDIRESMTVHCGFVRGIKPGRNTGFDIDGADLFEMEQCDGVVVASAIFG  263

Query  1353  A--------------------------FDLIHQPKNISEYARENVCFYMFVDEGTEAFLR  1454
                                        FD+I++P NIS+Y+R+ VCF MFVDE TE +L 
Sbjct  264   LYYVISAFIYLFISLQLIVYQIYCSGNFDVINEPNNISDYSRKTVCFLMFVDEQTEKYLI  323

Query  1455  NSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVD  1634
             +SG L  S +IGLWR +V  +LPY DARR GKIPKLLLHRL PNARYS+W+DGKLELVVD
Sbjct  324   SSGKLGISKKIGLWRTIVARNLPYPDARRTGKIPKLLLHRLVPNARYSIWLDGKLELVVD  383

Query  1635  PYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF  1814
             PYQILERFLWR+NA+FAIS+HY+RFDVF EAEANKAAGK+DNASIDFQ+EFYKKEGLTP+
Sbjct  384   PYQILERFLWRKNATFAISKHYRRFDVFIEAEANKAAGKYDNASIDFQIEFYKKEGLTPY  443

Query  1815  SAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNW  1994
             + AK P+ SDVPEGCVI+REH+PISNLF CLWFNEVDRFT RDQISFSTVRDKI SR ++
Sbjct  444   TEAKLPLISDVPEGCVIVREHVPISNLFACLWFNEVDRFTSRDQISFSTVRDKILSRVDF  503

Query  1995  NVEMFLDCERRNFVVQGYHRD-ILEHRApppppppRATIRDGVLKTSKYSGATTKLL---  2162
             +  MFLDCERRNFVVQ YHRD +L    P  PPPP       VL+TS   GA + +    
Sbjct  504   HFNMFLDCERRNFVVQKYHRDLLLRLAPPASPPPPSPPPPLPVLETSPEKGANSPIRRGP  563

Query  2163  ARRIGDPRS---RHRQ  2201
              RR  D R+   RHR+
Sbjct  564   GRRGKDRRAGSRRHRK  579



>ref|XP_010499331.1| PREDICTED: uncharacterized protein LOC104776879 [Camelina sativa]
Length=587

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/486 (66%), Positives = 379/486 (78%), Gaps = 18/486 (4%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR---GPEIPT  794
             KP K  KE+EG  H I KF  RKK+G+LLL  +SA VF+ VLYVGKGED +   GP    
Sbjct  36    KPSKMQKEREGIVHWICKFVGRKKIGMLLLFLISAVVFLRVLYVGKGEDGQEVQGPPSLH  95

Query  795   ISISATMK-DREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQ---PPPLPRVYFTGYTLP  962
              + SA +       I  E+  NI          N  + + D    PPP P ++F GYTLP
Sbjct  96    FNGSAGVNFSNMLQINEEQNMNI---------GNISLKAKDVVVFPPPPPPMHFLGYTLP  146

Query  963   PGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETL  1139
              G+PC  F+LPPPPAD+KRTGPRPCPVCYLPVE+A++ MP+APSFSPVL  L YI+EE L
Sbjct  147   QGHPCNSFSLPPPPADRKRTGPRPCPVCYLPVEDAVSFMPSAPSFSPVLKNLTYIYEEPL  206

Query  1140  senefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEA  1316
             + +   G    GGYP+LR R++S+DI+E+MSVHCGFVKG +PGR T FDID+ DL EM+ 
Sbjct  207   NRDTEFGGSDFGGYPTLRHRNDSFDIKETMSVHCGFVKGPQPGRNTGFDIDEADLLEMKQ  266

Query  1317  CEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLW  1496
             C G+VVASA+F AFD +  P+NIS+Y+ E VCFYMFVDE TE  L+    L+ + ++G+W
Sbjct  267   CRGIVVASAVFDAFDDVKAPQNISKYSEETVCFYMFVDEETETILKKERGLDENKKVGIW  326

Query  1497  RIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNA  1676
             R+VVVH+LPY D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLWR+NA
Sbjct  327   RVVVVHNLPYLDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLWRKNA  386

Query  1677  SFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEG  1856
             +FAISRHYKRFDV  EAEANKAAGK+DNASIDFQV+FYK EGLTP+S AK PITSDVPEG
Sbjct  387   TFAISRHYKRFDVLVEAEANKAAGKYDNASIDFQVDFYKNEGLTPYSVAKLPITSDVPEG  446

Query  1857  CVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFV  2036
             CVI+REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERRNFV
Sbjct  447   CVILREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCERRNFV  506

Query  2037  VQGYHR  2054
             VQ YHR
Sbjct  507   VQRYHR  512



>gb|KEH31064.1| DUF616 family protein [Medicago truncatula]
Length=531

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/481 (67%), Positives = 370/481 (77%), Gaps = 28/481 (6%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCA--VSAAVFVWVLYVGKGEDAR-GPEIPTISI--S  806
             KEKE  F  IFKFA RKKVG+L LC   +SAAVF+WV YVGKGED+R G  + +I +  S
Sbjct  5     KEKEQLFLWIFKFAGRKKVGMLFLCLTLISAAVFIWVFYVGKGEDSREGNTVQSIRVNES  64

Query  807   ATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGF  986
              +M D    +  E+                 IA    PP     YF GY LP G+PC  F
Sbjct  65    VSMSDSLSEVSTEK-----------------IALLPSPPN----YFLGYHLPIGHPCNSF  103

Query  987   TLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggs  1163
             TLPPPPADKKRTGPRPCPVCYLPVEEAIA MPT  S SPVL  L Y++EE  S     G 
Sbjct  104   TLPPPPADKKRTGPRPCPVCYLPVEEAIARMPTLTSPSPVLQNLMYVYEENFSRGAEFGG  163

Query  1164  gf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVAS  1340
                GGYP+L+QR+ES+D+RESMSVHCGFV+G KPGR T FDID+ DL EM+ C GVVVAS
Sbjct  164   SEFGGYPTLKQRNESFDVRESMSVHCGFVRGTKPGRNTGFDIDEDDLLEMDQCNGVVVAS  223

Query  1341  AIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDL  1520
             AIFG FD I++PKNIS+Y+ + VCF MFVDE TE +LR SG L  S +IGLWR++V  +L
Sbjct  224   AIFGNFDEINEPKNISDYSGKTVCFLMFVDEETEKYLRGSGRLGISKKIGLWRVIVARNL  283

Query  1521  PYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHY  1700
             PYTDARR GKIPKLLLHRL PNARYS+W DGKLELV DPYQILERFLWR+NA+FAIS+HY
Sbjct  284   PYTDARRTGKIPKLLLHRLVPNARYSIWADGKLELVADPYQILERFLWRKNATFAISKHY  343

Query  1701  KRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHI  1880
             +RFDVF EAEANKAAGK+ NASID Q+EFYKKEGLTP++ AK P+ SDVPEGCVI+REH+
Sbjct  344   RRFDVFVEAEANKAAGKYKNASIDSQIEFYKKEGLTPYAEAKLPLISDVPEGCVIVREHV  403

Query  1881  PISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDI  2060
             PISNLFTCLWFNEVDRFT RDQ+SFSTVRDKI SR +++  MFLDCERRNFV+Q YHRD+
Sbjct  404   PISNLFTCLWFNEVDRFTSRDQLSFSTVRDKILSRVDFHFNMFLDCERRNFVIQKYHRDL  463

Query  2061  L  2063
             L
Sbjct  464   L  464



>ref|XP_010478192.1| PREDICTED: uncharacterized protein LOC104757163 [Camelina sativa]
Length=585

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/483 (65%), Positives = 371/483 (77%), Gaps = 12/483 (2%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARG----PEIP  791
             KP K  KE+EG  H I KF  RKK+G+LLL  +SA VF+ VLYVGKGED +     P + 
Sbjct  36    KPSKMQKEREGIVHWICKFVGRKKIGMLLLFLISAVVFLRVLYVGKGEDGQEVQGPPSLH  95

Query  792   TISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGN  971
                 S         I  ++  NI    L   +       +        ++F GYTLP G+
Sbjct  96    FNGSSGVHFSNMLEINEDQNMNIGNISLKAKDVVVFPPPSPP------MHFLGYTLPQGH  149

Query  972   PCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsen  1148
             PC  F+LPPPPAD+KRTGPRPCPVCYLPVE+A++ MP+APSFSPVL  L YI+EE L+ +
Sbjct  150   PCNSFSLPPPPADRKRTGPRPCPVCYLPVEDAVSFMPSAPSFSPVLKNLTYIYEEPLNRD  209

Query  1149  efggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
                G    GGYP+LR R++S+DI+E+MSVHCGFVKG +PGR T FDID+ DL EM+ C G
Sbjct  210   TEFGGSDFGGYPTLRHRNDSFDIKETMSVHCGFVKGPQPGRNTGFDIDEADLLEMKQCRG  269

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             +VVASA+F AFD +  P+NIS+Y+ E VCFYMFVDE TE  L+    L+ + ++G+WR+V
Sbjct  270   IVVASAVFDAFDDVKAPQNISKYSEETVCFYMFVDEDTERILKKERGLDENKKVGIWRVV  329

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             VVH+LPY D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDPYQILERFLWR+NA+FA
Sbjct  330   VVHNLPYLDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPYQILERFLWRKNATFA  389

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVI  1865
             ISRHYKRFDV  EAEANKAAGK+DNASIDFQV+FYK EGLTP+S AK PITSDVPEGCVI
Sbjct  390   ISRHYKRFDVLVEAEANKAAGKYDNASIDFQVDFYKNEGLTPYSVAKLPITSDVPEGCVI  449

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQG  2045
             +REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERRNFVVQ 
Sbjct  450   LREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCERRNFVVQR  509

Query  2046  YHR  2054
             YHR
Sbjct  510   YHR  512



>ref|XP_010272448.1| PREDICTED: uncharacterized protein LOC104608221 isoform X2 [Nelumbo 
nucifera]
Length=590

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/495 (65%), Positives = 385/495 (78%), Gaps = 19/495 (4%)
 Frame = +3

Query  615   PPRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVL-YVGKGEDARGPEIP  791
             PP+  L   +EKE + HRI KFA R++VG+LLL  +S  VF+ VL  V K ED       
Sbjct  38    PPKMLLSGSREKEKFLHRICKFAGRRRVGMLLLVVISGVVFMSVLSVVSKDEDTTEGVSH  97

Query  792   TISISATMKDREYSI--------------EPEEKNNIHKTLLAKPNNNR--GIASTDQPP  923
                +S  +K  +                   ++KN+I +  ++    N+         PP
Sbjct  98    HTRMSQNIKQNDSMAIKYPRPSLVHGEQESKKDKNSILQNAISISGQNKMQPPPPPPPPP  157

Query  924   PLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSP  1103
             P P +   G  LPPG+PCE FTLPPPPADKKRTGPRPCPVCYLPVE+AI  MP +PS SP
Sbjct  158   PPPPLIVGGTALPPGHPCEKFTLPPPPADKKRTGPRPCPVCYLPVEQAIVFMPKSPSTSP  217

Query  1104  VLY-LNYIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATS  1277
             VL  L+Y++EE  +    FGGS FGGYPSL+QR++S++I+ESM VHCGF++G KPGR T 
Sbjct  218   VLRNLSYVYEENPIRTEPFGGSEFGGYPSLKQRNDSFNIKESMVVHCGFIRGKKPGRGTG  277

Query  1278  FDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRN  1457
             FDIDD D  EME C+G+VVASAIFG +D++ QPK+IS+ A++N+CFYMFVDEGTEA++RN
Sbjct  278   FDIDDVDFFEMEQCQGIVVASAIFGNYDILQQPKSISDAAKKNICFYMFVDEGTEAYMRN  337

Query  1458  SGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDP  1637
             S  L+SS+++GLWRIVVVH+LPY DARRNGK+PKLLLHR+FPNARYS+WIDGKLELVVDP
Sbjct  338   SSVLDSSNKVGLWRIVVVHNLPYIDARRNGKVPKLLLHRIFPNARYSIWIDGKLELVVDP  397

Query  1638  YQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFS  1817
             YQILERFLWR+ ASFAISRHY+RFDVF+EAEANKAAGK+DNASID+QVEFYK+EGLTP+S
Sbjct  398   YQILERFLWRKKASFAISRHYRRFDVFQEAEANKAAGKYDNASIDYQVEFYKREGLTPYS  457

Query  1818  AAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWN  1997
              AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQISFSTVRDKI S+  W+
Sbjct  458   EAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQISFSTVRDKIMSKVKWS  517

Query  1998  VEMFLDCERRNFVVQ  2042
             + MFLDCERRNFVVQ
Sbjct  518   INMFLDCERRNFVVQ  532



>ref|XP_009109744.1| PREDICTED: uncharacterized protein LOC103835341 [Brassica rapa]
Length=579

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/485 (66%), Positives = 379/485 (78%), Gaps = 20/485 (4%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHR--IFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTI  797
             KP K  KE+E       I K A RKKVG+LLL  +SA VF+ VL+VGKGED + P  P++
Sbjct  32    KPSKMHKEREAGLLLPWICKLAGRKKVGMLLLFLISAVVFLRVLFVGKGEDGQVP--PSL  89

Query  798   SISAT-MKDREYSI---EPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPP  965
               + T + +  Y +   E EE  NI            G+ +   PP    ++F GYTLP 
Sbjct  90    HFNGTFVVNHSYMLPTNEEEESINIRNISFL------GLNAVLSPP----MHFLGYTLPQ  139

Query  966   GNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLs  1142
             G+PC  FTLPPPPAD+KRTGPRPCPVCYLPVEEAIALMP APSFSP+L  L Y++EE L+
Sbjct  140   GHPCNSFTLPPPPADRKRTGPRPCPVCYLPVEEAIALMPNAPSFSPLLKNLTYVYEEPLN  199

Query  1143  enefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEAC  1319
              +   G    GGYP+L+ R++S++IRE+MSVHCGFVKG +PGR T FDID+ DL EM+ C
Sbjct  200   RDTEFGGSDFGGYPTLKHRNDSFEIRETMSVHCGFVKGPQPGRNTGFDIDEADLLEMKQC  259

Query  1320  EGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWR  1499
              G+VVASA+F AFD +  P+NIS+ + E VCF MFVDE TE+ L+    LNS+ ++G+WR
Sbjct  260   RGIVVASAVFDAFDDVKAPQNISKCSEETVCFDMFVDEETESILKRERGLNSNKKVGIWR  319

Query  1500  IVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNAS  1679
             +VVVH+LPY+D RRNGK+PKLL+HR+FPNARYSLWIDGKLELVVDP+QILERFLWR+NA+
Sbjct  320   VVVVHNLPYSDGRRNGKVPKLLVHRMFPNARYSLWIDGKLELVVDPHQILERFLWRKNAT  379

Query  1680  FAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGC  1859
             FAIS+HYKRFDV  EAEANKAAGK+DNASIDFQVEFYK EGLTP+S AK PITSDVPEGC
Sbjct  380   FAISKHYKRFDVLVEAEANKAAGKYDNASIDFQVEFYKNEGLTPYSVAKLPITSDVPEGC  439

Query  1860  VIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVV  2039
             VI+REH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++TNW V MFLDCERRNFVV
Sbjct  440   VILREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKTNWTVSMFLDCERRNFVV  499

Query  2040  QGYHR  2054
             Q YHR
Sbjct  500   QRYHR  504



>ref|XP_007025609.1| F3H9.11 protein isoform 4 [Theobroma cacao]
 gb|EOY28231.1| F3H9.11 protein isoform 4 [Theobroma cacao]
Length=516

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/447 (69%), Positives = 357/447 (80%), Gaps = 5/447 (1%)
 Frame = +3

Query  747   LYVG--KGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQP  920
             +Y G   GED     +P ++ S  + +    +  E ++       + P    G      P
Sbjct  5     IYFGLFTGEDQESDNVPKVNDSLPLNNSGSPLINEVQSVRIDNWTSLPVIVEGTEVRVMP  64

Query  921   PPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFS  1100
             PP P  YF GYTLPPG+PC  F+LPPPPADKKRTGPRPCPVCYLPVE+AIALMP  PSFS
Sbjct  65    PPPPS-YFLGYTLPPGHPCATFSLPPPPADKKRTGPRPCPVCYLPVEDAIALMPKVPSFS  123

Query  1101  PVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRAT  1274
             PV+  L YI+EE L++    G    GGYP+L+QRD+SYDIRESM+VHCGFVKG KPG  T
Sbjct  124   PVVKNLTYIYEENLNKETEFGGSDFGGYPTLKQRDDSYDIRESMNVHCGFVKGSKPGHGT  183

Query  1275  SFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLR  1454
              FDIDD DL EME C GVVVASAIFGAFD+I QPKNISEY+++ +CFYMF DE TEA L+
Sbjct  184   GFDIDDNDLLEMEKCHGVVVASAIFGAFDIIQQPKNISEYSKQTICFYMFADEETEADLK  243

Query  1455  NSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVD  1634
              +  L  S +IG+WRIVVV +LPYTD RRNGKIPKLL HRLFPNAR+SLWIDGKLELV D
Sbjct  244   ANRGLGESKKIGVWRIVVVRNLPYTDGRRNGKIPKLLPHRLFPNARFSLWIDGKLELVAD  303

Query  1635  PYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF  1814
             PYQILERFLWR+NA+FAISRHYKRFDVF+EAEANKAAGK+DNASIDFQV+FYKKEGLTP+
Sbjct  304   PYQILERFLWRKNATFAISRHYKRFDVFDEAEANKAAGKYDNASIDFQVDFYKKEGLTPY  363

Query  1815  SAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNW  1994
             S AK PITSDVPEGCVIIREH+PISNLFTCLWFN+VDRFT RDQISFSTVRDKI ++TNW
Sbjct  364   SEAKLPITSDVPEGCVIIREHVPISNLFTCLWFNDVDRFTSRDQISFSTVRDKIAAKTNW  423

Query  1995  NVEMFLDCERRNFVVQGYHRDILEHRA  2075
             +V MFLDCERRNFVVQ +H+++L H A
Sbjct  424   SVNMFLDCERRNFVVQKHHKEVLAHLA  450



>ref|XP_007025607.1| F3H9.11 protein isoform 2 [Theobroma cacao]
 gb|EOY28229.1| F3H9.11 protein isoform 2 [Theobroma cacao]
Length=511

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/440 (70%), Positives = 354/440 (80%), Gaps = 3/440 (1%)
 Frame = +3

Query  762   GEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVY  941
             GED     +P ++ S  + +    +  E ++       + P    G      PPP P  Y
Sbjct  7     GEDQESDNVPKVNDSLPLNNSGSPLINEVQSVRIDNWTSLPVIVEGTEVRVMPPPPPS-Y  65

Query  942   FTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LN  1118
             F GYTLPPG+PC  F+LPPPPADKKRTGPRPCPVCYLPVE+AIALMP  PSFSPV+  L 
Sbjct  66    FLGYTLPPGHPCATFSLPPPPADKKRTGPRPCPVCYLPVEDAIALMPKVPSFSPVVKNLT  125

Query  1119  YIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDK  1295
             YI+EE L++    G    GGYP+L+QRD+SYDIRESM+VHCGFVKG KPG  T FDIDD 
Sbjct  126   YIYEENLNKETEFGGSDFGGYPTLKQRDDSYDIRESMNVHCGFVKGSKPGHGTGFDIDDN  185

Query  1296  DLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNS  1475
             DL EME C GVVVASAIFGAFD+I QPKNISEY+++ +CFYMF DE TEA L+ +  L  
Sbjct  186   DLLEMEKCHGVVVASAIFGAFDIIQQPKNISEYSKQTICFYMFADEETEADLKANRGLGE  245

Query  1476  SSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILER  1655
             S +IG+WRIVVV +LPYTD RRNGKIPKLL HRLFPNAR+SLWIDGKLELV DPYQILER
Sbjct  246   SKKIGVWRIVVVRNLPYTDGRRNGKIPKLLPHRLFPNARFSLWIDGKLELVADPYQILER  305

Query  1656  FLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPI  1835
             FLWR+NA+FAISRHYKRFDVF+EAEANKAAGK+DNASIDFQV+FYKKEGLTP+S AK PI
Sbjct  306   FLWRKNATFAISRHYKRFDVFDEAEANKAAGKYDNASIDFQVDFYKKEGLTPYSEAKLPI  365

Query  1836  TSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLD  2015
             TSDVPEGCVIIREH+PISNLFTCLWFN+VDRFT RDQISFSTVRDKI ++TNW+V MFLD
Sbjct  366   TSDVPEGCVIIREHVPISNLFTCLWFNDVDRFTSRDQISFSTVRDKIAAKTNWSVNMFLD  425

Query  2016  CERRNFVVQGYHRDILEHRA  2075
             CERRNFVVQ +H+++L H A
Sbjct  426   CERRNFVVQKHHKEVLAHLA  445



>ref|XP_010915933.1| PREDICTED: uncharacterized protein LOC105040886 [Elaeis guineensis]
Length=600

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/514 (62%), Positives = 387/514 (75%), Gaps = 30/514 (6%)
 Frame = +3

Query  597   SSSFPIPPRKP----LKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFV-WVLYVGK  761
             S+S  +  RKP    L++ +EKE +   I K A R+K+G+LL+   SAAV + ++  + K
Sbjct  31    STSVSVSIRKPQKMLLQSSREKERFLLWICKLAGRRKIGMLLVLIASAAVILSFISAMSK  90

Query  762   GEDARGPEIPTISISA---------TMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTD  914
              EDA   E+P  ++ +         T K   +++ P   +          N+N+  AS D
Sbjct  91    DEDAS--EVPQTNLDSSYHVWGLVSTGKTALHNVTPPLTSVKESKTEITANSNQQSASGD  148

Query  915   ---QP--PPLP-RVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIAL  1076
                QP  P LP    FT +      PCE F+  PPPAD+KRTGPRPCPVCY+P E+A+  
Sbjct  149   NETQPSVPVLPLSATFTRH------PCENFSFSPPPADRKRTGPRPCPVCYIPAEQAMVF  202

Query  1077  MPTAPSFSPVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVK  1250
             MP  PS SPVL  L Y+ EE L+ NE  G    GG+PSL+QR+ES+DIRESMSVHCGFV+
Sbjct  203   MPALPSASPVLKNLTYVSEENLAVNETNGGTIFGGHPSLQQRNESFDIRESMSVHCGFVR  262

Query  1251  GVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVD  1430
             G KPG+ T FDIDD DL EME C GVVVASAIFG +D++ QP+NISEYA+ N CFYMFVD
Sbjct  263   GKKPGQGTGFDIDDADLREMEQCRGVVVASAIFGNYDMMQQPRNISEYAKRNACFYMFVD  322

Query  1431  EGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWID  1610
             E TEA+++N+ +L+S  R+GLWR+VVV +LPY DARRNGK+PKLLLHRLFPN R+SLWID
Sbjct  323   EETEAYIKNTTNLDSIQRVGLWRVVVVRNLPYVDARRNGKVPKLLLHRLFPNVRFSLWID  382

Query  1611  GKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFY  1790
             GKLELVVDPYQILERFLWR+NA+FAISRHY+RFDVFEEAEANKAAGK+DNASID Q+EFY
Sbjct  383   GKLELVVDPYQILERFLWRKNATFAISRHYRRFDVFEEAEANKAAGKYDNASIDHQIEFY  442

Query  1791  KKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRD  1970
             K+EGLT +S AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRD
Sbjct  443   KREGLTHYSLAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRD  502

Query  1971  KIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHR  2072
             KI SR NW++ MF+DCERRNFVVQ YHRD+LE R
Sbjct  503   KIMSRVNWSINMFMDCERRNFVVQAYHRDLLEQR  536



>ref|XP_010924642.1| PREDICTED: uncharacterized protein LOC105047426 [Elaeis guineensis]
Length=602

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/511 (61%), Positives = 382/511 (75%), Gaps = 18/511 (4%)
 Frame = +3

Query  582   QHHFLSSSFPIPPRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFV-WVLYVG  758
             Q    S S   PP+  L++ +EKE +   I K A R+K+G+LLL   SAAV + ++  + 
Sbjct  30    QSTSCSVSVRKPPKMLLQSSREKERFLPWICKLAGRRKIGMLLLLVASAAVVLSFISAMS  89

Query  759   KGEDARGPEIPTISISATMKD---------REYS--IEPEEKNNIHKTLLAKPNNNRGIA  905
             K EDA       +  S  ++          R ++    P ++NN   T  A PN      
Sbjct  90    KDEDASEGLQTNLGSSYHVRGLKRTGGTALRNFTPPFTPVKENNTEIT--AIPNQQSASG  147

Query  906   STDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPT  1085
              ++  PP+P       T+   +PCE F+  PPP D+KRTGPRPCPVCY+PVE+A+  MP 
Sbjct  148   DSETQPPVP--VLPRRTIFIHHPCENFSFSPPPTDRKRTGPRPCPVCYIPVEQAMTFMPA  205

Query  1086  APSFSPVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVK  1259
             +PS SPVL  L Y+ EETL+ N+  G    GG+PSL+QR+ES+DIRESM VHCGFV+G K
Sbjct  206   SPSVSPVLKNLTYVSEETLTVNKTNGGSIFGGHPSLQQRNESFDIRESMIVHCGFVRGKK  265

Query  1260  PGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGT  1439
             PG+ T FDIDD DL EME C GVVVASAIFG +D++ QP+NISEYA+ N CFYMFVD+ T
Sbjct  266   PGQGTGFDIDDADLLEMEQCRGVVVASAIFGNYDVMQQPRNISEYAKRNACFYMFVDKET  325

Query  1440  EAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKL  1619
             E +++N+ +L+S  R+GLWR+VVV +LPY DARRNGK+PKLLLHRLFPNAR+SLWIDGKL
Sbjct  326   EYYIKNTTNLDSIQRVGLWRVVVVRNLPYVDARRNGKVPKLLLHRLFPNARFSLWIDGKL  385

Query  1620  ELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKE  1799
             ELVVDPYQILERFLWR+NA+FAISRHY+RFDVFEEAEANKAAGK+DNASIDFQVEFY +E
Sbjct  386   ELVVDPYQILERFLWRKNATFAISRHYRRFDVFEEAEANKAAGKYDNASIDFQVEFYMRE  445

Query  1800  GLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIR  1979
             GL  +S AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKI 
Sbjct  446   GLMHYSPAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIM  505

Query  1980  SRTNWNVEMFLDCERRNFVVQGYHRDILEHR  2072
             S+ NW + MF+DCERRNFVVQ YHRD+LE R
Sbjct  506   SKVNWGINMFMDCERRNFVVQAYHRDLLEQR  536



>ref|XP_009394836.1| PREDICTED: uncharacterized protein LOC103980235 [Musa acuminata 
subsp. malaccensis]
Length=599

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/503 (63%), Positives = 374/503 (74%), Gaps = 13/503 (3%)
 Frame = +3

Query  597   SSSFPIPPRK----PLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKG  764
             + S P+P RK     L   ++KE    RIFKFA R+KVG+LLL   SAAV  ++  V K 
Sbjct  28    TQSPPLPVRKTSKMSLSGSRDKEKILPRIFKFAGRRKVGMLLLLVASAAVLSFISAVTKD  87

Query  765   EDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPN----NNRGIASTDQPPPLP  932
             ED      P   +  T   R +        N  K L A       N+   A+ +      
Sbjct  88    EDTS--VSPESRMGFTDHVRNFVNPSRPSFNNFKPLFAPAKVTEVNSTSYANHESANTHN  145

Query  933   RVYFTGYTLPPG-NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL  1109
             +   +   LPP  +PCE FTLPPPPADKKRTGPRPCPVCY+PVE+A+ LMP +PS SP+L
Sbjct  146   KTQLSIPILPPTPHPCESFTLPPPPADKKRTGPRPCPVCYVPVEQAVLLMPPSPSASPIL  205

Query  1110  Y-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFD  1283
               L+Y  E+ L  NE  G    GG+PSL  R+ES++I+ESM VHCGFVKG +PG+ T FD
Sbjct  206   KDLSYYSEDNLIANESNGGSIFGGHPSLLHRNESFNIKESMMVHCGFVKGKRPGQGTGFD  265

Query  1284  IDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSG  1463
             I+D DL EME C  VV+ASAIFG +D++ QPKNISEYA+ N CFYMFVDE TEA+++NS 
Sbjct  266   INDTDLLEMEECHDVVIASAIFGNYDIMQQPKNISEYAKRNACFYMFVDEETEAYIKNSS  325

Query  1464  DLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQ  1643
              L  + R+GLWR+VVV +LPY DARRNGK+PKLLL RLFPNAR+SLWIDGKLELVVDPYQ
Sbjct  326   GLVDTKRVGLWRVVVVQNLPYDDARRNGKVPKLLLQRLFPNARFSLWIDGKLELVVDPYQ  385

Query  1644  ILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAA  1823
             +LERFLWR+N +FAISRHY+RFDVFEEAEANKAAGK+DNASID Q+EFYKKEGLTP+S +
Sbjct  386   VLERFLWRKNYTFAISRHYRRFDVFEEAEANKAAGKYDNASIDSQIEFYKKEGLTPYSLS  445

Query  1824  KFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVE  2003
             K PITSDVPEGCVII+EHIPI+NLFTCLWFNEVDRFT RDQISFSTVRDKI S+ NW + 
Sbjct  446   KIPITSDVPEGCVIIKEHIPITNLFTCLWFNEVDRFTSRDQISFSTVRDKIMSQVNWTIN  505

Query  2004  MFLDCERRNFVVQGYHRDILEHR  2072
             MF+DCERRNFVVQ YHRD+LE R
Sbjct  506   MFMDCERRNFVVQAYHRDLLEQR  528



>ref|XP_009141342.1| PREDICTED: uncharacterized protein LOC103865296 isoform X1 [Brassica 
rapa]
Length=548

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/479 (64%), Positives = 366/479 (76%), Gaps = 22/479 (5%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISI  803
             KP K +KEKE     IFKF  R+K  L +   ++  VF+ VLYV  GED +  E+P    
Sbjct  19    KPSKMYKEKEDVVRWIFKFVGRRKKILFI---ITTLVFIRVLYVWHGEDGQKVEVP----  71

Query  804   SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEG  983
                      +   E  +NIH  L    ++    A   +P P P  YF GYTLPP +PC  
Sbjct  72    ------HSKTTNKEPLSNIHNNL----SHVVKAAKVYRPRPPP--YFRGYTLPPNHPCNR  119

Query  984   FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefgg  1160
             FTLPPPPADKKRTGPRPCPVCYLP+EEAIALMP++PSFSP+L  L YIHE+ L+     G
Sbjct  120   FTLPPPPADKKRTGPRPCPVCYLPLEEAIALMPSSPSFSPILKNLTYIHEKPLNRKTEFG  179

Query  1161  sgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVA  1337
                 GGYP+L+QR  S++I+ SMSVHCGFVKG +PGR T FDI++KDL EM+ C G+VVA
Sbjct  180   GSDFGGYPTLKQRRRSFNIKGSMSVHCGFVKGRQPGRGTGFDINEKDLLEMKRCRGIVVA  239

Query  1338  SAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLN-SSSRIGLWRIVVVH  1514
             S +F AFD +  P NIS+Y+ + VCF+MF+DE TE+ L+     N ++ ++GLWR+VVVH
Sbjct  240   STVFDAFDDVKSPSNISKYSEQTVCFFMFIDEKTESSLKRDKKFNRTTKKVGLWRVVVVH  299

Query  1515  DLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISR  1694
             +LPYTD RRNGK+PKLL+HRLFPN+RYSLW+DGKL+LVVDP+QILERFLWR N +FAISR
Sbjct  300   NLPYTDGRRNGKVPKLLVHRLFPNSRYSLWMDGKLDLVVDPHQILERFLWRENVTFAISR  359

Query  1695  HYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIRE  1874
             HYKRFDVF EAEANKAAGK+ NASIDFQV+FYKKEGLTP+S AK PITSDVPEGCVI+RE
Sbjct  360   HYKRFDVFVEAEANKAAGKYANASIDFQVDFYKKEGLTPYSTAKLPITSDVPEGCVILRE  419

Query  1875  HIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYH  2051
             H+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI +RT WNV MFLDC+RRNFVVQ YH
Sbjct  420   HVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAARTKWNVSMFLDCQRRNFVVQRYH  478



>ref|XP_008792270.1| PREDICTED: uncharacterized protein LOC103708934 [Phoenix dactylifera]
Length=602

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/508 (61%), Positives = 380/508 (75%), Gaps = 22/508 (4%)
 Frame = +3

Query  597   SSSFPIPPRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFV-WVLYVGKGEDA  773
             S S   PP+  L++ +EKE +   I K A R+K+G+LLL   SAAV + ++  + K EDA
Sbjct  35    SVSVRKPPKMLLQSSREKERFLPWICKLAGRRKIGMLLLLVASAAVVLSFIPAMSKDEDA  94

Query  774   -RGPEIPTISI----------SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQP  920
               GP+    S              +++      P ++N    T +    +  G   T  P
Sbjct  95    SEGPQTNLGSSYHVWGLVRTGGTALRNFTPPFTPVKENKTEITAMPNQQSASGDNETQPP  154

Query  921   PPL--PRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPS  1094
              P+  PR  F  +      PCE F+  PPP D+KRTGPRPCPVCY+P+E+A+  MP  PS
Sbjct  155   APVLPPRAIFIHH------PCENFSFSPPPTDRKRTGPRPCPVCYIPIEQAMTFMPALPS  208

Query  1095  FSPVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGR  1268
              SPVL  L Y+ EE L+EN+  G    GG+PSL+QR+ES+DIRESM+VHCGFV G KPG+
Sbjct  209   VSPVLKNLTYVSEEKLTENKTNGGSLFGGHPSLQQRNESFDIRESMTVHCGFVGGKKPGQ  268

Query  1269  ATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAF  1448
              T FDIDD DL +ME C GVVVASAIFG +D++ QP+NISEYA+ N CFYMFVD+ TE +
Sbjct  269   GTGFDIDDADLLDMEQCRGVVVASAIFGNYDVMQQPRNISEYAKRNACFYMFVDKETENY  328

Query  1449  LRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELV  1628
             ++N+ +L+S  R+GLWR+VVV +LPY DARRNGK+PKLLLHRLFPNAR+SLWIDGKLELV
Sbjct  329   IKNTTNLDSIWRVGLWRVVVVRNLPYVDARRNGKVPKLLLHRLFPNARFSLWIDGKLELV  388

Query  1629  VDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLT  1808
             VDPYQILERFLWR+NA+FAISRHY+RFDVFEEAEANKAAGK+DNASID+Q+EFYK+EGLT
Sbjct  389   VDPYQILERFLWRKNATFAISRHYRRFDVFEEAEANKAAGKYDNASIDYQIEFYKREGLT  448

Query  1809  PFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRT  1988
              +S AK P+TSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKI  R 
Sbjct  449   HYSPAKLPVTSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIMFRV  508

Query  1989  NWNVEMFLDCERRNFVVQGYHRDILEHR  2072
             NW++ MF+DCERRNFVVQ YH+D+LE R
Sbjct  509   NWSISMFMDCERRNFVVQAYHKDLLEQR  536



>ref|XP_008383733.1| PREDICTED: uncharacterized protein LOC103446403 [Malus domestica]
Length=576

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/378 (76%), Positives = 325/378 (86%), Gaps = 2/378 (1%)
 Frame = +3

Query  942   FTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LN  1118
             F GYTLPPG+PC  FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  PS+SPVL  L 
Sbjct  122   FLGYTLPPGHPCNTFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPKVPSYSPVLKNLT  181

Query  1119  YIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDK  1295
             YI+EE LS     G    GGYP+L+QR +SYDIRESMSVHCGFV+G KPGR T +D+D+ 
Sbjct  182   YIYEENLSRKTEFGGSEFGGYPTLKQRSDSYDIRESMSVHCGFVRGSKPGRNTGYDLDEI  241

Query  1296  DLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNS  1475
             DL +ME C GVVVASAIFG FD I+QP+NIS+Y++E VCFYMF+D+ TEA+LR SG +  
Sbjct  242   DLNDMEQCNGVVVASAIFGNFDEINQPRNISDYSKETVCFYMFIDDVTEAYLRTSGKMGG  301

Query  1476  SSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILER  1655
               ++G+WR VVVH+ PYTD RR GKIPKLL+HR+FPNAR+SLWIDGKLELVVDPYQILER
Sbjct  302   DRKVGIWRTVVVHNPPYTDGRRTGKIPKLLVHRMFPNARFSLWIDGKLELVVDPYQILER  361

Query  1656  FLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPI  1835
             FLWR+NA+FAISRHYKRFDVF EAEANKAAGK+DNASIDFQVEFYKKEGLTP+S  K PI
Sbjct  362   FLWRKNATFAISRHYKRFDVFTEAEANKAAGKYDNASIDFQVEFYKKEGLTPYSEEKLPI  421

Query  1836  TSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLD  2015
             TSDVPEGCVIIREH+PISNL  CLWF+EVDRFT RDQISFSTVRD IR +TNW + MF D
Sbjct  422   TSDVPEGCVIIREHVPISNLAACLWFHEVDRFTSRDQISFSTVRDHIREKTNWTINMFYD  481

Query  2016  CERRNFVVQGYHRDILEH  2069
             CERRNFVVQ YHRD+LEH
Sbjct  482   CERRNFVVQKYHRDVLEH  499



>emb|CDY37692.1| BnaA04g19760D [Brassica napus]
Length=548

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/479 (64%), Positives = 364/479 (76%), Gaps = 22/479 (5%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISI  803
             KP K +KEKE     IFKF  R+K  L +   ++  VF+ VLYV  GED +  E P    
Sbjct  19    KPSKLYKEKEDVVRWIFKFVGRRKKILFI---ITTLVFIRVLYVWHGEDGQKVEAP----  71

Query  804   SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEG  983
                      +   E  +NIH  L    ++    A   +P P P  YF GYTL P +PC  
Sbjct  72    ------HSETTNKEPLSNIHNNL----SHVVKAAKVYRPRPPP--YFRGYTLSPDHPCNR  119

Query  984   FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefgg  1160
             FTLPPPPADKKRTGPRPCPVCYLP+EEAIALMP++PSFSP+L  L YIHE+ L+     G
Sbjct  120   FTLPPPPADKKRTGPRPCPVCYLPLEEAIALMPSSPSFSPILKNLTYIHEKPLNRKTEFG  179

Query  1161  sgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVA  1337
                 GGYP+L+QR  S++I+ SMSVHCGFVKG +PGR T FDI++KDL EM+ C G+VVA
Sbjct  180   GSDFGGYPTLKQRRRSFNIKGSMSVHCGFVKGRQPGRGTGFDINEKDLLEMKRCRGIVVA  239

Query  1338  SAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLN-SSSRIGLWRIVVVH  1514
             S +F AFD +  P NIS+Y+ + VCF+MF+DE TE+ L+     N ++ ++GLWR+VVVH
Sbjct  240   STVFDAFDDVKSPSNISKYSEQTVCFFMFIDEKTESSLKRDKKFNRTTKKVGLWRVVVVH  299

Query  1515  DLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISR  1694
             +LPYTD RRNGK+PKLL+HRLFPN+RYSLW+DGKL+LVVDP+QILERFLWR N +FAISR
Sbjct  300   NLPYTDGRRNGKVPKLLVHRLFPNSRYSLWMDGKLDLVVDPHQILERFLWRENVTFAISR  359

Query  1695  HYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIRE  1874
             HYKRFDVF EAEANKAAGK+ NASIDFQV+FYKKEGLTP+S AK PITSDVPEGCVI+RE
Sbjct  360   HYKRFDVFVEAEANKAAGKYANASIDFQVDFYKKEGLTPYSTAKLPITSDVPEGCVILRE  419

Query  1875  HIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYH  2051
             H+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI +RT WNV MFLDC+RRNFVVQ YH
Sbjct  420   HVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAARTKWNVSMFLDCQRRNFVVQRYH  478



>ref|XP_009395983.1| PREDICTED: uncharacterized protein LOC103981108 [Musa acuminata 
subsp. malaccensis]
Length=601

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/494 (62%), Positives = 368/494 (74%), Gaps = 15/494 (3%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTIS  800
             R  L   +EKE    RIFKFA R+KVG+LLL   SAAV  ++  V K EDA       + 
Sbjct  41    RMSLSGSREKERILPRIFKFAGRRKVGMLLLLVASAAVLSFISVVSKDEDASVSPESRMG  100

Query  801   ISATMKDREYSIEPEEKN-------NIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTL  959
              +  +      + P   +           T+ +  N N   A+T         + +   L
Sbjct  101   FTDHVWKFVNPVRPSRNDFSPPFIPAKETTVDSTSNTNHESATTHN-----VTHLSVPIL  155

Query  960   PPG-NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEE  1133
             PP  +PCE F+LPPPPADKKRTGPRPCPVCY+PVE+A+ LMP +PS SP L  L+Y  E+
Sbjct  156   PPMPHPCESFSLPPPPADKKRTGPRPCPVCYVPVEQAVLLMPPSPSASPFLKNLSYFSED  215

Query  1134  TLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEM  1310
              L  +E  G    GGYPSL QR+ES++I+ESM VHCGF KG KPGR T FDI++ DL EM
Sbjct  216   NLIASESNGGSVFGGYPSLLQRNESFNIKESMMVHCGFAKGKKPGRETGFDINETDLLEM  275

Query  1311  EACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIG  1490
             E C  VVVASAIFG +D++ QPKNISEYA+ N CFYMFVDE TE +++NS  L  + R+G
Sbjct  276   EECHDVVVASAIFGKYDVMQQPKNISEYAKRNACFYMFVDEETELYIKNSSGLVDTKRVG  335

Query  1491  LWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRR  1670
             LW +VVV +LP+ DARRNGK+PKLLLHRLFPNAR+SLWIDGKL+LVVDPYQ+LERFLWR+
Sbjct  336   LWIVVVVRNLPFVDARRNGKVPKLLLHRLFPNARFSLWIDGKLKLVVDPYQVLERFLWRK  395

Query  1671  NASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVP  1850
             N++FAIS+HY+RFDVF EAEANKAAGK+DNASID+Q+EFYKKEGLTP+S +K PITSDVP
Sbjct  396   NSTFAISKHYRRFDVFVEAEANKAAGKYDNASIDYQIEFYKKEGLTPYSLSKLPITSDVP  455

Query  1851  EGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRN  2030
             EGCVII+EHIPI+NLFTCLWFNEVDRFT RDQISFSTVRD+I S+ NW + MF+DCERRN
Sbjct  456   EGCVIIKEHIPITNLFTCLWFNEVDRFTSRDQISFSTVRDRIMSQVNWTINMFMDCERRN  515

Query  2031  FVVQGYHRDILEHR  2072
             FVVQ YHRD+LE R
Sbjct  516   FVVQEYHRDLLEQR  529



>emb|CDY53782.1| BnaC04g44140D [Brassica napus]
Length=516

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/479 (64%), Positives = 363/479 (76%), Gaps = 22/479 (5%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISI  803
             KP K +KEKE     IFKF  R+K  L +   +S  VF+ VLYV  GE+ +  E P    
Sbjct  19    KPSKMYKEKEDVVRWIFKFVGRRKKILFI---ISILVFIRVLYVWHGEEGQKVEAP----  71

Query  804   SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEG  983
                      S   E  +NIH  L      ++  A   +PPP    YF GYTLPP +PC  
Sbjct  72    ------HSDSTNKEPLSNIHNNLSYVGKASK--AFRPRPPP----YFRGYTLPPDHPCNR  119

Query  984   FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefgg  1160
             F LPPPPADKKRTGPRPCPVCYLP+EEAIALMP++PSFSP+L  L YIHE+ L+     G
Sbjct  120   FKLPPPPADKKRTGPRPCPVCYLPLEEAIALMPSSPSFSPILKNLTYIHEKPLNRKTEFG  179

Query  1161  sgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVA  1337
                 GGYP+L+QR   ++I+ +MSVHCGFVKG +PGR T FDI++KDL EM+ C G+VVA
Sbjct  180   GSDFGGYPTLKQRRRYFNIKGTMSVHCGFVKGRQPGRGTGFDINEKDLLEMKRCRGIVVA  239

Query  1338  SAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLN-SSSRIGLWRIVVVH  1514
             S +F AFD +  P NIS+Y+ + VCF+MF+DE TE+ L+     N ++ ++GLWRIVVVH
Sbjct  240   STVFDAFDDVKSPSNISKYSEQTVCFFMFIDEKTESSLKRDKRFNRTTKKVGLWRIVVVH  299

Query  1515  DLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISR  1694
             +LPYTD RRNGK+PKLL+HRLFPN+RYSLW+DGKL+LVVDP+QILERFLWR N +FAISR
Sbjct  300   NLPYTDGRRNGKVPKLLVHRLFPNSRYSLWMDGKLDLVVDPHQILERFLWRENVTFAISR  359

Query  1695  HYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIRE  1874
             HYKRFDVF EAEANKAAGK+ NASIDFQV+FYKKEGLTP+S AK P+TSDVPEGCVI+RE
Sbjct  360   HYKRFDVFVEAEANKAAGKYANASIDFQVDFYKKEGLTPYSTAKLPVTSDVPEGCVILRE  419

Query  1875  HIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYH  2051
             H+PISNLFTCLWFNEVDRFT RDQISFSTVRDKI +RT WNV MFLDC+RRNFVVQ YH
Sbjct  420   HVPISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAARTKWNVSMFLDCQRRNFVVQRYH  478



>ref|XP_006410522.1| hypothetical protein EUTSA_v10017801mg [Eutrema salsugineum]
 gb|ESQ51975.1| hypothetical protein EUTSA_v10017801mg [Eutrema salsugineum]
Length=544

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/477 (64%), Positives = 364/477 (76%), Gaps = 18/477 (4%)
 Frame = +3

Query  633   KTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISAT  812
             K  KEKE   H IFKF+ R+K  L L   +S  VF+ +LYV +GED +  E+P     + 
Sbjct  22    KMHKEKEHIVHWIFKFSRRRKKILFL---ISTLVFIRLLYVWRGEDGQDIEVPPSQHFSV  78

Query  813   MKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTL  992
             + ++E     + +NN+     A        A   +PPP    YF GY LP  +PC  FTL
Sbjct  79    ITNKEQI--SDIQNNLSYVRKAVK------AYRPRPPP----YFHGYKLPQEHPCNRFTL  126

Query  993   PPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgf  1169
             PPPPADKKRTGPRPCPVCYLP+EEAIAL+P++PSFSPVL  L YIHEE L+     G   
Sbjct  127   PPPPADKKRTGPRPCPVCYLPLEEAIALIPSSPSFSPVLKNLTYIHEEPLNRKTEFGGSD  186

Query  1170  -ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAI  1346
              GGYP+L+QR  S++I+ SMSVHCGFVKG +PGR T FDID+ DL EM+ C G+VVAS +
Sbjct  187   FGGYPTLKQRRRSFNIKGSMSVHCGFVKGPEPGRGTGFDIDETDLLEMKRCRGIVVASTV  246

Query  1347  FGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSS-SRIGLWRIVVVHDLP  1523
             F AFD +  P NIS+Y+ + VCF+MFVDE TE+ L+     NS+ S++GLWR+VVVH+LP
Sbjct  247   FDAFDDVKSPSNISKYSEQTVCFFMFVDEKTESSLKRDKSFNSTTSKVGLWRVVVVHNLP  306

Query  1524  YTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYK  1703
             YTD RRNGK+PKLL+HRLFPN+RYS+W+DGKL+LVVDP+QILERFLWR N +FAISRHYK
Sbjct  307   YTDGRRNGKVPKLLVHRLFPNSRYSIWVDGKLDLVVDPHQILERFLWRENVTFAISRHYK  366

Query  1704  RFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIP  1883
             RFDVF EAEANKAAGK+ NASIDFQV FYK EGLTP+S AK PITSDVPEGCVI+REH+P
Sbjct  367   RFDVFVEAEANKAAGKYANASIDFQVNFYKNEGLTPYSPAKLPITSDVPEGCVILREHVP  426

Query  1884  ISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHR  2054
             ISNLFTCLWFNEVDRFT RDQISFSTVRDKI ++  WNV MFLDCERRNFVVQ YHR
Sbjct  427   ISNLFTCLWFNEVDRFTSRDQISFSTVRDKIAAKIKWNVSMFLDCERRNFVVQRYHR  483



>ref|XP_009410890.1| PREDICTED: uncharacterized protein LOC103992775 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410891.1| PREDICTED: uncharacterized protein LOC103992775 [Musa acuminata 
subsp. malaccensis]
Length=584

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/496 (61%), Positives = 367/496 (74%), Gaps = 9/496 (2%)
 Frame = +3

Query  606   FPIPPRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPE  785
             F  P +  L   +E+E    RI  FA R+KV +LLL   SAAV  ++  V KG+DA    
Sbjct  33    FRKPSKISLSGPRERERILPRICNFAGRRKVRMLLLLVASAAVLSFITVVSKGDDASANP  92

Query  786   IPTISISATMKD-REYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPR---VYFTGY  953
                ++ +  +++  +  I P   NN     +       GI +             + +  
Sbjct  93    DTRMAFADQVQNFVDSGIPP--LNNFRPPFIPAKKKKVGITTHSHQESATTHNVTHISAP  150

Query  954   TLPPG-NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIH  1127
               PP  +PC+ F+ PPPPADK+R GPRPCPVCY+P E+A  LMP +PS SPVL  L+Y  
Sbjct  151   IFPPKLHPCDSFSSPPPPADKRRIGPRPCPVCYVPAEQAALLMPPSPSASPVLKNLSYFS  210

Query  1128  EETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLG  1304
             E+ L  NE  G    GGYPSL +R+ES++I+ESM VHCGF KG KPG+ T FDI+D DL 
Sbjct  211   EDNLIANESIGGSIFGGYPSLLERNESFNIKESMMVHCGFAKGKKPGQGTGFDINDTDLL  270

Query  1305  EMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSR  1484
             EME C+ VVVASAIFG +D++ QPKNISEYA+ N CFYMFVDE TEA++RNS  L+ S R
Sbjct  271   EMEECDDVVVASAIFGNYDIMQQPKNISEYAKRNACFYMFVDEQTEAYMRNSSGLDDSKR  330

Query  1485  IGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLW  1664
             +GLW+ VVV +LPY DARRNGK+PKLLLHRLFPNAR+SLWIDGKLELV DPYQ+LERFLW
Sbjct  331   VGLWKTVVVRNLPYVDARRNGKVPKLLLHRLFPNARFSLWIDGKLELVADPYQVLERFLW  390

Query  1665  RRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSD  1844
             R+N + AISRHY+RFDVFEEAEANKAAGK+DNASID+Q+EFYKKEGLTP+S++K PITSD
Sbjct  391   RKNYTLAISRHYRRFDVFEEAEANKAAGKYDNASIDYQIEFYKKEGLTPYSSSKLPITSD  450

Query  1845  VPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCER  2024
             VPEGCVII+EHIPI+NLFTCLWFNEVDRFT RDQISFSTVRDKI S+ NW + MF+DCER
Sbjct  451   VPEGCVIIKEHIPITNLFTCLWFNEVDRFTSRDQISFSTVRDKIMSQVNWTINMFMDCER  510

Query  2025  RNFVVQGYHRDILEHR  2072
             RNFVVQ YHRD+LE R
Sbjct  511   RNFVVQAYHRDLLEQR  526



>gb|KDO75983.1| hypothetical protein CISIN_1g006222mg [Citrus sinensis]
Length=542

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/409 (73%), Positives = 336/409 (82%), Gaps = 6/409 (1%)
 Frame = +3

Query  843   EEKNNIHKTLLA--KPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKK  1016
             E +N+I  ++ A  K  + R I ST  PPP P  YF GYTLPPG+PC  FTLPPPPADKK
Sbjct  54    ESQNSIANSVEAMDKMVSVRPIESTVFPPPPPS-YFLGYTLPPGHPCNSFTLPPPPADKK  112

Query  1017  RTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgf-ggYPSLR  1190
             RTGPRPCPVCYLPVEE IALMP  PSFSPVL  L YI E  L+     G    GGYP L 
Sbjct  113   RTGPRPCPVCYLPVEEVIALMPKVPSFSPVLKNLTYITEPVLNREAEFGGSDFGGYPPLA  172

Query  1191  QRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIH  1370
             QR+ SYDIRESMSVHCGFVKG KPGR T +D+D++D+ +ME C G+VV SAIFGAFD I+
Sbjct  173   QRNNSYDIRESMSVHCGFVKG-KPGRGTGYDLDEEDILDMEQCHGIVVVSAIFGAFDDIN  231

Query  1371  QPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGK  1550
             QP NISEY+R+ VCF MFVDE TEA+L+ +  L+ + +IG+WRIVV+H+ PY+DARR GK
Sbjct  232   QPSNISEYSRKTVCFVMFVDEETEAYLKANSGLDRTKKIGIWRIVVIHNPPYSDARRTGK  291

Query  1551  IPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAE  1730
             IPKLL HRLFPNAR+SLWIDGKLELVVDPYQILER LWR+NA+FAISRHYKRFDV  EAE
Sbjct  292   IPKLLAHRLFPNARFSLWIDGKLELVVDPYQILERHLWRKNATFAISRHYKRFDVLVEAE  351

Query  1731  ANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLW  1910
             ANKAA K+DNASIDFQ+EFYK EGLTP+S AK PITSDVPEGCVIIREH+PISNLF CLW
Sbjct  352   ANKAAKKYDNASIDFQIEFYKNEGLTPYSEAKLPITSDVPEGCVIIREHVPISNLFVCLW  411

Query  1911  FNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRD  2057
             FNEVDRFT RDQISFSTVRDK+ ++TNW V MFLDCERRNFVVQ YHRD
Sbjct  412   FNEVDRFTSRDQISFSTVRDKLWAKTNWTVNMFLDCERRNFVVQKYHRD  460



>ref|XP_008807992.1| PREDICTED: uncharacterized protein LOC103720176 isoform X2 [Phoenix 
dactylifera]
Length=600

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/514 (62%), Positives = 385/514 (75%), Gaps = 30/514 (6%)
 Frame = +3

Query  597   SSSFPIPPRKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFV-WVLYVGK  761
             S+S  +  RKP KT     +EKE +   I K A R+K+G+LL+   SAAV + ++  + K
Sbjct  31    STSVSVSVRKPQKTLLQSSREKERFLLWICKLAGRRKIGMLLVLIASAAVILSFISAMSK  90

Query  762   GED-ARGPEIPTIS------ISATMKDREYSIEP------EEKNNIHKTLLAKPNNNRGI  902
              ED + GP+    S      + +T     +++ P      E K  I  T +    +  G 
Sbjct  91    DEDGSEGPQTNLGSSYHVWGLVSTGGTALHNLTPPLTSIKESKTEI--TAILNQQSASGD  148

Query  903   ASTDQPPPL--PRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIAL  1076
               T +P P+  PR  FT +      PCE F+  PPP D+KRTGPRPCPVCY+PVE+A+A 
Sbjct  149   NETQRPVPVLPPRAIFTWH------PCENFSFSPPPTDRKRTGPRPCPVCYIPVEQAVAF  202

Query  1077  MPTAPSFSPVL-YLNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVK  1250
             MP  PS SPVL  L Y+ EE L  NE  G    GG+PSL+QR+ES+DIRESMSVHCGFV+
Sbjct  203   MPALPSVSPVLKSLTYVSEENLIVNETNGGTIFGGHPSLQQRNESFDIRESMSVHCGFVR  262

Query  1251  GVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVD  1430
             G KPG+ T FDIDD DL EME C GVVVASAIFG +D++ QP+NISEYA+ N CFY+FVD
Sbjct  263   GKKPGQGTGFDIDDADLIEMEQCRGVVVASAIFGNYDMMQQPRNISEYAKRNACFYIFVD  322

Query  1431  EGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWID  1610
             E TEA+++N+ +L+S  R+GLWR+VVV +LPY DARRNGK+PKLLLHRLFPNAR+SLWID
Sbjct  323   EETEAYIKNTTNLDSIQRVGLWRVVVVRNLPYVDARRNGKVPKLLLHRLFPNARFSLWID  382

Query  1611  GKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFY  1790
             GKLELVVDPY ILERFLWR+NA+FAISRHY+RFDVFEEAEANKAA K+DNASID+Q+EFY
Sbjct  383   GKLELVVDPYPILERFLWRKNATFAISRHYRRFDVFEEAEANKAAAKYDNASIDYQIEFY  442

Query  1791  KKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRD  1970
             K+EGLT +S  K PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRD
Sbjct  443   KREGLTHYSPVKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRD  502

Query  1971  KIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHR  2072
             KI SR NW++ MF+DCERRNFVVQ YHRD+LE R
Sbjct  503   KIMSRVNWSINMFMDCERRNFVVQAYHRDLLEQR  536



>ref|XP_008807991.1| PREDICTED: uncharacterized protein LOC103720176 isoform X1 [Phoenix 
dactylifera]
Length=620

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/514 (62%), Positives = 385/514 (75%), Gaps = 30/514 (6%)
 Frame = +3

Query  597   SSSFPIPPRKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFV-WVLYVGK  761
             S+S  +  RKP KT     +EKE +   I K A R+K+G+LL+   SAAV + ++  + K
Sbjct  31    STSVSVSVRKPQKTLLQSSREKERFLLWICKLAGRRKIGMLLVLIASAAVILSFISAMSK  90

Query  762   GED-ARGPEIPTIS------ISATMKDREYSIEP------EEKNNIHKTLLAKPNNNRGI  902
              ED + GP+    S      + +T     +++ P      E K  I  T +    +  G 
Sbjct  91    DEDGSEGPQTNLGSSYHVWGLVSTGGTALHNLTPPLTSIKESKTEI--TAILNQQSASGD  148

Query  903   ASTDQPPPL--PRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIAL  1076
               T +P P+  PR  FT +      PCE F+  PPP D+KRTGPRPCPVCY+PVE+A+A 
Sbjct  149   NETQRPVPVLPPRAIFTWH------PCENFSFSPPPTDRKRTGPRPCPVCYIPVEQAVAF  202

Query  1077  MPTAPSFSPVL-YLNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVK  1250
             MP  PS SPVL  L Y+ EE L  NE  G    GG+PSL+QR+ES+DIRESMSVHCGFV+
Sbjct  203   MPALPSVSPVLKSLTYVSEENLIVNETNGGTIFGGHPSLQQRNESFDIRESMSVHCGFVR  262

Query  1251  GVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVD  1430
             G KPG+ T FDIDD DL EME C GVVVASAIFG +D++ QP+NISEYA+ N CFY+FVD
Sbjct  263   GKKPGQGTGFDIDDADLIEMEQCRGVVVASAIFGNYDMMQQPRNISEYAKRNACFYIFVD  322

Query  1431  EGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWID  1610
             E TEA+++N+ +L+S  R+GLWR+VVV +LPY DARRNGK+PKLLLHRLFPNAR+SLWID
Sbjct  323   EETEAYIKNTTNLDSIQRVGLWRVVVVRNLPYVDARRNGKVPKLLLHRLFPNARFSLWID  382

Query  1611  GKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFY  1790
             GKLELVVDPY ILERFLWR+NA+FAISRHY+RFDVFEEAEANKAA K+DNASID+Q+EFY
Sbjct  383   GKLELVVDPYPILERFLWRKNATFAISRHYRRFDVFEEAEANKAAAKYDNASIDYQIEFY  442

Query  1791  KKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRD  1970
             K+EGLT +S  K PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRD
Sbjct  443   KREGLTHYSPVKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRD  502

Query  1971  KIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHR  2072
             KI SR NW++ MF+DCERRNFVVQ YHRD+LE R
Sbjct  503   KIMSRVNWSINMFMDCERRNFVVQAYHRDLLEQR  536



>gb|EPS72533.1| hypothetical protein M569_02220, partial [Genlisea aurea]
Length=400

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/389 (75%), Positives = 336/389 (86%), Gaps = 1/389 (0%)
 Frame = +3

Query  906   STDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPT  1085
             S+ QP P P V+FTGY LPPGNPC  F LPPPPADKKR GPR CPVCYLP+E+AIALMP 
Sbjct  1     SSLQPRPPPSVFFTGYKLPPGNPCHDFALPPPPADKKRIGPRQCPVCYLPLEDAIALMPK  60

Query  1086  APSFSPVLY-LNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKP  1262
             APSFSPV+  L Y+HEE L ++EFGGS FGGYPSL QR +SYDI++SMS+HCGFV G KP
Sbjct  61    APSFSPVIKNLTYLHEENLVKSEFGGSDFGGYPSLEQRKDSYDIKDSMSMHCGFVTGTKP  120

Query  1263  GRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTE  1442
             G  T +DI D DL EME C G+V+ASAIFGAFD++ QPKN+SEY++ NVCF+MFVDE T+
Sbjct  121   GNRTGYDIGDSDLLEMENCRGIVIASAIFGAFDIVRQPKNVSEYSKRNVCFHMFVDEETK  180

Query  1443  AFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLE  1622
              FLRN+  L + +++GLWRI+VV +LPY+D RRNGKIPKLLLHRLFPNARYSLWID KLE
Sbjct  181   DFLRNTTQLGNDTKVGLWRIIVVRNLPYSDPRRNGKIPKLLLHRLFPNARYSLWIDAKLE  240

Query  1623  LVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEG  1802
             LVVDP  ILERFLWR+NASFAISRHYKRFDVF EAEANKAA K+DN SIDFQ+EFYKKEG
Sbjct  241   LVVDPILILERFLWRKNASFAISRHYKRFDVFLEAEANKAAAKYDNGSIDFQIEFYKKEG  300

Query  1803  LTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRS  1982
             LT +S AK P+TSDVPEGCVI+REHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKI S
Sbjct  301   LTSYSDAKLPVTSDVPEGCVILREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIWS  360

Query  1983  RTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             +TN+ + MFLDC+RRNFV+QGYHRDILE 
Sbjct  361   KTNYTINMFLDCQRRNFVIQGYHRDILEQ  389



>ref|XP_006594318.1| PREDICTED: uncharacterized protein LOC100779951 isoform X2 [Glycine 
max]
Length=549

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/394 (73%), Positives = 328/394 (83%), Gaps = 2/394 (1%)
 Frame = +3

Query  888   NNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEA  1067
             N  G+      PP P  YF GY LPPG+PC  FTLPPPPADKKRTGPRPCPVCYLPVEEA
Sbjct  90    NAMGLTKRSVLPPPPAGYFLGYRLPPGHPCNSFTLPPPPADKKRTGPRPCPVCYLPVEEA  149

Query  1068  IALMPTAPSFSPVL-YLNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCG  1241
             I LMP  PS SPVL  L Y++EE LS +   G    GGYP+L+QR++S+DIRESMSVHCG
Sbjct  150   IGLMPALPSPSPVLGNLTYVYEENLSRDGEFGGSDFGGYPTLKQRNDSFDIRESMSVHCG  209

Query  1242  FVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYM  1421
             FV+G+KPGR T FDID+ D  EME C GVVVASAIFG FD I++P NIS+Y+R+ VCF M
Sbjct  210   FVRGIKPGRNTGFDIDEADHFEMEQCNGVVVASAIFGNFDEINEPNNISDYSRKTVCFLM  269

Query  1422  FVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSL  1601
             FVDE TE +L +SG L  S +IGLWRI+V  +LPY DARR GKIPKLLLHRL PNARYS+
Sbjct  270   FVDEETEKYLISSGKLGISKKIGLWRIIVARNLPYPDARRTGKIPKLLLHRLVPNARYSI  329

Query  1602  WIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQV  1781
             W+DGKLELVVDPYQILERFLWR+NA+FAIS+HY+RFDVF EAEANKAAGK++NASIDFQ+
Sbjct  330   WLDGKLELVVDPYQILERFLWRKNATFAISKHYRRFDVFIEAEANKAAGKYENASIDFQI  389

Query  1782  EFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFST  1961
             EFYK EGLTP++ AK P+ SDVPEGCVI+REH+PISNLFTCLWFNEVDRFT RDQISFST
Sbjct  390   EFYKNEGLTPYTEAKLPLISDVPEGCVIVREHVPISNLFTCLWFNEVDRFTSRDQISFST  449

Query  1962  VRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             VRDKI SR +++  MFLDCERRNFVVQ YHRD+L
Sbjct  450   VRDKILSRVDFHFNMFLDCERRNFVVQKYHRDLL  483



>ref|XP_003568085.1| PREDICTED: uncharacterized protein LOC100826851 isoform X1 [Brachypodium 
distachyon]
Length=595

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/571 (55%), Positives = 392/571 (69%), Gaps = 39/571 (7%)
 Frame = +3

Query  597   SSSFPIPPRKPLKTFKEKEG------WFHRIFKFAARKKVGLLLLCAVSAAVFVWVL--Y  752
             S+S P+ PRKP KT     G       F RI  FA R++  LLLL    A VF ++    
Sbjct  27    SASPPLAPRKPAKTSLGGVGRGGERLLFARICLFAGRRQRMLLLLLVAVAVVFCFLFSSL  86

Query  753   VGKGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTL--LAKPNNNRGIASTDQPPP  926
             + K E A  P   T+ +  +   R + + P   +++ ++L    +     GI+   +   
Sbjct  87    ISKDEVA-APGTDTV-LGFSDHFRSF-VNPVWSSSLSESLNMTLQTGKESGISHVKERGL  143

Query  927   LPRVYFTGYTLPPG-----NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAP  1091
             L        T PP      +PCE F+  PPP D+KRTGPRPCPVCY+PVE+A+ALMP AP
Sbjct  144   L-------RTFPPAIALEHHPCENFSFSPPPIDRKRTGPRPCPVCYVPVEQALALMPGAP  196

Query  1092  SFSPVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPG  1265
             S SPVL  LNY+ E+ L   E       GGYPSL QRD SYD+++SM+VHCGFV+G  PG
Sbjct  197   SASPVLQSLNYLSEDNLIFKESNSGSLFGGYPSLEQRDRSYDLKDSMAVHCGFVRGKIPG  256

Query  1266  RATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEA  1445
               T FD+D+ DL EM+ C G VVASAIFG +D++ QP+NISE++++ VCF+MF+DE TEA
Sbjct  257   LNTGFDVDEADLSEMQQCHGTVVASAIFGNYDIMQQPENISEFSKDTVCFFMFLDEETEA  316

Query  1446  FLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLEL  1625
              ++N+  ++++ RIGLWR+VVV +LPY+DARRNGK+PKLLLHRLFPN RYSLWIDGKL+L
Sbjct  317   AIKNTTMVDNTKRIGLWRVVVVRNLPYSDARRNGKVPKLLLHRLFPNVRYSLWIDGKLKL  376

Query  1626  VVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGL  1805
             V DPYQ+LERFLWRRN +FAISRHY+RFDVFEEAEANKA GK+DNASID Q+EFYK+EGL
Sbjct  377   VKDPYQLLERFLWRRNVTFAISRHYRRFDVFEEAEANKAGGKYDNASIDNQIEFYKREGL  436

Query  1806  TPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSR  1985
             T +S+AK PITSDVPEGCVIIREHI I+NLFTCLWFNEVDRFT RDQ+SFSTVRDKIRSR
Sbjct  437   THYSSAKLPITSDVPEGCVIIREHILITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIRSR  496

Query  1986  TNWNVEMFLDCERRNFVVQGYHRDILEHRAppppp------------ppRATIRDGVLKT  2129
              NW  +MFLDCERR+FVVQ YHR++LE R                   PR  + D   K 
Sbjct  497   VNWTADMFLDCERRDFVVQAYHRELLEQRLAVLRSQPPPPPPVVLVQQPRKMLPDNAAKE  556

Query  2130  SKYSGATTKLLARRIGDPRSRHRQE*RCWLN  2222
                + AT KL  +R  D +S  ++  R  LN
Sbjct  557   LGRASATKKLTGKRTRDRKSSSKRSHRTKLN  587



>ref|XP_010231154.1| PREDICTED: uncharacterized protein LOC100826851 isoform X3 [Brachypodium 
distachyon]
Length=555

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/442 (63%), Positives = 338/442 (76%), Gaps = 19/442 (4%)
 Frame = +3

Query  954   TLPPG-----NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-L  1115
             T PP      +PCE F+  PPP D+KRTGPRPCPVCY+PVE+A+ALMP APS SPVL  L
Sbjct  106   TFPPAIALEHHPCENFSFSPPPIDRKRTGPRPCPVCYVPVEQALALMPGAPSASPVLQSL  165

Query  1116  NYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDD  1292
             NY+ E+ L   E       GGYPSL QRD SYD+++SM+VHCGFV+G  PG  T FD+D+
Sbjct  166   NYLSEDNLIFKESNSGSLFGGYPSLEQRDRSYDLKDSMAVHCGFVRGKIPGLNTGFDVDE  225

Query  1293  KDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLN  1472
              DL EM+ C G VVASAIFG +D++ QP+NISE++++ VCF+MF+DE TEA ++N+  ++
Sbjct  226   ADLSEMQQCHGTVVASAIFGNYDIMQQPENISEFSKDTVCFFMFLDEETEAAIKNTTMVD  285

Query  1473  SSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILE  1652
             ++ RIGLWR+VVV +LPY+DARRNGK+PKLLLHRLFPN RYSLWIDGKL+LV DPYQ+LE
Sbjct  286   NTKRIGLWRVVVVRNLPYSDARRNGKVPKLLLHRLFPNVRYSLWIDGKLKLVKDPYQLLE  345

Query  1653  RFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFP  1832
             RFLWRRN +FAISRHY+RFDVFEEAEANKA GK+DNASID Q+EFYK+EGLT +S+AK P
Sbjct  346   RFLWRRNVTFAISRHYRRFDVFEEAEANKAGGKYDNASIDNQIEFYKREGLTHYSSAKLP  405

Query  1833  ITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFL  2012
             ITSDVPEGCVIIREHI I+NLFTCLWFNEVDRFT RDQ+SFSTVRDKIRSR NW  +MFL
Sbjct  406   ITSDVPEGCVIIREHILITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIRSRVNWTADMFL  465

Query  2013  DCERRNFVVQGYHRDILEHRAppppp------------ppRATIRDGVLKTSKYSGATTK  2156
             DCERR+FVVQ YHR++LE R                   PR  + D   K    + AT K
Sbjct  466   DCERRDFVVQAYHRELLEQRLAVLRSQPPPPPPVVLVQQPRKMLPDNAAKELGRASATKK  525

Query  2157  LLARRIGDPRSRHRQE*RCWLN  2222
             L  +R  D +S  ++  R  LN
Sbjct  526   LTGKRTRDRKSSSKRSHRTKLN  547



>ref|XP_004485785.1| PREDICTED: uncharacterized protein LOC101495908 isoform X3 [Cicer 
arietinum]
Length=502

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/395 (72%), Positives = 331/395 (84%), Gaps = 2/395 (1%)
 Frame = +3

Query  897   GIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIAL  1076
             G A+    P  P  YF GY LPPG+PC  FTLPPPPADKKRTGPRPCPVCYLPV+EAI L
Sbjct  41    GFATNLVLPLSPPNYFLGYNLPPGHPCNSFTLPPPPADKKRTGPRPCPVCYLPVDEAIGL  100

Query  1077  MPTAPSFSPVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVK  1250
             MP  PS SPVL  L +I+EE LS +   G    GGYP+L QR++S+DIRESM+VHCGFV+
Sbjct  101   MPKFPSPSPVLNKLTFIYEENLSRDGEFGGSDFGGYPTLGQRNDSFDIRESMNVHCGFVR  160

Query  1251  GVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVD  1430
             G+KPGR T FDID+ DL +ME C G+VVASA+FG FD I++PKNISEY+++ VCF MFVD
Sbjct  161   GIKPGRNTGFDIDEDDLLDMEQCRGIVVASAVFGNFDEINEPKNISEYSKQTVCFLMFVD  220

Query  1431  EGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWID  1610
             E TE +LR+SG L +S +IGLWRI+V  +LPYTDARR+GKIPKLLLHR+ PNARYS+W+D
Sbjct  221   EETEKYLRSSGRLGTSKKIGLWRIIVARNLPYTDARRSGKIPKLLLHRMTPNARYSIWLD  280

Query  1611  GKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFY  1790
             GKLELVVDPYQILERFLWR NA+FAIS+HY+RFDVF EAEANKAA K+DNASIDFQ+EFY
Sbjct  281   GKLELVVDPYQILERFLWRNNATFAISKHYRRFDVFVEAEANKAAAKYDNASIDFQIEFY  340

Query  1791  KKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRD  1970
             K EGLTP++ AK P+ SDVPEGCVIIREH+PISNLFTCLWFNEVDRFT RDQISFSTVRD
Sbjct  341   KNEGLTPYTEAKLPLISDVPEGCVIIREHVPISNLFTCLWFNEVDRFTSRDQISFSTVRD  400

Query  1971  KIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             K  SR +++  MFLDCERRNFVVQ YHRD+LE  A
Sbjct  401   KFLSRVDFHFHMFLDCERRNFVVQKYHRDVLERLA  435



>dbj|BAJ98309.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/380 (70%), Positives = 321/380 (84%), Gaps = 7/380 (2%)
 Frame = +3

Query  954   TLPPG-----NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-L  1115
             TLPP      +PCE F+  PPP D+KRTGPRPCPVCY+PV++A+ALMP AP+ SP+L  L
Sbjct  151   TLPPAIHLEHHPCENFSFSPPPIDRKRTGPRPCPVCYVPVDQALALMPVAPTASPILQSL  210

Query  1116  NYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDD  1292
             NY+ E+ L   E       GGYPSL QRD S+DI++SM+VHCGFV+G  PG  T FD+D+
Sbjct  211   NYLSEDNLVLKESNSGSLFGGYPSLEQRDMSFDIKDSMTVHCGFVRGKIPGLNTGFDVDE  270

Query  1293  KDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLN  1472
              DL EM  C+G VVASAIFG +D++ QP+NISE++++ VCF+MF+DE TEA ++N+  ++
Sbjct  271   ADLSEMRQCQGTVVASAIFGNYDIMQQPENISEFSKDTVCFFMFLDEETEAAIKNTTAID  330

Query  1473  SSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILE  1652
             ++ RIGLWR+VVVH+LPY+DARRNGKIPKLLLHRLFPN RYSLWIDGKL+LV DPYQ+LE
Sbjct  331   NTKRIGLWRVVVVHNLPYSDARRNGKIPKLLLHRLFPNVRYSLWIDGKLKLVKDPYQLLE  390

Query  1653  RFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFP  1832
             RFLWR+N SFAISRHY+RFDVFEEAEANKA GK+DNASID Q+EFYK+EGLT +S+AK P
Sbjct  391   RFLWRKNVSFAISRHYRRFDVFEEAEANKAGGKYDNASIDNQIEFYKREGLTHYSSAKLP  450

Query  1833  ITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFL  2012
             ITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQISFSTVRDKIRSR NW  +MFL
Sbjct  451   ITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQISFSTVRDKIRSRLNWTADMFL  510

Query  2013  DCERRNFVVQGYHRDILEHR  2072
             DCERR+FVVQ YHR+++E R
Sbjct  511   DCERRDFVVQAYHRELMEQR  530



>ref|XP_008655198.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=586

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/568 (55%), Positives = 389/568 (68%), Gaps = 44/568 (8%)
 Frame = +3

Query  597   SSSFPIPPRKPLK-TFKEKEG--WFHRIFKFAARKKVGLLLLCAVSAAV---FVWVLYVG  758
             SSS P+  RKP K +     G     RI K A R++  +LLL  VS AV   F++   V 
Sbjct  28    SSSPPLAARKPAKMSLGGTSGPRVCARICKLAGRRQ-RMLLLLLVSVAVAFCFLFSSLVS  86

Query  759   KGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRG---IASTDQPPPL  929
             K EDA  P + T+ +        +S       N   T   +P   RG   +   + P  +
Sbjct  87    KDEDA-SPGVETMLV--------FSDHVRSFVNPVWTSSGRPVAQRGSLTVNGLNTPSQM  137

Query  930   PR------VYFTGYTLPPG-----NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIAL  1076
              +      V     + PP      +PCE F+L PPP D+KRTGPRPCPVCYLPVE+A+AL
Sbjct  138   EKQSDSKQVQELMQSFPPAIVVDHHPCENFSLSPPPVDRKRTGPRPCPVCYLPVEQALAL  197

Query  1077  MPTAPSFSPVLY-LNYIHEETLs-enefggsgfggYPSLRQRDESYDIRESMSVHCGFVK  1250
              P  PS SPVL  LNY+ EE L  +    GS FGG+PSL +RD+SYDI++SM+VHCGFV+
Sbjct  198   RPAKPSLSPVLQSLNYVLEEILIPKESKSGSLFGGFPSLEERDKSYDIKDSMTVHCGFVR  257

Query  1251  GVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVD  1430
             G  PG  T FDID+ D  EM+ C+  VVASAIFG +D++ QP+NIS+++++ VCF+MF+D
Sbjct  258   GKVPGLNTGFDIDEADHSEMQLCQSTVVASAIFGNYDVMQQPENISKFSKDTVCFFMFLD  317

Query  1431  EGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWID  1610
             E TEA ++N+  +  + +IGLWR+VVV +LP+TDARRNGK+PKLLLHRLFPNARYS+WID
Sbjct  318   EETEAAIKNT-TIGHTKKIGLWRVVVVRNLPFTDARRNGKVPKLLLHRLFPNARYSIWID  376

Query  1611  GKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFY  1790
             GKL+LV DPYQ+LERFLWR+N SFAISRHY+RFDVFEEAEANKA GK+DN SID+Q+EFY
Sbjct  377   GKLKLVRDPYQVLERFLWRKNVSFAISRHYRRFDVFEEAEANKAGGKYDNTSIDYQIEFY  436

Query  1791  KKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRD  1970
             K+EGLT +S+AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRD
Sbjct  437   KREGLTHYSSAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRD  496

Query  1971  KIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRAppppp-----------ppRATIRDG  2117
             KIR R NW  +MFLDCERR+FVVQ YHR++LE R                  PR  + D 
Sbjct  497   KIRWRVNWTADMFLDCERRDFVVQSYHRELLEQRQSALRRWPPQRSPVARFQPRKMLPDN  556

Query  2118  VLKTSKYSGATTKLLARRIGDPRSRHRQ  2201
               +    + AT KL  +R  D +S  R+
Sbjct  557   AAREPWKASATKKLSRKRARDKKSSSRR  584



>ref|XP_008655199.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 ref|XP_008655200.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=489

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/424 (64%), Positives = 333/424 (79%), Gaps = 14/424 (3%)
 Frame = +3

Query  969   NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLs-  1142
             +PCE F+L PPP D+KRTGPRPCPVCYLPVE+A+AL P  PS SPVL  LNY+ EE L  
Sbjct  65    HPCENFSLSPPPVDRKRTGPRPCPVCYLPVEQALALRPAKPSLSPVLQSLNYVLEEILIP  124

Query  1143  enefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
             +    GS FGG+PSL +RD+SYDI++SM+VHCGFV+G  PG  T FDID+ D  EM+ C+
Sbjct  125   KESKSGSLFGGFPSLEERDKSYDIKDSMTVHCGFVRGKVPGLNTGFDIDEADHSEMQLCQ  184

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
               VVASAIFG +D++ QP+NIS+++++ VCF+MF+DE TEA ++N+  +  + +IGLWR+
Sbjct  185   STVVASAIFGNYDVMQQPENISKFSKDTVCFFMFLDEETEAAIKNTT-IGHTKKIGLWRV  243

Query  1503  VVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASF  1682
             VVV +LP+TDARRNGK+PKLLLHRLFPNARYS+WIDGKL+LV DPYQ+LERFLWR+N SF
Sbjct  244   VVVRNLPFTDARRNGKVPKLLLHRLFPNARYSIWIDGKLKLVRDPYQVLERFLWRKNVSF  303

Query  1683  AISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCV  1862
             AISRHY+RFDVFEEAEANKA GK+DN SID+Q+EFYK+EGLT +S+AK PITSDVPEGCV
Sbjct  304   AISRHYRRFDVFEEAEANKAGGKYDNTSIDYQIEFYKREGLTHYSSAKLPITSDVPEGCV  363

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             IIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKIR R NW  +MFLDCERR+FVVQ
Sbjct  364   IIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIRWRVNWTADMFLDCERRDFVVQ  423

Query  2043  GYHRDILEHRAppppp-----------ppRATIRDGVLKTSKYSGATTKLLARRIGDPRS  2189
              YHR++LE R                  PR  + D   +    + AT KL  +R  D +S
Sbjct  424   SYHRELLEQRQSALRRWPPQRSPVARFQPRKMLPDNAAREPWKASATKKLSRKRARDKKS  483

Query  2190  RHRQ  2201
               R+
Sbjct  484   SSRR  487



>ref|XP_010060563.1| PREDICTED: uncharacterized protein LOC104448440 isoform X2 [Eucalyptus 
grandis]
 gb|KCW67345.1| hypothetical protein EUGRSUZ_F01129 [Eucalyptus grandis]
Length=608

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/473 (62%), Positives = 359/473 (76%), Gaps = 20/473 (4%)
 Frame = +3

Query  843   EEKNNIHKTLLAKPNNNRGIASTDQPPPLP-------------RVYFTG---YTLPPGNP  974
             E++     +L  K  +  G  S  QPPP+P             R   T     ++P G+ 
Sbjct  125   EDRQKGRGSLGRKTASRSGGRSRAQPPPVPARSHRRARPHPLSRSDSTSPKPGSVPMGHQ  184

Query  975   CEGFTLPPPPA-DKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-Lse  1145
             C+ F  PPPP  D KR GPRPCPVCY+PVE+AIA MP++P+ SPVL  L YIH+E  +  
Sbjct  185   CKKFAFPPPPPADGKRIGPRPCPVCYVPVEQAIASMPSSPAISPVLRNLTYIHDEDPVKS  244

Query  1146  nefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
              + G S FGGYPSL +RD+S+DI+ESM VHCGFVKG KPGR T FDID+ DL EME    
Sbjct  245   EQHGVSDFGGYPSLTERDDSFDIKESMRVHCGFVKGHKPGRQTGFDIDEADLEEMEQYHD  304

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             V+VASAIFG +D+I +P+NISE A++N+ F+MF+DE TEA+++NS  LNSS R+GLW+I+
Sbjct  305   VIVASAIFGNYDIIQEPRNISEAAKKNIPFFMFIDEETEAYMQNSSVLNSSRRVGLWKII  364

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             VVH++PY DARRNGK+PKLLLHRLFPN RYS+W+DGKL+LVVDPYQILERFLWR NASFA
Sbjct  365   VVHNIPYADARRNGKVPKLLLHRLFPNVRYSIWVDGKLQLVVDPYQILERFLWRENASFA  424

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVI  1865
             ISRHY+RFDVFEEAEANKAAGK+DNASID Q+EFYK+EGLTP+S AK PITSDVPEGCVI
Sbjct  425   ISRHYRRFDVFEEAEANKAAGKYDNASIDSQIEFYKREGLTPYSVAKLPITSDVPEGCVI  484

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQG  2045
             +REHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDK+ ++ +W++ MFLDCERRNFV+Q 
Sbjct  485   MREHIPITNLFTCLWFNEVDRFTARDQLSFSTVRDKLMAKADWSINMFLDCERRNFVIQA  544

Query  2046  YHRDILEHRApppppppRATIRDGVLKTSKYSGATTK-LLARRIGDPRSRHRQ  2201
             YHRD+LE   PP  P  RA +   ++ TS       K + ++R    R RHR+
Sbjct  545   YHRDLLEQMPPPASPAIRARLSSTIISTSGRRAPVKKGISSKRSKSDRRRHRK  597



>ref|XP_008656460.1| PREDICTED: uncharacterized protein LOC103635859 isoform X2 [Zea 
mays]
Length=546

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/424 (64%), Positives = 333/424 (79%), Gaps = 14/424 (3%)
 Frame = +3

Query  969   NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLs-  1142
             +PCE F+L PPP D+KRTGPRPCPVCYLPVE+A+AL P  PS SPVL  LNY+ EE L  
Sbjct  122   HPCENFSLSPPPVDRKRTGPRPCPVCYLPVEQALALRPAKPSLSPVLQSLNYVLEEILIP  181

Query  1143  enefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
             +    GS FGG+PSL +RD+SYDI++SM+VHCGFV+G  PG  T FDID+ D  EM+ C+
Sbjct  182   KESKSGSLFGGFPSLEERDKSYDIKDSMTVHCGFVRGKVPGLNTGFDIDEADHSEMQLCQ  241

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
               VVASAIFG +D++ QP+NIS+++++ VCF+MF+DE TEA ++N+  +  + +IGLWR+
Sbjct  242   STVVASAIFGNYDVMQQPENISKFSKDTVCFFMFLDEETEAAIKNT-TIGHTKKIGLWRV  300

Query  1503  VVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASF  1682
             VVV +LP+TDARRNGK+PKLLLHRLFPNARYS+WIDGKL+LV DPYQ+LERFLWR+N SF
Sbjct  301   VVVRNLPFTDARRNGKVPKLLLHRLFPNARYSIWIDGKLKLVRDPYQVLERFLWRKNVSF  360

Query  1683  AISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCV  1862
             AISRHY+RFDVFEEAEANKA GK+DN SID+Q+EFYK+EGLT +S+AK PITSDVPEGCV
Sbjct  361   AISRHYRRFDVFEEAEANKAGGKYDNTSIDYQIEFYKREGLTHYSSAKLPITSDVPEGCV  420

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             IIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKIR R NW  +MFLDCERR+FVVQ
Sbjct  421   IIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIRWRVNWTADMFLDCERRDFVVQ  480

Query  2043  GYHRDILEHRAppppp-----------ppRATIRDGVLKTSKYSGATTKLLARRIGDPRS  2189
              YHR++LE R                  PR  + D   +    + AT KL  +R  D +S
Sbjct  481   SYHRELLEQRQSALRRWPPQRSPIARFQPRKMLPDNAAREPWKASATKKLSRKRARDKKS  540

Query  2190  RHRQ  2201
               R+
Sbjct  541   SSRR  544



>ref|XP_008656458.1| PREDICTED: uncharacterized protein LOC103635859 isoform X1 [Zea 
mays]
 ref|XP_008656459.1| PREDICTED: uncharacterized protein LOC103635859 isoform X1 [Zea 
mays]
Length=563

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/424 (64%), Positives = 333/424 (79%), Gaps = 14/424 (3%)
 Frame = +3

Query  969   NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLs-  1142
             +PCE F+L PPP D+KRTGPRPCPVCYLPVE+A+AL P  PS SPVL  LNY+ EE L  
Sbjct  139   HPCENFSLSPPPVDRKRTGPRPCPVCYLPVEQALALRPAKPSLSPVLQSLNYVLEEILIP  198

Query  1143  enefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
             +    GS FGG+PSL +RD+SYDI++SM+VHCGFV+G  PG  T FDID+ D  EM+ C+
Sbjct  199   KESKSGSLFGGFPSLEERDKSYDIKDSMTVHCGFVRGKVPGLNTGFDIDEADHSEMQLCQ  258

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
               VVASAIFG +D++ QP+NIS+++++ VCF+MF+DE TEA ++N+  +  + +IGLWR+
Sbjct  259   STVVASAIFGNYDVMQQPENISKFSKDTVCFFMFLDEETEAAIKNTT-IGHTKKIGLWRV  317

Query  1503  VVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASF  1682
             VVV +LP+TDARRNGK+PKLLLHRLFPNARYS+WIDGKL+LV DPYQ+LERFLWR+N SF
Sbjct  318   VVVRNLPFTDARRNGKVPKLLLHRLFPNARYSIWIDGKLKLVRDPYQVLERFLWRKNVSF  377

Query  1683  AISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCV  1862
             AISRHY+RFDVFEEAEANKA GK+DN SID+Q+EFYK+EGLT +S+AK PITSDVPEGCV
Sbjct  378   AISRHYRRFDVFEEAEANKAGGKYDNTSIDYQIEFYKREGLTHYSSAKLPITSDVPEGCV  437

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             IIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKIR R NW  +MFLDCERR+FVVQ
Sbjct  438   IIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIRWRVNWTADMFLDCERRDFVVQ  497

Query  2043  GYHRDILEHRAppppp-----------ppRATIRDGVLKTSKYSGATTKLLARRIGDPRS  2189
              YHR++LE R                  PR  + D   +    + AT KL  +R  D +S
Sbjct  498   SYHRELLEQRQSALRRWPPQRSPIARFQPRKMLPDNAAREPWKASATKKLSRKRARDKKS  557

Query  2190  RHRQ  2201
               R+
Sbjct  558   SSRR  561



>ref|XP_010644196.1| PREDICTED: uncharacterized protein LOC100246918 isoform X1 [Vitis 
vinifera]
Length=605

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/515 (59%), Positives = 379/515 (74%), Gaps = 38/515 (7%)
 Frame = +3

Query  621   RKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEI  788
             RKP K      +EKE     +F+F +R++VG+L+L   +  VF+        +DA  PE 
Sbjct  33    RKPSKMLPSGSREKERLLPYLFRFLSRRRVGMLILVGFAFLVFLSGFSTVSKDDA--PES  90

Query  789   PTISISATM----------KDREY-----SIEPEEKNNIH---KTLLAKPNNNRGIASTD  914
              ++SI+  +           D++       IE + K+N+     T+     NN       
Sbjct  91    NSVSITQHIHHINPYDNGESDQDLPFFLPRIEVKHKDNVDYIPSTVTESGENNA------  144

Query  915   QPPPLP-----RVYFTGYTLPPGNPCEGFTLPPPPA-DKKRTGPRPCPVCYLPVEEAIAL  1076
               PPLP          GYT P  +PCE F  PPPP  D+KR GPRPCPVCYLPVE+AIA 
Sbjct  145   HRPPLPPSTSAVAAVVGYTPPLHHPCENFAFPPPPPPDRKRIGPRPCPVCYLPVEQAIAS  204

Query  1077  MPTAPSFSPVL-YLNYIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVK  1250
             +P++ S SP+L  LNY+HEE  +     GGS FGGYPSL+QR++S+DI+ESM+VHCGFV 
Sbjct  205   IPSSSSPSPLLKQLNYVHEENPIKTEPHGGSEFGGYPSLKQRNDSFDIKESMTVHCGFVT  264

Query  1251  GVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVD  1430
             G KPG  T FDID+ DL E+E    V+VASAIFG +D+I QP+N+SE AR+NV FYMF+D
Sbjct  265   GSKPGHHTGFDIDEADLKELEQPHEVIVASAIFGNYDIIQQPRNVSEAARKNVPFYMFID  324

Query  1431  EGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWID  1610
             E TEA++RNS  L+SS R+GLWRI++VH++PYTDARRNGKIPKLLLHR+FPN R+S+WID
Sbjct  325   EETEAYMRNSSVLDSSKRVGLWRIILVHNIPYTDARRNGKIPKLLLHRIFPNVRFSIWID  384

Query  1611  GKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFY  1790
             GKL+L+VDPYQ+LERFLWR+NAS AISRHY+RFDVFEEAEANKAAGK+DN SID+Q+EFY
Sbjct  385   GKLQLLVDPYQVLERFLWRQNASLAISRHYRRFDVFEEAEANKAAGKYDNVSIDYQIEFY  444

Query  1791  KKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRD  1970
             K EGLTP+S AK PITSDVPEGCVI++EHIPI+NLFTCLWFNEVDRFT RDQ+SF+ VRD
Sbjct  445   KNEGLTPYSEAKLPITSDVPEGCVIVKEHIPITNLFTCLWFNEVDRFTSRDQLSFAIVRD  504

Query  1971  KIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             KI S+ +WN+ MFLDCERRNFV Q YHRD+LEH A
Sbjct  505   KITSQVDWNISMFLDCERRNFVYQAYHRDLLEHMA  539



>ref|XP_004961478.1| PREDICTED: uncharacterized protein LOC101776045 [Setaria italica]
Length=612

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/424 (64%), Positives = 327/424 (77%), Gaps = 13/424 (3%)
 Frame = +3

Query  969   NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLse  1145
             +PCE F+L PPP D+KRTGPRPCPVCYLPVE+A+AL P   S SPVL  LNYI E  L  
Sbjct  174   HPCENFSLSPPPIDRKRTGPRPCPVCYLPVEQALALRPAQLSASPVLQSLNYISEANLVS  233

Query  1146  nefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
              E  G    GGYPSL +RD+SYDI++  +VHCGFV+G  PG  T FDID+ D  EM+ CE
Sbjct  234   EESNGGSLFGGYPSLEERDKSYDIKDLTTVHCGFVRGKIPGLNTGFDIDEADRSEMQQCE  293

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
               VVASAIFG +D++ QP+NIS+++++ VCF+MF+DE TEA L+NS  ++ + RIGLWR+
Sbjct  294   RTVVASAIFGNYDILQQPENISDFSKDTVCFFMFLDEETEAALKNSTTIDHTKRIGLWRV  353

Query  1503  VVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASF  1682
             VVV +LPY+DARRNGK+PKLLLHRLFPN RYS+WIDGKL+LV DPYQ+LERFLWR+N SF
Sbjct  354   VVVRNLPYSDARRNGKVPKLLLHRLFPNVRYSIWIDGKLKLVRDPYQVLERFLWRKNVSF  413

Query  1683  AISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCV  1862
             A+SRHY+RFDVFEEAEANKA GK+DNASID+Q+EFYK EGLT +S+AK PITSDVPEGCV
Sbjct  414   AVSRHYRRFDVFEEAEANKAGGKYDNASIDYQIEFYKSEGLTHYSSAKLPITSDVPEGCV  473

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             IIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKIRSR NW  +MFLDCERR+FVVQ
Sbjct  474   IIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIRSRVNWTADMFLDCERRDFVVQ  533

Query  2043  GYHRDILEHRAppppp-----------ppRATIRDGVLKTSKYSGATTKLLARRIGDPRS  2189
              YHR++LE R                  PR  + D   K    + +  KL  +R  D +S
Sbjct  534   SYHRELLEQRQATLRSRPPLRPPMVQIQPRKMLPDNAAKEPGKASSAKKLPGKRTRDKKS  593

Query  2190  RHRQ  2201
               ++
Sbjct  594   SSKR  597



>dbj|BAH01178.1| unnamed protein product [Oryza sativa Japonica Group]
Length=605

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/428 (63%), Positives = 331/428 (77%), Gaps = 15/428 (4%)
 Frame = +3

Query  951   YTLPPG-----NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-Y  1112
             ++ PP      +PCE F+  PPP D+KRTGPRPCPVCY+PVE+A+ALMP APS SPVL  
Sbjct  159   WSFPPSIVLEHHPCENFSFFPPPIDRKRTGPRPCPVCYVPVEQALALMPGAPSASPVLRS  218

Query  1113  LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDID  1289
             LNY+  + L   E       GGYPSL +RD+SYDI++SM+VHCGF +G  PG  T FDID
Sbjct  219   LNYLSGDNLISKESNHGSLFGGYPSLEERDKSYDIKDSMTVHCGFARGKIPGVNTGFDID  278

Query  1290  DKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDL  1469
               DL EM  C+G+VVASAIFG +D++ QPKNIS ++++ VCF+MF+DE TEA ++N+  +
Sbjct  279   RADLSEMWQCQGIVVASAIFGNYDIMQQPKNISVFSKDTVCFFMFLDEETEAAIKNTTTI  338

Query  1470  NSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQIL  1649
             ++S RIGLWR+VVV +LPY+DARRNGK+PKLLLHRLFPN RYS+WIDGKL+LV DPYQ+L
Sbjct  339   DNSKRIGLWRVVVVRNLPYSDARRNGKVPKLLLHRLFPNVRYSIWIDGKLKLVRDPYQLL  398

Query  1650  ERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKF  1829
             ERFLWR+N SFAISRHY+RFDVFEEAEANK  GK+DNASID+Q+EFYK+EGLT +S+AK 
Sbjct  399   ERFLWRKNVSFAISRHYRRFDVFEEAEANKVGGKYDNASIDYQIEFYKREGLTHYSSAKL  458

Query  1830  PITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMF  2009
             PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKIR R NW  +MF
Sbjct  459   PITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIRKRVNWTADMF  518

Query  2010  LDCERRNFVVQGYHRDILEH--------RApppppppRATIRDGVLKTSKYSGATTKLLA  2165
             LDCERR+FVVQ YHR++ E         +       PR  + D   K    +  + ++ A
Sbjct  519   LDCERRDFVVQAYHRELWEQILRSPPPPQPRLVRQQPRKMLPDNTAKEPGKASGSKRVSA  578

Query  2166  RRIGDPRS  2189
             +R  D +S
Sbjct  579   KRTRDKKS  586



>ref|XP_006645802.1| PREDICTED: uncharacterized protein LOC102719635 [Oryza brachyantha]
Length=569

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/432 (63%), Positives = 333/432 (77%), Gaps = 15/432 (3%)
 Frame = +3

Query  951   YTLPPG-----NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-Y  1112
             ++ PP      +PCE F+   PP D+KRTGPRPCPVCY+PVE+A+ALMP+APS SPVL  
Sbjct  123   WSFPPSVVLEHHPCENFSFSSPPIDRKRTGPRPCPVCYVPVEQALALMPSAPSSSPVLRS  182

Query  1113  LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDID  1289
             L Y+ +  L   E       GGYPSL +RD+SYDI++SM+VHCGFV+G  PG +T FDID
Sbjct  183   LTYLSDGNLILKESNSGSLFGGYPSLEERDKSYDIKDSMTVHCGFVRGKIPGVSTGFDID  242

Query  1290  DKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDL  1469
               DL EM  C+G VVASAIFG +DL+ QP+N+S ++++ VCF+MF+DE TEA ++N+  +
Sbjct  243   RADLSEMWQCQGTVVASAIFGNYDLMQQPENVSMFSKDTVCFFMFLDEETEAAIKNTTTI  302

Query  1470  NSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQIL  1649
             ++S RIGLWR+VVV +LPY+DARRNGK+PKLLLHRLFPN RYS+WIDGKL+LV DPYQ+L
Sbjct  303   DNSKRIGLWRVVVVRNLPYSDARRNGKVPKLLLHRLFPNVRYSIWIDGKLKLVRDPYQLL  362

Query  1650  ERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKF  1829
             ERFLWR+N SFAISRHY+RFDVFEEAEANK  GK+DNASID+Q+EFYK+EGLT +S AK 
Sbjct  363   ERFLWRKNVSFAISRHYRRFDVFEEAEANKVGGKYDNASIDYQIEFYKREGLTHYSPAKL  422

Query  1830  PITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMF  2009
             PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKIR+R NW  +MF
Sbjct  423   PITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIRTRVNWVADMF  482

Query  2010  LDCERRNFVVQGYHRDILEH--------RApppppppRATIRDGVLKTSKYSGATTKLLA  2165
             LDCERR+FVVQ YHR++ E         + P      R  + D   K    + A  KL A
Sbjct  483   LDCERRDFVVQAYHRELWEQILRNPPPPQHPLVHQQHRKMLPDNTAKEPGKASAPKKLPA  542

Query  2166  RRIGDPRSRHRQ  2201
             +R  D +S  ++
Sbjct  543   KRTRDKKSSSKR  554



>ref|XP_009589865.1| PREDICTED: uncharacterized protein LOC104087164 [Nicotiana tomentosiformis]
 ref|XP_009589872.1| PREDICTED: uncharacterized protein LOC104087164 [Nicotiana tomentosiformis]
Length=570

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/491 (60%), Positives = 359/491 (73%), Gaps = 17/491 (3%)
 Frame = +3

Query  618   PRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTI  797
             P+  L   +EKE     I +F  R++VG+L+L A +   FV    +   +DA        
Sbjct  37    PKTSLSGSREKERCLPSICRFLVRRQVGMLILVAFALLAFVAGFSMVNKDDA--------  88

Query  798   SISATMKDREYSIEPEEKNNIH-KTLLAKPNNNRGIASTDQPPP-LPRVYFTGYTLPPGN  971
             S S+ +  +E+     E N  H   LL +     G  +   PPP    +     ++   +
Sbjct  89    SRSSELDFKEWF----ENNTYHLSALLPRKVMVCGENTAQLPPPNASAMILAKDSIAFPD  144

Query  972   PCEGFTLPPPP-ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEET-Ls  1142
             PC  F  PPPP  D++R GPRPCPVCY+PVE+ IA MP  PS SP L +L Y HE+  + 
Sbjct  145   PCRNFAFPPPPPGDRRRIGPRPCPVCYIPVEQVIARMPRVPSASPGLQHLTYFHEQIPMK  204

Query  1143  enefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
                 GGS FGGYPSL +R+ S+DI+ESM+VHCGFVKG +PG  T FDID  DL EME   
Sbjct  205   TEPHGGSEFGGYPSLEERNASFDIKESMTVHCGFVKGCRPGDRTGFDIDAADLKEMEQFH  264

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
              V+VASAIFG +D+I QPKN  E ARENV FYMFVDE TEA+L+NS  L+S +R+GLWRI
Sbjct  265   EVIVASAIFGNYDVIQQPKNAGEIARENVPFYMFVDEETEAYLKNSSILDSRNRVGLWRI  324

Query  1503  VVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASF  1682
             ++V ++PY+DARRNGK+PKLLLHRLFPN RYS+WIDGKL+LVVDPYQILERFLWR+NA+F
Sbjct  325   ILVRNVPYSDARRNGKVPKLLLHRLFPNVRYSIWIDGKLQLVVDPYQILERFLWRQNATF  384

Query  1683  AISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCV  1862
             AISRHY+RFDVFEEAEANKAAGK+DN SID Q+ FY+KEGLT +S AK PITSDVPEGCV
Sbjct  385   AISRHYRRFDVFEEAEANKAAGKYDNVSIDHQIGFYRKEGLTAYSEAKLPITSDVPEGCV  444

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             II+EHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDK+ ++ +WN+ MFLDCERRNFV+Q
Sbjct  445   IIKEHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKLMAKVSWNINMFLDCERRNFVIQ  504

Query  2043  GYHRDILEHRA  2075
              YHRD+LE RA
Sbjct  505   AYHRDLLEQRA  515



>ref|XP_010060562.1| PREDICTED: uncharacterized protein LOC104448440 isoform X1 [Eucalyptus 
grandis]
Length=677

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/473 (62%), Positives = 359/473 (76%), Gaps = 20/473 (4%)
 Frame = +3

Query  843   EEKNNIHKTLLAKPNNNRGIASTDQPPPLP-------------RVYFTG---YTLPPGNP  974
             E++     +L  K  +  G  S  QPPP+P             R   T     ++P G+ 
Sbjct  194   EDRQKGRGSLGRKTASRSGGRSRAQPPPVPARSHRRARPHPLSRSDSTSPKPGSVPMGHQ  253

Query  975   CEGFTLPPPPA-DKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-Lse  1145
             C+ F  PPPP  D KR GPRPCPVCY+PVE+AIA MP++P+ SPVL  L YIH+E  +  
Sbjct  254   CKKFAFPPPPPADGKRIGPRPCPVCYVPVEQAIASMPSSPAISPVLRNLTYIHDEDPVKS  313

Query  1146  nefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
              + G S FGGYPSL +RD+S+DI+ESM VHCGFVKG KPGR T FDID+ DL EME    
Sbjct  314   EQHGVSDFGGYPSLTERDDSFDIKESMRVHCGFVKGHKPGRQTGFDIDEADLEEMEQYHD  373

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             V+VASAIFG +D+I +P+NISE A++N+ F+MF+DE TEA+++NS  LNSS R+GLW+I+
Sbjct  374   VIVASAIFGNYDIIQEPRNISEAAKKNIPFFMFIDEETEAYMQNSSVLNSSRRVGLWKII  433

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             VVH++PY DARRNGK+PKLLLHRLFPN RYS+W+DGKL+LVVDPYQILERFLWR NASFA
Sbjct  434   VVHNIPYADARRNGKVPKLLLHRLFPNVRYSIWVDGKLQLVVDPYQILERFLWRENASFA  493

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVI  1865
             ISRHY+RFDVFEEAEANKAAGK+DNASID Q+EFYK+EGLTP+S AK PITSDVPEGCVI
Sbjct  494   ISRHYRRFDVFEEAEANKAAGKYDNASIDSQIEFYKREGLTPYSVAKLPITSDVPEGCVI  553

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQG  2045
             +REHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDK+ ++ +W++ MFLDCERRNFV+Q 
Sbjct  554   MREHIPITNLFTCLWFNEVDRFTARDQLSFSTVRDKLMAKADWSINMFLDCERRNFVIQA  613

Query  2046  YHRDILEHRApppppppRATIRDGVLKTSKYSGATTK-LLARRIGDPRSRHRQ  2201
             YHRD+LE   PP  P  RA +   ++ TS       K + ++R    R RHR+
Sbjct  614   YHRDLLEQMPPPASPAIRARLSSTIISTSGRRAPVKKGISSKRSKSDRRRHRK  666



>ref|XP_010644198.1| PREDICTED: uncharacterized protein LOC100246918 isoform X4 [Vitis 
vinifera]
Length=568

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/496 (60%), Positives = 370/496 (75%), Gaps = 37/496 (7%)
 Frame = +3

Query  621   RKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEI  788
             RKP K      +EKE     +F+F +R++VG+L+L   +  VF+                
Sbjct  33    RKPSKMLPSGSREKERLLPYLFRFLSRRRVGMLILVGFAFLVFL-------------SGF  79

Query  789   PTISISATMKDR-EY---SIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYT  956
              T+S     KD  +Y   ++    +NN H+  L  P +   +A+             GYT
Sbjct  80    STVSKEVKHKDNVDYIPSTVTESGENNAHRPPL--PPSTSAVAAV-----------VGYT  126

Query  957   LPPGNPCEGFTLPPPPA-DKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHE  1130
              P  +PCE F  PPPP  D+KR GPRPCPVCYLPVE+AIA +P++ S SP+L  LNY+HE
Sbjct  127   PPLHHPCENFAFPPPPPPDRKRIGPRPCPVCYLPVEQAIASIPSSSSPSPLLKQLNYVHE  186

Query  1131  ET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGE  1307
             E  +     GGS FGGYPSL+QR++S+DI+ESM+VHCGFV G KPG  T FDID+ DL E
Sbjct  187   ENPIKTEPHGGSEFGGYPSLKQRNDSFDIKESMTVHCGFVTGSKPGHHTGFDIDEADLKE  246

Query  1308  MEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRI  1487
             +E    V+VASAIFG +D+I QP+N+SE AR+NV FYMF+DE TEA++RNS  L+SS R+
Sbjct  247   LEQPHEVIVASAIFGNYDIIQQPRNVSEAARKNVPFYMFIDEETEAYMRNSSVLDSSKRV  306

Query  1488  GLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWR  1667
             GLWRI++VH++PYTDARRNGKIPKLLLHR+FPN R+S+WIDGKL+L+VDPYQ+LERFLWR
Sbjct  307   GLWRIILVHNIPYTDARRNGKIPKLLLHRIFPNVRFSIWIDGKLQLLVDPYQVLERFLWR  366

Query  1668  RNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDV  1847
             +NAS AISRHY+RFDVFEEAEANKAAGK+DN SID+Q+EFYK EGLTP+S AK PITSDV
Sbjct  367   QNASLAISRHYRRFDVFEEAEANKAAGKYDNVSIDYQIEFYKNEGLTPYSEAKLPITSDV  426

Query  1848  PEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERR  2027
             PEGCVI++EHIPI+NLFTCLWFNEVDRFT RDQ+SF+ VRDKI S+ +WN+ MFLDCERR
Sbjct  427   PEGCVIVKEHIPITNLFTCLWFNEVDRFTSRDQLSFAIVRDKITSQVDWNISMFLDCERR  486

Query  2028  NFVVQGYHRDILEHRA  2075
             NFV Q YHRD+LEH A
Sbjct  487   NFVYQAYHRDLLEHMA  502



>ref|XP_009761252.1| PREDICTED: uncharacterized protein LOC104213447 [Nicotiana sylvestris]
 ref|XP_009761253.1| PREDICTED: uncharacterized protein LOC104213447 [Nicotiana sylvestris]
Length=570

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/491 (60%), Positives = 360/491 (73%), Gaps = 17/491 (3%)
 Frame = +3

Query  618   PRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTI  797
             P+  L   +EKE     I +F  R++VG+L+L A +   FV    +   +DA        
Sbjct  37    PKTSLSGSREKERCLPSICRFLVRRQVGMLILVAFALLAFVAGFSMVNKDDA--------  88

Query  798   SISATMKDREYSIEPEEKNNIH-KTLLAKPNNNRGIASTDQPPP-LPRVYFTGYTLPPGN  971
             S S+ +  +E+     E N  H   LL +     G  +   PPP    V     ++   +
Sbjct  89    SRSSELDFKEWF----ENNTYHLSALLPRKVMVCGENTAQLPPPNASTVILAKDSIAFPD  144

Query  972   PCEGFTLPPPP-ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEET-Ls  1142
             PC+ F  PPPP  D++R GPRPCPVCY+PVE+AIA MP  PS SP L +L Y HE+  + 
Sbjct  145   PCQNFAFPPPPPGDRRRIGPRPCPVCYVPVEQAIARMPRVPSPSPGLQHLTYFHEQIPMK  204

Query  1143  enefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
                 GGS FGGYPSL +R+ S+DI+ESM+VHCGFVKG +PG  T FDI+  DL EME   
Sbjct  205   TEPHGGSEFGGYPSLEERNASFDIKESMTVHCGFVKGCRPGDRTGFDINAADLKEMEQFH  264

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
              V+VASAIFG +D+I QPKN  E ARENV FYMFVDE TEA L+NS  L+S +R+GLWRI
Sbjct  265   EVIVASAIFGNYDVIQQPKNAGEIARENVPFYMFVDEETEASLKNSSLLDSRNRVGLWRI  324

Query  1503  VVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASF  1682
             ++V ++PY+DARRNGK+PKLLLHRLFPN RYS+WIDGKL+LVVDPYQILERFLWR+NA+F
Sbjct  325   ILVRNVPYSDARRNGKVPKLLLHRLFPNVRYSIWIDGKLQLVVDPYQILERFLWRQNATF  384

Query  1683  AISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCV  1862
             AISRHY+RFDVFEEAEANKAAGK+DN SID Q+ FY+KEGLT +S AK PITSDVPEGCV
Sbjct  385   AISRHYRRFDVFEEAEANKAAGKYDNVSIDHQIGFYRKEGLTAYSEAKLPITSDVPEGCV  444

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             II+EHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDK+ ++ +WN+ MFLDCERRNFV+Q
Sbjct  445   IIKEHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKLMAKVSWNINMFLDCERRNFVIQ  504

Query  2043  GYHRDILEHRA  2075
              YHRD+LE RA
Sbjct  505   AYHRDLLEQRA  515



>ref|XP_010644197.1| PREDICTED: uncharacterized protein LOC100246918 isoform X3 [Vitis 
vinifera]
Length=569

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/493 (60%), Positives = 368/493 (75%), Gaps = 30/493 (6%)
 Frame = +3

Query  621   RKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVL-YVGKGEDARGPE  785
             RKP K      +EKE     +F+F +R++VG+L+L   +  VF+     V K E      
Sbjct  33    RKPSKMLPSGSREKERLLPYLFRFLSRRRVGMLILVGFAFLVFLSGFSTVSKDEVKHKDN  92

Query  786   IPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPP  965
             +  I  + T            +NN H+  L  P +   +A+             GYT P 
Sbjct  93    VDYIPSTVTESG---------ENNAHRPPL--PPSTSAVAAV-----------VGYTPPL  130

Query  966   GNPCEGFTLPPPPA-DKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEET-  1136
              +PCE F  PPPP  D+KR GPRPCPVCYLPVE+AIA +P++ S SP+L  LNY+HEE  
Sbjct  131   HHPCENFAFPPPPPPDRKRIGPRPCPVCYLPVEQAIASIPSSSSPSPLLKQLNYVHEENP  190

Query  1137  LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEA  1316
             +     GGS FGGYPSL+QR++S+DI+ESM+VHCGFV G KPG  T FDID+ DL E+E 
Sbjct  191   IKTEPHGGSEFGGYPSLKQRNDSFDIKESMTVHCGFVTGSKPGHHTGFDIDEADLKELEQ  250

Query  1317  CEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLW  1496
                V+VASAIFG +D+I QP+N+SE AR+NV FYMF+DE TEA++RNS  L+SS R+GLW
Sbjct  251   PHEVIVASAIFGNYDIIQQPRNVSEAARKNVPFYMFIDEETEAYMRNSSVLDSSKRVGLW  310

Query  1497  RIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNA  1676
             RI++VH++PYTDARRNGKIPKLLLHR+FPN R+S+WIDGKL+L+VDPYQ+LERFLWR+NA
Sbjct  311   RIILVHNIPYTDARRNGKIPKLLLHRIFPNVRFSIWIDGKLQLLVDPYQVLERFLWRQNA  370

Query  1677  SFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEG  1856
             S AISRHY+RFDVFEEAEANKAAGK+DN SID+Q+EFYK EGLTP+S AK PITSDVPEG
Sbjct  371   SLAISRHYRRFDVFEEAEANKAAGKYDNVSIDYQIEFYKNEGLTPYSEAKLPITSDVPEG  430

Query  1857  CVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFV  2036
             CVI++EHIPI+NLFTCLWFNEVDRFT RDQ+SF+ VRDKI S+ +WN+ MFLDCERRNFV
Sbjct  431   CVIVKEHIPITNLFTCLWFNEVDRFTSRDQLSFAIVRDKITSQVDWNISMFLDCERRNFV  490

Query  2037  VQGYHRDILEHRA  2075
              Q YHRD+LEH A
Sbjct  491   YQAYHRDLLEHMA  503



>ref|XP_002282417.1| PREDICTED: uncharacterized protein LOC100246918 isoform X2 [Vitis 
vinifera]
Length=604

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/515 (59%), Positives = 380/515 (74%), Gaps = 39/515 (8%)
 Frame = +3

Query  621   RKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEI  788
             RKP K      +EKE     +F+F +R++VG+L+L   +  VF+   +    +DA  PE 
Sbjct  33    RKPSKMLPSGSREKERLLPYLFRFLSRRRVGMLILVGFAFLVFL-SGFSTVSKDA--PES  89

Query  789   PTISISATM----------KDREY-----SIEPEEKNNIH---KTLLAKPNNNRGIASTD  914
              ++SI+  +           D++       IE + K+N+     T+     NN       
Sbjct  90    NSVSITQHIHHINPYDNGESDQDLPFFLPRIEVKHKDNVDYIPSTVTESGENNA------  143

Query  915   QPPPLP-----RVYFTGYTLPPGNPCEGFTLPPPPA-DKKRTGPRPCPVCYLPVEEAIAL  1076
               PPLP          GYT P  +PCE F  PPPP  D+KR GPRPCPVCYLPVE+AIA 
Sbjct  144   HRPPLPPSTSAVAAVVGYTPPLHHPCENFAFPPPPPPDRKRIGPRPCPVCYLPVEQAIAS  203

Query  1077  MPTAPSFSPVL-YLNYIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVK  1250
             +P++ S SP+L  LNY+HEE  +     GGS FGGYPSL+QR++S+DI+ESM+VHCGFV 
Sbjct  204   IPSSSSPSPLLKQLNYVHEENPIKTEPHGGSEFGGYPSLKQRNDSFDIKESMTVHCGFVT  263

Query  1251  GVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVD  1430
             G KPG  T FDID+ DL E+E    V+VASAIFG +D+I QP+N+SE AR+NV FYMF+D
Sbjct  264   GSKPGHHTGFDIDEADLKELEQPHEVIVASAIFGNYDIIQQPRNVSEAARKNVPFYMFID  323

Query  1431  EGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWID  1610
             E TEA++RNS  L+SS R+GLWRI++VH++PYTDARRNGKIPKLLLHR+FPN R+S+WID
Sbjct  324   EETEAYMRNSSVLDSSKRVGLWRIILVHNIPYTDARRNGKIPKLLLHRIFPNVRFSIWID  383

Query  1611  GKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFY  1790
             GKL+L+VDPYQ+LERFLWR+NAS AISRHY+RFDVFEEAEANKAAGK+DN SID+Q+EFY
Sbjct  384   GKLQLLVDPYQVLERFLWRQNASLAISRHYRRFDVFEEAEANKAAGKYDNVSIDYQIEFY  443

Query  1791  KKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRD  1970
             K EGLTP+S AK PITSDVPEGCVI++EHIPI+NLFTCLWFNEVDRFT RDQ+SF+ VRD
Sbjct  444   KNEGLTPYSEAKLPITSDVPEGCVIVKEHIPITNLFTCLWFNEVDRFTSRDQLSFAIVRD  503

Query  1971  KIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             KI S+ +WN+ MFLDCERRNFV Q YHRD+LEH A
Sbjct  504   KITSQVDWNISMFLDCERRNFVYQAYHRDLLEHMA  538



>ref|XP_008452456.1| PREDICTED: uncharacterized protein LOC103493486 [Cucumis melo]
 ref|XP_008452457.1| PREDICTED: uncharacterized protein LOC103493486 [Cucumis melo]
 ref|XP_008452458.1| PREDICTED: uncharacterized protein LOC103493486 [Cucumis melo]
 ref|XP_008452460.1| PREDICTED: uncharacterized protein LOC103493486 [Cucumis melo]
Length=587

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/498 (59%), Positives = 367/498 (74%), Gaps = 27/498 (5%)
 Frame = +3

Query  615   PPRKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYV--GKGEDARGPEI  788
             P +  L + +E+E       ++  R++V +LLL  ++  VFV+  +       D + P  
Sbjct  37    PSKTNLSSSRERERVMPLFCRYFGRRRVAMLLLFILALLVFVFGSFAVSRDSSDLKAPYE  96

Query  789   PTISISATMKDREYSIEP--EEKNNI----HKTLLAKP--NNNRGIASTDQPPPLPRVYF  944
              T     T++D      P  EE  +I    H  L+  P  ++NR + S           F
Sbjct  97    ET-----TLRDLINHAVPKTEEFKDIITSTHGNLINPPFPHSNRSLISYS---------F  142

Query  945   TGYTLPPGNPCEGFTLPPP-PADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LN  1118
               ++LP  +PC  F LPPP PA+ KRTG RPCPVCY+PVE+AIA MP APS SPVL  L 
Sbjct  143   PRHSLPSPHPCRNFALPPPAPANGKRTGARPCPVCYIPVEQAIASMPIAPSMSPVLRNLT  202

Query  1119  YIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDK  1295
             YIH+   +     GGS FGGYPSLRQR++S+DI+ESM+VHCGFVKG KPG  + FDID+ 
Sbjct  203   YIHDGNPIKTEPHGGSDFGGYPSLRQRNDSFDIKESMTVHCGFVKGSKPGNQSGFDIDEA  262

Query  1296  DLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNS  1475
             DL E+E    V+VASAIFG +D++ QP NISE +++ V FYMFVDE TEA+++NS  L+S
Sbjct  263   DLVELEEFHEVIVASAIFGNYDVLQQPINISEESKKFVPFYMFVDEETEAYMKNSSLLDS  322

Query  1476  SSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILER  1655
               RIGLWRI+VVH++PY D+RRNGKIPKLLLHRLFPN +YS+WIDGKL+LVVDP+QILER
Sbjct  323   RKRIGLWRIIVVHNVPYADSRRNGKIPKLLLHRLFPNIQYSIWIDGKLQLVVDPFQILER  382

Query  1656  FLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPI  1835
             FLWR+NA+FAISRHYKRFDVFEEA+ANKAAGK+DN+SID Q+ FY  EGLTP+S AK PI
Sbjct  383   FLWRQNATFAISRHYKRFDVFEEADANKAAGKYDNSSIDEQIGFYVSEGLTPYSLAKLPI  442

Query  1836  TSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLD  2015
             TSDVPEGCV+IREHIPI+NLFTCLWFNEVDRFT RDQ+SFS VRDKI S+ NW++ MFLD
Sbjct  443   TSDVPEGCVLIREHIPITNLFTCLWFNEVDRFTSRDQLSFSMVRDKIMSKVNWSLNMFLD  502

Query  2016  CERRNFVVQGYHRDILEH  2069
             CERRNFV+Q YHR++LEH
Sbjct  503   CERRNFVIQTYHRELLEH  520



>gb|EMS60340.1| hypothetical protein TRIUR3_08737 [Triticum urartu]
Length=568

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/405 (65%), Positives = 318/405 (79%), Gaps = 37/405 (9%)
 Frame = +3

Query  969   NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLse  1145
             +PCE F+  PPP D+KRTGPRPCPVCY+PV++A+ALMP AP+ SP+L  LNY+ E+ L  
Sbjct  91    HPCENFSFSPPPIDRKRTGPRPCPVCYVPVDQALALMPAAPTASPILQSLNYLSEDNLVL  150

Query  1146  nefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
              E       GGYPSL QRD S+DI++SM+VHCGFV+G  PG  T FD+D+ DL EM  C+
Sbjct  151   KESNSGSLFGGYPSLEQRDMSFDIKDSMAVHCGFVRGKIPGINTGFDVDEADLSEMRQCQ  210

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
             G VVASAIFG +D++ QP+NISE++++ VCF+MF+DE TEA ++N+  ++++ +IGLWR+
Sbjct  211   GTVVASAIFGNYDIMQQPENISEFSKDTVCFFMFLDEETEAAIKNTTAVDNTEKIGLWRV  270

Query  1503  VVVHDLPYTDARRNGKI-----------------------------------PKLLLHRL  1577
             VVVH+LPY+DARRNGKI                                   PKLLLHRL
Sbjct  271   VVVHNLPYSDARRNGKITDPSETNMFPFFSALDEYVKIWIAQPGEEDAMLNIPKLLLHRL  330

Query  1578  FPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFD  1757
             FPNARYSLWIDGKL+LV DPYQ+LERFLWR+N SFAISRHY+RFDVFEEAEANKA GK+D
Sbjct  331   FPNARYSLWIDGKLKLVKDPYQLLERFLWRKNVSFAISRHYRRFDVFEEAEANKAGGKYD  390

Query  1758  NASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTP  1937
             NASID Q+EFYK+EGLT +S+AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT 
Sbjct  391   NASIDNQIEFYKREGLTHYSSAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTS  450

Query  1938  RDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHR  2072
             RDQISFSTVRDKIRSR NW  +MFLDCERR+FVVQ YHR+++E R
Sbjct  451   RDQISFSTVRDKIRSRVNWTADMFLDCERRDFVVQAYHRELMEQR  495



>ref|XP_002440126.1| hypothetical protein SORBIDRAFT_09g026520 [Sorghum bicolor]
 gb|EES18556.1| hypothetical protein SORBIDRAFT_09g026520 [Sorghum bicolor]
Length=576

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/484 (57%), Positives = 356/484 (74%), Gaps = 11/484 (2%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISI  803
             +PL+  KE+    HR  +   R++ G+LLL AV++A     L+    +D+    I  ++ 
Sbjct  39    RPLRGEKERLQLLHRALRLVGRRRAGVLLLLAVASAAVFCSLFAVVKDDSNS--ISIVNN  96

Query  804   SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEG  983
                    + S+ P   +     +++    +  + +  + P    + +  +T    +PCEG
Sbjct  97    YEVPNAIQKSVYP---STTRPLMMSGNQYSTSVVNKIELPNRLHLSYANFT----HPCEG  149

Query  984   FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefgg  1160
             F++PPP  DKKRTGPRPCPVCY+ V++A ALMP   S SPVL  LNY+ E+ ++ N    
Sbjct  150   FSVPPPLVDKKRTGPRPCPVCYVSVDQAFALMPLQASPSPVLKNLNYVSEDGITANLSNQ  209

Query  1161  sgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVA  1337
                 GG+PSL QR++S++I ESM+VHCGFV+G KPG+ T FDI D DL EME C  +VVA
Sbjct  210   GSGFGGHPSLEQRNDSFNINESMTVHCGFVRGKKPGQGTGFDIKDDDLLEMEQCRELVVA  269

Query  1338  SAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHD  1517
             SAIFG +D+I  P+NISE+++ N CFYMFVDE TEA+++NS  + +++++GLWR+VVV +
Sbjct  270   SAIFGNYDMIQHPRNISEFSKANACFYMFVDEETEAYVKNSSSMYNNNKVGLWRLVVVRN  329

Query  1518  LPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRH  1697
             LPY D RR GKIPKLLLHRLFPN R+S+WID KLELV DPY +LERFLWR+N +FAISRH
Sbjct  330   LPYEDPRRTGKIPKLLLHRLFPNVRFSVWIDAKLELVADPYLLLERFLWRKNTTFAISRH  389

Query  1698  YKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREH  1877
             YKRFDVFEEAEANKAAGK+DN+SID+Q+EFY+ EGLT +S AK PITSDVPEGCVIIREH
Sbjct  390   YKRFDVFEEAEANKAAGKYDNSSIDYQIEFYRNEGLTHYSTAKLPITSDVPEGCVIIREH  449

Query  1878  IPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRD  2057
             IPI+NLFTCLWFNEVDRFT RDQISFSTVRDKIR+R  W  EMF+DCERRNFVVQ YHR+
Sbjct  450   IPITNLFTCLWFNEVDRFTSRDQISFSTVRDKIRARVGWMPEMFMDCERRNFVVQAYHRE  509

Query  2058  ILEH  2069
             +LE 
Sbjct  510   LLEQ  513



>ref|NP_001056134.1| Os05g0531500 [Oryza sativa Japonica Group]
 dbj|BAF18048.1| Os05g0531500 [Oryza sativa Japonica Group]
Length=575

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/481 (58%), Positives = 359/481 (75%), Gaps = 16/481 (3%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCAVSAA-VFVWVLYVGKGEDARGPEIPTISISATMK  818
             KE+    HR  +   R++ G+LLL A ++A VF  +  V K ++A         ++ T++
Sbjct  40    KERLQLLHRALRLVGRRRAGVLLLLAAASAAVFCSIFAVVKDDNASMIIANNYEVANTIQ  99

Query  819   DREYSIEPEEKNNIHKTLLAKPN--NNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTL  992
             +  Y        ++ + L+   +  +   +  T+ P  L R+ F  +T    +PCEGF++
Sbjct  100   NSVYP-------SMTRPLMTSSDQFSASSVNKTELPNRL-RLSFANFT---HHPCEGFSV  148

Query  993   PPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgf  1169
              PP  D KRTGPRPC VCY+PV++A ALMP  PS SPVL  L+Y+ E+ ++ N       
Sbjct  149   APPLVDPKRTGPRPCDVCYVPVDQAFALMPPQPSPSPVLKNLSYVFEDNITANFSNQGSV  208

Query  1170  -ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAI  1346
              GG+PSL QR++S+DI ESM+VHCGFV+G KPG+ + FDI+D DL EME C  +VVASAI
Sbjct  209   FGGHPSLEQRNKSFDISESMTVHCGFVRGKKPGQGSGFDINDDDLLEMEKCRELVVASAI  268

Query  1347  FGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPY  1526
             FG +D+I  P+N SE+++ N CFYMFVDE TEA+++NS  L  ++++GLWR+VVV +LPY
Sbjct  269   FGNYDMIQHPRNASEFSKANACFYMFVDEETEAYVKNSSSLYRNNKVGLWRLVVVRNLPY  328

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GKIPKLLLHRLFPN R+S+WID KL+LVVDPY +LERFLWR+NA+FAISRHYKR
Sbjct  329   EDPRRTGKIPKLLLHRLFPNVRFSVWIDAKLKLVVDPYLLLERFLWRKNATFAISRHYKR  388

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPI  1886
             FDVFEEAEANKAAGK+DNASID+Q+EFY+ EGLT ++ AK PITSDVPEGCVIIREHIPI
Sbjct  389   FDVFEEAEANKAAGKYDNASIDYQIEFYRNEGLTYYTPAKLPITSDVPEGCVIIREHIPI  448

Query  1887  SNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILE  2066
             +NLFTCLWFNEVDRFT RDQISFSTVRDKIR+R  W  EMFLDCERRNFV+QGYHR++LE
Sbjct  449   TNLFTCLWFNEVDRFTSRDQISFSTVRDKIRARVGWMPEMFLDCERRNFVIQGYHRELLE  508

Query  2067  H  2069
              
Sbjct  509   Q  509



>gb|EEE64464.1| hypothetical protein OsJ_19313 [Oryza sativa Japonica Group]
Length=575

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/481 (58%), Positives = 359/481 (75%), Gaps = 16/481 (3%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCAVSAA-VFVWVLYVGKGEDARGPEIPTISISATMK  818
             KE+    HR  +   R++ G+LLL A ++A VF  +  V K ++A         ++ T++
Sbjct  40    KERLQLLHRALRLVGRRRAGVLLLLAAASAAVFCSIFAVVKDDNASMIIANNYEVANTIQ  99

Query  819   DREYSIEPEEKNNIHKTLLAKPN--NNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTL  992
             +  Y        ++ + L+   +  +   +  T+ P  L R+ F  +T    +PCEGF++
Sbjct  100   NSVYP-------SMTRPLMTSSDQFSASSVNKTELPNRL-RLSFANFT---HHPCEGFSV  148

Query  993   PPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgf  1169
              PP  D KRTGPRPC VCY+PV++A ALMP  PS SPVL  L+Y+ E+ ++ N       
Sbjct  149   APPLVDPKRTGPRPCDVCYVPVDQAFALMPPQPSPSPVLKNLSYVFEDNITANFSNQGSV  208

Query  1170  -ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAI  1346
              GG+PSL QR++S+DI ESM+VHCGFV+G KPG+ + FDI+D DL EME C  +VVASAI
Sbjct  209   FGGHPSLEQRNKSFDISESMTVHCGFVRGKKPGQGSGFDINDDDLLEMEKCRELVVASAI  268

Query  1347  FGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPY  1526
             FG +D+I  P+N SE+++ N CFYMFVDE TEA+++NS  L  ++++GLWR+VVV +LPY
Sbjct  269   FGNYDMIQHPRNASEFSKANACFYMFVDEETEAYVKNSSSLYRNNKVGLWRLVVVRNLPY  328

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GKIPKLLLHRLFPN R+S+WID KL+LVVDPY +LERFLWR+NA+FAISRHYKR
Sbjct  329   EDPRRTGKIPKLLLHRLFPNVRFSVWIDAKLKLVVDPYLLLERFLWRKNATFAISRHYKR  388

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPI  1886
             FDVFEEAEANKAAGK+DNASID+Q+EFY+ EGLT ++ AK PITSDVPEGCVIIREHIPI
Sbjct  389   FDVFEEAEANKAAGKYDNASIDYQIEFYRNEGLTYYAPAKLPITSDVPEGCVIIREHIPI  448

Query  1887  SNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILE  2066
             +NLFTCLWFNEVDRFT RDQISFSTVRDKIR+R  W  EMFLDCERRNFV+QGYHR++LE
Sbjct  449   TNLFTCLWFNEVDRFTSRDQISFSTVRDKIRARVGWMPEMFLDCERRNFVIQGYHRELLE  508

Query  2067  H  2069
              
Sbjct  509   Q  509



>ref|XP_004141362.1| PREDICTED: uncharacterized protein LOC101219639 [Cucumis sativus]
 ref|XP_004167997.1| PREDICTED: uncharacterized LOC101219639 [Cucumis sativus]
Length=522

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/379 (70%), Positives = 319/379 (84%), Gaps = 3/379 (1%)
 Frame = +3

Query  942   FTGYTLPPGNPCEGFTLPPP-PADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-L  1115
             F  ++LP  +PC  F LPPP PA+ KRTG RPCPVCY+PVE+AIA MP APS SPVL  L
Sbjct  77    FPRHSLPSPHPCINFALPPPAPANGKRTGARPCPVCYIPVEQAIASMPIAPSISPVLRNL  136

Query  1116  NYIHE-ETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDD  1292
              YIH+   +     GGS FGGYPSLRQR++S+DI+ESM+VHCGFVKG KPG  + FDID+
Sbjct  137   TYIHDGNPIKTEPHGGSDFGGYPSLRQRNDSFDIKESMTVHCGFVKGSKPGNQSGFDIDE  196

Query  1293  KDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLN  1472
              DL E+E    V+VASAIFG +D++ QP NISE +++ V FYMF+DE TEA+++NS  L+
Sbjct  197   ADLLELEEFHEVIVASAIFGNYDVLQQPINISEESKKFVPFYMFIDEETEAYMKNSSLLD  256

Query  1473  SSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILE  1652
             S  RIGLWRI+VVH++PY D+RRNGKIPKLLLHRLFPN +YS+WIDGKL+LVVDP+QILE
Sbjct  257   SRKRIGLWRIIVVHNVPYADSRRNGKIPKLLLHRLFPNIQYSIWIDGKLQLVVDPFQILE  316

Query  1653  RFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFP  1832
             RFLWR+NA+FAISRHYKRFDVFEEA+ANKAAGK+DN+SID Q+ FY  EGLTP+S AK P
Sbjct  317   RFLWRQNATFAISRHYKRFDVFEEADANKAAGKYDNSSIDEQIGFYVTEGLTPYSLAKLP  376

Query  1833  ITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFL  2012
             ITSDVPEGCV+IREHIPI+NLFTCLWFNEVDRFT RDQ+SFS VRDKI S+ NW++ MFL
Sbjct  377   ITSDVPEGCVLIREHIPITNLFTCLWFNEVDRFTSRDQLSFSMVRDKIMSKVNWSLNMFL  436

Query  2013  DCERRNFVVQGYHRDILEH  2069
             DCERRNFV+Q YHR++LEH
Sbjct  437   DCERRNFVIQTYHRELLEH  455



>ref|XP_010060565.1| PREDICTED: uncharacterized protein LOC104448440 isoform X4 [Eucalyptus 
grandis]
Length=495

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/397 (67%), Positives = 325/397 (82%), Gaps = 3/397 (1%)
 Frame = +3

Query  1020  TGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-LsenefggsgfggYPSLRQ  1193
             T  R CPVCY+PVE+AIA MP++P+ SPVL  L YIH+E  +   + G S FGGYPSL +
Sbjct  88    TVNRACPVCYVPVEQAIASMPSSPAISPVLRNLTYIHDEDPVKSEQHGVSDFGGYPSLTE  147

Query  1194  RDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQ  1373
             RD+S+DI+ESM VHCGFVKG KPGR T FDID+ DL EME    V+VASAIFG +D+I +
Sbjct  148   RDDSFDIKESMRVHCGFVKGHKPGRQTGFDIDEADLEEMEQYHDVIVASAIFGNYDIIQE  207

Query  1374  PKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKI  1553
             P+NISE A++N+ F+MF+DE TEA+++NS  LNSS R+GLW+I+VVH++PY DARRNGK+
Sbjct  208   PRNISEAAKKNIPFFMFIDEETEAYMQNSSVLNSSRRVGLWKIIVVHNIPYADARRNGKV  267

Query  1554  PKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEA  1733
             PKLLLHRLFPN RYS+W+DGKL+LVVDPYQILERFLWR NASFAISRHY+RFDVFEEAEA
Sbjct  268   PKLLLHRLFPNVRYSIWVDGKLQLVVDPYQILERFLWRENASFAISRHYRRFDVFEEAEA  327

Query  1734  NKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWF  1913
             NKAAGK+DNASID Q+EFYK+EGLTP+S AK PITSDVPEGCVI+REHIPI+NLFTCLWF
Sbjct  328   NKAAGKYDNASIDSQIEFYKREGLTPYSVAKLPITSDVPEGCVIMREHIPITNLFTCLWF  387

Query  1914  NEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRApppppp  2093
             NEVDRFT RDQ+SFSTVRDK+ ++ +W++ MFLDCERRNFV+Q YHRD+LE   PP  P 
Sbjct  388   NEVDRFTARDQLSFSTVRDKLMAKADWSINMFLDCERRNFVIQAYHRDLLEQMPPPASPA  447

Query  2094  pRATIRDGVLKTSKYSGATTK-LLARRIGDPRSRHRQ  2201
              RA +   ++ TS       K + ++R    R RHR+
Sbjct  448   IRARLSSTIISTSGRRAPVKKGISSKRSKSDRRRHRK  484



>ref|XP_002440091.1| hypothetical protein SORBIDRAFT_09g025850 [Sorghum bicolor]
 gb|EES18521.1| hypothetical protein SORBIDRAFT_09g025850 [Sorghum bicolor]
Length=635

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/463 (59%), Positives = 337/463 (73%), Gaps = 47/463 (10%)
 Frame = +3

Query  954   TLPPG----NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LN  1118
             + PP     +PCE F+L PPP D+KRTGPRPCPVCYLPVE+A+AL P  PS SPVL  LN
Sbjct  161   SFPPAVMDHHPCENFSLSPPPIDRKRTGPRPCPVCYLPVEQALALRPAKPSLSPVLQSLN  220

Query  1119  YIHEETLs-enefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDK  1295
             Y+ EE L  +    GS FGG+PSL +R++SYDI++SM+VHCGF++G  PG +T FDID+ 
Sbjct  221   YMFEENLIPKESKSGSLFGGFPSLEEREKSYDIKDSMTVHCGFIRGKTPGLSTGFDIDEA  280

Query  1296  DLGEMEACEGVVVASAIFGAF------------------------------DLIHQPKNI  1385
             D  EM+ C+  VVASAIFG +                              D++ QP+NI
Sbjct  281   DRSEMQLCQSTVVASAIFGNYYFGFQPSFQIACTLAYKYCVHLLTNFSGNYDVMQQPENI  340

Query  1386  SEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLL  1565
             S+++++ VCF+MF+DE TEA ++NS  +  + RIGLWR+VVV +LP+TDARRNGK+PKLL
Sbjct  341   SKFSKDTVCFFMFLDEETEAAIKNSTTIGHTKRIGLWRVVVVRNLPFTDARRNGKVPKLL  400

Query  1566  LHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAA  1745
             LHRLFPN RYS+WIDGKL+LV DPYQ+LERFLWR+N SFAISRHY+RFDVFEEAEANKA 
Sbjct  401   LHRLFPNVRYSIWIDGKLKLVRDPYQVLERFLWRKNVSFAISRHYRRFDVFEEAEANKAG  460

Query  1746  GKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVD  1925
             GK+DN SID+Q+EFYK+EGLT +S+AK PITSDVPEGCVIIREH+PI+NLFTCLWFNEVD
Sbjct  461   GKYDNTSIDYQIEFYKREGLTHYSSAKLPITSDVPEGCVIIREHVPITNLFTCLWFNEVD  520

Query  1926  RFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRAppppp-----  2090
             RFT RDQ+SFSTVRDKIRSR NW  +MFLDCERR+FVVQ YHR++LE R           
Sbjct  521   RFTSRDQLSFSTVRDKIRSRVNWTADMFLDCERRDFVVQSYHRELLEQRQATLRSWPPQR  580

Query  2091  ------ppRATIRDGVLKTSKYSGATTKLLARRIGDPRSRHRQ  2201
                    PR  + D   K    + AT KL  +R  D RS  R+
Sbjct  581   PPIVRVHPRKMLPDNAAKEPWRASATKKLSGKRTRDKRSSSRR  623



>emb|CDP05921.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/488 (57%), Positives = 352/488 (72%), Gaps = 16/488 (3%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISI  803
             + L   +EKE +   IFK+  R+KV +L+L  ++             E A   E   +  
Sbjct  38    RTLSGSREKERYLPFIFKYLGRRKVIMLILVIIAILALTTGFLTASKEAAS--ESSMLGF  95

Query  804   SATMKDREYSIEPEEKNNIHKTLLAKPNNN-RGIASTDQPPPLPRVYFTGYTLPP-----  965
                 ++R Y +  E    +  T     N N  G+ ST+    LP  + +  T+       
Sbjct  96    DGWFENRTYPVSRE----VEGTSENGSNVNIHGVCSTNNGSYLPTAHNSTATIAMPAPVM  151

Query  966   -GNPCEGFTLPPPP-ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET  1136
               +PC+ F  PPPP  D +R GPRPCPVCY+PVE+AIA +P + S SPVL+ L Y +EE 
Sbjct  152   LSHPCKTFAFPPPPPGDARRIGPRPCPVCYIPVEQAIAALPRSASASPVLHHLTYFYEEN  211

Query  1137  -LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEME  1313
              +     GGS FGGYPSL+QR++ +++ +SM+VHCGF+KG + G  T FDID  DL EM+
Sbjct  212   PMKTEPHGGSDFGGYPSLKQRNDYFNVNKSMTVHCGFIKGCRAGDNTGFDIDLDDLKEMD  271

Query  1314  ACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGL  1493
                 ++VASAIFG +D+I QP +ISE A++N+ FYMFVDE TEA+++NS  L++S R+GL
Sbjct  272   EFHEIIVASAIFGNYDIIQQPTDISEIAKKNIPFYMFVDEETEAYMKNSSLLDNSKRVGL  331

Query  1494  WRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRN  1673
             WRI+VVH++PYTD RRNGK+PKLLLHRLFPN RYS+WIDGKL+LVVDPYQILERFLWR+N
Sbjct  332   WRIIVVHNVPYTDPRRNGKVPKLLLHRLFPNVRYSIWIDGKLQLVVDPYQILERFLWRQN  391

Query  1674  ASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPE  1853
             A+FAISRHY RFDV  EAEANKAAGK+DN SID Q++FY+KEGLTP+S AK PITSDVPE
Sbjct  392   ATFAISRHYARFDVIVEAEANKAAGKYDNVSIDNQIDFYRKEGLTPYSKAKLPITSDVPE  451

Query  1854  GCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNF  2033
             GCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKI ++ NW + MFLDCERRNF
Sbjct  452   GCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIMAKANWTINMFLDCERRNF  511

Query  2034  VVQGYHRD  2057
             V+Q YHRD
Sbjct  512   VIQAYHRD  519



>gb|EEC79575.1| hypothetical protein OsI_20740 [Oryza sativa Indica Group]
Length=464

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/381 (68%), Positives = 315/381 (83%), Gaps = 5/381 (1%)
 Frame = +3

Query  933   RVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY  1112
             R+ F  +T    +PCEGF++ PP  D KRTGPRPC VCY+PV++A ALMP  PS SPVL 
Sbjct  27    RLSFANFT---HHPCEGFSVAPPLVDPKRTGPRPCDVCYVPVDQAFALMPLQPSPSPVLK  83

Query  1113  -LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDI  1286
              L+Y+ E+ ++ N        GG+PSL QR++S+DIRESM+VHCGFV+G KPG+ + FDI
Sbjct  84    NLSYVFEDNITANFSNQGSVFGGHPSLEQRNKSFDIRESMTVHCGFVRGKKPGQGSGFDI  143

Query  1287  DDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGD  1466
             +D DL EME C  +VVASAIFG +D+I  P+N SE+++ N CFYMFVDE TEA+++NS  
Sbjct  144   NDDDLLEMEKCRELVVASAIFGNYDMIQHPRNASEFSKANACFYMFVDEETEAYVKNSSS  203

Query  1467  LNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQI  1646
             L  ++++GLWR+VVV +LPY D RR GKIPKLLLHRLFPN R+S+WID KL+LVVDPY +
Sbjct  204   LYRNNKVGLWRLVVVRNLPYEDPRRTGKIPKLLLHRLFPNVRFSVWIDAKLKLVVDPYLL  263

Query  1647  LERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAK  1826
             LERFLWR+NA+FAISRHYKRFDVFEEAEANKAAGK+DNASID+Q+EFY+ EGLT ++ AK
Sbjct  264   LERFLWRKNATFAISRHYKRFDVFEEAEANKAAGKYDNASIDYQIEFYRNEGLTYYAPAK  323

Query  1827  FPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEM  2006
              PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQISFSTVRDKIR+R  W  EM
Sbjct  324   LPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQISFSTVRDKIRARVGWMPEM  383

Query  2007  FLDCERRNFVVQGYHRDILEH  2069
             FLDCERRNFV+QGYHR++LE 
Sbjct  384   FLDCERRNFVIQGYHRELLEQ  404



>ref|XP_009798714.1| PREDICTED: uncharacterized protein LOC104244891, partial [Nicotiana 
sylvestris]
Length=413

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/404 (73%), Positives = 330/404 (82%), Gaps = 10/404 (2%)
 Frame = +3

Query  639   FKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMK  818
             +KEKEG    I KFA RKKVG+LLLCAVS AV VWVL+V KGEDA+        ++A++ 
Sbjct  2     YKEKEGLLPWIHKFAPRKKVGMLLLCAVSLAVLVWVLFVDKGEDAQ-------ELNASIT  54

Query  819   DREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQP-PPLP-RVYFTGYTLPPGNPCEGFTL  992
             +  ++ E  +K+N       +  N    AS  QP PPLP  VYF GYTLPPGNPCEGFTL
Sbjct  55    NSVFTPEAGQKDNSTYIESIERTNVGQSASIVQPLPPLPPTVYFKGYTLPPGNPCEGFTL  114

Query  993   PPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSP-VLYLNYIHEETLsenefggsgf  1169
             PPPPADKKRTGPRPCPVCYLPVE+AIALMP APSFSP +  L YI EE L + EFGGS F
Sbjct  115   PPPPADKKRTGPRPCPVCYLPVEQAIALMPDAPSFSPGISNLTYIREENLRKTEFGGSEF  174

Query  1170  ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIF  1349
             GGYPSL QR+ SYD+RESMS+HCGFV+G++PG  T FDIDD DL  ME+C GV+VASAIF
Sbjct  175   GGYPSLMQRNNSYDVRESMSLHCGFVRGIRPGHQTGFDIDDSDLLGMESCGGVLVASAIF  234

Query  1350  GAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYT  1529
             GAFDLI QPKNISEYA++NVCFYMFVDE TE FLR+S +L+ + RIGLWRIV+VH+LPY 
Sbjct  235   GAFDLIRQPKNISEYAKKNVCFYMFVDEETEVFLRDSSELDGTMRIGLWRIVIVHNLPYD  294

Query  1530  DARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRF  1709
             D RRNGK+PKLLLHRLFPNARYSLWID KLELVVDPYQILERFLWR+NASFAISRHY+RF
Sbjct  295   DPRRNGKVPKLLLHRLFPNARYSLWIDAKLELVVDPYQILERFLWRKNASFAISRHYRRF  354

Query  1710  DVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITS  1841
             DVF EAEANKAA KFDNASIDFQVEFYKKEGLTP+S AK PITS
Sbjct  355   DVFIEAEANKAAAKFDNASIDFQVEFYKKEGLTPYSTAKLPITS  398



>gb|KGN55129.1| hypothetical protein Csa_4G637690 [Cucumis sativus]
Length=587

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/491 (59%), Positives = 363/491 (74%), Gaps = 23/491 (5%)
 Frame = +3

Query  630   LKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYV--GKGEDARGPEIPT---  794
             L + +E+E       ++  R++V +LLL  ++  VFV+  +       D + P   T   
Sbjct  42    LSSTRERERVIPLCCRYFGRRRVAMLLLFILALLVFVFGSFAVSRDSSDLKAPYEETTLR  101

Query  795   -ISISATMKDREYSIEPEEKNNIHKTLLAKP--NNNRGIASTDQPPPLPRVYFTGYTLPP  965
              +   A +K  E+    +   + H  L+  P   +NR + S           F  ++LP 
Sbjct  102   DLLNPAVLKTEEFK---DIITSTHGNLINPPFPYSNRSLISYS---------FPRHSLPS  149

Query  966   GNPCEGFTLPPP-PADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-  1136
              +PC  F LPPP PA+ KRTG RPCPVCY+PVE+AIA MP APS SPVL  L YIH+   
Sbjct  150   PHPCINFALPPPAPANGKRTGARPCPVCYIPVEQAIASMPIAPSISPVLRNLTYIHDGNP  209

Query  1137  LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEA  1316
             +     GGS FGGYPSLRQR++S+DI+ESM+VHCGFVKG KPG  + FDID+ DL E+E 
Sbjct  210   IKTEPHGGSDFGGYPSLRQRNDSFDIKESMTVHCGFVKGSKPGNQSGFDIDEADLLELEE  269

Query  1317  CEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLW  1496
                V+VASAIFG +D++ QP NISE +++ V FYMF+DE TEA+++NS  L+S  RIGLW
Sbjct  270   FHEVIVASAIFGNYDVLQQPINISEESKKFVPFYMFIDEETEAYMKNSSLLDSRKRIGLW  329

Query  1497  RIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNA  1676
             RI+VVH++PY D+RRNGKIPKLLLHRLFPN +YS+WIDGKL+LVVDP+QILERFLWR+NA
Sbjct  330   RIIVVHNVPYADSRRNGKIPKLLLHRLFPNIQYSIWIDGKLQLVVDPFQILERFLWRQNA  389

Query  1677  SFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEG  1856
             +FAISRHYKRFDVFEEA+ANKAAGK+DN+SID Q+ FY  EGLTP+S AK PITSDVPEG
Sbjct  390   TFAISRHYKRFDVFEEADANKAAGKYDNSSIDEQIGFYVTEGLTPYSLAKLPITSDVPEG  449

Query  1857  CVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFV  2036
             CV+IREHIPI+NLFTCLWFNEVDRFT RDQ+SFS VRDKI S+ NW++ MFLDCERRNFV
Sbjct  450   CVLIREHIPITNLFTCLWFNEVDRFTSRDQLSFSMVRDKIMSKVNWSLNMFLDCERRNFV  509

Query  2037  VQGYHRDILEH  2069
             +Q YHR++LEH
Sbjct  510   IQTYHRELLEH  520



>ref|XP_004961409.1| PREDICTED: uncharacterized protein LOC101783074 [Setaria italica]
Length=571

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/369 (70%), Positives = 308/369 (83%), Gaps = 2/369 (1%)
 Frame = +3

Query  969   NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLse  1145
             +PCEGF++PPP  DKKRTGPRPCPVCY+ V++A ALMP   S SPVL  LNYI E+ +  
Sbjct  142   HPCEGFSVPPPLVDKKRTGPRPCPVCYVSVDQAFALMPLQASPSPVLKNLNYISEDGIVA  201

Query  1146  nefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
             N        GG+PSL QR++S+DI ESM+VHCGFV+G KPG+ T FDI D DL EME C 
Sbjct  202   NLSSQGSEFGGHPSLEQRNKSFDISESMTVHCGFVRGKKPGQGTGFDIKDDDLVEMEQCR  261

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
              +VVASAIFG +D+I  P+NISE+++ N CFYMFVDE TEA+++NS  L +++++GLWR+
Sbjct  262   ELVVASAIFGNYDMIQHPRNISEFSKANACFYMFVDEETEAYVKNSSSLYNNNKVGLWRL  321

Query  1503  VVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASF  1682
             VVV +LPY D RR GKIPKLLLHRLFPN R+S+WID KLELV DPY +LERFLWR+ A+F
Sbjct  322   VVVRNLPYEDPRRTGKIPKLLLHRLFPNVRFSVWIDAKLELVADPYLLLERFLWRKKATF  381

Query  1683  AISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCV  1862
             AISRHYKRFDVFEEAEANKAAGK+DNAS+D+Q+EFY+ EGL+ +S AKFPITSDVPEGCV
Sbjct  382   AISRHYKRFDVFEEAEANKAAGKYDNASVDYQIEFYRNEGLSHYSPAKFPITSDVPEGCV  441

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             IIREHIPI+NLFTCLWFNEVDRFT RDQISFSTVRDKIR+R  W  EMFLDCERRNFVVQ
Sbjct  442   IIREHIPITNLFTCLWFNEVDRFTSRDQISFSTVRDKIRARVGWMPEMFLDCERRNFVVQ  501

Query  2043  GYHRDILEH  2069
              YHR++LE 
Sbjct  502   AYHRELLEQ  510



>ref|XP_008656481.1| PREDICTED: uncharacterized protein LOC103635877 isoform X1 [Zea 
mays]
 gb|AFW82561.1| hypothetical protein ZEAMMB73_537168 [Zea mays]
Length=579

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/481 (58%), Positives = 355/481 (74%), Gaps = 11/481 (2%)
 Frame = +3

Query  633   KTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISAT  812
             +T + ++   HR  +   R++ G+LLL AV++A     L+    +DA    I  ++    
Sbjct  37    RTLRVEKERLHRALRLVGRRRTGVLLLLAVASAALFCSLFAVVKDDANSTSI--VNNYEV  94

Query  813   MKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTL  992
                 + S+ P     +   +++    +  + +    P    + F  +T    +PCEGF++
Sbjct  95    PNAIQKSVYPSRTRPL---MMSGNQESTSVVNKIDFPNRLHLSFANFT----HPCEGFSV  147

Query  993   PPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgf  1169
             PPP  DKKRTGPRPCPVCY+ V++A ALMP   S SPVL  LNY+ E+ ++ N       
Sbjct  148   PPPLVDKKRTGPRPCPVCYVSVDQAFALMPLQASPSPVLKDLNYVSEDGVTANLSNQGSG  207

Query  1170  -ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAI  1346
              GG+PSL QR++S++I ESM+VHCGFV+G KPG+ T FDI D DL EME C  +VVASAI
Sbjct  208   FGGHPSLDQRNDSFNINESMTVHCGFVRGKKPGQGTGFDIKDDDLLEMEQCHDLVVASAI  267

Query  1347  FGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPY  1526
             FG +D+I  P+NIS++++ N CFYMFVDE TEA+++NS  L +++++GLWR+VVV +LPY
Sbjct  268   FGNYDMIQHPRNISDFSKANACFYMFVDEETEAYVKNSSSLYNNNKVGLWRLVVVRNLPY  327

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GKIPKLLLHRLFPN R+S+WID KLELVVDPY +LERFLWR+N +FAISRHYKR
Sbjct  328   EDPRRTGKIPKLLLHRLFPNVRFSVWIDAKLELVVDPYLLLERFLWRKNTTFAISRHYKR  387

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPI  1886
             FDVFEEAEANKAAGK+DNASID+Q+EFY+ EGLT +S+AK PITSDVPEGCVIIREHIPI
Sbjct  388   FDVFEEAEANKAAGKYDNASIDYQIEFYRNEGLTHYSSAKLPITSDVPEGCVIIREHIPI  447

Query  1887  SNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILE  2066
             +NLFTC+WFNEVDRFT RDQISFSTVRDKIR+R  W  EMF+DCERRNFVVQ YHR++LE
Sbjct  448   TNLFTCVWFNEVDRFTSRDQISFSTVRDKIRARVGWMPEMFMDCERRNFVVQVYHRELLE  507

Query  2067  H  2069
              
Sbjct  508   Q  508



>ref|XP_008649892.1| PREDICTED: uncharacterized protein LOC103630624 [Zea mays]
Length=573

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/458 (59%), Positives = 339/458 (74%), Gaps = 12/458 (3%)
 Frame = +3

Query  702   LLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAK  881
             L+LL  VSAAVF  +  V K +      +    +   ++   Y       +     +++ 
Sbjct  62    LMLLAVVSAAVFSSLFAVVKDDSNSISIVNNYEVPNAIQKSVY------PSTTRPLMMSG  115

Query  882   PNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVE  1061
                +  + +  + P    + +  +T    +PCEGF++PPP  DKKRTGPRPCPVCY+ V+
Sbjct  116   NQYSTSVVNKIELPNRLHLTYANFT----HPCEGFSVPPPLVDKKRTGPRPCPVCYVSVD  171

Query  1062  EAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVH  1235
             +A ALMP   S SPV+  LNY+ E+ ++ N        GG+PSL QR++S++I ESM+VH
Sbjct  172   QAFALMPLQASPSPVVKNLNYVSEDGVTANLSNLGSGFGGHPSLEQRNKSFNINESMTVH  231

Query  1236  CGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCF  1415
             CGFV+G KPG+ T FDI D DL EME C  +VVASAIFG +D+I  P+NISE+++ N CF
Sbjct  232   CGFVRGKKPGQGTGFDIKDDDLLEMEQCRELVVASAIFGNYDMIQHPRNISEFSKANACF  291

Query  1416  YMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARY  1595
             YMFVDE TEA+++NS  L +++++GLWR+VVV +LPY D RR GKIPKLLLHRLFPN ++
Sbjct  292   YMFVDEETEAYVKNSSSLYNNNKVGLWRLVVVRNLPYEDPRRTGKIPKLLLHRLFPNVKF  351

Query  1596  SLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDF  1775
             S+WID KL+LV DPY +LERFLWR+N +FAISRHYKRFDVFEEAEANKAAGK+ NASID+
Sbjct  352   SVWIDAKLQLVADPYLLLERFLWRKNTTFAISRHYKRFDVFEEAEANKAAGKYYNASIDY  411

Query  1776  QVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISF  1955
             Q+EFY+ EGLT +S AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQISF
Sbjct  412   QIEFYRNEGLTHYSPAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQISF  471

Query  1956  STVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             STVRDKIR+R  W  EMF+DCERRNFVVQ YHR++LE 
Sbjct  472   STVRDKIRARVGWMPEMFMDCERRNFVVQAYHRELLEQ  509



>emb|CAN74978.1| hypothetical protein VITISV_027198 [Vitis vinifera]
Length=616

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/527 (58%), Positives = 380/527 (72%), Gaps = 51/527 (10%)
 Frame = +3

Query  621   RKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEI  788
             RKP K      +EKE     +F+F +R++VG+L+L   +  VF+   +    +DA  PE 
Sbjct  33    RKPSKMLPSGSREKERLLPYLFRFLSRRRVGMLILVGFAFLVFL-SGFSTVSKDA--PES  89

Query  789   PTISISATM----------KDREY-----SIEPEEKNNIH---KTLLAKPNNNRGIASTD  914
              ++SI+  +           D++       IE + K+N+     T+     NN       
Sbjct  90    NSVSITQHIHHINPYDNGESDQDLPFFLPRIEVKHKDNVDYIPSTVTESGENNA------  143

Query  915   QPPPLP-----RVYFTGYTLPPGNPCEGFTLPPPPA-DKKRTGPRPCPVCYLPVEEAIAL  1076
               PPLP          GYT P  +PCE F  PPPP  D+KR GPRPCPVCYLPVE+AIA 
Sbjct  144   HRPPLPPSTSAVAAVIGYTPPLHHPCENFAFPPPPPPDRKRIGPRPCPVCYLPVEQAIAS  203

Query  1077  MPTAPSFSPVL-YLNYIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVK  1250
             +P++ S SP+L  LNY+HEE  +     GGS FGGYPSL+QR++S+DI+ESM+VHCGFV 
Sbjct  204   IPSSSSPSPLLKQLNYVHEENPIKTEPHGGSEFGGYPSLKQRNDSFDIKESMTVHCGFVT  263

Query  1251  GVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA------------FDLIHQPKNISEY  1394
             G KPG  T FDID+ DL E+E    V+VASAIFG             +D+I QP+N+SE 
Sbjct  264   GSKPGHHTGFDIDEADLKELEQPHEVIVASAIFGIEDETAQIYLKGNYDIIQQPRNVSEA  323

Query  1395  ARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHR  1574
             AR+NV FYMF+DE TEA++RNS  L+SS R+GLWRI++VH++PYTDARRNGKIPKLLLHR
Sbjct  324   ARKNVPFYMFIDEETEAYMRNSSVLDSSKRVGLWRIILVHNIPYTDARRNGKIPKLLLHR  383

Query  1575  LFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKF  1754
             +FPN R+S+WIDGKL+L+VDPYQ+LERFLWR+NAS AISRHY+RFDVFEEAEANKAAGK+
Sbjct  384   IFPNVRFSIWIDGKLQLLVDPYQVLERFLWRQNASLAISRHYRRFDVFEEAEANKAAGKY  443

Query  1755  DNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFT  1934
             DN SID+Q+EFYK EGLTP+S AK PITSDVPEGCVI++EHIPI+NLFTCLWFNEVDRFT
Sbjct  444   DNVSIDYQIEFYKNEGLTPYSEAKLPITSDVPEGCVIVKEHIPITNLFTCLWFNEVDRFT  503

Query  1935  PRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
              RDQ+SF+ VRDKI S+ +WN+ MFLDCERRNFV Q YHRD+LEH A
Sbjct  504   SRDQLSFAIVRDKITSQVDWNISMFLDCERRNFVYQAYHRDLLEHMA  550



>gb|AFW78753.1| hypothetical protein ZEAMMB73_662499 [Zea mays]
Length=511

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/457 (58%), Positives = 338/457 (74%), Gaps = 12/457 (3%)
 Frame = +3

Query  705   LLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKP  884
             +LL  VSAAVF  +  V K +      +    +   ++   Y       +     +++  
Sbjct  1     MLLAVVSAAVFSSLFAVVKDDSNSISIVNNYEVPNAIQKSVYP------STTRPLMMSGN  54

Query  885   NNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEE  1064
               +  + +  + P    + +  +T    +PCEGF++PPP  DKKRTGPRPCPVCY+ V++
Sbjct  55    QYSTSVVNKIELPNRLHLTYANFT----HPCEGFSVPPPLVDKKRTGPRPCPVCYVSVDQ  110

Query  1065  AIALMPTAPSFSPVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHC  1238
             A ALMP   S SPV+  LNY+ E+ ++ N        GG+PSL QR++S++I ESM+VHC
Sbjct  111   AFALMPLQASPSPVVKNLNYVSEDGVTANLSNLGSGFGGHPSLEQRNKSFNINESMTVHC  170

Query  1239  GFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFY  1418
             GFV+G KPG+ T FDI D DL EME C  +VVASAIFG +D+I  P+NISE+++ N CFY
Sbjct  171   GFVRGKKPGQGTGFDIKDDDLLEMEQCRELVVASAIFGNYDMIQHPRNISEFSKANACFY  230

Query  1419  MFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYS  1598
             MFVDE TEA+++NS  L +++++GLWR+VVV +LPY D RR GKIPKLLLHRLFPN ++S
Sbjct  231   MFVDEETEAYVKNSSSLYNNNKVGLWRLVVVRNLPYEDPRRTGKIPKLLLHRLFPNVKFS  290

Query  1599  LWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQ  1778
             +WID KL+LV DPY +LERFLWR+N +FAISRHYKRFDVFEEAEANKAAGK+ NASID+Q
Sbjct  291   VWIDAKLQLVADPYLLLERFLWRKNTTFAISRHYKRFDVFEEAEANKAAGKYYNASIDYQ  350

Query  1779  VEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFS  1958
             +EFY+ EGLT +S AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQISFS
Sbjct  351   IEFYRNEGLTHYSPAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQISFS  410

Query  1959  TVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             TVRDKIR+R  W  EMF+DCERRNFVVQ YHR++LE 
Sbjct  411   TVRDKIRARVGWMPEMFMDCERRNFVVQAYHRELLEQ  447



>ref|XP_006855641.1| hypothetical protein AMTR_s00044p00106410 [Amborella trichopoda]
 gb|ERN17108.1| hypothetical protein AMTR_s00044p00106410 [Amborella trichopoda]
Length=653

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/565 (52%), Positives = 365/565 (65%), Gaps = 78/565 (14%)
 Frame = +3

Query  594   LSSSFPIPP------RKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVW  743
             +S   P+P       RKP K      +EKE + H IFK   R+K G+L+L   S  +   
Sbjct  22    ISPGLPVPNNSPNFIRKPSKMLISGSREKERFIHWIFKIVGRRKAGMLILVVFSLVIVTS  81

Query  744   VLYVGKGED-----------------------------------ARGPEI-----PTISI  803
             ++     ED                                    R P+I     P  S 
Sbjct  82    LMSTFYKEDDASEVDLTRQRPSRPLKPFRGHEQITVHTHYSPQIVREPDIKKDNPPVPST  141

Query  804   SATMKDREYSIEPEEKNNIHKTLLAKP--NNNRGIASTDQPPPLPRVY------------  941
               T    +  IEP+ K +    L+  P  NN   + +  + P +P               
Sbjct  142   VHTHNSPQTVIEPDTKKD--NPLVPPPDINNGNSLNTLAEKPSVPLFEIPLQSRENKTLP  199

Query  942   ----FTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL  1109
                 F+   LPPG+PCE FT PPPPADKKRTGPRPCPVCY+PVEEAI L+P  PS SPVL
Sbjct  200   PPPDFSALQLPPGHPCEDFTFPPPPADKKRTGPRPCPVCYVPVEEAIRLVPATPSDSPVL  259

Query  1110  -YLNYIHEETLsenefggsgfgg-------YPSLRQRDESYDIRESMSVHCGFVKGVKPG  1265
              +L+Y+ ++ +   +   +           YPSL+QRDES++I+E+M V+CGFV G +PG
Sbjct  260   KHLSYVVDQNIVLPQKSVNPVDEGGSVFGGYPSLKQRDESFNIKETMEVYCGFVGGNRPG  319

Query  1266  RATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEA  1445
               T FDID++DL EM+ C  +VVASAIF  +D I QPKNISE A+ +VCFYMF+DE T  
Sbjct  320   NYTGFDIDEEDLYEMDQCGPIVVASAIFANYDEIQQPKNISEAAKRHVCFYMFIDEVTRN  379

Query  1446  FLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLEL  1625
             F+ NS  LN + ++GLWRIVVV +LPY DARRNGK+PKLLLHRLF +ARYS+WIDGKLEL
Sbjct  380   FMVNSSILNDTKKVGLWRIVVVRNLPYQDARRNGKVPKLLLHRLFLHARYSIWIDGKLEL  439

Query  1626  VVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGL  1805
             V DPY+++ERFL RRNA+F+IS+HY+RF+VFEEAEANKAAGK+ N+SID Q+EFY+ EGL
Sbjct  440   VRDPYELIERFLLRRNATFSISKHYRRFNVFEEAEANKAAGKYYNSSIDRQIEFYRSEGL  499

Query  1806  TPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSR  1985
             TP+S AK PI SDVPEGCVIIREHIPI+NLFTC WFNEVDRFT RDQ+SFSTVRDK+ + 
Sbjct  500   TPYSEAKLPIISDVPEGCVIIREHIPITNLFTCNWFNEVDRFTSRDQLSFSTVRDKVMTA  559

Query  1986  TNWNVEMFLDCERRNFVVQGYHRDI  2060
             TNW   MF DCERRNFV+Q YHRD+
Sbjct  560   TNWVPYMFQDCERRNFVIQAYHRDV  584



>ref|XP_010916737.1| PREDICTED: uncharacterized protein LOC105041464 [Elaeis guineensis]
Length=534

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/538 (54%), Positives = 368/538 (68%), Gaps = 47/538 (9%)
 Frame = +3

Query  618   PRKPLKTFKEKEG-WFHRIFKFAARKKVGLL-LLCAVSAAVFVWVLYVGKGEDARGPEIP  791
             PR  +   +EKE  +F RI++    ++VGL  LL  ++AA F +V  + +G+        
Sbjct  28    PRASISGSREKEANFFRRIWRTLLGREVGLFFLLFVLAAAFFSFVFRLSEGQ-------V  80

Query  792   TISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGN  971
              + + +T      S EP                  GI  +        +Y+    +P  +
Sbjct  81    RMDMESTAHQHPASNEP------------------GIRHSG-------IYWQTKAIPSPH  115

Query  972   PCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEE-TLse  1145
             PC  F+ PPPP DKKRTGPR CPVCY+PVE+A+  MPT+ S SPVL  LNYI EE ++ +
Sbjct  116   PCGNFSYPPPPHDKKRTGPRSCPVCYVPVEQAMNSMPTSSSVSPVLKDLNYIIEENSVKK  175

Query  1146  nefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
                GGS FGG+P+L+QR+ES+DI+ESM+VHCGFVKG KPG  T FDI+D DL EME C G
Sbjct  176   ESKGGSTFGGHPTLQQRNESFDIKESMTVHCGFVKGKKPGCGTLFDINDADLLEMEQCHG  235

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             +VVASAIFG +D++  PKNISE ++ + CFYMFVDE T A++ NS +L+ + R+GLWR++
Sbjct  236   IVVASAIFGNYDIMQHPKNISEASKMSACFYMFVDERTAAYINNSTELDRTKRVGLWRVI  295

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             VV +LPY D RRNGK+PKLLLHRLFPN RYS+WIDGKLELVVDPY ILERFLWR NA+FA
Sbjct  296   VVRNLPYVDPRRNGKVPKLLLHRLFPNVRYSIWIDGKLELVVDPYLILERFLWRENATFA  355

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVI  1865
             ISRHY+RFDVFEE +ANKAA K+ NASID Q+EFY++EGLT +S  K PITSDVPEGCVI
Sbjct  356   ISRHYRRFDVFEEGKANKAAKKYGNASIDAQLEFYRREGLTHYSPDKLPITSDVPEGCVI  415

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQG  2045
             +REHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKI ++ +  + MF DC+RRNFV Q 
Sbjct  416   LREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIMAKVDLKLNMFDDCQRRNFVNQV  475

Query  2046  YHRDILEHRApppppppRATIRDGVLKTSKYSGATTKLLAR------RIGDPRSRHRQ  2201
             YH+D+++ ++       R  +          S  TT+   R      R   PRS HR 
Sbjct  476   YHKDVMQQKS-----SHRPPVSSNESSGKSQSDRTTRFQQRKPVGNGRYKKPRSGHRH  528



>ref|XP_004244227.1| PREDICTED: uncharacterized protein LOC101254615 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010324362.1| PREDICTED: uncharacterized protein LOC101254615 isoform X1 [Solanum 
lycopersicum]
Length=574

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/497 (59%), Positives = 362/497 (73%), Gaps = 19/497 (4%)
 Frame = +3

Query  630   LKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISA  809
             L T++EKE +   IF+F  RK+VG+L+L A +   F+   ++   EDA        S S+
Sbjct  42    LSTYREKEKFLPSIFRFLVRKQVGMLILAAFALLAFLTAFWMVNKEDA--------SRSS  93

Query  810   TMKDREYSIEPEEKNNIH-KTLLAKPNNNRGIASTDQPPP--LPRVYFTGYTLPPGNPCE  980
              +  +E+     E +  H   LL       G  +   PPP  L  +     T  P +PC 
Sbjct  94    ELDFKEWF----ENSTYHLSALLPGKVVVCGEHNAQLPPPHALSMIQTKDSTAFP-DPCR  148

Query  981   GFTLPPPP-ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEET-Lsene  1151
              F  PPPP  D++R GPRPCPVCY+PV++AIA MP  PS SP L +L Y HE+  +    
Sbjct  149   NFAFPPPPPGDRRRIGPRPCPVCYVPVDQAIARMPRVPSVSPGLQHLTYFHEQIPMKTEP  208

Query  1152  fggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVV  1331
               GS FGGYPSL +R+ S++I+ESM+VHCGFV+G +PG  T FDID  DL EME    V+
Sbjct  209   HRGSAFGGYPSLAERNASFEIKESMTVHCGFVQGCRPGDRTGFDIDAADLKEMEQFHDVI  268

Query  1332  VASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVV  1511
             VASAIFG +D+I QPKN  +  RE V FYMFVDE TEA L+NS  L+S +R+GLWRI++V
Sbjct  269   VASAIFGNYDVIQQPKNWGKTTREKVPFYMFVDEETEASLKNSSLLDSRNRVGLWRIILV  328

Query  1512  HDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAIS  1691
              ++PY+DARRNGK+PKLLLHRLFPN RYS+WIDGKL+L+VDPYQILERFLWR+NA+FAIS
Sbjct  329   RNVPYSDARRNGKVPKLLLHRLFPNVRYSIWIDGKLQLIVDPYQILERFLWRQNATFAIS  388

Query  1692  RHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIR  1871
             RHY+RFDVFEEAEANKAAGK+DN SID Q++FYKKEGLT +S AK PITSDVPEGCVII+
Sbjct  389   RHYRRFDVFEEAEANKAAGKYDNVSIDHQIDFYKKEGLTAYSEAKLPITSDVPEGCVIIK  448

Query  1872  EHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYH  2051
             EHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDK+ ++ +WNV MFLDCERRNFV+Q YH
Sbjct  449   EHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKLMAKVSWNVNMFLDCERRNFVIQAYH  508

Query  2052  RDILEHRApppppppRA  2102
             RD+LE RA       RA
Sbjct  509   RDLLEQRAHMTVVRSRA  525



>dbj|BAD44906.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ11594.1| hypothetical protein OsJ_01458 [Oryza sativa Japonica Group]
 gb|EEC70493.1| hypothetical protein OsI_01565 [Oryza sativa Indica Group]
Length=626

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/449 (60%), Positives = 331/449 (74%), Gaps = 36/449 (8%)
 Frame = +3

Query  951   YTLPPG-----NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-Y  1112
             ++ PP      +PCE F+  PPP D+KRTGPRPCPVCY+PVE+A+ALMP APS SPVL  
Sbjct  159   WSFPPSIVLEHHPCENFSFFPPPIDRKRTGPRPCPVCYVPVEQALALMPGAPSASPVLRS  218

Query  1113  LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDID  1289
             LNY+  + L   E       GGYPSL +RD+SYDI++SM+VHCGF +G  PG  T FDID
Sbjct  219   LNYLSGDNLISKESNHGSLFGGYPSLEERDKSYDIKDSMTVHCGFARGKIPGVNTGFDID  278

Query  1290  DKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDL  1469
               DL EM  C+G+VVASAIFG +D++ QPKNIS ++++ VCF+MF+DE TEA ++N+  +
Sbjct  279   RADLSEMWQCQGIVVASAIFGNYDIMQQPKNISVFSKDTVCFFMFLDEETEAAIKNTTTI  338

Query  1470  NSSSRIGLWRIVVVHDLPYTDARRNGK---------------------IPKLLLHRLFPN  1586
             ++S RIGLWR+VVV +LPY+DARRNGK                     +PKLLLHRLFPN
Sbjct  339   DNSKRIGLWRVVVVRNLPYSDARRNGKCLPDLKAIVMLLVKANDAMLNVPKLLLHRLFPN  398

Query  1587  ARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNAS  1766
              RYS+WIDGKL+LV DPYQ+LERFLWR+N SFAISRHY+RFDVFEEAEANK  GK+DNAS
Sbjct  399   VRYSIWIDGKLKLVRDPYQLLERFLWRKNVSFAISRHYRRFDVFEEAEANKVGGKYDNAS  458

Query  1767  IDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQ  1946
             ID+Q+EFYK+EGLT +S+AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ
Sbjct  459   IDYQIEFYKREGLTHYSSAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQ  518

Query  1947  ISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH--------RApppppppRA  2102
             +SFSTVRDKIR R NW  +MFLDCERR+FVVQ YHR++ E         +       PR 
Sbjct  519   LSFSTVRDKIRKRVNWTADMFLDCERRDFVVQAYHRELWEQILRSPPPPQPRLVRQQPRK  578

Query  2103  TIRDGVLKTSKYSGATTKLLARRIGDPRS  2189
              + D   K    +  + ++ A+R  D +S
Sbjct  579   MLPDNTAKEPGKASGSKRVSAKRTRDKKS  607



>ref|XP_003568036.1| PREDICTED: uncharacterized protein LOC100838689 [Brachypodium 
distachyon]
Length=559

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/395 (67%), Positives = 315/395 (80%), Gaps = 10/395 (3%)
 Frame = +3

Query  897   GIASTDQPPPL--PRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAI  1070
             G+  T+ P  L  P   FT +      PCEGF +PP   DKKRTGPRPCPVCY+ V++A 
Sbjct  118   GVNETEHPNQLLLPFANFTNH------PCEGFAVPPTLFDKKRTGPRPCPVCYVSVDQAF  171

Query  1071  ALMPTAPSFSPVL-YLNYIHEE-TLsenefggsgfggYPSLRQRDESYDIRESMSVHCGF  1244
             ALMP   S SPVL  LNY+ E+ T +     GS FGGY SL QR++S+DI  SM+VHCGF
Sbjct  172   ALMPLQASQSPVLEILNYVAEDSTTANFSNRGSAFGGYLSLEQRNKSFDITNSMTVHCGF  231

Query  1245  VKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMF  1424
             V+G KPG+ T FDI++ DL EME C G+VVASAIFG +D+I  P+N+SE A+EN CFYMF
Sbjct  232   VRGKKPGQGTGFDINNDDLLEMEQCRGLVVASAIFGNYDMIQHPRNVSELAKENACFYMF  291

Query  1425  VDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLW  1604
             VDE T A+++NS  L   ++IG+WR+VVV +LPY D RR GKIPKLLLHRLFPN RYS+W
Sbjct  292   VDEETNAYVKNSSSLYRDNKIGIWRLVVVQNLPYKDPRRTGKIPKLLLHRLFPNVRYSIW  351

Query  1605  IDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVE  1784
             ID KL+LVVDPY +LERFLWR+NA+FAISRHY+RFDVFEEAEANKAAGK+DN+SID Q++
Sbjct  352   IDAKLQLVVDPYLLLERFLWRKNATFAISRHYRRFDVFEEAEANKAAGKYDNSSIDEQID  411

Query  1785  FYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTV  1964
             FY+ EGLT +S AK PITSDVPEGCVIIREH+PISNLFTCLWFNEVDRFT RDQISFSTV
Sbjct  412   FYRNEGLTHYSTAKLPITSDVPEGCVIIREHVPISNLFTCLWFNEVDRFTARDQISFSTV  471

Query  1965  RDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             RDKIR++  W  +MFLDCERRNFVVQ YHR++LE 
Sbjct  472   RDKIRAKVGWMPQMFLDCERRNFVVQAYHRELLEQ  506



>ref|XP_006655514.1| PREDICTED: uncharacterized protein LOC102708343, partial [Oryza 
brachyantha]
Length=523

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/369 (69%), Positives = 310/369 (84%), Gaps = 2/369 (1%)
 Frame = +3

Query  969   NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLse  1145
             +PCEGF++ PP  D KRTGPRPC VCY+ V++A ALMP  PS SPVL  L+Y+ E++++ 
Sbjct  93    HPCEGFSVAPPLVDPKRTGPRPCAVCYVSVDQAFALMPLQPSPSPVLKNLSYVSEDSITA  152

Query  1146  nefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
             N        GG+PSL QR++ +DI ESM+VHCGFV+G KPG+ + FDI+D DL EME C 
Sbjct  153   NLSNQGSVFGGHPSLEQRNKYFDINESMTVHCGFVRGKKPGQGSGFDINDDDLLEMEQCR  212

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
              +VVASAIFG +D+I QP+N SE+++ N CFYMFVDE TEA+++NS  +  ++++GLWR+
Sbjct  213   ELVVASAIFGNYDMIQQPRNASEFSKANACFYMFVDEETEAYIKNSSAVYRNNKVGLWRL  272

Query  1503  VVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASF  1682
             VVV +LPY D+RR GKIPKLLLHRLFPN R+S+WID KL+LVVDPY +LERFLWR+NA+F
Sbjct  273   VVVRNLPYEDSRRTGKIPKLLLHRLFPNVRFSVWIDAKLKLVVDPYLLLERFLWRKNATF  332

Query  1683  AISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCV  1862
             AISRHYKRFDVFEEAEANKAAGK+DNASID+Q+EFY+ EGLT ++ AK PITSDVPEGCV
Sbjct  333   AISRHYKRFDVFEEAEANKAAGKYDNASIDYQIEFYRNEGLTHYTTAKLPITSDVPEGCV  392

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             IIREHIPI+NLFTCLWFNEVDRFT RDQISFSTVRDKIR+R +W  +MFLDCERRNFVVQ
Sbjct  393   IIREHIPITNLFTCLWFNEVDRFTSRDQISFSTVRDKIRARVDWMPQMFLDCERRNFVVQ  452

Query  2043  GYHRDILEH  2069
              YHR++LE 
Sbjct  453   AYHRELLEQ  461



>ref|XP_010231153.1| PREDICTED: uncharacterized protein LOC100826851 isoform X2 [Brachypodium 
distachyon]
Length=582

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/571 (53%), Positives = 380/571 (67%), Gaps = 52/571 (9%)
 Frame = +3

Query  597   SSSFPIPPRKPLKTFKEKEG------WFHRIFKFAARKKVGLLLLCAVSAAVFVWVL--Y  752
             S+S P+ PRKP KT     G       F RI  FA R++  LLLL    A VF ++    
Sbjct  27    SASPPLAPRKPAKTSLGGVGRGGERLLFARICLFAGRRQRMLLLLLVAVAVVFCFLFSSL  86

Query  753   VGKGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTL--LAKPNNNRGIASTDQPPP  926
             + K E A  P   T+ +  +   R + + P   +++ ++L    +     GI+   +   
Sbjct  87    ISKDEVA-APGTDTV-LGFSDHFRSF-VNPVWSSSLSESLNMTLQTGKESGISHVKERGL  143

Query  927   LPRVYFTGYTLPPG-----NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAP  1091
             L        T PP      +PCE F+  PPP D+KRTGPRPCPVCY+PVE+A+ALMP AP
Sbjct  144   L-------RTFPPAIALEHHPCENFSFSPPPIDRKRTGPRPCPVCYVPVEQALALMPGAP  196

Query  1092  SFSPVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPG  1265
             S SPVL  LNY+ E+ L   E       GGYPSL QRD SYD+++SM+VHCGFV+G  PG
Sbjct  197   SASPVLQSLNYLSEDNLIFKESNSGSLFGGYPSLEQRDRSYDLKDSMAVHCGFVRGKIPG  256

Query  1266  RATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEA  1445
               T FD+D+ DL EM+ C G VVASAIFG +D++ QP+NISE++++ VCF+MF+DE TEA
Sbjct  257   LNTGFDVDEADLSEMQQCHGTVVASAIFGNYDIMQQPENISEFSKDTVCFFMFLDEETEA  316

Query  1446  FLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLEL  1625
              ++N+  ++++ RIGLWR+VVV +LPY+DARRNGK+PKLLLHRLFPN RYSLWIDGKL+L
Sbjct  317   AIKNTTMVDNTKRIGLWRVVVVRNLPYSDARRNGKVPKLLLHRLFPNVRYSLWIDGKLKL  376

Query  1626  VVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGL  1805
             V DPYQ+LE             RHY+RFDVFEEAEANKA GK+DNASID Q+EFYK+EGL
Sbjct  377   VKDPYQLLE-------------RHYRRFDVFEEAEANKAGGKYDNASIDNQIEFYKREGL  423

Query  1806  TPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSR  1985
             T +S+AK PITSDVPEGCVIIREHI I+NLFTCLWFNEVDRFT RDQ+SFSTVRDKIRSR
Sbjct  424   THYSSAKLPITSDVPEGCVIIREHILITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIRSR  483

Query  1986  TNWNVEMFLDCERRNFVVQGYHRDILEHRAppppp------------ppRATIRDGVLKT  2129
              NW  +MFLDCERR+FVVQ YHR++LE R                   PR  + D   K 
Sbjct  484   VNWTADMFLDCERRDFVVQAYHRELLEQRLAVLRSQPPPPPPVVLVQQPRKMLPDNAAKE  543

Query  2130  SKYSGATTKLLARRIGDPRSRHRQE*RCWLN  2222
                + AT KL  +R  D +S  ++  R  LN
Sbjct  544   LGRASATKKLTGKRTRDRKSSSKRSHRTKLN  574



>ref|XP_009141343.1| PREDICTED: uncharacterized protein LOC103865296 isoform X2 [Brassica 
rapa]
Length=522

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/479 (59%), Positives = 340/479 (71%), Gaps = 48/479 (10%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISI  803
             KP K +KEKE     IFKF  R+K  L +   ++  VF+ VLYV  GED +  E+P    
Sbjct  19    KPSKMYKEKEDVVRWIFKFVGRRKKILFI---ITTLVFIRVLYVWHGEDGQKVEVP----  71

Query  804   SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEG  983
                      +   E  +NIH  L    ++    A   +P P P  YF GYTLPP +PC  
Sbjct  72    ------HSKTTNKEPLSNIHNNL----SHVVKAAKVYRPRPPP--YFRGYTLPPNHPCNR  119

Query  984   FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefgg  1160
             FTLPPPPADKKRTGPRPCPVCYLP+EEAIALMP++PSFSP+L  L YIHE+ L+     G
Sbjct  120   FTLPPPPADKKRTGPRPCPVCYLPLEEAIALMPSSPSFSPILKNLTYIHEKPLNRKTEFG  179

Query  1161  sgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVA  1337
                 GGYP+L+QR  S++I+ SMSVHCGFVKG +PGR T FDI++KDL EM+ C G+VVA
Sbjct  180   GSDFGGYPTLKQRRRSFNIKGSMSVHCGFVKGRQPGRGTGFDINEKDLLEMKRCRGIVVA  239

Query  1338  SAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLN-SSSRIGLWRIVVVH  1514
             S +F AFD +  P NIS+Y+ + VCF+MF+DE TE+ L+     N ++ ++GLWR+VVVH
Sbjct  240   STVFDAFDDVKSPSNISKYSEQTVCFFMFIDEKTESSLKRDKKFNRTTKKVGLWRVVVVH  299

Query  1515  DLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISR  1694
             +LPYTD RRNGK+PKLL+HRLFPN+RYSLW+DGKL+LVVDP+QILERFLWR N +FAISR
Sbjct  300   NLPYTDGRRNGKVPKLLVHRLFPNSRYSLWMDGKLDLVVDPHQILERFLWRENVTFAISR  359

Query  1695  HYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIRE  1874
             HYKRFDVF EAEANKAAGK+ NASIDFQV+FYKKEGLTP+S AK PITS           
Sbjct  360   HYKRFDVFVEAEANKAAGKYANASIDFQVDFYKKEGLTPYSTAKLPITS-----------  408

Query  1875  HIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYH  2051
                            VDRFT RDQISFSTVRDKI +RT WNV MFLDC+RRNFVVQ YH
Sbjct  409   ---------------VDRFTSRDQISFSTVRDKIAARTKWNVSMFLDCQRRNFVVQRYH  452



>ref|XP_008656451.1| PREDICTED: uncharacterized protein LOC103635853 [Zea mays]
Length=435

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/413 (64%), Positives = 324/413 (78%), Gaps = 14/413 (3%)
 Frame = +3

Query  1002  PADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLs-enefggsgfgg  1175
             P D+KRTGPRPCPVCYLPVE+A+AL P  PS SPVL  LNY+ EE L  +    GS FGG
Sbjct  22    PVDRKRTGPRPCPVCYLPVEQALALRPAKPSLSPVLQSLNYVLEEILIPKESKSGSLFGG  81

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             +PSL +RD+SYDI++SM+VHCGFV+G  PG  T FDID+ D  EM+ C+  VVASAIFG 
Sbjct  82    FPSLEERDKSYDIKDSMTVHCGFVRGKVPGLNTGFDIDEADHSEMQLCQSTVVASAIFGN  141

Query  1356  FDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDA  1535
             +D++ QP+NIS+++++ VCF+MF++E TEA ++N+  +  + +IGLWR+VVV +LP+TDA
Sbjct  142   YDVMQQPENISKFSKDTVCFFMFLEEETEAAIKNTT-IGHTKKIGLWRVVVVRNLPFTDA  200

Query  1536  RRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDV  1715
             RRNGK+PKLLLHRLFPNARYS+WIDGKL+LV DPYQ+LERFLWR+N SFAISRHY+RFDV
Sbjct  201   RRNGKVPKLLLHRLFPNARYSIWIDGKLKLVRDPYQVLERFLWRKNVSFAISRHYRRFDV  260

Query  1716  FEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNL  1895
             FEEAEANKA GK+DN SID+Q+EFYK+EGLT +S+AK PITSDVPEGCVIIREHIPI+NL
Sbjct  261   FEEAEANKAGGKYDNTSIDYQIEFYKREGLTHYSSAKLPITSDVPEGCVIIREHIPITNL  320

Query  1896  FTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             FTCLWFNEVDRFT RDQ+SFSTVRDKIR R NW  +MFLDCERR+FVVQ YHR++LE R 
Sbjct  321   FTCLWFNEVDRFTSRDQLSFSTVRDKIRWRVNWTADMFLDCERRDFVVQSYHRELLEQRQ  380

Query  2076  ppppp-----------ppRATIRDGVLKTSKYSGATTKLLARRIGDPRSRHRQ  2201
                              PR  + D   +    + AT KL  +R  D +S  R+
Sbjct  381   SALRRWPPQRSPIARFQPRKMLPDNAAREPWKASATKKLSRKRARDKKSSSRR  433



>emb|CBI20302.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/393 (70%), Positives = 328/393 (83%), Gaps = 8/393 (2%)
 Frame = +3

Query  921   PPLP-----RVYFTGYTLPPGNPCEGFTLPPPPA-DKKRTGPRPCPVCYLPVEEAIALMP  1082
             PPLP          GYT P  +PCE F  PPPP  D+KR GPRPCPVCYLPVE+AIA +P
Sbjct  83    PPLPPSTSAVAAVVGYTPPLHHPCENFAFPPPPPPDRKRIGPRPCPVCYLPVEQAIASIP  142

Query  1083  TAPSFSPVL-YLNYIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGV  1256
             ++ S SP+L  LNY+HEE  +     GGS FGGYPSL+QR++S+DI+ESM+VHCGFV G 
Sbjct  143   SSSSPSPLLKQLNYVHEENPIKTEPHGGSEFGGYPSLKQRNDSFDIKESMTVHCGFVTGS  202

Query  1257  KPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEG  1436
             KPG  T FDID+ DL E+E    V+VASAIFG +D+I QP+N+SE AR+NV FYMF+DE 
Sbjct  203   KPGHHTGFDIDEADLKELEQPHEVIVASAIFGNYDIIQQPRNVSEAARKNVPFYMFIDEE  262

Query  1437  TEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGK  1616
             TEA++RNS  L+SS R+GLWRI++VH++PYTDARRNGKIPKLLLHR+FPN R+S+WIDGK
Sbjct  263   TEAYMRNSSVLDSSKRVGLWRIILVHNIPYTDARRNGKIPKLLLHRIFPNVRFSIWIDGK  322

Query  1617  LELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKK  1796
             L+L+VDPYQ+LERFLWR+NAS AISRHY+RFDVFEEAEANKAAGK+DN SID+Q+EFYK 
Sbjct  323   LQLLVDPYQVLERFLWRQNASLAISRHYRRFDVFEEAEANKAAGKYDNVSIDYQIEFYKN  382

Query  1797  EGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKI  1976
             EGLTP+S AK PITSDVPEGCVI++EHIPI+NLFTCLWFNEVDRFT RDQ+SF+ VRDKI
Sbjct  383   EGLTPYSEAKLPITSDVPEGCVIVKEHIPITNLFTCLWFNEVDRFTSRDQLSFAIVRDKI  442

Query  1977  RSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
              S+ +WN+ MFLDCERRNFV Q YHRD+LEH A
Sbjct  443   TSQVDWNISMFLDCERRNFVYQAYHRDLLEHMA  475



>ref|XP_007149460.1| hypothetical protein PHAVU_005G072000g [Phaseolus vulgaris]
 gb|ESW21454.1| hypothetical protein PHAVU_005G072000g [Phaseolus vulgaris]
Length=580

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/516 (57%), Positives = 375/516 (73%), Gaps = 38/516 (7%)
 Frame = +3

Query  603   SFPIPPRKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLY-VGKG-  764
             S P+  R+P KT     +EKE  F  I +   R +V +LL+ A+   VFV+  + V KG 
Sbjct  22    SVPMLVRRPSKTLLYNPREKERGFFFICRLLGRGRVAMLLMFALGLCVFVFGCFTVYKGG  81

Query  765   ------EDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPP  926
                   ED R   I    I   ++ R   +E + +++    LL+  +  R   ST +PPP
Sbjct  82    SITSEIEDTRSYAITRYEI---LRPRGV-VEDKSQDSNSSRLLSLTSRYR---STSRPPP  134

Query  927   LP-----------RVYFTGYTLPPGNPCEGFTLPPPP-ADKKRTGPRPCPVCYLPVEEAI  1070
              P           RVYF  +     + C+ F  PPPP  D++RTGPRPCPVCY+PV++A+
Sbjct  135   APNSLSLSKSKGKRVYFPTWR----HRCDRFAFPPPPPVDRRRTGPRPCPVCYIPVKQAV  190

Query  1071  ALMPTAPSFSPVL-YLNYIHEE-TLsenefggsgfggYPSLRQRDESYDIRESMSVHCGF  1244
             A MP +PS SP+L  L Y+H+E ++     GGS FGGYPSL +RD ++DI+E+M+VHCGF
Sbjct  191   ASMPISPSKSPILRSLTYVHDENSIKSERHGGSDFGGYPSLEERDAAFDIKETMTVHCGF  250

Query  1245  VKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMF  1424
             VKG +PGR T FD D+ DL E++    V+VASAIFG +D+I QP+NIS  A+ N+ FYMF
Sbjct  251   VKGSRPGRLTGFDFDEADLLELDKYHDVIVASAIFGNYDVIQQPRNISSEAKRNIPFYMF  310

Query  1425  VDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLW  1604
             +DE TE +++N+  L+SS R+GLWRI+VVH++PY D+RRNGK+PKLLLHR+FPNARYS+W
Sbjct  311   IDEETEMYMKNASILSSSRRVGLWRIIVVHNIPYADSRRNGKVPKLLLHRIFPNARYSIW  370

Query  1605  IDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVE  1784
             IDGKL+LVVDPYQ+LERFLWR NA+FAISRHY+RFDVF EAEANK AGK++N SID Q++
Sbjct  371   IDGKLQLVVDPYQVLERFLWRPNATFAISRHYRRFDVFVEAEANKVAGKYENGSIDNQIQ  430

Query  1785  FYK-KEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFST  1961
             FYK  +GLT +S  K PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFST
Sbjct  431   FYKVYDGLTHYSRDKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFST  490

Query  1962  VRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             VRDKI ++T W++ MF+DCERRNFV+QGYHRDILE 
Sbjct  491   VRDKIMAKTGWSINMFMDCERRNFVIQGYHRDILEQ  526



>ref|XP_006348249.1| PREDICTED: uncharacterized protein LOC102589017 isoform X1 [Solanum 
tuberosum]
 ref|XP_006348250.1| PREDICTED: uncharacterized protein LOC102589017 isoform X2 [Solanum 
tuberosum]
Length=574

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/507 (59%), Positives = 366/507 (72%), Gaps = 31/507 (6%)
 Frame = +3

Query  597   SSSFPIPPRKPLKT----FKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKG  764
             S S    PRK  KT    ++EKE +   I +F  RK+VG+L+L A +   F+   ++   
Sbjct  27    SHSNSFVPRKGSKTSLSSYREKEKFLPSILRFLVRKQVGMLILAAFALLAFLTAFWMVNK  86

Query  765   EDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQ-----PPP-  926
             EDA        S S+ +  +E+     E +  H + L      R +   D+     PPP 
Sbjct  87    EDA--------SRSSELDFKEWF----ENSTYHLSALLP----RKVMVCDEHNAQLPPPH  130

Query  927   -LPRVYFTGYTLPPGNPCEGFTLPPPP-ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFS  1100
              L  +     +  P +PC  F  PPPP  D++R GPRPCPVCY+PVE+AIA MP  PS S
Sbjct  131   ALAMIQTKDSSAFP-DPCRNFAFPPPPPGDRRRIGPRPCPVCYVPVEQAIARMPRVPSVS  189

Query  1101  PVL-YLNYIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRAT  1274
             P L +L Y HE+  +      GS FGGYPSL +R+ S+DI+ESM+VHCGFV+G +PG  T
Sbjct  190   PGLQHLTYFHEQIPMKTEPHRGSAFGGYPSLVERNASFDIKESMTVHCGFVQGCRPGDRT  249

Query  1275  SFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLR  1454
              FDID  DL EME    V+VASAIFG +D+I QPKN  +  RE V FYMFVDE TEA L+
Sbjct  250   GFDIDAADLKEMEQFHDVIVASAIFGNYDVIQQPKNWGKTTREKVPFYMFVDEETEASLK  309

Query  1455  NSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVD  1634
             NS  L+S +R+GLWRI++V ++PY+DARRNGK+PKLLLHRLFPN RYS+WIDGKL+L+VD
Sbjct  310   NSSLLDSRNRVGLWRIILVRNVPYSDARRNGKVPKLLLHRLFPNVRYSIWIDGKLQLIVD  369

Query  1635  PYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF  1814
             PYQILERFLWR+NA+FAISRHY+RFDVFEEAEANKAAGK+DN SID Q++FYKKEGLT +
Sbjct  370   PYQILERFLWRQNATFAISRHYRRFDVFEEAEANKAAGKYDNVSIDHQIDFYKKEGLTAY  429

Query  1815  SAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNW  1994
             S AK PITSDVPEGCVII+EHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDK+ ++ +W
Sbjct  430   SEAKLPITSDVPEGCVIIKEHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKLMAKVSW  489

Query  1995  NVEMFLDCERRNFVVQGYHRDILEHRA  2075
             NV MFLDCERRNFV+Q YHRD+LE RA
Sbjct  490   NVNMFLDCERRNFVIQAYHRDLLEQRA  516



>ref|XP_011098310.1| PREDICTED: uncharacterized protein LOC105176998 [Sesamum indicum]
 ref|XP_011098311.1| PREDICTED: uncharacterized protein LOC105176998 [Sesamum indicum]
 ref|XP_011098312.1| PREDICTED: uncharacterized protein LOC105176998 [Sesamum indicum]
Length=577

 Score =   544 bits (1401),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 283/494 (57%), Positives = 359/494 (73%), Gaps = 13/494 (3%)
 Frame = +3

Query  621   RKPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLY-VGKGEDARGPEIPTI  797
             +  L   +EKE +F    ++  R+KVG+L+L + +   F+   + V K +D  G  +P  
Sbjct  39    KTSLNGSREKERFFSSTLRYLCRRKVGMLILASFAVLGFMTGFFTVNKEDDFEGYGLPFD  98

Query  798   SISATMKDREYSIEPEEK-----NNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLP  962
             +   T       + P ++     + I+K L+   +   G A+      +     +   L 
Sbjct  99    TRYITKSYVTPWLLPGKEVIHSNSKINKVLVC--DYRTGWATLFNASAVGNSSTSATVLT  156

Query  963   PGNPCEGFTLPPPP-ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET  1136
               NPC+GF  PPPP  DK+R GPRPCPVCY+PVE+AIA MP  PS SP+++ LNY  EE 
Sbjct  157   --NPCKGFAFPPPPPGDKRRIGPRPCPVCYIPVEQAIARMPGFPSPSPIVHHLNYFSEEN  214

Query  1137  -LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEME  1313
                    GGS FGGYPSL+QR++S++I+ESM+VHCGFVKG + G  T F+I   DL  +E
Sbjct  215   PSKTEANGGSDFGGYPSLKQRNDSFNIKESMTVHCGFVKGCRAGYQTGFEIHMADLEVLE  274

Query  1314  ACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGL  1493
                 V+VASAIFG +D+I QPKNI E AR  V F+MF+DE TE +++NS  L S  ++GL
Sbjct  275   QFHEVIVASAIFGNYDVIQQPKNIGETARSKVPFFMFIDEETERYMKNSSLLGSDKQVGL  334

Query  1494  WRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRN  1673
             WRI+VV ++PYTD RRNGK+PKLLLHRLFPN R+S+WIDGKL+LVVDPYQILERFLWR N
Sbjct  335   WRIIVVRNVPYTDPRRNGKVPKLLLHRLFPNTRFSIWIDGKLQLVVDPYQILERFLWRHN  394

Query  1674  ASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPE  1853
             A+FAISRHY+RFDVFEEAEANKA  K+DNASID+Q+EFYKKEGLTP++ AK PITSDVPE
Sbjct  395   ATFAISRHYRRFDVFEEAEANKAGAKYDNASIDYQIEFYKKEGLTPYTTAKLPITSDVPE  454

Query  1854  GCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNF  2033
             GCVIIREHIPI+NLF+CLWFNEVDRFT RDQ+SFSTVRDK+ ++ NW++ MFLDCERRNF
Sbjct  455   GCVIIREHIPITNLFSCLWFNEVDRFTSRDQLSFSTVRDKVVAQVNWSINMFLDCERRNF  514

Query  2034  VVQGYHRDILEHRA  2075
             V+Q YHRD+LE RA
Sbjct  515   VIQAYHRDLLEQRA  528



>gb|EYU26382.1| hypothetical protein MIMGU_mgv1a004380mg [Erythranthe guttata]
Length=530

 Score =   541 bits (1393),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 255/372 (69%), Positives = 310/372 (83%), Gaps = 3/372 (1%)
 Frame = +3

Query  969   NPCEGFTLPPPP-ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-L  1139
             NPC+ F  PPPP  D +R GPRPCPVCY+PVEEA+A MP  PS SP+L  L Y  EE  +
Sbjct  105   NPCKDFAFPPPPPGDMRRIGPRPCPVCYVPVEEAVASMPKFPSHSPILKRLTYFSEENPM  164

Query  1140  senefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEAC  1319
               +  GGS FGGYP+L+ R++S+DI+ESM+VHCGFVKG +PG  T FDID  DL  ++  
Sbjct  165   KTDPIGGSDFGGYPNLKLRNDSFDIQESMTVHCGFVKGCRPGYRTGFDIDVADLEVLKQF  224

Query  1320  EGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWR  1499
               V+VASAIFG +DLI QP+N+ E +R  V F+MFVDE TE +++N   L S  ++GLWR
Sbjct  225   HEVIVASAIFGNYDLIQQPENVGETSRRKVPFFMFVDEETENYMKNMSLLGSDKQVGLWR  284

Query  1500  IVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNAS  1679
             I+VVH++PYTD+RRNGK+PKLLLHRLFPN RYS+WIDGKL+LVVDPYQILERFLWR+NA+
Sbjct  285   IIVVHNVPYTDSRRNGKVPKLLLHRLFPNTRYSIWIDGKLQLVVDPYQILERFLWRQNAT  344

Query  1680  FAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGC  1859
              AISRHY+RFDVFEEAEANKA GK+DN SID+Q+EFYK+EGLTP+++AK PITSDVPEGC
Sbjct  345   LAISRHYRRFDVFEEAEANKAGGKYDNISIDYQIEFYKEEGLTPYTSAKLPITSDVPEGC  404

Query  1860  VIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVV  2039
             VIIREHIPI+NLF+CLWFNEVDRFT RDQ+SFSTVRDK+ ++ +W+V MFLDCERRNFV+
Sbjct  405   VIIREHIPITNLFSCLWFNEVDRFTSRDQLSFSTVRDKVLAQVDWSVNMFLDCERRNFVI  464

Query  2040  QGYHRDILEHRA  2075
             Q YHRD+LE RA
Sbjct  465   QAYHRDLLEQRA  476



>ref|XP_010324363.1| PREDICTED: uncharacterized protein LOC101254615 isoform X2 [Solanum 
lycopersicum]
Length=441

 Score =   535 bits (1379),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 261/381 (69%), Positives = 311/381 (82%), Gaps = 3/381 (1%)
 Frame = +3

Query  969   NPCEGFTLPPPP-ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEET-L  1139
             +PC  F  PPPP  D++R GPRPCPVCY+PV++AIA MP  PS SP L +L Y HE+  +
Sbjct  12    DPCRNFAFPPPPPGDRRRIGPRPCPVCYVPVDQAIARMPRVPSVSPGLQHLTYFHEQIPM  71

Query  1140  senefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEAC  1319
                   GS FGGYPSL +R+ S++I+ESM+VHCGFV+G +PG  T FDID  DL EME  
Sbjct  72    KTEPHRGSAFGGYPSLAERNASFEIKESMTVHCGFVQGCRPGDRTGFDIDAADLKEMEQF  131

Query  1320  EGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWR  1499
               V+VASAIFG +D+I QPKN  +  RE V FYMFVDE TEA L+NS  L+S +R+GLWR
Sbjct  132   HDVIVASAIFGNYDVIQQPKNWGKTTREKVPFYMFVDEETEASLKNSSLLDSRNRVGLWR  191

Query  1500  IVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNAS  1679
             I++V ++PY+DARRNGK+PKLLLHRLFPN RYS+WIDGKL+L+VDPYQILERFLWR+NA+
Sbjct  192   IILVRNVPYSDARRNGKVPKLLLHRLFPNVRYSIWIDGKLQLIVDPYQILERFLWRQNAT  251

Query  1680  FAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGC  1859
             FAISRHY+RFDVFEEAEANKAAGK+DN SID Q++FYKKEGLT +S AK PITSDVPEGC
Sbjct  252   FAISRHYRRFDVFEEAEANKAAGKYDNVSIDHQIDFYKKEGLTAYSEAKLPITSDVPEGC  311

Query  1860  VIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVV  2039
             VII+EHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDK+ ++ +WNV MFLDCERRNFV+
Sbjct  312   VIIKEHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKLMAKVSWNVNMFLDCERRNFVI  371

Query  2040  QGYHRDILEHRApppppppRA  2102
             Q YHRD+LE RA       RA
Sbjct  372   QAYHRDLLEQRAHMTVVRSRA  392



>ref|XP_006370258.1| hypothetical protein POPTR_0001s41050g [Populus trichocarpa]
 gb|ERP66827.1| hypothetical protein POPTR_0001s41050g [Populus trichocarpa]
Length=454

 Score =   536 bits (1380),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 260/370 (70%), Positives = 315/370 (85%), Gaps = 3/370 (1%)
 Frame = +3

Query  969   NPCEGFTLPPPP-ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEET-L  1139
             +PC  F LPPPP +  +R GPRPCPVCY+  E+A A +P + S SPVL  L Y+ +E  +
Sbjct  29    HPCHKFALPPPPPSGGRRFGPRPCPVCYISAEQARASIPCSSSASPVLRNLTYVVDENPI  88

Query  1140  senefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEAC  1319
                  GGS FGGYPSL+QR+ES+DI+ESM+VHCGFVKG +PGR T FDID+ DL ++E  
Sbjct  89    KIESHGGSEFGGYPSLKQRNESFDIQESMTVHCGFVKGNRPGRQTGFDIDEADLMKLEEF  148

Query  1320  EGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWR  1499
               V+VASAIFG +D+I QPKN+SE AR+NV FYMF+DE TE +L+NS  L+S+ RIGLWR
Sbjct  149   HEVIVASAIFGNYDIIQQPKNVSEAARKNVPFYMFIDEETETYLKNSSALDSNMRIGLWR  208

Query  1500  IVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNAS  1679
             I+VVH++PYTDARRNGK+PKLLLHRL PN RYS+WIDGKL+LVVDPYQ+LERFLW++NAS
Sbjct  209   IIVVHNIPYTDARRNGKVPKLLLHRLLPNVRYSIWIDGKLQLVVDPYQVLERFLWQQNAS  268

Query  1680  FAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGC  1859
             FAISRHY RFDVF+EAEANKAAGK DN+SID+Q+EFYKKEGL+P+S AK PITSDVPEGC
Sbjct  269   FAISRHYHRFDVFKEAEANKAAGKCDNSSIDYQIEFYKKEGLSPYSKAKLPITSDVPEGC  328

Query  1860  VIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVV  2039
             VIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKI ++ +W++ MFLDCERRNFV+
Sbjct  329   VIIREHIPITNLFTCLWFNEVDRFTARDQLSFSTVRDKIMAKVDWSINMFLDCERRNFVI  388

Query  2040  QGYHRDILEH  2069
             Q YH+D+L+H
Sbjct  389   QAYHKDLLDH  398



>ref|XP_008795198.1| PREDICTED: uncharacterized protein LOC103711007 [Phoenix dactylifera]
Length=533

 Score =   538 bits (1386),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 280/490 (57%), Positives = 348/490 (71%), Gaps = 36/490 (7%)
 Frame = +3

Query  618   PRKPLKTFKEKEG-WFHRIFKFAARKKVGLLLLCAVSAAVFVWVLY-VGKGEDARGPEIP  791
             PR  +   +EKE  +F RI +    KK G   L  VSAA F    + + KG+        
Sbjct  32    PRSSILGSREKEASFFRRIRRTLLGKKFGFFALLFVSAAAFFLPAFRLSKGQ-------V  84

Query  792   TISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGN  971
             T+ + +T      S    E    H     +P   +GI                   P  +
Sbjct  85    TMDMESTFHQHPAS---NESATWHSGRYWQP---KGI-------------------PTPH  119

Query  972   PCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-Lse  1145
             PC  F+ PPPP DKKRTGPRPCPVCY+P E+A+  MPT+ S SPVL  LNY+ EET +  
Sbjct  120   PCGNFSYPPPPHDKKRTGPRPCPVCYVPAEQAMDSMPTSLSVSPVLRDLNYVIEETSVKT  179

Query  1146  nefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
                GGS FGG+P+L+QR+ES+DI+ESM+VHCGFVKG+KPGR T FDI+D DL EME C G
Sbjct  180   ELEGGSTFGGHPTLQQRNESFDIKESMTVHCGFVKGMKPGRGTLFDINDADLLEMEQCHG  239

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             +VVASAIFG +D++  PKNI+E  + + CFYMFVDE T A++ NS +L+ + R+GLWR+V
Sbjct  240   IVVASAIFGNYDIMQHPKNINEATKRSACFYMFVDEETAAYINNSTELDRTKRVGLWRVV  299

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             VV +LPY D RRNGK+PKLLLHRLFPN +YS+WIDGKLELVVDP+ ILER LWR NA+FA
Sbjct  300   VVRNLPYDDPRRNGKVPKLLLHRLFPNIQYSIWIDGKLELVVDPHLILERLLWRENATFA  359

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVI  1865
             ISRHYKRFDVFEE +ANKAA K+D+ASID Q+EFYK+EGLT +S  K PITSDVPEGCVI
Sbjct  360   ISRHYKRFDVFEEGKANKAAKKYDSASIDAQLEFYKREGLTHYSPDKLPITSDVPEGCVI  419

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQG  2045
             +REHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKI ++ +  + MF DC+RRNFV Q 
Sbjct  420   VREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIMAKVDLKLNMFDDCQRRNFVNQV  479

Query  2046  YHRDILEHRA  2075
             YH+D++  ++
Sbjct  480   YHKDVMRQKS  489



>gb|KHF99606.1| Putative tRNA (Met) cytidine acetyltransferase [Gossypium arboreum]
Length=570

 Score =   536 bits (1381),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 283/492 (58%), Positives = 359/492 (73%), Gaps = 26/492 (5%)
 Frame = +3

Query  618   PRKPLKTFKEKEGWFHRI-FKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPT  794
             P   L   +EKE  F  I +++  R+K+ +LL+ A++  VFV   +V   E         
Sbjct  42    PIMMLSGSREKERSFPSIWYRYLGRRKISMLLMVALAVLVFVLGSFVVNKE---------  92

Query  795   ISISATMKDREYSIEPEEKNNIHKT----LLAKPNNNRGIASTDQPPPLPRVYFTGYTLP  962
              S S  +  R  ++      N  +T    +L + N  +G         +P+         
Sbjct  93    -SNSPNVDQRIGTMSMAHYINATRTDASRILGRRNRQKGGDGNRFQASVPK--------G  143

Query  963   PGNPCEGFTLPPPPADK-KRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET  1136
               +PC  FT PPPP    +R GPRPCPVCYLPV++AIA MP++PS SPVL+ L Y+H+E 
Sbjct  144   ANHPCANFTFPPPPPPHLRRIGPRPCPVCYLPVDQAIASMPSSPSESPVLHNLTYVHDEN  203

Query  1137  -LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEME  1313
              +     GGS FGGYPSL+QR++S+DI+ESM VHCGFVKG KPG  T FD D  DL E++
Sbjct  204   PIKTEPHGGSDFGGYPSLKQRNDSFDIKESMVVHCGFVKGSKPGHQTGFDFDKSDLAELQ  263

Query  1314  ACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGL  1493
                 ++VASAIFG +DLI QP+NISE A+ NV FYMF+DE TEA+++N   L+SS R+GL
Sbjct  264   QFHEIIVASAIFGNYDLIQQPRNISEEAKRNVPFYMFIDEETEAYMKNRSMLDSSKRVGL  323

Query  1494  WRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRN  1673
             WRI+V+H++PY+DARRNGK+PKLLLHR+FPN RYS+WIDGKL+LVVDPYQILERFLWR+N
Sbjct  324   WRIIVIHNVPYSDARRNGKVPKLLLHRIFPNIRYSIWIDGKLQLVVDPYQILERFLWRQN  383

Query  1674  ASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPE  1853
             A+FAISRHY+RFDVF EAEANKAAGK+DN+SID QV+FY+ EGLTP+S AK PI SDVPE
Sbjct  384   ANFAISRHYRRFDVFVEAEANKAAGKYDNSSIDAQVDFYRTEGLTPYSEAKLPIISDVPE  443

Query  1854  GCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNF  2033
             GCV+I+EHIPI+NLFTCLWFNEVDRFT RDQ+SF  VRDKI ++ +W++ MFLDCERRNF
Sbjct  444   GCVLIKEHIPITNLFTCLWFNEVDRFTSRDQLSFGIVRDKIMAKVDWHINMFLDCERRNF  503

Query  2034  VVQGYHRDILEH  2069
             V+Q YHRD+LEH
Sbjct  504   VIQAYHRDLLEH  515



>ref|XP_010694986.1| PREDICTED: uncharacterized protein LOC104907715 [Beta vulgaris 
subsp. vulgaris]
Length=577

 Score =   536 bits (1381),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 277/494 (56%), Positives = 338/494 (68%), Gaps = 19/494 (4%)
 Frame = +3

Query  618   PRKPLKTF------KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARG  779
             PRK  K        KE+E     I ++  R KVG+++L   +  VF    +    E    
Sbjct  34    PRKSSKVLLSSYREKERERCIPFICRYLCRGKVGMVILVVFALLVFASGFFTVNKETTGS  93

Query  780   PEIPTISISATMKDREYS-IEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYT  956
                  + +    K R  + I         K        NR   S + P  +P        
Sbjct  94    NNRNILEVLQNSKARGRTVIGSISSGPTAKDFTKIAQTNRNQTSGNSPALVP--------  145

Query  957   LPPGNPCEGFTL-PPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHE  1130
              P  +PC+ FT  PPPP + KR GPRPC VCYL  E+A A MP  PS SPVL  L ++HE
Sbjct  146   -PMLHPCKNFTFSPPPPPNTKRFGPRPCRVCYLSNEQAAASMPRVPSASPVLQNLTFVHE  204

Query  1131  ET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGE  1307
             E        GGS FGGYPSL+QR +++DI++SM+VHCGFVKG  PGR + FDID+ DL E
Sbjct  205   EDPTKSETRGGSDFGGYPSLKQRTDAFDIKDSMTVHCGFVKGSSPGRGSGFDIDEDDLSE  264

Query  1308  MEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRI  1487
             +     V+VASAIFG +D+I +P NISE A+ +V FYMF+DE TE ++ N   L SS  +
Sbjct  265   LNKYHDVIVASAIFGNYDVIQEPINISESAKRHVPFYMFIDEETENYMTNKSVLTSSKLV  324

Query  1488  GLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWR  1667
             GLWRI+VV ++PY DARRNGK+PKLLLHRLFPN RYS+WIDGKL+LV DPYQ+LERFLWR
Sbjct  325   GLWRIIVVRNIPYNDARRNGKVPKLLLHRLFPNVRYSIWIDGKLKLVRDPYQVLERFLWR  384

Query  1668  RNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDV  1847
              NA+FAISRHY RFDVF EAEANKA GK+DNASID Q+ FY+ EGLTP+S AK PITSDV
Sbjct  385   ENATFAISRHYTRFDVFVEAEANKAGGKYDNASIDDQINFYRNEGLTPYSEAKLPITSDV  444

Query  1848  PEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERR  2027
             PEGCVI+REHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKI S+ +W++ MFLDCERR
Sbjct  445   PEGCVILREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIMSKVSWSINMFLDCERR  504

Query  2028  NFVVQGYHRDILEH  2069
             NFV+Q YHR++LEH
Sbjct  505   NFVIQTYHRELLEH  518



>ref|XP_002317500.2| hypothetical protein POPTR_0011s11990g [Populus trichocarpa]
 gb|EEE98112.2| hypothetical protein POPTR_0011s11990g [Populus trichocarpa]
Length=541

 Score =   534 bits (1376),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 257/371 (69%), Positives = 317/371 (85%), Gaps = 3/371 (1%)
 Frame = +3

Query  966   GNPCEGFTLPPPP-ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-  1136
             G+PC+ F+LPPPP +  +R GPRPCPVCY+  E+A A MP + S SPVL+ L Y+ +E  
Sbjct  115   GHPCDKFSLPPPPPSGGRRIGPRPCPVCYISAEQARASMPCSSSASPVLHNLTYVVDENP  174

Query  1137  LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEA  1316
             +     GGS FGGYPSL+QR++S+DIRESM+VHCGFVKG +PG  T FDID+ DL ++E 
Sbjct  175   VKTESHGGSDFGGYPSLKQRNDSFDIRESMTVHCGFVKGNRPGFQTGFDIDEADLMKLED  234

Query  1317  CEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLW  1496
                V+VASAIFG +D+I QP+NISE AR+NV FYMF+D+ TE +L+NS  L+S+ RIGLW
Sbjct  235   SHEVIVASAIFGNYDIIQQPQNISEAARKNVPFYMFIDKETEMYLKNSSALDSNMRIGLW  294

Query  1497  RIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNA  1676
             RI+VV ++PYTDARRNGK+PKLLLHRL PN RYS+WIDGKL+LVVDPYQ+LERFLW++NA
Sbjct  295   RIIVVRNIPYTDARRNGKVPKLLLHRLLPNVRYSIWIDGKLQLVVDPYQVLERFLWQQNA  354

Query  1677  SFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEG  1856
             SFAISRHY+RFDVFEEAEANKAAGK+ N+SID+Q+EFYKKEGL+P+S AK PITSDVPEG
Sbjct  355   SFAISRHYRRFDVFEEAEANKAAGKYGNSSIDYQIEFYKKEGLSPYSKAKLPITSDVPEG  414

Query  1857  CVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFV  2036
             CVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDK+ ++ +W++ MFLDCERRNFV
Sbjct  415   CVIIREHIPITNLFTCLWFNEVDRFTARDQLSFSTVRDKMMAKVDWSINMFLDCERRNFV  474

Query  2037  VQGYHRDILEH  2069
             +Q YH+D+L+ 
Sbjct  475   IQAYHKDLLDQ  485



>gb|AFW82501.1| hypothetical protein ZEAMMB73_312453 [Zea mays]
Length=538

 Score =   534 bits (1375),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 263/424 (62%), Positives = 325/424 (77%), Gaps = 22/424 (5%)
 Frame = +3

Query  969   NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLs-  1142
             +PCE F+L PPP D+KRTGPR        +E+A+AL P  PS SPVL  LNY+ EE L  
Sbjct  122   HPCENFSLSPPPVDRKRTGPR--------LEQALALRPAKPSLSPVLQSLNYVLEEILIP  173

Query  1143  enefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
             +    GS FGG+PSL +RD+SYDI++SM+VHCGFV+G  PG  T FDID+ D  EM+ C+
Sbjct  174   KESKSGSLFGGFPSLEERDKSYDIKDSMTVHCGFVRGKVPGLNTGFDIDEADHSEMQLCQ  233

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
               VVASAIFG +D++ QP+NIS+++++ VCF+MF+DE TEA ++N+  +  + +IGLWR+
Sbjct  234   STVVASAIFGNYDVMQQPENISKFSKDTVCFFMFLDEETEAAIKNTT-IGHTKKIGLWRV  292

Query  1503  VVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASF  1682
             VVV +LP+TDARRNGK+PKLLLHRLFPNARYS+WIDGKL+LV DPYQ+LERFLWR+N SF
Sbjct  293   VVVRNLPFTDARRNGKVPKLLLHRLFPNARYSIWIDGKLKLVRDPYQVLERFLWRKNVSF  352

Query  1683  AISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCV  1862
             AISRHY+RFDVFEEAEANKA GK+DN SID+Q+EFYK+EGLT +S+AK PITSDVPEGCV
Sbjct  353   AISRHYRRFDVFEEAEANKAGGKYDNTSIDYQIEFYKREGLTHYSSAKLPITSDVPEGCV  412

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             IIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKIR R NW  +MFLDCERR+FVVQ
Sbjct  413   IIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIRWRVNWTADMFLDCERRDFVVQ  472

Query  2043  GYHRDILEHRAppppp-----------ppRATIRDGVLKTSKYSGATTKLLARRIGDPRS  2189
              YHR++LE R                  PR  + D   +    + AT KL  +R  D +S
Sbjct  473   SYHRELLEQRQSALRRWPPQRSPIARFQPRKMLPDNAAREPWKASATKKLSRKRARDKKS  532

Query  2190  RHRQ  2201
               R+
Sbjct  533   SSRR  536



>ref|XP_002531719.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30678.1| conserved hypothetical protein [Ricinus communis]
Length=500

 Score =   532 bits (1371),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 272/468 (58%), Positives = 341/468 (73%), Gaps = 23/468 (5%)
 Frame = +3

Query  675   KFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKN  854
             ++  RK+V ++LL   +  VF+W  +    E +        +++  M       +P    
Sbjct  43    RYLGRKRVAMVLLVTFALLVFIWGSFPVSKESSSSNLKSRSTLALEM-------DPSHTG  95

Query  855   NIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPA-DKKRTGPR  1031
               +  + A             P P P     G      +PC  F+LPPPP   +KR GPR
Sbjct  96    ERNGRIRA-------------PSPPPHRISEGSGGSSDHPCRNFSLPPPPPPSRKRLGPR  142

Query  1032  PCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-LsenefggsgfggYPSLRQRDES  1205
             PC VCYLP E+A A MP++PS SPVL+ L Y+ +   +     GGS FGGYPSL QR+ S
Sbjct  143   PCSVCYLPAEQARARMPSSPSVSPVLHNLTYVVDANPVKTEPHGGSDFGGYPSLEQRNVS  202

Query  1206  YDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNI  1385
             +DI+ESM+VHCGFVKG KPG  T FDID+ DL EME    V++ASAIFG +D+I QPKNI
Sbjct  203   FDIQESMTVHCGFVKGSKPGFQTGFDIDEADLREMEQFHEVIIASAIFGNYDIIQQPKNI  262

Query  1386  SEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLL  1565
              E A + V FYMF+DE TEA+++NS  L+SS ++GLWRI+VVH++PY D+RRNGK+PKLL
Sbjct  263   GEAATKYVPFYMFIDEDTEAYMKNSNVLDSSMKVGLWRIIVVHNIPYMDSRRNGKVPKLL  322

Query  1566  LHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAA  1745
             LHR+FPN RYS+WIDGKL+LV DPY++LERFLW +NA+FAISRHY+RFDVF EAEANKAA
Sbjct  323   LHRIFPNVRYSVWIDGKLQLVEDPYKVLERFLWSQNANFAISRHYRRFDVFVEAEANKAA  382

Query  1746  GKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVD  1925
             GK+DNASID+ +EFYKKEGLTP++ AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVD
Sbjct  383   GKYDNASIDYHIEFYKKEGLTPYTRAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVD  442

Query  1926  RFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             RFT RDQ+SFSTVRDKI  + NW++ MFLDCERRNFV+Q YH++IL+H
Sbjct  443   RFTSRDQLSFSTVRDKIMKKVNWSISMFLDCERRNFVIQSYHKEILDH  490



>ref|XP_010112976.1| hypothetical protein L484_021497 [Morus notabilis]
 gb|EXC35135.1| hypothetical protein L484_021497 [Morus notabilis]
Length=733

 Score =   540 bits (1392),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 264/402 (66%), Positives = 321/402 (80%), Gaps = 5/402 (1%)
 Frame = +3

Query  1014  KRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-LsenefggsgfggYPSL  1187
             KR GPRPCPVCYLPVE+A+ +MP + S SPV+  L+YI ++       FGGS FGGYPSL
Sbjct  217   KRIGPRPCPVCYLPVEQAVTMMPRSASVSPVIINLSYILDDNPTRTEPFGGSEFGGYPSL  276

Query  1188  RQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLI  1367
             +QRD+S+DI+ESM VHCGFV+G +PG  T FDID+ DL E+E    V+VASAIFG +DLI
Sbjct  277   KQRDDSFDIKESMQVHCGFVRGSRPGFRTGFDIDEVDLMELEQSHEVIVASAIFGNYDLI  336

Query  1368  HQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNG  1547
              QPKN+SE AR+ + FYMF+DE TEA+L+NS  L++S R+GLWRI+VVH++PY D+RRNG
Sbjct  337   QQPKNVSELARKTIPFYMFIDEETEAYLKNSSVLDNSKRVGLWRIIVVHNIPYNDSRRNG  396

Query  1548  KIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEA  1727
             KIPKLLLHR+FPN RYS+WIDGKL+LVVDPYQILERFLWR NA+FAISRHY+R+DVFEEA
Sbjct  397   KIPKLLLHRIFPNVRYSIWIDGKLQLVVDPYQILERFLWRHNATFAISRHYRRYDVFEEA  456

Query  1728  EANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCL  1907
             EANKAAGK+DNA+ID Q+EFY+KEGL P+S AK PITSDVPEGCVIIREHIPI+NLFTCL
Sbjct  457   EANKAAGKYDNATIDRQIEFYRKEGLKPYSTAKLPITSDVPEGCVIIREHIPITNLFTCL  516

Query  1908  WFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRApppp  2087
             WFNEVDRFT RDQ+SFSTVRDK+R R  W++ MF+DCERRNFV+Q YHR++LEH   P  
Sbjct  517   WFNEVDRFTSRDQLSFSTVRDKLRQRVGWSINMFMDCERRNFVIQTYHRELLEHMPTPEV  576

Query  2088  pppRATIRDGVLKTSKYSG---ATTKLLARRIGDPRSRHRQE  2204
                R  +  G       +G   +T +   R+ G  R R  Q+
Sbjct  577   SDFRPVLPSGNTYGKTPAGKKASTRRGRERKSGSKRHRKLQK  618



>ref|XP_007021484.1| Inner membrane protein oxaA [Theobroma cacao]
 gb|EOY13009.1| Inner membrane protein oxaA [Theobroma cacao]
Length=589

 Score =   535 bits (1377),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 281/494 (57%), Positives = 360/494 (73%), Gaps = 16/494 (3%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIF-KFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTIS  800
             K L + +EKE     I+ ++  R+KV +LLL A +  VFV   +V   E       P + 
Sbjct  44    KMLSSSREKERSLPYIWCRYLGRRKVSMLLLVAFALLVFVLGSFVVNKESTS----PNVD  99

Query  801   ISATMKDREYSIEPEEKNNIHKTLLAKPNNNR--------GIASTDQPPPLPRVYFTGYT  956
                        +     N    ++L + +  +        G+   D    L         
Sbjct  100   QRTGTLGMVPYVNGAPSNPEASSILGRKDKQKDEHYSVVNGLKGGDGNRFLVPASEGATV  159

Query  957   LPPGNPCEGFTLPPPPADK-KRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHE  1130
             LP  +PC  FT PPPP    +R GPRPCPVCYLPV++AIA MP +PS SPVL+ L Y+H+
Sbjct  160   LPFNHPCSNFTFPPPPPPTLRRIGPRPCPVCYLPVDQAIASMPISPSASPVLHNLTYVHD  219

Query  1131  ET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGE  1307
             E  +     GGS FGGYPSL+QR++S+DI+ESM+VHCGFVKG KPG  T FD D+ DL E
Sbjct  220   ENPIKSEPHGGSDFGGYPSLKQRNDSFDIKESMTVHCGFVKGRKPGHLTGFDFDEADLAE  279

Query  1308  MEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRI  1487
             ++    ++VASAIFG +D++ QP+NISE A++N+ FYMF+DE TEA+++N   L+SS R+
Sbjct  280   LQQFHDIIVASAIFGNYDIMQQPRNISEEAKKNIPFYMFIDEETEAYMKNKSILDSSKRV  339

Query  1488  GLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWR  1667
             GLWRIVV+H++PY+DARRNGK+PKLLLHR+FPN RYS+WIDGKL+LVVDPYQ+LERFLWR
Sbjct  340   GLWRIVVIHNVPYSDARRNGKVPKLLLHRIFPNVRYSIWIDGKLQLVVDPYQLLERFLWR  399

Query  1668  RNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDV  1847
             +NA+FAISRHY+RFDVF EAEANKAAGK+DN+SID QV+FYKKEGLTP+S AK P+TSDV
Sbjct  400   QNANFAISRHYRRFDVFVEAEANKAAGKYDNSSIDEQVDFYKKEGLTPYSEAKLPLTSDV  459

Query  1848  PEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERR  2027
             PEGCV+I+EHIPI+NLFTCLWFNEVDRFT RDQ+SF+ VRDKI ++ +W++ MFLDCERR
Sbjct  460   PEGCVLIKEHIPITNLFTCLWFNEVDRFTSRDQLSFAIVRDKIMAKVDWSINMFLDCERR  519

Query  2028  NFVVQGYHRDILEH  2069
             NFV+Q YHRD+LE 
Sbjct  520   NFVIQAYHRDLLEQ  533



>gb|KDO62490.1| hypothetical protein CISIN_1g007884mg [Citrus sinensis]
Length=575

 Score =   533 bits (1373),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 293/499 (59%), Positives = 357/499 (72%), Gaps = 32/499 (6%)
 Frame = +3

Query  618   PRKPLKTFKEKEGWFHRIF--KFAARKKVGLLLLCAVSAAVFVWVLYV-GKG-------E  767
             P+  L   +++E  F  +   KF  R++V +LLL  +   +F    YV  KG       +
Sbjct  39    PKMLLAGSRDREKQFLLLVFCKFLGRRRVAMLLLVGLPLLIFTLGSYVLDKGSLVPYVSQ  98

Query  768   DARGPEIPTIS-ISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYF  944
              A  P    IS +  T KDR+ S E +                     T +P P      
Sbjct  99    AADDPAALMISRVKDTQKDRDSSTEKDGNK------------------TQRPSPPAAASL  140

Query  945   TGYTLPPGNPCEGFTLPPPPADKKRTGPRP-CPVCYLPVEEAIALMPTAPSFSPVLY-LN  1118
                 +P  +PCE F  PPPP    R      CPVCY+PVE+AIA MP++PS SPVL  L 
Sbjct  141   IKRVVPLHHPCENFAFPPPPPPGLRRPGPRPCPVCYVPVEQAIASMPSSPSESPVLQNLT  200

Query  1119  YIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDK  1295
             YIH+E  +     GGS FGGYPSL+QR+ SY+I+ESM+VHCGFVKG +PGR + FD+D+ 
Sbjct  201   YIHDENPVKTETHGGSDFGGYPSLKQRNGSYEIKESMTVHCGFVKGSRPGRQSGFDLDEF  260

Query  1296  DLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNS  1475
             DL E+E    V+VASAIFG +DLI QPK IS+ AR+NV FYMFVDE TEA+++NS  L+S
Sbjct  261   DLTELEQFHDVIVASAIFGNYDLIQQPKKISQAARQNVPFYMFVDEETEAYMKNSSILDS  320

Query  1476  SSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILER  1655
             + R+GLWRI+VV ++PY D+RRNGK+PKLLLHR+FPN RYS+WIDGKL+LVVDPYQILER
Sbjct  321   NKRVGLWRIIVVRNIPYNDSRRNGKVPKLLLHRIFPNVRYSIWIDGKLQLVVDPYQILER  380

Query  1656  FLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPI  1835
             FLWR NA+FAISRHY+RFDVF EAEANKAAGK+DNASID+QVEFYK EGLTP+S AK PI
Sbjct  381   FLWRENATFAISRHYRRFDVFVEAEANKAAGKYDNASIDYQVEFYKNEGLTPYSEAKLPI  440

Query  1836  TSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLD  2015
             TSDVPEGCVIIREHIPI+NLF+CLWFNEVDRFT RDQ+SFSTVRDKI ++ NW V MFLD
Sbjct  441   TSDVPEGCVIIREHIPITNLFSCLWFNEVDRFTARDQLSFSTVRDKIMAKVNWTVNMFLD  500

Query  2016  CERRNFVVQGYHRDILEHR  2072
             CERRNFV+Q YHRD+L H+
Sbjct  501   CERRNFVIQAYHRDLLVHK  519



>ref|XP_011004637.1| PREDICTED: uncharacterized protein LOC105111090 [Populus euphratica]
 ref|XP_011004638.1| PREDICTED: uncharacterized protein LOC105111090 [Populus euphratica]
 ref|XP_011004640.1| PREDICTED: uncharacterized protein LOC105111090 [Populus euphratica]
 ref|XP_011004641.1| PREDICTED: uncharacterized protein LOC105111090 [Populus euphratica]
Length=541

 Score =   531 bits (1369),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 259/370 (70%), Positives = 312/370 (84%), Gaps = 3/370 (1%)
 Frame = +3

Query  969   NPCEGFTLPPPP-ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNYIHEET-L  1139
             +PC  F LPPPP +  +R GPRPCPVCY+  E+A   +P +   SPVL  L Y+ +E  +
Sbjct  116   HPCHKFALPPPPPSGGRRFGPRPCPVCYISAEQARDSIPCSSFASPVLRNLTYVVDENPI  175

Query  1140  senefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEAC  1319
                  GGS FGGYPSL+QR+ES+DI+ESM+VHCGFVKG +PGR T FDID+ DL ++E  
Sbjct  176   KIESHGGSEFGGYPSLKQRNESFDIQESMTVHCGFVKGNRPGRQTGFDIDEADLMKLEEF  235

Query  1320  EGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWR  1499
               V+VASAIFG +D+I QPKN+SE AR+NV FYMF+DE TE +L+NS  L S+ RIGLWR
Sbjct  236   HEVIVASAIFGNYDIIQQPKNVSEAARKNVPFYMFIDEETETYLKNSSALASNMRIGLWR  295

Query  1500  IVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNAS  1679
             I+VVH++PYTDARRNGK+PKLLLHRL PN RYS+WIDGKL+LVVDPYQ+LERFLW++NAS
Sbjct  296   IIVVHNIPYTDARRNGKVPKLLLHRLLPNVRYSIWIDGKLQLVVDPYQVLERFLWQQNAS  355

Query  1680  FAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGC  1859
             FAISRHY RFDVFEEAEANKAAGK DN+SID+Q+EFYKKEGL+P+S AK PITSDVPEGC
Sbjct  356   FAISRHYHRFDVFEEAEANKAAGKSDNSSIDYQIEFYKKEGLSPYSKAKLPITSDVPEGC  415

Query  1860  VIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVV  2039
             VIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKI ++ +W++ MFLDCERRNFV+
Sbjct  416   VIIREHIPITNLFTCLWFNEVDRFTARDQLSFSTVRDKIMAKVDWSINMFLDCERRNFVI  475

Query  2040  QGYHRDILEH  2069
             Q YH+D+L+H
Sbjct  476   QAYHKDLLDH  485



>gb|KDO62491.1| hypothetical protein CISIN_1g007884mg [Citrus sinensis]
Length=586

 Score =   533 bits (1372),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 290/500 (58%), Positives = 353/500 (71%), Gaps = 41/500 (8%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-------GPEIPTIS  800
             +EK+       KF  R++V +LLL  +   +F    YV   E+         G  +P +S
Sbjct  49    REKQFLLLVFCKFLGRRRVAMLLLVGLPLLIFTLGSYVLDKENTSLNIDEHIGSLVPYVS  108

Query  801   ISA-------------TMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVY  941
              +A             T KDR+ S E +                     T +P P     
Sbjct  109   QAADDPAALMISRVKDTQKDRDSSTEKDGNK------------------TQRPSPPAAAS  150

Query  942   FTGYTLPPGNPCEGFTLPPPPADKKRTGPRP-CPVCYLPVEEAIALMPTAPSFSPVLY-L  1115
                  +P  +PCE F  PPPP    R      CPVCY+PVE+AIA MP++PS SPVL  L
Sbjct  151   LIKRVVPLHHPCENFAFPPPPPPGLRRPGPRPCPVCYVPVEQAIASMPSSPSESPVLQNL  210

Query  1116  NYIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDD  1292
              YIH+E  +     GGS FGGYPSL+QR+ SY+I+ESM+VHCGFVKG +PGR + FD+D+
Sbjct  211   TYIHDENPVKTETHGGSDFGGYPSLKQRNGSYEIKESMTVHCGFVKGSRPGRQSGFDLDE  270

Query  1293  KDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLN  1472
              DL E+E    V+VASAIFG +DLI QPK IS+ AR+NV FYMFVDE TEA+++NS  L+
Sbjct  271   FDLTELEQFHDVIVASAIFGNYDLIQQPKKISQAARQNVPFYMFVDEETEAYMKNSSILD  330

Query  1473  SSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILE  1652
             S+ R+GLWRI+VV ++PY D+RRNGK+PKLLLHR+FPN RYS+WIDGKL+LVVDPYQILE
Sbjct  331   SNKRVGLWRIIVVRNIPYNDSRRNGKVPKLLLHRIFPNVRYSIWIDGKLQLVVDPYQILE  390

Query  1653  RFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFP  1832
             RFLWR NA+FAISRHY+RFDVF EAEANKAAGK+DNASID+QVEFYK EGLTP+S AK P
Sbjct  391   RFLWRENATFAISRHYRRFDVFVEAEANKAAGKYDNASIDYQVEFYKNEGLTPYSEAKLP  450

Query  1833  ITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFL  2012
             ITSDVPEGCVIIREHIPI+NLF+CLWFNEVDRFT RDQ+SFSTVRDKI ++ NW V MFL
Sbjct  451   ITSDVPEGCVIIREHIPITNLFSCLWFNEVDRFTARDQLSFSTVRDKIMAKVNWTVNMFL  510

Query  2013  DCERRNFVVQGYHRDILEHR  2072
             DCERRNFV+Q YHRD+L H+
Sbjct  511   DCERRNFVIQAYHRDLLVHK  530



>ref|XP_006451851.1| hypothetical protein CICLE_v10007828mg [Citrus clementina]
 ref|XP_006464750.1| PREDICTED: uncharacterized protein LOC102625940 isoform X1 [Citrus 
sinensis]
 ref|XP_006464751.1| PREDICTED: uncharacterized protein LOC102625940 isoform X2 [Citrus 
sinensis]
 gb|ESR65091.1| hypothetical protein CICLE_v10007828mg [Citrus clementina]
Length=586

 Score =   532 bits (1371),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 292/511 (57%), Positives = 359/511 (70%), Gaps = 43/511 (8%)
 Frame = +3

Query  618   PRKPLKTFKEKEGWFHRIF--KFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-----  776
             P+  L   +++E  F  +   KF  R++V +LLL  +   +F    YV   E+       
Sbjct  39    PKMLLAGSRDREKQFLLLVFCKFLGRRRVAMLLLVGLPLLIFTLGSYVLDKENTSLNIDE  98

Query  777   --GPEIPTISISA-------------TMKDREYSIEPEEKNNIHKTLLAKPNNNRGIAST  911
               G  +P +S +A             T KDR+ S E +                     T
Sbjct  99    HIGSLVPYVSQAADDPAALMISRVKDTQKDRDSSTEKDGNK------------------T  140

Query  912   DQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRP-CPVCYLPVEEAIALMPTA  1088
              +P P          +P  +PCE F  PPPP    R      CPVCY+PVE+AIA MP++
Sbjct  141   QRPSPPAAASLIKRVVPLHHPCENFAFPPPPPPGLRRPGPRPCPVCYVPVEQAIASMPSS  200

Query  1089  PSFSPVLY-LNYIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKP  1262
             PS SPVL  L YIH+E  +     GGS FGGYPSL+QR+ SY+I+ESM+VHCGFVKG +P
Sbjct  201   PSESPVLQNLTYIHDENPVKTETHGGSDFGGYPSLKQRNGSYEIKESMTVHCGFVKGSRP  260

Query  1263  GRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTE  1442
             GR + FD+D+ DL E+E    V+VASAIFG +DLI QPK IS+ AR+NV FYMFVDE TE
Sbjct  261   GRQSGFDLDEFDLTELEQFHDVIVASAIFGNYDLIQQPKKISQAARQNVPFYMFVDEETE  320

Query  1443  AFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLE  1622
             A+++NS  L+S+ R+GLWRI+VV ++PY D+RRNGK+PKLLLHR+FPN RYS+WIDGKL+
Sbjct  321   AYMKNSSILDSNKRVGLWRIIVVCNIPYNDSRRNGKVPKLLLHRIFPNVRYSIWIDGKLQ  380

Query  1623  LVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEG  1802
             LVVDPYQILERFLWR NA+FAISRHY+RFDVF EAEANKAAGK+DN+SID+QVEFYK EG
Sbjct  381   LVVDPYQILERFLWRENATFAISRHYRRFDVFVEAEANKAAGKYDNSSIDYQVEFYKNEG  440

Query  1803  LTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRS  1982
             LTP+S AK PITSDVPEGCVIIREHIPI+NLF+CLWFNEVDRFT RDQ+SFSTVRDKI +
Sbjct  441   LTPYSEAKLPITSDVPEGCVIIREHIPITNLFSCLWFNEVDRFTARDQLSFSTVRDKIMA  500

Query  1983  RTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
             + NW V MFLDCERRNFV+Q YHRD+L H+A
Sbjct  501   KVNWTVNMFLDCERRNFVIQAYHRDLLVHKA  531



>ref|XP_008226631.1| PREDICTED: uncharacterized protein LOC103326206 [Prunus mume]
 ref|XP_008226632.1| PREDICTED: uncharacterized protein LOC103326206 [Prunus mume]
 ref|XP_008226633.1| PREDICTED: uncharacterized protein LOC103326206 [Prunus mume]
Length=586

 Score =   530 bits (1366),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 268/430 (62%), Positives = 335/430 (78%), Gaps = 25/430 (6%)
 Frame = +3

Query  807   ATMKDREYSIEPEEKNNI-----HKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGN  971
             A M+D+     P  +N +     H+TL+  P++        QP  + R           +
Sbjct  117   AGMEDKHDIKIPSTENTVKGNVKHRTLIPSPSH-----PLIQPSTVVR-----------D  160

Query  972   PCEGFTLPPPP--ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-L  1139
              CE F  PPPP   D+KR GPRPCPVCYLPVE+AIA MP+  S S VL  L Y+++E  +
Sbjct  161   HCENFAFPPPPPPTDRKRYGPRPCPVCYLPVEQAIASMPSFSSESSVLRNLTYVYDENPI  220

Query  1140  senefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEAC  1319
                   GS FGG+P+L+QR++SYDI+ESM VHCGFVKG KPG  + FD+D+ DL E+E  
Sbjct  221   RIESHRGSEFGGFPTLKQRNDSYDIKESMMVHCGFVKGSKPGHQSGFDVDEADLMELEMF  280

Query  1320  EGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWR  1499
               ++VASA+FG +D+I QPKNISE++R+NV FYMF+DE TEA+++NS  L +S R+GLWR
Sbjct  281   HDIIVASAVFGNYDIIQQPKNISEFSRKNVPFYMFIDEETEAYMKNSSVLGNSKRVGLWR  340

Query  1500  IVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNAS  1679
             I+VV ++PY+DARRNGK+PKLLLHRLFPN RYSLWIDGKL+LVVDPYQILERFLWR+NA+
Sbjct  341   IIVVRNVPYSDARRNGKVPKLLLHRLFPNVRYSLWIDGKLQLVVDPYQILERFLWRQNAN  400

Query  1680  FAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGC  1859
             FAISRHY+R+DVFEEAEANKAAGK+DN++I+ Q++FY KEGL P+S AKFPITSDVPEGC
Sbjct  401   FAISRHYRRYDVFEEAEANKAAGKYDNSTINEQIDFYIKEGLQPYSVAKFPITSDVPEGC  460

Query  1860  VIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVV  2039
             VII+EHIPI+NLFTC WFNEVDRFT RDQ+SFSTVRDKI  + NW++ MFLDCERRNFV+
Sbjct  461   VIIKEHIPITNLFTCNWFNEVDRFTSRDQLSFSTVRDKIMGKVNWSINMFLDCERRNFVI  520

Query  2040  QGYHRDILEH  2069
             Q YHR++LEH
Sbjct  521   QAYHRELLEH  530



>gb|AFW82496.1| hypothetical protein ZEAMMB73_098573 [Zea mays]
Length=522

 Score =   527 bits (1357),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 264/443 (60%), Positives = 324/443 (73%), Gaps = 44/443 (10%)
 Frame = +3

Query  1002  PADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLs-enefggsgfgg  1175
             P D+KRTGPRPCPVCYLPVE+A+AL P  PS SPVL  LNY+ EE L  +    GS FGG
Sbjct  79    PVDRKRTGPRPCPVCYLPVEQALALRPAKPSLSPVLQSLNYVLEEILIPKESKSGSLFGG  138

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIF--  1349
             +PSL +RD+SYDI++SM+VHCGFV+G  PG  T FDID+ D  EM+ C+  VVASAIF  
Sbjct  139   FPSLEERDKSYDIKDSMTVHCGFVRGKVPGLNTGFDIDEADHSEMQLCQSTVVASAIFGN  198

Query  1350  ----------------------------GAFDLIHQPKNISEYARENVCFYMFVDEGTEA  1445
                                         G +D++ QP+NIS+++++ VCF+MF++E TEA
Sbjct  199   YNFGFQSSLQIAFTLAYKYYVHLLTNFSGNYDVMQQPENISKFSKDTVCFFMFLEEETEA  258

Query  1446  FLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLEL  1625
              ++N+  +  + +IGLWR+VVV +LP+TDARRNGK+PKLLLHRLFPNARYS+WIDGKL+L
Sbjct  259   AIKNT-TIGHTKKIGLWRVVVVRNLPFTDARRNGKVPKLLLHRLFPNARYSIWIDGKLKL  317

Query  1626  VVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGL  1805
             V DPYQ+LERFLWR+N SFAISRHY+RFDVFEEAEANKA GK+DN SID+Q+EFYK+EGL
Sbjct  318   VRDPYQVLERFLWRKNVSFAISRHYRRFDVFEEAEANKAGGKYDNTSIDYQIEFYKREGL  377

Query  1806  TPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSR  1985
             T +S+AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKIR R
Sbjct  378   THYSSAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIRWR  437

Query  1986  TNWNVEMFLDCERRNFVVQGYHRDILEHRApp-----------pppppRATIRDGVLKTS  2132
              NW  +MFLDCERR+FVVQ YHR++LE R                  PR  + D   +  
Sbjct  438   VNWTADMFLDCERRDFVVQSYHRELLEQRQSALRRWPPQRSPIARFQPRKMLPDNAAREP  497

Query  2133  KYSGATTKLLARRIGDPRSRHRQ  2201
               + AT KL  +R  D +S  R+
Sbjct  498   WKASATKKLSRKRARDKKSSSRR  520



>ref|XP_003596749.1| hypothetical protein MTR_2g085170 [Medicago truncatula]
 gb|AES67000.1| DUF616 family protein [Medicago truncatula]
Length=592

 Score =   529 bits (1363),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 293/512 (57%), Positives = 365/512 (71%), Gaps = 30/512 (6%)
 Frame = +3

Query  600   SSFPIPPRKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVW---VLYVG  758
             S  P+  R+  KT     KEKE     I +   R KV +LL+      +FV+    LY G
Sbjct  25    SQVPVLVRRASKTLLYNPKEKERSCLYICRHLGRGKVAMLLMLLCGLFIFVFGCFTLYKG  84

Query  759   KG-----EDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPP  923
                    ED R   + T  +       + +IE + K +   T L   + N    S  +PP
Sbjct  85    GNITSEIEDTRSYALSTYKVIGV----DGTIETKLKGSSSSTSLTSRHKN----SFREPP  136

Query  924   --PLPRVYF----TGYTLPPGNPCE-GFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMP  1082
               PL   Y      G +   G+ C+     PPPPAD++RTGPRPCPVCY+PVE+AIA MP
Sbjct  137   VSPLRSSYNLKGKKGASSTVGHQCDHFAFPPPPPADRRRTGPRPCPVCYIPVEQAIASMP  196

Query  1083  TAPSFSPVL-YLNYIHEETLsene-fggsgfggYPSLRQRDESYDIRESMSVHCGFVKGV  1256
             T+PS SPVL  L Y H E +  +E  GGS FGGYP L +RD S+DI+E+M VHCGFVKG 
Sbjct  197   TSPSESPVLRTLTYAHNENMFPSEPEGGSDFGGYPPLEERDASFDIKETMKVHCGFVKGS  256

Query  1257  KPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEG  1436
             +PGR T FD D++DL E++    ++VASAIFG +D+I QP+NIS+ AR+N+ FYMF+DE 
Sbjct  257   RPGRQTGFDFDEEDLLELDQYHDIIVASAIFGNYDVIQQPRNISKQARKNIPFYMFIDEE  316

Query  1437  TEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGK  1616
             TE ++RN+  L+S  R+GLWRI+VV ++PY D+RRNGKIPKLLLHR+FPN RYS+WIDGK
Sbjct  317   TEMYMRNASILDSRRRVGLWRIIVVRNIPYADSRRNGKIPKLLLHRIFPNIRYSIWIDGK  376

Query  1617  LELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYK-  1793
             LELV DPYQILERFLWR NA+FAISRHY+RFDVF EAEANK AGK++NASID QV+FY+ 
Sbjct  377   LELVKDPYQILERFLWRPNATFAISRHYRRFDVFVEAEANKVAGKYENASIDRQVQFYQY  436

Query  1794  KEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDK  1973
              +GLT +S AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDK
Sbjct  437   HDGLTRYSRAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDK  496

Query  1974  IRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             I ++ +W++ MFLDCERRNFV+Q YHRD+LE+
Sbjct  497   IMAKVDWSINMFLDCERRNFVIQAYHRDVLEN  528



>ref|XP_008366979.1| PREDICTED: uncharacterized protein LOC103430607 [Malus domestica]
Length=575

 Score =   526 bits (1356),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 263/415 (63%), Positives = 328/415 (79%), Gaps = 6/415 (1%)
 Frame = +3

Query  975   CEGFTLPPPP--ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-Ls  1142
             CE F  PPPP   D+KR GPRPCPVCYLPVE+AIA MP+ PS SPVL+ L Y+++E    
Sbjct  150   CENFAFPPPPPPTDRKRYGPRPCPVCYLPVEQAIASMPSYPSESPVLHNLTYVYDENPTR  209

Query  1143  enefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
                  GS FGG+P+L+QR++SYDI+ESM VHCGFV   KPG  + FD+D+ DL E+E   
Sbjct  210   VEPHRGSEFGGFPTLKQRNDSYDIKESMMVHCGFVNASKPGHRSGFDVDEADLMELEMYH  269

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
              V+VASA+FG +D+I QPKNISE++R+NV FY+F+DE TEA+++N   L  S RIGLWRI
Sbjct  270   DVIVASAVFGNYDIIQQPKNISEFSRKNVPFYLFIDEETEAYMKNYSVLGDSKRIGLWRI  329

Query  1503  VVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASF  1682
             +VV ++PY+DARRNGKIPKLLLHR+FPN RYS+WIDGKL LVVDP+Q+LERFLWR+NA+F
Sbjct  330   IVVRNVPYSDARRNGKIPKLLLHRIFPNVRYSIWIDGKLRLVVDPFQVLERFLWRQNANF  389

Query  1683  AISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCV  1862
             AISRHYKR+DVF EAEANKAAGK+DN++I+ Q++FY KEGL P+S AKFPITSDVPEGCV
Sbjct  390   AISRHYKRYDVFVEAEANKAAGKYDNSTINEQIDFYIKEGLQPYSEAKFPITSDVPEGCV  449

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             II+EHIPI+NLFTC WFNEVDRFT RDQ+SFSTVRD+I  + +W++ MFLDCERRNFV+Q
Sbjct  450   IIKEHIPITNLFTCNWFNEVDRFTSRDQLSFSTVRDRIMXKVDWSINMFLDCERRNFVIQ  509

Query  2043  GYHRDILEHRApppppppRATIRDGVLK--TSKYSGATTKLLARRIGDPRSRHRQ  2201
              YHR++LEH  PPPPP         +    TS  +    K+  +R+   + RHR+
Sbjct  510   AYHRELLEHMPPPPPPRVIVRRPPSLSHGTTSVKTPIGKKISQKRVRGDKKRHRK  564



>ref|XP_009356810.1| PREDICTED: uncharacterized protein LOC103947615 [Pyrus x bretschneideri]
Length=576

 Score =   525 bits (1353),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 309/369 (84%), Gaps = 4/369 (1%)
 Frame = +3

Query  975   CEGFTLPPPP--ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-Ls  1142
             CE F  PPPP   D+KR GPRPCPVCYLPVE+AIA MP+ PS SPVL+ L Y+++E    
Sbjct  151   CENFAFPPPPPPTDRKRYGPRPCPVCYLPVEQAIASMPSYPSESPVLHNLTYVYDENPTR  210

Query  1143  enefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACE  1322
                  GS FGG+P+L+QR++SYD++ESM VHCGFV   KPG  + FD+D+ DL E+E   
Sbjct  211   VEPHRGSEFGGFPTLKQRNDSYDLKESMMVHCGFVNASKPGHRSGFDVDEADLMELEMYH  270

Query  1323  GVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRI  1502
              V+VASA+FG +D+I QPKNISE++R+NV FY+F+DE TEA+++N   L  S RIGLWRI
Sbjct  271   DVIVASAVFGNYDIIQQPKNISEFSRKNVPFYLFIDEETEAYMKNYSVLGDSKRIGLWRI  330

Query  1503  VVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASF  1682
             +VV ++PY+DARRNGKIPKLLLHR+FPN RYS+WIDGKL LVVDP+Q+LERFLWR+NA+F
Sbjct  331   IVVRNVPYSDARRNGKIPKLLLHRIFPNVRYSIWIDGKLRLVVDPFQVLERFLWRQNANF  390

Query  1683  AISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCV  1862
             AISRHYKR+DVF EAEANKAAGK+DN++I+ Q++FY KEGL P+S AKFPITSDVPEGCV
Sbjct  391   AISRHYKRYDVFVEAEANKAAGKYDNSTINEQIDFYIKEGLQPYSEAKFPITSDVPEGCV  450

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             II+EHIPI+NLFTC WFNEVDRFT RDQ+SFSTVRD+I  + +W++ MFLDCERRNFV+Q
Sbjct  451   IIKEHIPITNLFTCNWFNEVDRFTSRDQLSFSTVRDRIMGKVDWSINMFLDCERRNFVIQ  510

Query  2043  GYHRDILEH  2069
              YHR++LEH
Sbjct  511   AYHRELLEH  519



>ref|XP_004297916.1| PREDICTED: uncharacterized protein LOC101306424, partial [Fragaria 
vesca subsp. vesca]
Length=420

 Score =   517 bits (1331),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 243/347 (70%), Positives = 300/347 (86%), Gaps = 2/347 (1%)
 Frame = +3

Query  1035  CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-LsenefggsgfggYPSLRQRDESY  1208
             CPVCYLPVE+AIA MPT+PS SPVL+ L Y+++E        GGS FGG+P+LR+R+ESY
Sbjct  21    CPVCYLPVEQAIASMPTSPSESPVLHNLTYVYDENPTRIEPHGGSEFGGFPTLRERNESY  80

Query  1209  DIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNIS  1388
             DI+ESM+VHCGFVKG KPG  + FD+D+ DL E+E    ++VASA+FG +D+I QP NIS
Sbjct  81    DIKESMTVHCGFVKGNKPGDQSGFDVDEVDLMELETSHQIIVASAVFGNYDIIQQPTNIS  140

Query  1389  EYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLL  1568
             E++RE+V FYMF+DE TEA+++NS  L ++ ++GLWR++VV ++PYTDARRNGKIPKLLL
Sbjct  141   EFSRESVPFYMFIDEETEAYMKNSSVLGNNRKVGLWRVIVVRNIPYTDARRNGKIPKLLL  200

Query  1569  HRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAG  1748
             HRLFPN RYS+WIDGKL LVVDPYQILERFLWR+NA+FAIS+HY+RFDVFEEAEAN+AAG
Sbjct  201   HRLFPNVRYSIWIDGKLRLVVDPYQILERFLWRQNANFAISKHYRRFDVFEEAEANRAAG  260

Query  1749  KFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDR  1928
             K+DN+SI+ QV+FY KEGL P+S AK PITSDVPEGCVII+EHIPI+NLFTC WFNEVDR
Sbjct  261   KYDNSSINEQVDFYIKEGLQPYSEAKLPITSDVPEGCVIIKEHIPITNLFTCNWFNEVDR  320

Query  1929  FTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             FT RDQ+SFSTVRDKI ++ +W+V MFLDCERRNFV+Q YHR++LE 
Sbjct  321   FTSRDQLSFSTVRDKIMAKVDWSVNMFLDCERRNFVIQAYHRELLEQ  367



>gb|EPS68952.1| hypothetical protein M569_05814, partial [Genlisea aurea]
Length=442

 Score =   514 bits (1325),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 253/380 (67%), Positives = 297/380 (78%), Gaps = 12/380 (3%)
 Frame = +3

Query  969   NPCEGF-TLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLs  1142
             +PC+ F +L  PPA    +GPRPCPVCY+PVEEAIA MP  P  SP+L  LNY H E   
Sbjct  1     HPCQNFASLSSPPAALHGSGPRPCPVCYVPVEEAIARMPEVPPPSPILRRLNY-HSELKP  59

Query  1143  enefgg--------sgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKD  1298
                           S FGGYP+LRQR++S+ I+E+M+VHCGFVKG KPG  T FDID  D
Sbjct  60    MRTEMNGDFEFGGDSEFGGYPALRQRNDSFTIKETMTVHCGFVKGCKPGYETGFDIDIDD  119

Query  1299  LGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSS  1478
              G +E     VVASAIFG +D IHQP+N+SE ++ N+ F+MFVDE TE +LRNS  L S 
Sbjct  120   RGMLEKFHNTVVASAIFGNYDEIHQPENVSEISKRNIPFFMFVDEETETYLRNSSLLGSD  179

Query  1479  SRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERF  1658
               +GLWRIVVVH+LPY DARRNGK+PKLLLHRLFP  RYSLWID KL+L+VDPYQILERF
Sbjct  180   MHVGLWRIVVVHNLPYVDARRNGKVPKLLLHRLFPRTRYSLWIDAKLQLLVDPYQILERF  239

Query  1659  LWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPIT  1838
             LWR+NA+FAISRHY RF VFEEAEANKA GK+ NASID Q+EFY KEGLTP++ AK PIT
Sbjct  240   LWRQNATFAISRHYTRFSVFEEAEANKAGGKYQNASIDHQIEFYMKEGLTPYTEAKLPIT  299

Query  1839  SDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRS-RTNWNVEMFLD  2015
             SDVPEGCV++REHIPI+NLF+CLWFNEVDRFT RDQ+SFSTVRDKI+S +  W+V MFLD
Sbjct  300   SDVPEGCVLVREHIPITNLFSCLWFNEVDRFTSRDQLSFSTVRDKIQSQQVEWSVNMFLD  359

Query  2016  CERRNFVVQGYHRDILEHRA  2075
             CERR+FV Q YHRD+L  +A
Sbjct  360   CERRSFVRQDYHRDVLREKA  379



>ref|XP_002964308.1| hypothetical protein SELMODRAFT_62660, partial [Selaginella moellendorffii]
 gb|EFJ34641.1| hypothetical protein SELMODRAFT_62660, partial [Selaginella moellendorffii]
Length=395

 Score =   512 bits (1318),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 244/385 (63%), Positives = 300/385 (78%), Gaps = 4/385 (1%)
 Frame = +3

Query  930   PRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL  1109
             P   F    LP G+PCE FT+PPPPADKKRTGPRPCPVCYLPVEEA  L P +  F  ++
Sbjct  1     PPTSFLDPPLPHGHPCESFTMPPPPADKKRTGPRPCPVCYLPVEEAKKLYPPSGVFPSLI  60

Query  1110  Y--LNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFD  1283
                L Y+ E+  +     GS FGG+P+L  R  S+ I ESM ++CGF +G+KPG  + FD
Sbjct  61    VQNLTYVREDASTAATSPGSAFGGHPTLEDRKRSHKIEESMHLYCGFARGIKPGVGSGFD  120

Query  1284  IDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEA-FLRNS  1460
             ID+ DL +ME C G+VV SAIFG +D + QPK+ISE++++NVCF+MFVDE T+A  ++  
Sbjct  121   IDEFDLYDMEKCHGIVVISAIFGNYDPLQQPKHISEHSKKNVCFFMFVDEETQAAIIKRG  180

Query  1461  GDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPY  1640
             G  + + ++GLWR+V VH++PY D RR GKIPKLL HRLFPNAR+SLWIDGKLELVVDPY
Sbjct  181   GSYSRTKKVGLWRVVTVHNIPYLDPRRTGKIPKLLSHRLFPNARFSLWIDGKLELVVDPY  240

Query  1641  QILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSA  1820
             QI+ERFLWR + +FAIS+HYKRFDVF EAEANK A K++NASID QV FY+KEGL P++ 
Sbjct  241   QIMERFLWRTHDTFAISKHYKRFDVFTEAEANKLARKYNNASIDAQVNFYRKEGLVPYTT  300

Query  1821  AKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNV  2000
             AK PI SDVPEGCVI+REH P++NLFTCLWFNEVDRFT RDQISF  VRDKI ++  W +
Sbjct  301   AKLPIVSDVPEGCVIVREHTPLTNLFTCLWFNEVDRFTSRDQISFGIVRDKIMAQVPWRI  360

Query  2001  EMFLDCERRNFVV-QGYHRDILEHR  2072
              MFLDC+RRNFVV QGYHRD++E R
Sbjct  361   NMFLDCQRRNFVVQQGYHRDVIEQR  385



>ref|XP_007211858.1| hypothetical protein PRUPE_ppa004778mg [Prunus persica]
 gb|EMJ13057.1| hypothetical protein PRUPE_ppa004778mg [Prunus persica]
Length=492

 Score =   513 bits (1322),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 245/352 (70%), Positives = 299/352 (85%), Gaps = 2/352 (1%)
 Frame = +3

Query  1020  TGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-LsenefggsgfggYPSLRQ  1193
             T  + CPVCYLPVE+AIA MP+  S S VL  L Y+++E  +      GS FGG+P+L+Q
Sbjct  85    TVNKACPVCYLPVEQAIASMPSFSSESSVLRNLTYVYDENPIRIESHRGSEFGGFPTLKQ  144

Query  1194  RDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQ  1373
             R++SYDI+ESM VHCGFVKG KPG  + FD+D+ DL E+E    ++VASA+FG +D+I Q
Sbjct  145   RNDSYDIKESMMVHCGFVKGSKPGHQSGFDVDEADLMELEMFHDIIVASAVFGNYDIIQQ  204

Query  1374  PKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKI  1553
             PKNISE++R+NV FYMF+DE TEA++ NS  L +S R+GLWRI+VV ++PY+DARRNGKI
Sbjct  205   PKNISEFSRKNVPFYMFIDEETEAYMTNSSVLGNSKRVGLWRIIVVRNVPYSDARRNGKI  264

Query  1554  PKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEA  1733
             PKLLLHRLFPN RYSLWIDGKL+LVVDPYQILERFLWR+NA+FAISRHYKR+DVFEEAEA
Sbjct  265   PKLLLHRLFPNVRYSLWIDGKLQLVVDPYQILERFLWRQNANFAISRHYKRYDVFEEAEA  324

Query  1734  NKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWF  1913
             NKAAGK+DN++I+ Q++FY KEGL P+S AKFPITSDVPEGCVII+EHIPI+NLFTC WF
Sbjct  325   NKAAGKYDNSTINEQIDFYIKEGLQPYSEAKFPITSDVPEGCVIIKEHIPITNLFTCNWF  384

Query  1914  NEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             NEVDRFT RDQ+SFSTVRDKI  + NW++ MFLDCERRNFV+Q YHR++LEH
Sbjct  385   NEVDRFTSRDQLSFSTVRDKIMGKVNWSINMFLDCERRNFVIQAYHRELLEH  436



>ref|XP_006451852.1| hypothetical protein CICLE_v10007828mg [Citrus clementina]
 gb|ESR65092.1| hypothetical protein CICLE_v10007828mg [Citrus clementina]
Length=547

 Score =   514 bits (1325),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 284/492 (58%), Positives = 346/492 (70%), Gaps = 41/492 (8%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDAR-------GPEIPTIS  800
             +EK+       KF  R++V +LLL  +   +F    YV   E+         G  +P +S
Sbjct  49    REKQFLLLVFCKFLGRRRVAMLLLVGLPLLIFTLGSYVLDKENTSLNIDEHIGSLVPYVS  108

Query  801   ISA-------------TMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVY  941
              +A             T KDR+ S E +                     T +P P     
Sbjct  109   QAADDPAALMISRVKDTQKDRDSSTEKDGN------------------KTQRPSPPAAAS  150

Query  942   FTGYTLPPGNPCEGFTLPPPPADKKRTGPRP-CPVCYLPVEEAIALMPTAPSFSPVLY-L  1115
                  +P  +PCE F  PPPP    R      CPVCY+PVE+AIA MP++PS SPVL  L
Sbjct  151   LIKRVVPLHHPCENFAFPPPPPPGLRRPGPRPCPVCYVPVEQAIASMPSSPSESPVLQNL  210

Query  1116  NYIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDD  1292
              YIH+E  +     GGS FGGYPSL+QR+ SY+I+ESM+VHCGFVKG +PGR + FD+D+
Sbjct  211   TYIHDENPVKTETHGGSDFGGYPSLKQRNGSYEIKESMTVHCGFVKGSRPGRQSGFDLDE  270

Query  1293  KDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLN  1472
              DL E+E    V+VASAIFG +DLI QPK IS+ AR+NV FYMFVDE TEA+++NS  L+
Sbjct  271   FDLTELEQFHDVIVASAIFGNYDLIQQPKKISQAARQNVPFYMFVDEETEAYMKNSSILD  330

Query  1473  SSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILE  1652
             S+ R+GLWRI+VV ++PY D+RRNGK+PKLLLHR+FPN RYS+WIDGKL+LVVDPYQILE
Sbjct  331   SNKRVGLWRIIVVCNIPYNDSRRNGKVPKLLLHRIFPNVRYSIWIDGKLQLVVDPYQILE  390

Query  1653  RFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFP  1832
             RFLWR NA+FAISRHY+RFDVF EAEANKAAGK+DN+SID+QVEFYK EGLTP+S AK P
Sbjct  391   RFLWRENATFAISRHYRRFDVFVEAEANKAAGKYDNSSIDYQVEFYKNEGLTPYSEAKLP  450

Query  1833  ITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFL  2012
             ITSDVPEGCVIIREHIPI+NLF+CLWFNEVDRFT RDQ+SFSTVRDKI ++ NW V MFL
Sbjct  451   ITSDVPEGCVIIREHIPITNLFSCLWFNEVDRFTARDQLSFSTVRDKIMAKVNWTVNMFL  510

Query  2013  DCERRNFVVQGY  2048
             DCERRNFV+Q Y
Sbjct  511   DCERRNFVIQVY  522



>gb|KHG28984.1| Putative tRNA (Met) cytidine acetyltransferase [Gossypium arboreum]
Length=572

 Score =   506 bits (1303),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 281/495 (57%), Positives = 356/495 (72%), Gaps = 33/495 (7%)
 Frame = +3

Query  624   KPLKTFKEKE-----GWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPE-  785
             K L   +EKE      W+    ++   +K  +LLL A +  VF    +V   +D+  P  
Sbjct  41    KMLSGIREKERPLPNAWY----RYIGCRKFSMLLLIAFALLVFALGSFV-VNKDSTSPNV  95

Query  786   ---IPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYT  956
                I T+ I   +    +     E + I      K + NR      Q P      F G +
Sbjct  96    LQRIGTLGIVPYVNGGHH-----EASQILGEKDKKKDENRF-----QIPA-----FKGAS  140

Query  957   -LPPGNPCEGFTLPPPPADKKRTGPRP-CPVCYLPVEEAIALMPTAPSFSPVLY-LNYI-  1124
              LP  +PC  FT PPPP   +R      CPVCYLPV++AIA MP++ S SPVL+ L Y+ 
Sbjct  141   VLPFHHPCANFTFPPPPPPTRRRLGPRPCPVCYLPVDQAIASMPSSSSASPVLHNLTYVL  200

Query  1125  HEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLG  1304
             +E  +     GGS FGGYPSL+QR++S+DI+ESM+VHCGFVKG KPG  T FD D+ DL 
Sbjct  201   NENPIKSEPHGGSDFGGYPSLKQRNDSFDIKESMAVHCGFVKGSKPGHGTGFDFDESDLA  260

Query  1305  EMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSR  1484
             E++    ++VASAIFG +D+I  P+NISE A++N+ FYMFVDE TEAF++N   L+SS  
Sbjct  261   ELQQFHDIIVASAIFGNYDIIQHPQNISEEAKKNIPFYMFVDEETEAFMKNRSILSSSKW  320

Query  1485  IGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLW  1664
             +GLWRIVV+H++PY+DARRNGK+PKLLLHR+FPN RYS+WIDGKL+LVVDPYQ+LERFLW
Sbjct  321   VGLWRIVVIHNVPYSDARRNGKVPKLLLHRIFPNVRYSIWIDGKLQLVVDPYQVLERFLW  380

Query  1665  RRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSD  1844
             R+NA+FAISRHY+RFDVF EAEANKAAGK+DN+SID QV+FYKKEGLTP+S AK PITSD
Sbjct  381   RQNANFAISRHYRRFDVFVEAEANKAAGKYDNSSIDEQVDFYKKEGLTPYSEAKLPITSD  440

Query  1845  VPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCER  2024
             VPEGCV+I+EHIPI+NLFTCLWFNEVDRFT RDQ+SF+ VRDKI ++ +W++ MFLDCER
Sbjct  441   VPEGCVLIKEHIPITNLFTCLWFNEVDRFTSRDQLSFAIVRDKIMTKVDWSINMFLDCER  500

Query  2025  RNFVVQGYHRDILEH  2069
             RNFV+Q YHRD+LE 
Sbjct  501   RNFVIQSYHRDLLEQ  515



>gb|KDO75984.1| hypothetical protein CISIN_1g006222mg [Citrus sinensis]
Length=410

 Score =   500 bits (1287),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 244/329 (74%), Positives = 276/329 (84%), Gaps = 3/329 (1%)
 Frame = +3

Query  1077  MPTAPSFSPVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVK  1250
             MP  PSFSPVL  L YI E  L+     G    GGYP L QR+ SYDIRESMSVHCGFVK
Sbjct  1     MPKVPSFSPVLKNLTYITEPVLNREAEFGGSDFGGYPPLAQRNNSYDIRESMSVHCGFVK  60

Query  1251  GVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVD  1430
             G KPGR T +D+D++D+ +ME C G+VV SAIFGAFD I+QP NISEY+R+ VCF MFVD
Sbjct  61    G-KPGRGTGYDLDEEDILDMEQCHGIVVVSAIFGAFDDINQPSNISEYSRKTVCFVMFVD  119

Query  1431  EGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWID  1610
             E TEA+L+ +  L+ + +IG+WRIVV+H+ PY+DARR GKIPKLL HRLFPNAR+SLWID
Sbjct  120   EETEAYLKANSGLDRTKKIGIWRIVVIHNPPYSDARRTGKIPKLLAHRLFPNARFSLWID  179

Query  1611  GKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFY  1790
             GKLELVVDPYQILER LWR+NA+FAISRHYKRFDV  EAEANKAA K+DNASIDFQ+EFY
Sbjct  180   GKLELVVDPYQILERHLWRKNATFAISRHYKRFDVLVEAEANKAAKKYDNASIDFQIEFY  239

Query  1791  KKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRD  1970
             K EGLTP+S AK PITSDVPEGCVIIREH+PISNLF CLWFNEVDRFT RDQISFSTVRD
Sbjct  240   KNEGLTPYSEAKLPITSDVPEGCVIIREHVPISNLFVCLWFNEVDRFTSRDQISFSTVRD  299

Query  1971  KIRSRTNWNVEMFLDCERRNFVVQGYHRD  2057
             K+ ++TNW V MFLDCERRNFVVQ YHRD
Sbjct  300   KLWAKTNWTVNMFLDCERRNFVVQKYHRD  328



>gb|KHN36822.1| hypothetical protein glysoja_001553 [Glycine soja]
Length=584

 Score =   504 bits (1299),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 284/523 (54%), Positives = 368/523 (70%), Gaps = 36/523 (7%)
 Frame = +3

Query  579   QQHHFLSSSFPIPPRKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWV  746
             QQ +   S  P+  R+P KT     +EKE  F  + +   R KV +LL+ A+   VFV+ 
Sbjct  18    QQQNGTVSLKPLLVRRPSKTLLYNPREKERGFFFVCRLLGRGKVAMLLMLALGLCVFVFG  77

Query  747   LY-VGKGEDARGPEIPTISISATMKD-REYSIEPEEKNNIHKTLLAKP---NNNRGIA--  905
              + V +G +          I++ ++D R Y+I   E       +  KP   N++R  +  
Sbjct  78    CFTVYRGGN----------ITSEIEDTRSYAITRYEFLKPRGVIEDKPQDSNSSRVFSLT  127

Query  906   ----STDQPPPLPRVYF-------TGYTLPPGNPCEGFTLPPPPADKKRTGPRPCP-VCY  1049
                 ST +PPP P            GY     + C+ F  PPPP   +R        VCY
Sbjct  128   SRHRSTARPPPAPNSLSLSKSKRKMGYFPTWRHRCDHFAFPPPPPADRRRPGPRPCPVCY  187

Query  1050  LPVEEAIALMPTAPSFSPVL-YLNYIHEE-TLsenefggsgfggYPSLRQRDESYDIRES  1223
             +PV++AIA MP +PS SP+L  L Y+H+E ++     GGS FGGYPSL +RD ++DI+E+
Sbjct  188   IPVKQAIASMPGSPSESPILRTLTYVHDENSIEGEPHGGSDFGGYPSLEERDAAFDIKET  247

Query  1224  MSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARE  1403
             M VHCGFVKG +PGR T FD D+ DL E++    V+VASAIFG +D+I QP+NIS  A++
Sbjct  248   MKVHCGFVKGSRPGRQTGFDFDEADLLELDQYHDVIVASAIFGNYDVIQQPRNISLEAKK  307

Query  1404  NVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFP  1583
             N+ FYMF+DE TE +++N+  L+SS R+GLWRI++V ++PY D+RRNGK+PKLLLHR+FP
Sbjct  308   NIPFYMFIDEETEMYMKNASILSSSRRVGLWRIIIVRNIPYADSRRNGKVPKLLLHRIFP  367

Query  1584  NARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNA  1763
             N RYS+WIDGKLELVVDPYQ+LERFLWR+NA+FAISRHY+RFDVF EAEANKAAGK++NA
Sbjct  368   NVRYSIWIDGKLELVVDPYQVLERFLWRQNATFAISRHYRRFDVFVEAEANKAAGKYENA  427

Query  1764  SIDFQVEFYK-KEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPR  1940
             SID Q++FYK  +GLT +S  K PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT R
Sbjct  428   SIDHQIQFYKYHDGLTHYSRTKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSR  487

Query  1941  DQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             DQ+SFSTVRDKI ++T+W++ MFLDCERRNFV+Q YHRDILE 
Sbjct  488   DQLSFSTVRDKIMAKTDWSISMFLDCERRNFVIQAYHRDILEQ  530



>gb|AFW82497.1| hypothetical protein ZEAMMB73_098573 [Zea mays]
Length=488

 Score =   501 bits (1289),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 266/495 (54%), Positives = 334/495 (67%), Gaps = 58/495 (12%)
 Frame = +3

Query  858   IHKTLLAKPNNNRGIASTDQPPPLPRV----YFTGYTLPPGNPCEGFTLPPPPADKKRTG  1025
             +  ++ AKPN    I   +     P V     F+ +     NP   +T    P D+KRTG
Sbjct  3     VSHSVPAKPNQLLAIIRNEDEDASPGVETMLVFSDHVRSFVNPV--WTSSGRPVDRKRTG  60

Query  1026  PRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLs-enefggsgfggYPSLRQRD  1199
             PR        +E+A+AL P  PS SPVL  LNY+ EE L  +    GS FGG+PSL +RD
Sbjct  61    PR--------LEQALALRPAKPSLSPVLQSLNYVLEEILIPKESKSGSLFGGFPSLEERD  112

Query  1200  ESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIF----------  1349
             +SYDI++SM+VHCGFV+G  PG  T FDID+ D  EM+ C+  VVASAIF          
Sbjct  113   KSYDIKDSMTVHCGFVRGKVPGLNTGFDIDEADHSEMQLCQSTVVASAIFGNYNFGFQSS  172

Query  1350  --------------------GAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDL  1469
                                 G +D++ QP+NIS+++++ VCF+MF++E TEA ++N+  +
Sbjct  173   LQIAFTLAYKYYVHLLTNFSGNYDVMQQPENISKFSKDTVCFFMFLEEETEAAIKNTT-I  231

Query  1470  NSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQIL  1649
               + +IGLWR+VVV +LP+TDARRNGK+PKLLLHRLFPNARYS+WIDGKL+LV DPYQ+L
Sbjct  232   GHTKKIGLWRVVVVRNLPFTDARRNGKVPKLLLHRLFPNARYSIWIDGKLKLVRDPYQVL  291

Query  1650  ERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKF  1829
             ERFLWR+N SFAISRHY+RFDVFEEAEANKA GK+DN SID+Q+EFYK+EGLT +S+AK 
Sbjct  292   ERFLWRKNVSFAISRHYRRFDVFEEAEANKAGGKYDNTSIDYQIEFYKREGLTHYSSAKL  351

Query  1830  PITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMF  2009
             PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKIR R NW  +MF
Sbjct  352   PITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVRDKIRWRVNWTADMF  411

Query  2010  LDCERRNFVVQGYHRDILEHRAppppp-----------ppRATIRDGVLKTSKYSGATTK  2156
             LDCERR+FVVQ YHR++LE R                  PR  + D   +    + AT K
Sbjct  412   LDCERRDFVVQSYHRELLEQRQSALRRWPPQRSPIARFQPRKMLPDNAAREPWKASATKK  471

Query  2157  LLARRIGDPRSRHRQ  2201
             L  +R  D +S  R+
Sbjct  472   LSRKRARDKKSSSRR  486



>ref|XP_008656482.1| PREDICTED: uncharacterized protein LOC103635877 isoform X2 [Zea 
mays]
Length=553

 Score =   503 bits (1294),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 263/481 (55%), Positives = 334/481 (69%), Gaps = 37/481 (8%)
 Frame = +3

Query  633   KTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISAT  812
             +T + ++   HR  +   R++ G+LLL AV++A     L+    +DA    I  ++    
Sbjct  37    RTLRVEKERLHRALRLVGRRRTGVLLLLAVASAALFCSLFAVVKDDANSTSI--VNNYEV  94

Query  813   MKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTL  992
                 + S+ P     +   +++    +  + +    P    + F  +T    +PCEGF++
Sbjct  95    PNAIQKSVYPSRTRPL---MMSGNQESTSVVNKIDFPNRLHLSFANFT----HPCEGFSV  147

Query  993   PPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgf  1169
             PPP  DKKRTGPRPCPVCY+ V++A ALMP   S SPVL  LNY+ E+ ++ N       
Sbjct  148   PPPLVDKKRTGPRPCPVCYVSVDQAFALMPLQASPSPVLKDLNYVSEDGVTANLSNQGSG  207

Query  1170  -ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAI  1346
              GG+PSL QR++S++I ESM+VHCGFV+G KPG+ T FDI D DL EME C  +VVASAI
Sbjct  208   FGGHPSLDQRNDSFNINESMTVHCGFVRGKKPGQGTGFDIKDDDLLEMEQCHDLVVASAI  267

Query  1347  FGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPY  1526
             F                          DE TEA+++NS  L +++++GLWR+VVV +LPY
Sbjct  268   F--------------------------DEETEAYVKNSSSLYNNNKVGLWRLVVVRNLPY  301

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GKIPKLLLHRLFPN R+S+WID KLELVVDPY +LERFLWR+N +FAISRHYKR
Sbjct  302   EDPRRTGKIPKLLLHRLFPNVRFSVWIDAKLELVVDPYLLLERFLWRKNTTFAISRHYKR  361

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPI  1886
             FDVFEEAEANKAAGK+DNASID+Q+EFY+ EGLT +S+AK PITSDVPEGCVIIREHIPI
Sbjct  362   FDVFEEAEANKAAGKYDNASIDYQIEFYRNEGLTHYSSAKLPITSDVPEGCVIIREHIPI  421

Query  1887  SNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILE  2066
             +NLFTC+WFNEVDRFT RDQISFSTVRDKIR+R  W  EMF+DCERRNFVVQ YHR++LE
Sbjct  422   TNLFTCVWFNEVDRFTSRDQISFSTVRDKIRARVGWMPEMFMDCERRNFVVQVYHRELLE  481

Query  2067  H  2069
              
Sbjct  482   Q  482



>ref|XP_003541846.1| PREDICTED: uncharacterized protein LOC100810247 [Glycine max]
Length=584

 Score =   504 bits (1297),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 283/523 (54%), Positives = 368/523 (70%), Gaps = 36/523 (7%)
 Frame = +3

Query  579   QQHHFLSSSFPIPPRKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWV  746
             QQ +   S  P+  R+P KT     +EKE  F  + +   R KV +LL+ A+   VFV+ 
Sbjct  18    QQQNGTVSPKPLLVRRPSKTLLYNPREKERGFFFVCRLLGRGKVAMLLMLALGLCVFVFG  77

Query  747   LY-VGKGEDARGPEIPTISISATMKD-REYSIEPEEKNNIHKTLLAKP---NNNRGIA--  905
              + V +G +          I++ ++D R Y+I   E       +  KP   N++R  +  
Sbjct  78    CFTVYRGGN----------ITSEIEDTRSYAITRYEFLKPRGVIEDKPQDSNSSRVFSLT  127

Query  906   ----STDQPPPLPRVYF-------TGYTLPPGNPCEGFTLPPPPADKKRTGPRPCP-VCY  1049
                 ST +PPP P            GY    G+ C+ F  PPPP   +R        VCY
Sbjct  128   SRHRSTARPPPAPNSLSLSKSKRKMGYFPTWGHRCDHFAFPPPPPADRRRPGPRPCPVCY  187

Query  1050  LPVEEAIALMPTAPSFSPVL-YLNYIHEET-LsenefggsgfggYPSLRQRDESYDIRES  1223
             +PV++AIA MP +PS SP+L  L Y+H+E  +     GGS FGGYPSL +RD ++DI+E+
Sbjct  188   IPVKQAIASMPGSPSESPILRTLTYVHDENPIEGEPHGGSDFGGYPSLEERDAAFDIKET  247

Query  1224  MSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARE  1403
             M VHCGFVKG +PGR T FD D+ DL E++    V+VASAIFG +D+I QP+NIS  A++
Sbjct  248   MKVHCGFVKGSRPGRQTGFDFDEADLLELDQYHDVIVASAIFGNYDVIQQPRNISLEAKK  307

Query  1404  NVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFP  1583
             N+ FYMF+DE TE +++N+  L+SS R+GLWRI++V ++PY D+RRNGK+PKLLLHR+FP
Sbjct  308   NIPFYMFIDEETEMYMKNASILSSSRRVGLWRIIIVRNIPYADSRRNGKVPKLLLHRIFP  367

Query  1584  NARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNA  1763
             N RYS+WIDGKLELVVDPY+++ERFLWR+NA+FAISRHY+RFDVF EAEANKAAGK++NA
Sbjct  368   NVRYSIWIDGKLELVVDPYKVIERFLWRQNATFAISRHYRRFDVFVEAEANKAAGKYENA  427

Query  1764  SIDFQVEFYK-KEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPR  1940
             SID Q++FYK  +GLT +S  K PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT R
Sbjct  428   SIDHQIQFYKYHDGLTHYSRTKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSR  487

Query  1941  DQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             DQ+SFSTVRDKI ++T+W++ MFLDCERRNFV+Q YHRDILE 
Sbjct  488   DQLSFSTVRDKIMAKTDWSISMFLDCERRNFVIQAYHRDILEQ  530



>ref|XP_010500933.1| PREDICTED: uncharacterized protein LOC104778236 [Camelina sativa]
Length=541

 Score =   501 bits (1290),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 272/479 (57%), Positives = 328/479 (68%), Gaps = 29/479 (6%)
 Frame = +3

Query  678   FAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPT------ISISATMKDREY-SI  836
             +  R++V +LLL +++  VFV   Y    E +  P I           S T   RE  S 
Sbjct  20    YLGRRRVAMLLLLSLAFVVFVLGSYTINKE-SNSPNIHQSIQTMDFGSSQTPVSRELTSF  78

Query  837   EPEEKNNIHKTLLAKPNNNRGIASTD-----QPPPLPRVYFTGYTLPPGNPCEGFTLPPP  1001
               E  NN H   +       GI  +D      PP LP  +         +PC+ F+ PPP
Sbjct  79    YTENSNNDH---IRDSFMRNGIGGSDVDINHPPPSLPSTHH--------HPCDSFSFPPP  127

Query  1002  PADKKRTGPRP-CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgfg-  1172
             P    R      CPVCYLP EEA+A MP  P  SPVL  L +I +E   ++E    G   
Sbjct  128   PPPGMRRPGPRPCPVCYLPPEEALAHMPKLPFESPVLKNLTFIRDENPVKHEESQGGSDF  187

Query  1173  -gYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIF  1349
              GYPSL  R  S+DI+ESM+VHCGFV G KPG  T FDID+  L E++    V+VASAIF
Sbjct  188   GGYPSLEDRTNSFDIKESMTVHCGFVNGTKPGHQTGFDIDEDILHELDQFHDVIVASAIF  247

Query  1350  GAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSS-RIGLWRIVVVHDLPY  1526
             G +D+I +P NISE AR N+ FYMFVDE T  +L+N+      + R+GLWRI+VVH++PY
Sbjct  248   GKYDIIQEPVNISEMARTNIPFYMFVDEETHLYLKNTSSYTEDNKRVGLWRIIVVHNVPY  307

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
             TDARRNGK+PKLLLHRLFPN RYS+W+D KL+LVVDPYQILERFLWR N+SFAISRHY+R
Sbjct  308   TDARRNGKVPKLLLHRLFPNVRYSIWVDAKLQLVVDPYQILERFLWRTNSSFAISRHYRR  367

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPI  1886
             FDVF EAEANKAA K+DNASID+Q+EFYKKEGLTP+S AK PITSDVPEGC IIREHIPI
Sbjct  368   FDVFVEAEANKAARKYDNASIDYQIEFYKKEGLTPYSEAKLPITSDVPEGCTIIREHIPI  427

Query  1887  SNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             +NLFTC+WFNEVDRFT RDQISF+  RDKIR + +W++ MFLDCERRNFV Q YHRD+L
Sbjct  428   TNLFTCVWFNEVDRFTSRDQISFAIARDKIREKVDWSINMFLDCERRNFVKQVYHRDVL  486



>ref|NP_175712.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974013.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAF01187.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32882.1| uncharacterized protein AT1G53040 [Arabidopsis thaliana]
 gb|AEE32883.1| uncharacterized protein AT1G53040 [Arabidopsis thaliana]
Length=540

 Score =   501 bits (1290),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 271/478 (57%), Positives = 333/478 (70%), Gaps = 27/478 (6%)
 Frame = +3

Query  678   FAARKKVGLLLLCAVSAAVFVWVLYVGKGEDA-----RGPEIPTISISATMKDREY-SIE  839
             +  R++V +LLL +++  VFV   Y    E       +  E      + T   RE  S  
Sbjct  20    YLGRRRVAMLLLLSLAFVVFVLGSYTINKESNSPNIHQSIETMDFGSNQTPISRELTSFY  79

Query  840   PEEKNNIHKTLLAKPNNNRGIASTD----QPPP-LPRVYFTGYTLPPGNPCEGFTLPPPP  1004
              +E +N H   +  P    GI  +D     PPP LP  +         +PC+ F+ PPPP
Sbjct  80    TKESDNDH---VRDPFLWNGIGGSDVDVNHPPPFLPSWHH--------HPCDSFSFPPPP  128

Query  1005  ADKKRTGPRP-CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgfg--  1172
                 R      CPVCYLP EEA+A MP  P  SP+L  L YI EE+  + E    G    
Sbjct  129   PPGMRRPGPRPCPVCYLPPEEALAHMPKYPFESPLLKNLTYIREESPVKPEESEGGSEFG  188

Query  1173  gYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFG  1352
             GYPSL  R  S+DI+ESM+VHCGF+KG KPG  T FDID+  L E++    V+VASAIFG
Sbjct  189   GYPSLEHRTNSFDIKESMTVHCGFIKGTKPGHQTGFDIDEDILHELDQSHDVIVASAIFG  248

Query  1353  AFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPYT  1529
              +D+I +P NISE AR+N+ FYMFVDE T  +L+N+    + + R+GLWRI+VVH++PYT
Sbjct  249   KYDIIQEPVNISEMARKNIPFYMFVDEETHLYLKNTSSYTDDNKRVGLWRIIVVHNVPYT  308

Query  1530  DARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRF  1709
             DARRNGK+PKLLLHRLFPN RYS+W+D KL+LVVDPYQILERFLWR N+SFAISRHY+RF
Sbjct  309   DARRNGKVPKLLLHRLFPNVRYSIWVDAKLQLVVDPYQILERFLWRTNSSFAISRHYRRF  368

Query  1710  DVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPIS  1889
             DVF EAEANKAA K+DNASID+QVEFYKKEGLTP++ AK PITSDVPEGC IIREHIPI+
Sbjct  369   DVFVEAEANKAARKYDNASIDYQVEFYKKEGLTPYTEAKLPITSDVPEGCTIIREHIPIT  428

Query  1890  NLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             NLFTC+WFNEVDRFT RDQ+SF+  RDKIR + +W++ MFLDCERRNFV Q YHRD+L
Sbjct  429   NLFTCVWFNEVDRFTSRDQLSFAIARDKIREKVDWSINMFLDCERRNFVKQVYHRDVL  486



>ref|XP_010479837.1| PREDICTED: uncharacterized protein LOC104758641 [Camelina sativa]
 ref|XP_010479838.1| PREDICTED: uncharacterized protein LOC104758641 [Camelina sativa]
Length=542

 Score =   499 bits (1286),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 273/476 (57%), Positives = 330/476 (69%), Gaps = 23/476 (5%)
 Frame = +3

Query  678   FAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPT------ISISATMKDREY-SI  836
             +  R++V +LLL +++  VFV   Y    E +  P I           S T   RE  S 
Sbjct  20    YLGRRRVAMLLLLSLAFVVFVLGSYTINKE-SNSPNIHQSIQTMDFGSSQTPVSRELTSF  78

Query  837   EPEEKNNIH--KTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPAD  1010
               E  NN H   + +    N  G +  D   P P +  T +     +PC+ F+ PPPP  
Sbjct  79    YTENSNNDHIRDSFMW---NGLGGSDVDVNHPPPSLLSTHH-----HPCDSFSFPPPPPP  130

Query  1011  KKRTGPRP-CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgfg--gY  1178
               R      CPVCYLP EEA+A MP  P  SPVL  L YI +E   ++E G  G    GY
Sbjct  131   GMRRPGPRPCPVCYLPPEEALAHMPKLPFESPVLKNLTYIRDENPVKHEEGQGGSDFGGY  190

Query  1179  PSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAF  1358
             PSL  R  S+DI+ESM+VHCGFV G KPG  T FDID+  L E++    V+VASAIFG +
Sbjct  191   PSLEDRTNSFDIKESMTVHCGFVNGTKPGHQTGFDIDEDILHELDQFHDVIVASAIFGKY  250

Query  1359  DLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSS-RIGLWRIVVVHDLPYTDA  1535
             DLI +P NISE AR N+ FYMFVDE T  +L+N+      + R+GLWRI+VVH++PYTDA
Sbjct  251   DLIQEPVNISEMARTNIPFYMFVDEETHLYLKNTSSYTEDNKRVGLWRIIVVHNVPYTDA  310

Query  1536  RRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDV  1715
             RRNGK+PKLLLHRLFPN RYS+W+D KL+LVVDPYQILERFLWR N+SFAISRHY+RFDV
Sbjct  311   RRNGKVPKLLLHRLFPNVRYSIWVDAKLQLVVDPYQILERFLWRTNSSFAISRHYRRFDV  370

Query  1716  FEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNL  1895
             F EAEANKAA K+DNASID+Q+EFYKKEGLTP++ AK PITSDVPEGC IIREHIPI+NL
Sbjct  371   FVEAEANKAARKYDNASIDYQIEFYKKEGLTPYTEAKLPITSDVPEGCTIIREHIPITNL  430

Query  1896  FTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             FTC+WFNEVDRFT RDQISF+  RDKIR + +W++ MFLDCERRNFV Q YHRD+L
Sbjct  431   FTCVWFNEVDRFTSRDQISFAIARDKIREKVDWSINMFLDCERRNFVKQVYHRDVL  486



>ref|XP_011029487.1| PREDICTED: uncharacterized protein LOC105129212 [Populus euphratica]
Length=564

 Score =   499 bits (1285),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 247/371 (67%), Positives = 303/371 (82%), Gaps = 13/371 (4%)
 Frame = +3

Query  966   GNPCEGFTLPPPP-ADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-  1136
             G+PC+ F+LPPPP +  +R GPRPCPVCY+  E+A A MP + S SPVL+ L Y+ +E  
Sbjct  148   GHPCDKFSLPPPPPSGGRRIGPRPCPVCYISAEQARASMPCSSSASPVLHNLTYVVDENP  207

Query  1137  LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEA  1316
             +     GGS FGGYPSL+QR++S+D+RESM+VHCGFVKG +PG  T FDID+ DL ++E 
Sbjct  208   VKTESHGGSDFGGYPSLKQRNDSFDVRESMTVHCGFVKGNRPGFQTGFDIDEADLMKLED  267

Query  1317  CEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLW  1496
                V+VASAIFG +D+I QP+NISE AR+NV FYMFVD+ TE +L+NS  L+S+ RIGLW
Sbjct  268   SHEVIVASAIFGNYDIIQQPQNISEAARKNVPFYMFVDKETEMYLKNSSALDSNMRIGLW  327

Query  1497  RIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNA  1676
             R V +  +          +PKLLLHRL PN RYS+WIDGKL+LVVDPYQ+LERFLW++NA
Sbjct  328   RFVCICLV----------VPKLLLHRLLPNVRYSIWIDGKLQLVVDPYQVLERFLWQQNA  377

Query  1677  SFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEG  1856
             SFAISRHY RFDVFEEAEANKAAGK DN+SID+Q+EFYKKEGL+P+S AK PITSDVPEG
Sbjct  378   SFAISRHYHRFDVFEEAEANKAAGKSDNSSIDYQIEFYKKEGLSPYSKAKLPITSDVPEG  437

Query  1857  CVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFV  2036
             CVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVRDKI ++ +W++ MFLDCERRNFV
Sbjct  438   CVIIREHIPITNLFTCLWFNEVDRFTARDQLSFSTVRDKIMAKVDWSINMFLDCERRNFV  497

Query  2037  VQGYHRDILEH  2069
             +Q YH+D+L+ 
Sbjct  498   IQAYHKDLLDQ  508



>ref|XP_002894423.1| hypothetical protein ARALYDRAFT_892330 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70682.1| hypothetical protein ARALYDRAFT_892330 [Arabidopsis lyrata subsp. 
lyrata]
Length=537

 Score =   498 bits (1282),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 271/473 (57%), Positives = 332/473 (70%), Gaps = 21/473 (4%)
 Frame = +3

Query  678   FAARKKVGLLLLCAVSAAVFVWVLYVGKGEDA-----RGPEIPTISISATMKDREY-SIE  839
             +  R++V +LLL +++  VFV   Y    E       +  E      + T   RE  S  
Sbjct  20    YLGRRRVAMLLLLSLAFVVFVLGSYTINKESNSPNIHQSIETMDFGSNQTPISRELTSFY  79

Query  840   PEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKR  1019
              +  +N H     K N   G +  D   P P  +         +PC+ F+ PPPP  + R
Sbjct  80    TQNSDNDHIRDSFKWNGIGG-SDVDVNHPSPSHH---------HPCDSFSFPPPPPPEMR  129

Query  1020  TGPRP-CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLse--nefggsgfggYPSL  1187
                   CPVCYLP EEA+A MP     SPVL  L YIHEE+  +     GGS FGGYPSL
Sbjct  130   RPGPRPCPVCYLPPEEALAHMPKYRFESPVLKNLTYIHEESPVKPEESQGGSDFGGYPSL  189

Query  1188  RQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLI  1367
               R  S+DI+ESM+VHCGF+KG KPG  T FDID+  L E++    V+VASAIFG +D+I
Sbjct  190   EHRANSFDIKESMTVHCGFIKGTKPGHQTGFDIDEDILHELDQSHDVIVASAIFGKYDII  249

Query  1368  HQPKNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPYTDARRN  1544
              +P NISE AR+N+ FYMFVDE T  +L+N+    + + R+GLWRI+VVH++PY+DARRN
Sbjct  250   QEPVNISEMARKNIPFYMFVDEETHLYLKNTSSYTDDNKRVGLWRIIVVHNVPYSDARRN  309

Query  1545  GKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEE  1724
             GK+PKLLLHRLFPN RYS+W+D KL+LVVDPYQILERFLWR N+SFAISRHY+RFDVF E
Sbjct  310   GKVPKLLLHRLFPNVRYSIWVDAKLQLVVDPYQILERFLWRTNSSFAISRHYRRFDVFVE  369

Query  1725  AEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTC  1904
             AEANKAA K+DNASID+QVEFYKKEGLTP++ AK PITSDVPEGC IIREHIPI+NLFTC
Sbjct  370   AEANKAARKYDNASIDYQVEFYKKEGLTPYTEAKLPITSDVPEGCTIIREHIPITNLFTC  429

Query  1905  LWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             +WFNEVDRFT RDQ+SF+  RDKIR + +W++ MFLDCERRNFV Q YHRDIL
Sbjct  430   VWFNEVDRFTSRDQLSFAIARDKIREKVDWSINMFLDCERRNFVKQVYHRDIL  482



>ref|XP_010462161.1| PREDICTED: uncharacterized protein LOC104742807 [Camelina sativa]
 ref|XP_010462162.1| PREDICTED: uncharacterized protein LOC104742807 [Camelina sativa]
Length=541

 Score =   498 bits (1282),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 265/479 (55%), Positives = 326/479 (68%), Gaps = 29/479 (6%)
 Frame = +3

Query  678   FAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMKD---------RE-  827
             +  R++V +LLL +++  VFV   Y    E       P I  S    D         RE 
Sbjct  20    YLGRRRVAMLLLLSLAFVVFVLGSYTINKESNS----PNIHQSIQTMDFGSNQTPVSREL  75

Query  828   --YSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPP  1001
               +  E  + ++I  + +        +     PP LP  +         +PC+ F+ PPP
Sbjct  76    TSFYTENSKNDHIRDSFMWNGIGGSDVDVNHPPPSLPSTHH--------HPCDSFSFPPP  127

Query  1002  PADKKRTGPRP-CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgfg-  1172
             P    R      CPVCYLP EEA+A MP  P  SPVL  L +I +E   ++E    G   
Sbjct  128   PPPGMRRPGPRPCPVCYLPPEEALAHMPKLPFESPVLKNLTFIRDENPVKHEESQGGSDF  187

Query  1173  -gYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIF  1349
              GYPSL  R  S+DI+ESM+VHCGFV G KPG  T FDID+  L E++    V+VASAIF
Sbjct  188   GGYPSLEDRTNSFDIKESMTVHCGFVNGTKPGHQTGFDIDEDILHELDQFHDVIVASAIF  247

Query  1350  GAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSS-RIGLWRIVVVHDLPY  1526
             G +D+I +P NISE AR N+ FYMFVDE T  +L+N+      + R+GLWRI+VVH++PY
Sbjct  248   GKYDIIQEPVNISEMARTNIPFYMFVDEETHLYLKNTSSYTEDNKRVGLWRIIVVHNVPY  307

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
             TDARRNGK+PKLLLHRLFPN RYS+W+D KL+LVVDPYQILERFLWR N+SFAISRHY+R
Sbjct  308   TDARRNGKVPKLLLHRLFPNVRYSIWVDAKLQLVVDPYQILERFLWRTNSSFAISRHYRR  367

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPI  1886
             FDVF EAEANKAA K+DNASID+Q+EFYKKEGLTP++ AK PITSDVPEGC IIREHIPI
Sbjct  368   FDVFVEAEANKAARKYDNASIDYQIEFYKKEGLTPYTEAKLPITSDVPEGCTIIREHIPI  427

Query  1887  SNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             +NLFTC+WFNEVDRFT RDQISF+  RDKIR + +W++ MFLDCERRNFV Q YHRD+L
Sbjct  428   TNLFTCVWFNEVDRFTSRDQISFAIARDKIREKVDWSINMFLDCERRNFVKQVYHRDVL  486



>ref|XP_006307191.1| hypothetical protein CARUB_v10008783mg [Capsella rubella]
 gb|EOA40089.1| hypothetical protein CARUB_v10008783mg [Capsella rubella]
Length=543

 Score =   498 bits (1281),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 263/477 (55%), Positives = 329/477 (69%), Gaps = 24/477 (5%)
 Frame = +3

Query  678   FAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPT------ISISATMKDRE----  827
             +  R++V +LLL +++  VFV   Y    E +  P I           + T   RE    
Sbjct  20    YLGRRRVAMLLLLSLAFVVFVLGSYTINKE-SNSPNIHQSIGTMDFGSNQTPVSRELTSF  78

Query  828   YSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPA  1007
             Y+    + ++I  + L        + +   PP LP  +         +PC+ F+ PPPP 
Sbjct  79    YTKTSNDDDHIRDSFLWNGIGGSDVDANHPPPSLPSSHH--------HPCDSFSFPPPPP  130

Query  1008  DKKRTGPRP-CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgfg--g  1175
                R      CPVCYLP EEA+A MP  P  SPVL  L YIH+E   + E    G    G
Sbjct  131   PGMRRPGPRPCPVCYLPPEEALAHMPKLPFESPVLKNLTYIHDENPVKREESQGGSDFGG  190

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             YPSL  R  S+DI+ESM+VHCGFVKG KPG  T FDI++  L E++    V+VASAIFG 
Sbjct  191   YPSLEHRTNSFDIKESMTVHCGFVKGTKPGHQTGFDIEEDILHELDQFHDVIVASAIFGK  250

Query  1356  FDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGD-LNSSSRIGLWRIVVVHDLPYTD  1532
             +D+I +P NISE AR+N+ FYMFVDE T  +L+N+    + + R+GLWRI+VVH++PYTD
Sbjct  251   YDIIQEPVNISEIARKNIPFYMFVDEETHLYLKNTSSYTDDNKRVGLWRIIVVHNVPYTD  310

Query  1533  ARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFD  1712
             ARRNGKIPKLLLHRL PN RYS+W+D KL+LVVDPYQILERFLWR N+S AISRHY+RFD
Sbjct  311   ARRNGKIPKLLLHRLVPNVRYSIWVDAKLQLVVDPYQILERFLWRTNSSIAISRHYRRFD  370

Query  1713  VFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISN  1892
             VF EAEANKAA K+DNASID+Q+EFYKKEGLTP++ AK PITSDVPEGC IIREHIPI+N
Sbjct  371   VFVEAEANKAARKYDNASIDYQIEFYKKEGLTPYTEAKLPITSDVPEGCTIIREHIPITN  430

Query  1893  LFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             LFTC+WFNEVDRFT RDQ+SF+  R+KI+ + +W++ MFLDCERRNFV Q YHRD+L
Sbjct  431   LFTCVWFNEVDRFTSRDQLSFAIARNKIKEKVDWSINMFLDCERRNFVKQVYHRDVL  487



>ref|XP_009107009.1| PREDICTED: uncharacterized protein LOC103832699 [Brassica rapa]
Length=533

 Score =   496 bits (1276),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 263/468 (56%), Positives = 327/468 (70%), Gaps = 16/468 (3%)
 Frame = +3

Query  678   FAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNN  857
             +  R++V +LLL +++  VFV   Y    E +  P     +I  +++  E+ I     + 
Sbjct  20    YLGRRRVAMLLLLSLAFVVFVLGSYTINKESSNSP-----NIHQSIETIEFGINQTPLSR  74

Query  858   IHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRP-  1034
                +     +NN     +D       +     +LP  +PC+ F+ PPPP    R      
Sbjct  75    ELSSFYTGDSNNDQTRGSDVD-----IIHPPPSLPSHHPCDSFSFPPPPPPGLRRPGPRP  129

Query  1035  CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgfgg---YPSLRQRDE  1202
             CPVCYL  EEA+A MP  P  SPVL  L YI EE+  + E  G G      YPSL  R  
Sbjct  130   CPVCYLSPEEALAHMPKHPFESPVLKNLTYIREESPLKREEEGQGGSEFGGYPSLEDRTN  189

Query  1203  SYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKN  1382
             S+DI+ESM+VHCGFVKG KPG  T FDID+  L EM+    V+VASAIFG +DLI +P N
Sbjct  190   SFDIKESMTVHCGFVKGTKPGHQTGFDIDEDILHEMDQFHEVIVASAIFGKYDLIQEPVN  249

Query  1383  ISEYARENVCFYMFVDEGTEAFLRNSGDLNSSS-RIGLWRIVVVHDLPYTDARRNGKIPK  1559
             ISE AR+N+ FYMFVDE T ++L+N+      S R+GLWRI+V H++PYTDARRNGKIPK
Sbjct  250   ISEMARKNIPFYMFVDEETHSYLKNTSSYTEDSKRVGLWRIIVAHNVPYTDARRNGKIPK  309

Query  1560  LLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANK  1739
             LLLHRLFPN +YS+W+D KL+LVVDPYQILERFLWR N+S AIS+HY+RFDVF EAEANK
Sbjct  310   LLLHRLFPNVKYSIWVDAKLQLVVDPYQILERFLWRTNSSLAISKHYRRFDVFVEAEANK  369

Query  1740  AAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNE  1919
             AA K+DNASID+QVEFYKKEGLTP++ AK PITSDVPEGC IIREHIPI+NLFTC+WFNE
Sbjct  370   AARKYDNASIDYQVEFYKKEGLTPYTDAKLPITSDVPEGCTIIREHIPITNLFTCVWFNE  429

Query  1920  VDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             VDRFT RDQ+SF+  RD+IR + +W++ MFLDCERRNFV Q YHRD+L
Sbjct  430   VDRFTSRDQLSFAVARDRIREKVDWSINMFLDCERRNFVKQVYHRDVL  477



>gb|AAF87865.1|AC022520_9 Unknown protein [Arabidopsis thaliana]
Length=500

 Score =   493 bits (1268),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 236/347 (68%), Positives = 281/347 (81%), Gaps = 4/347 (1%)
 Frame = +3

Query  1035  CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgfg--gYPSLRQRDES  1205
             CPVCYLP EEA+A MP  P  SP+L  L YI EE+  + E    G    GYPSL  R  S
Sbjct  100   CPVCYLPPEEALAHMPKYPFESPLLKNLTYIREESPVKPEESEGGSEFGGYPSLEHRTNS  159

Query  1206  YDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNI  1385
             +DI+ESM+VHCGF+KG KPG  T FDID+  L E++    V+VASAIFG +D+I +P NI
Sbjct  160   FDIKESMTVHCGFIKGTKPGHQTGFDIDEDILHELDQSHDVIVASAIFGKYDIIQEPVNI  219

Query  1386  SEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPYTDARRNGKIPKL  1562
             SE AR+N+ FYMFVDE T  +L+N+    + + R+GLWRI+VVH++PYTDARRNGK+PKL
Sbjct  220   SEMARKNIPFYMFVDEETHLYLKNTSSYTDDNKRVGLWRIIVVHNVPYTDARRNGKVPKL  279

Query  1563  LLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKA  1742
             LLHRLFPN RYS+W+D KL+LVVDPYQILERFLWR N+SFAISRHY+RFDVF EAEANKA
Sbjct  280   LLHRLFPNVRYSIWVDAKLQLVVDPYQILERFLWRTNSSFAISRHYRRFDVFVEAEANKA  339

Query  1743  AGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEV  1922
             A K+DNASID+QVEFYKKEGLTP++ AK PITSDVPEGC IIREHIPI+NLFTC+WFNEV
Sbjct  340   ARKYDNASIDYQVEFYKKEGLTPYTEAKLPITSDVPEGCTIIREHIPITNLFTCVWFNEV  399

Query  1923  DRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             DRFT RDQ+SF+  RDKIR + +W++ MFLDCERRNFV Q YHRD+L
Sbjct  400   DRFTSRDQLSFAIARDKIREKVDWSINMFLDCERRNFVKQVYHRDVL  446



>ref|XP_002967726.1| hypothetical protein SELMODRAFT_169494 [Selaginella moellendorffii]
 gb|EFJ31073.1| hypothetical protein SELMODRAFT_169494 [Selaginella moellendorffii]
Length=360

 Score =   486 bits (1252),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 230/354 (65%), Positives = 282/354 (80%), Gaps = 3/354 (1%)
 Frame = +3

Query  990   LPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY--LNYIHEETLsenefggs  1163
             +PPPPADKKRTGPRPCPVCYLPVEEA  L P +  F  ++   L Y+ E+T +     GS
Sbjct  1     MPPPPADKKRTGPRPCPVCYLPVEEAKKLYPPSGVFPSLIVQNLTYVREDTSTAATSPGS  60

Query  1164  gfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASA  1343
              FGG+P+L  R  S+ I ESM ++CGF +G+KPG  + FDID+ DL +ME C G+VV SA
Sbjct  61    AFGGHPTLEDRKRSHKIEESMHLYCGFARGIKPGVGSGFDIDESDLYDMEKCHGIVVISA  120

Query  1344  IFGAFDLIHQPKNISEYARENVCFYMFVDEGTEA-FLRNSGDLNSSSRIGLWRIVVVHDL  1520
             IFG +D + QPK+ISE++++NVCF+MFVDE T+A  ++  G  + + ++GLWR+V VH++
Sbjct  121   IFGNYDPLQQPKHISEHSKKNVCFFMFVDEETQAAIIKRGGSYSRTKKVGLWRVVTVHNI  180

Query  1521  PYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHY  1700
             PY D RR GKIPKLL HRLFPNAR+SLWIDGKLELVVDPYQILERFLWR + +FAIS+HY
Sbjct  181   PYLDPRRTGKIPKLLSHRLFPNARFSLWIDGKLELVVDPYQILERFLWRTHDTFAISKHY  240

Query  1701  KRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHI  1880
             KRFDVF EAEANKAA K++NASID QV FY+KEGL P++ AK PI SDVPEGCVI+REH 
Sbjct  241   KRFDVFTEAEANKAARKYNNASIDAQVNFYRKEGLVPYTTAKLPIVSDVPEGCVIVREHT  300

Query  1881  PISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQ  2042
             P++NLFTCLWFNEVDRFT RDQISF  VRDKI ++  W + MFLDC+RRNFVVQ
Sbjct  301   PLTNLFTCLWFNEVDRFTSRDQISFGIVRDKIMAQVPWRINMFLDCQRRNFVVQ  354



>ref|XP_010542285.1| PREDICTED: uncharacterized protein LOC104815554 isoform X1 [Tarenaya 
hassleriana]
Length=561

 Score =   494 bits (1271),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 240/348 (69%), Positives = 286/348 (82%), Gaps = 5/348 (1%)
 Frame = +3

Query  1035  CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET---LsenefggsgfggYPSLRQRDE  1202
             CPVCYLP +EA A MP  PS SPVL  L YI +E+   L     G S FGG+PSL QR++
Sbjct  160   CPVCYLPPDEAFARMPKYPSESPVLKNLTYIRDESILKLEGQGQGSSEFGGFPSLEQRND  219

Query  1203  SYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKN  1382
             S++IRESM+VHCGFVKG KPG  T F+ID+  L E+E    V+VASA+FG +D+I +P+N
Sbjct  220   SFNIRESMAVHCGFVKGKKPGIQTLFNIDEDILDELEQFHDVIVASAVFGKYDIIQEPRN  279

Query  1383  ISEYARENVCFYMFVDEGTEAFLRNS-GDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPK  1559
             ISE A++N+ FYMFVDE TEA+LRN+    N + R+GLWRI+VVH +PY DARRNGK+PK
Sbjct  280   ISEVAKKNIPFYMFVDEVTEAYLRNTTAYTNDNKRVGLWRIIVVHSVPYDDARRNGKVPK  339

Query  1560  LLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANK  1739
             LLLHRLFPN RYS+WID KL+LVVDPYQILERFLWR N+SFAISRHY+RFD +EE EANK
Sbjct  340   LLLHRLFPNVRYSIWIDAKLQLVVDPYQILERFLWRVNSSFAISRHYRRFDAYEEGEANK  399

Query  1740  AAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNE  1919
             AA K+DN +ID+Q+EFYKKEGLTP+S AK PITSDVPEGC IIREHIPI+NLFTC+WFNE
Sbjct  400   AARKYDNETIDYQMEFYKKEGLTPYSEAKLPITSDVPEGCTIIREHIPITNLFTCVWFNE  459

Query  1920  VDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             V RFT RDQ+SF+ VRDKIR+R +W++ MFLDCERRNFV Q YHRDIL
Sbjct  460   VARFTSRDQLSFAIVRDKIRARVHWSINMFLDCERRNFVKQVYHRDIL  507



>emb|CDY02526.1| BnaA08g01330D [Brassica napus]
Length=533

 Score =   492 bits (1267),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 262/468 (56%), Positives = 329/468 (70%), Gaps = 16/468 (3%)
 Frame = +3

Query  678   FAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMKDREYSI-EPEEKN  854
             +  R++V +LLL +++  VFV   Y    E +  P     +I  +++  E+ I +     
Sbjct  20    YLGRRRVAMLLLLSLAFVVFVLGSYTINKESSNSP-----NIHQSIETIEFGINQTPLSR  74

Query  855   NIHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRP  1034
              +        NN++    +D       +     +LP  +PC+ F+ PPPP    R     
Sbjct  75    ELSSFYTGDSNNDQTTRGSDVD-----IIHPPPSLPSHHPCDSFSFPPPPPPGLRRPGPR  129

Query  1035  -CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgfg--gYPSLRQRDE  1202
              CPVCYL  EEA+  MP     SPVL  L +IHEE+  ++E G  G    GYPSL  R  
Sbjct  130   PCPVCYLSPEEALVHMPKHQFESPVLKNLTFIHEESPVKHEEGQGGSEFGGYPSLEDRTN  189

Query  1203  SYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKN  1382
             S+DI+ESM+VHCGFVKG KPG  T FDID+  L EM+    V+VASAIFG +DLI +P N
Sbjct  190   SFDIKESMTVHCGFVKGTKPGHQTGFDIDEDILHEMDQFHEVIVASAIFGKYDLIQEPVN  249

Query  1383  ISEYARENVCFYMFVDEGTEAFLRNSGDLNSSS-RIGLWRIVVVHDLPYTDARRNGKIPK  1559
             ISE AR+N+ FYMFVDE T ++L+N+      S R+GLWRI+V H++PYTDARRNGKIPK
Sbjct  250   ISEMARKNIPFYMFVDEETHSYLKNTSSYTEDSKRVGLWRIIVAHNVPYTDARRNGKIPK  309

Query  1560  LLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANK  1739
             LLLHRLFPN +YS+W+D KL+LVVDPYQILERFLWR N+S AIS+HY+RFDVF EAEANK
Sbjct  310   LLLHRLFPNVKYSIWVDAKLQLVVDPYQILERFLWRTNSSLAISKHYRRFDVFVEAEANK  369

Query  1740  AAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNE  1919
             AA K+DNASID+QVEFYKKEGLTP++ AK PITSDVPEGC IIREHIPI+NLFTC+WFNE
Sbjct  370   AARKYDNASIDYQVEFYKKEGLTPYTDAKLPITSDVPEGCTIIREHIPITNLFTCVWFNE  429

Query  1920  VDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             VDRFT RDQ+SF+  RD+IR + +W++ MFLDCERRNFV Q YHRD+L
Sbjct  430   VDRFTSRDQLSFAVARDRIREKVDWSINMFLDCERRNFVKQVYHRDVL  477



>ref|XP_006392838.1| hypothetical protein EUTSA_v10011374mg [Eutrema salsugineum]
 gb|ESQ30124.1| hypothetical protein EUTSA_v10011374mg [Eutrema salsugineum]
Length=539

 Score =   492 bits (1267),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 270/477 (57%), Positives = 331/477 (69%), Gaps = 27/477 (6%)
 Frame = +3

Query  678   FAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMKDREYSIEP--EEK  851
             +  R++V +LLL +++  VFV   Y    E       P I  S    D   +  P   E 
Sbjct  20    YLGRRRVAMLLLLSLAFVVFVLGSYTINKESNS----PNIHQSIETMDFGSNQTPISREL  75

Query  852   NNIHKTLLAKPNNNR--------GIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPA  1007
              + H       NN+         GI  +D       +     +LP  +PC+GF+ PPPP 
Sbjct  76    TSFHT---GNSNNDHIRDSFMWNGIRGSDVD-----IIHPPPSLPSHHPCDGFSFPPPPP  127

Query  1008  DKKRTGPRP-CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgfg--g  1175
                R      CPVCYL  EEA+A MP  P  SPVL  L+YIH+E+  + E    G    G
Sbjct  128   PGLRRPGPRPCPVCYLSPEEALAHMPKHPFESPVLKNLSYIHDESPVKREESQGGSEFGG  187

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             YPSL  R  S+DI+ESM+VHCGFVKG KPG  T FDID+  L E++    V+VASAIFG 
Sbjct  188   YPSLEHRTNSFDIKESMAVHCGFVKGTKPGHHTGFDIDEDILPELDQFHDVIVASAIFGK  247

Query  1356  FDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPYTD  1532
             +D+I +P NISE AR+N+ FYMFVDE T  +L+N+    + + R+GLWRI+VVH++PYTD
Sbjct  248   YDIIQEPVNISEMARKNIPFYMFVDEETHLYLKNTSSYTDDNKRVGLWRIIVVHNVPYTD  307

Query  1533  ARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFD  1712
             ARRNGKIPKLLLHRLF N RYS+W+D KL+LVVDPYQILERFLWR N+SFAISRHY+RFD
Sbjct  308   ARRNGKIPKLLLHRLFLNVRYSVWVDAKLQLVVDPYQILERFLWRTNSSFAISRHYRRFD  367

Query  1713  VFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISN  1892
             V+EEAEANKAA K+DNASID+Q+EFYKKEGLTP++ AK PITSDVPEGC IIREHIPI+N
Sbjct  368   VYEEAEANKAARKYDNASIDYQIEFYKKEGLTPYTEAKLPITSDVPEGCTIIREHIPITN  427

Query  1893  LFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             LFTC+WFNEVDRFT RDQ+SF+  RDKIR + +W++ MFLDCERRNFV Q YHRDIL
Sbjct  428   LFTCVWFNEVDRFTSRDQLSFAIARDKIREKVDWSINMFLDCERRNFVKQVYHRDIL  484



>gb|KHG13812.1| Serine/threonine-protein kinase SIK3 [Gossypium arboreum]
Length=576

 Score =   493 bits (1269),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 272/497 (55%), Positives = 349/497 (70%), Gaps = 32/497 (6%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIF-KFAARKKVGLLLLCAVSAAVFVW----------VLYVGKGED  770
             K    F+EKE     ++ +    +K+ +LLL A +  VFV            L V +   
Sbjct  44    KMFSGFREKERSLPSVWCRCLGCRKISMLLLIAFALLVFVLGSLAVDKETISLNVDQQIG  103

Query  771   ARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTDQPPPLPRVYFTG  950
                  +P ++ + +     +    ++K N    L+A       I + D+      V   G
Sbjct  104   TLSMVLPYVNGAPSNPGASWIFGKKDKQNDENYLVAN------ILNEDEENRFRIVGSKG  157

Query  951   -YTLPPGNPCEGFTLPPPPA-DKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNY  1121
                LP  +PC  FT PPPP  + +R GPRPCPVCYLPV++AIA MP++PS SPVL  L Y
Sbjct  158   AIVLPSNHPCTKFTFPPPPPPNLRRIGPRPCPVCYLPVDQAIASMPSSPSASPVLQNLTY  217

Query  1122  IHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKD  1298
             +H+E  +     GGS FGGYPS++QR  S+D++ESM+VHCGFVK  KPG  T FD D+ D
Sbjct  218   VHDENPIKTEPHGGSDFGGYPSIKQRSNSFDVKESMTVHCGFVKRSKPGLQTGFDFDESD  277

Query  1299  LGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSS  1478
             L E++    ++VASAIFG +D+I QP+N+SE A++N+ FYMF+DE TEA+++N   L SS
Sbjct  278   LAELQQFHDIIVASAIFGNYDVIQQPRNVSEEAKKNIPFYMFIDEETEAYIKNKSILESS  337

Query  1479  SRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERF  1658
              R+GLWRIVVV +           +PKLLLHR+FPN RYS+WIDGKL+LVVDPYQILE+F
Sbjct  338   KRVGLWRIVVVRN-----------VPKLLLHRIFPNVRYSIWIDGKLQLVVDPYQILEKF  386

Query  1659  LWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPIT  1838
             LWR+NA+FAISRHY+RFDVF EAEANKAAGK+DN+SID QV FYK+EGLTP+S AKFPIT
Sbjct  387   LWRQNANFAISRHYRRFDVFVEAEANKAAGKYDNSSIDEQVGFYKQEGLTPYSEAKFPIT  446

Query  1839  SDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDC  2018
             SDVPEGCV+I+EHIPI+NLFTCLWFNEVDRFT RDQ+SF+ VRDKIR++ +WN+ MFLDC
Sbjct  447   SDVPEGCVLIKEHIPITNLFTCLWFNEVDRFTSRDQLSFAIVRDKIRAKVDWNINMFLDC  506

Query  2019  ERRNFVVQGYHRDILEH  2069
             ERRNFV+Q YHRD+LE 
Sbjct  507   ERRNFVIQTYHRDLLEQ  523



>ref|XP_001781072.1| predicted protein [Physcomitrella patens]
 gb|EDQ54098.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   488 bits (1255),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 240/374 (64%), Positives = 293/374 (78%), Gaps = 5/374 (1%)
 Frame = +3

Query  969   NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSF-SPVLY-LNYIHEETLs  1142
             +PC+G+T+PPPPAD KRTGPRPCPVCYL  E A++ +P    + SPVL  L+++ +   +
Sbjct  14    HPCDGYTVPPPPADPKRTGPRPCPVCYLDEEGALSQLPVEGKYDSPVLKRLSFMSDPAAA  73

Query  1143  enefggsgfgg---YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEME  1313
             +    G+       YPSL +R  S+D+RE M VHCGFVKG  PG  T +DID+++   M 
Sbjct  74    KRPSSGAPGSAFGGYPSLEERAASFDVREEMKVHCGFVKGPTPGLGTGYDIDEENREAML  133

Query  1314  ACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGL  1493
             AC GVVVASAIFG +D + QPKNI++ ++ +VCF+MFVDE TEA L +  +  SS ++GL
Sbjct  134   ACRGVVVASAIFGNYDQLQQPKNITDESKRSVCFFMFVDEETEASLNDYDNFKSSKQVGL  193

Query  1494  WRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRN  1673
             WR+VVVH+LPY DARR GKIPKLLLHRLFPN R+S+W+DGKLELV DPY+ILERFLWR N
Sbjct  194   WRVVVVHNLPYRDARRTGKIPKLLLHRLFPNVRFSIWVDGKLELVQDPYKILERFLWRTN  253

Query  1674  ASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPE  1853
              +FAIS+HYKRFDVF EAEANKAA K++N SID Q++FYKKEGLTP+SAAK PITSDVPE
Sbjct  254   ETFAISQHYKRFDVFMEAEANKAAAKYNNKSIDSQIDFYKKEGLTPYSAAKLPITSDVPE  313

Query  1854  GCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNF  2033
             GCVIIREH PI+NL +CLWFNEVDRFT RDQ+SF  VRDK+ +   W V MF DCERRNF
Sbjct  314   GCVIIREHTPIANLMSCLWFNEVDRFTSRDQLSFGIVRDKLMAAVPWRVSMFKDCERRNF  373

Query  2034  VVQGYHRDILEHRA  2075
             VVQGYHRD+L  R 
Sbjct  374   VVQGYHRDLLVKRG  387



>ref|XP_003539597.1| PREDICTED: uncharacterized protein LOC100810918 isoform X1 [Glycine 
max]
Length=583

 Score =   493 bits (1268),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 280/516 (54%), Positives = 368/516 (71%), Gaps = 24/516 (5%)
 Frame = +3

Query  582   QHHFLSSSFPIPPRKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVW--  743
             Q +   S  P+  R+P KT     +EKE  F    +   R KV +LL+ A+   VFV+  
Sbjct  17    QQNGTVSPKPMLVRRPSKTLLYNPREKERGFFFFCRLLGRGKVAMLLMLALGLCVFVFGC  76

Query  744   -VLYVGKGEDARGPEIPTISISAT--MKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTD  914
               +Y G   ++   +  + +I+    +K R   IE + +++    + +  + +R   ST 
Sbjct  77    FTVYRGGNINSEIEDTRSYAITRYEFLKPRGV-IEDKSEDSNSSRVFSLTSRHR---STA  132

Query  915   QPPPLPR-------VYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCP-VCYLPVEEAI  1070
             +PPP P            GY    G+ C+ F  PPPP   +R        VCY+PVE+AI
Sbjct  133   RPPPAPNSLSLSKPTRKKGYFPTWGHRCDHFAFPPPPPADRRRPGPRPCPVCYIPVEQAI  192

Query  1071  ALMPTAPSFSPVL-YLNYIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGF  1244
             A MP++PS SP+L  L Y+H+E  +     GGS FGGYPSL +RD +++I+E+M VHCGF
Sbjct  193   ASMPSSPSESPILRTLTYVHDENPIESEPHGGSDFGGYPSLEERDAAFNIKETMKVHCGF  252

Query  1245  VKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMF  1424
             VKG +PGR T FD D+ DL E++    V+VASAIFG +D+I QP+NIS  A++N+ FYMF
Sbjct  253   VKGSRPGRQTGFDFDEADLLELDQYHDVIVASAIFGNYDVIQQPRNISSEAKKNIPFYMF  312

Query  1425  VDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLW  1604
             +DE TE +++N+  L+SS R+GLWRI++V ++PY D+RRNGK+PKLLLHR+FPN RYS+W
Sbjct  313   IDEETEMYMKNASILSSSRRVGLWRIIIVRNIPYADSRRNGKVPKLLLHRIFPNVRYSIW  372

Query  1605  IDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVE  1784
             IDGKLELVVDPYQ+LERFLWR+NA+FAISRHY+RFDVF EAEANKAAGK++NASID Q++
Sbjct  373   IDGKLELVVDPYQVLERFLWRQNATFAISRHYRRFDVFVEAEANKAAGKYENASIDHQIQ  432

Query  1785  FYK-KEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFST  1961
             FYK  +GLT +S AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFST
Sbjct  433   FYKYHDGLTHYSRAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFST  492

Query  1962  VRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             VRDKI ++T+W++ MF+DCERRNFV+Q YHRDILE 
Sbjct  493   VRDKIMAKTDWSINMFMDCERRNFVIQAYHRDILEQ  528



>gb|KHN28060.1| hypothetical protein glysoja_007792 [Glycine soja]
Length=583

 Score =   492 bits (1267),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 280/516 (54%), Positives = 368/516 (71%), Gaps = 24/516 (5%)
 Frame = +3

Query  582   QHHFLSSSFPIPPRKPLKTF----KEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVW--  743
             Q +   S  P+  R+P KT     +EKE  F    +   R KV +LL+ A+   VFV+  
Sbjct  17    QQNGTVSPKPMLVRRPSKTLLYNPREKERGFFFFCRLLGRGKVAMLLMLALGLCVFVFGC  76

Query  744   -VLYVGKGEDARGPEIPTISISAT--MKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTD  914
               +Y G   ++   +  + +I+    +K R   IE + +++    + +  + +R   ST 
Sbjct  77    FTVYRGGNINSEIEDTRSYAITRYEFLKPRGV-IEDKSEDSNSSRVFSLTSRHR---STA  132

Query  915   QPPPLPR-------VYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCP-VCYLPVEEAI  1070
             +PPP P            GY    G+ C+ F  PPPP   +R        VCY+PVE+AI
Sbjct  133   RPPPAPNSLSLSKPTRKKGYFPTWGHRCDHFAFPPPPPADRRRPGPRPCPVCYIPVEQAI  192

Query  1071  ALMPTAPSFSPVL-YLNYIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVHCGF  1244
             A MP++PS SP+L  L Y+H+E  +     GGS FGGYPSL +RD +++I+E+M VHCGF
Sbjct  193   ASMPSSPSESPILRTLTYVHDENPIESEPHGGSDFGGYPSLEERDAAFNIKETMKVHCGF  252

Query  1245  VKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMF  1424
             VKG +PGR T FD D+ DL E++    V+VASAIFG +D+I QP+NIS  A++N+ FYMF
Sbjct  253   VKGSRPGRQTGFDFDEADLLELDQYHDVIVASAIFGNYDVIQQPRNISSEAKKNIPFYMF  312

Query  1425  VDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLW  1604
             +DE TE +++N+  L+SS R+GLWRI++V ++PY D+RRNGK+PKLLLHR+FPN RYS+W
Sbjct  313   IDEETEMYMKNASILSSSRRVGLWRIIIVRNIPYADSRRNGKVPKLLLHRIFPNVRYSIW  372

Query  1605  IDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVE  1784
             IDGKLELVVDPYQ+LERFLWR+NA+FAISRHY+RFDVF EAEANKAAGK++NASID Q++
Sbjct  373   IDGKLELVVDPYQVLERFLWRQNATFAISRHYRRFDVFVEAEANKAAGKYENASIDHQIQ  432

Query  1785  FYK-KEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFST  1961
             FYK  +GLT +S AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFST
Sbjct  433   FYKYHDGLTHYSRAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFST  492

Query  1962  VRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             VRDKI ++T+W++ MF+DCERRNFV+Q YHRDILE 
Sbjct  493   VRDKIMAKTDWSINMFMDCERRNFVIQAYHRDILEQ  528



>emb|CDY65037.1| BnaC03g78100D [Brassica napus]
Length=533

 Score =   490 bits (1261),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 269/471 (57%), Positives = 332/471 (70%), Gaps = 22/471 (5%)
 Frame = +3

Query  678   FAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNN  857
             +  R++V +LLL +++  VFV   Y    E +  P I              SIE  E   
Sbjct  20    YLGRRRVAMLLLLSLAFVVFVLGSYTINKESSNSPNI------------HQSIETIE-FG  66

Query  858   IHKTLLAKPNNN--RGIASTDQPPPLPRV--YFTGYTLPPGNPCEGFTLPPPPADKKRTG  1025
             I++T L++  ++   G +S DQ      V       +LP  +PC+ F+ PPPP    R  
Sbjct  67    INQTPLSRELSSFYTGDSSNDQTTRGSDVDIIHPPPSLPSHHPCDSFSFPPPPPPGLRRP  126

Query  1026  PRP-CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgfg--gYPSLRQ  1193
                 CPVCYL  EEA+A MP     SP+L  L +IHEE+  + E G  G    GYPSL  
Sbjct  127   GPRPCPVCYLSPEEALAHMPKRQFESPMLKNLTFIHEESPVKREEGQGGSEFGGYPSLED  186

Query  1194  RDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQ  1373
             R  S+DI+ESM+VHCGFVKG KPG  T FDID+  L EM+    V+VASAIFG +DLI +
Sbjct  187   RTNSFDIKESMTVHCGFVKGTKPGHQTGFDIDEDILPEMDQFHEVIVASAIFGKYDLIQE  246

Query  1374  PKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSS-RIGLWRIVVVHDLPYTDARRNGK  1550
             P NISE AR+N+ FYMFVDE T ++L+N+      + RIGLWRI+V H++PYTDARRNGK
Sbjct  247   PVNISEMARKNIPFYMFVDEETHSYLKNTSSYTEDNKRIGLWRIIVAHNVPYTDARRNGK  306

Query  1551  IPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAE  1730
             IPKLLLHRLFPN +YS+W+D KL+LVVDPYQILERFLWR N+S AIS+HY+RFDVF EAE
Sbjct  307   IPKLLLHRLFPNVKYSIWVDAKLQLVVDPYQILERFLWRTNSSLAISKHYRRFDVFVEAE  366

Query  1731  ANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLW  1910
             ANKAA K+DNASID+QVEFYKKEGLTP++ AK PITSDVPEGC IIREHIPI++LFTC+W
Sbjct  367   ANKAARKYDNASIDYQVEFYKKEGLTPYTDAKLPITSDVPEGCTIIREHIPITSLFTCVW  426

Query  1911  FNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             FNEVDRFT RDQ+SF+  RDKIR + +W++ MFLDCERRNFV Q YHRD+L
Sbjct  427   FNEVDRFTSRDQLSFAVARDKIREKVDWSINMFLDCERRNFVKQVYHRDVL  477



>ref|XP_010535101.1| PREDICTED: uncharacterized protein LOC104810473 [Tarenaya hassleriana]
Length=555

 Score =   491 bits (1263),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 252/372 (68%), Positives = 300/372 (81%), Gaps = 4/372 (1%)
 Frame = +3

Query  960   PPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET  1136
             P  +PCE F+ PPPP   +R GPRPCPVCYL  EEA A MP  PS SPV+  L Y  ++T
Sbjct  125   PLRHPCESFSFPPPPPGLRRPGPRPCPVCYLSPEEAFARMPKYPSESPVVKNLTYFRDDT  184

Query  1137  Lsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEME  1313
             L + E  G    GGYPSL QR++S+D+R+SM+VHCGFVKG KPG  + FDID+  L E+E
Sbjct  185   LLKREGQGGSEFGGYPSLEQRNDSFDVRQSMAVHCGFVKGKKPGLQSGFDIDEDILDELE  244

Query  1314  ACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIG  1490
                 V+VASA+FG +D+I +P+NIS  AR+ V FYMFVDE TEA+L+N+    + + R+G
Sbjct  245   QFHDVIVASAVFGKYDIIQEPQNISGVARKKVPFYMFVDEETEAYLKNTTTYSDDNKRMG  304

Query  1491  LWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRR  1670
             LWRI+VVH++PY DARRNGK+PKLLLHRLFPN RYS+WID KL+LVVDPYQILERFLWR 
Sbjct  305   LWRIIVVHNVPYNDARRNGKVPKLLLHRLFPNVRYSIWIDAKLQLVVDPYQILERFLWRS  364

Query  1671  NASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVP  1850
             N+SFAISRHY+RFDVFEEAEANKAA K+DN SID+Q+EFYKKEGLTP+S AK PITSDVP
Sbjct  365   NSSFAISRHYRRFDVFEEAEANKAARKYDNDSIDYQIEFYKKEGLTPYSEAKLPITSDVP  424

Query  1851  EGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRT-NWNVEMFLDCERR  2027
             EGC II+EHIPI+NLFTC+WFNEVDRFT RDQ+SF+  RDKIR R  +W + MFLDCERR
Sbjct  425   EGCTIIKEHIPITNLFTCVWFNEVDRFTSRDQLSFAIARDKIRERVEDWRINMFLDCERR  484

Query  2028  NFVVQGYHRDIL  2063
             NFV Q YHRDIL
Sbjct  485   NFVKQVYHRDIL  496



>ref|XP_009147637.1| PREDICTED: uncharacterized protein LOC103871160 [Brassica rapa]
Length=530

 Score =   489 bits (1260),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 260/472 (55%), Positives = 324/472 (69%), Gaps = 28/472 (6%)
 Frame = +3

Query  678   FAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNN  857
             +  R++  +LLL +++  VF+   Y    E       P I  S    D   +  P  +  
Sbjct  20    YLGRRRFAMLLLLSLAFVVFILGSYTINKESNS----PIIHQSIETMDFVSNQTPLSRE-  74

Query  858   IHKTLLAKPNNNRGIASTD----QPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTG  1025
                +   + +N+ GI  +D     PPP              +PC+ F+ PPPP    R  
Sbjct  75    -LSSFYTENSNDDGIRGSDVDIIHPPP------------SHHPCDSFSFPPPPPPGLRRP  121

Query  1026  PRP-CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgfgg---YPSLR  1190
                 CPVCYL  EEA+A MP  P  SPVL  L Y+HEE+  + E  G G      YPSL 
Sbjct  122   GPRPCPVCYLSPEEALAHMPKHPFESPVLMNLTYVHEESPVKREEEGQGGSEFGGYPSLE  181

Query  1191  QRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIH  1370
              R  S+DI+ESM+VHCGFVKG KPG  T F+ID+  L E++    V+VASAIFG +D+I 
Sbjct  182   DRTNSFDIKESMTVHCGFVKGTKPGHQTGFEIDEDILPELDQFHDVIVASAIFGKYDIIQ  241

Query  1371  QPKNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPYTDARRNG  1547
             +P NISE AR N+ FYMF+DE T ++L+N+    + + R+GLW I+VVH++PYTDARRNG
Sbjct  242   EPVNISEMARNNIPFYMFIDEETHSYLKNTSRYSDDNKRVGLWTIIVVHNVPYTDARRNG  301

Query  1548  KIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEA  1727
             KIPKLLLHRLFPN RYS+W+D KL+LVVDPYQILERFLWR N+S A+SRHY+RFDVF EA
Sbjct  302   KIPKLLLHRLFPNVRYSIWLDAKLQLVVDPYQILERFLWRTNSSIAMSRHYRRFDVFVEA  361

Query  1728  EANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCL  1907
             EANKAA K+DNASID+QVEFYKKEGLTP++ AK PITSDVPEGC IIREHIPI+NLFTC+
Sbjct  362   EANKAARKYDNASIDYQVEFYKKEGLTPYTDAKLPITSDVPEGCTIIREHIPITNLFTCV  421

Query  1908  WFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             WFNEVDRFT RDQ+SF+  RDKIR + +W++ MFLDCERRNFV Q YHR +L
Sbjct  422   WFNEVDRFTSRDQLSFAIARDKIREKVDWSINMFLDCERRNFVKQVYHRYVL  473



>ref|XP_006592911.1| PREDICTED: uncharacterized protein LOC100810918 isoform X2 [Glycine 
max]
Length=512

 Score =   487 bits (1253),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 252/399 (63%), Positives = 315/399 (79%), Gaps = 11/399 (3%)
 Frame = +3

Query  906   STDQPPPLPR-------VYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCP-VCYLPVE  1061
             ST +PPP P            GY    G+ C+ F  PPPP   +R        VCY+PVE
Sbjct  59    STARPPPAPNSLSLSKPTRKKGYFPTWGHRCDHFAFPPPPPADRRRPGPRPCPVCYIPVE  118

Query  1062  EAIALMPTAPSFSPVL-YLNYIHEET-LsenefggsgfggYPSLRQRDESYDIRESMSVH  1235
             +AIA MP++PS SP+L  L Y+H+E  +     GGS FGGYPSL +RD +++I+E+M VH
Sbjct  119   QAIASMPSSPSESPILRTLTYVHDENPIESEPHGGSDFGGYPSLEERDAAFNIKETMKVH  178

Query  1236  CGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCF  1415
             CGFVKG +PGR T FD D+ DL E++    V+VASAIFG +D+I QP+NIS  A++N+ F
Sbjct  179   CGFVKGSRPGRQTGFDFDEADLLELDQYHDVIVASAIFGNYDVIQQPRNISSEAKKNIPF  238

Query  1416  YMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARY  1595
             YMF+DE TE +++N+  L+SS R+GLWRI++V ++PY D+RRNGK+PKLLLHR+FPN RY
Sbjct  239   YMFIDEETEMYMKNASILSSSRRVGLWRIIIVRNIPYADSRRNGKVPKLLLHRIFPNVRY  298

Query  1596  SLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDF  1775
             S+WIDGKLELVVDPYQ+LERFLWR+NA+FAISRHY+RFDVF EAEANKAAGK++NASID 
Sbjct  299   SIWIDGKLELVVDPYQVLERFLWRQNATFAISRHYRRFDVFVEAEANKAAGKYENASIDH  358

Query  1776  QVEFYK-KEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQIS  1952
             Q++FYK  +GLT +S AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+S
Sbjct  359   QIQFYKYHDGLTHYSRAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLS  418

Query  1953  FSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             FSTVRDKI ++T+W++ MF+DCERRNFV+Q YHRDILE 
Sbjct  419   FSTVRDKIMAKTDWSINMFMDCERRNFVIQAYHRDILEQ  457



>emb|CDY26015.1| BnaC06g06090D [Brassica napus]
Length=531

 Score =   487 bits (1253),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 259/468 (55%), Positives = 323/468 (69%), Gaps = 19/468 (4%)
 Frame = +3

Query  678   FAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISISATMKDREYSIEPEEKNN  857
             +  R++  +LLL +++  VF+   Y    E       P I  S    D   +  P  +  
Sbjct  20    YLGRRRFAMLLLLSLAFVVFILGSYTINKESNS----PIIHQSIETMDFVSNQTPLSRE-  74

Query  858   IHKTLLAKPNNNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRP-  1034
                +   + +N+ GI  +D       V          +PC+ F+ PPPP    R      
Sbjct  75    -LSSFYTENSNDDGIRGSD-------VDIIHPPPSHHHPCDSFSFPPPPPPGLRRPGPRP  126

Query  1035  CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgfgg---YPSLRQRDE  1202
             CPVCYL  EEA+A MP  P  SPVL  L Y+HEE+  + E  G G      YPSL  R  
Sbjct  127   CPVCYLSPEEALAHMPKHPFESPVLKNLTYVHEESPVKREEEGQGGSEFGGYPSLEDRTN  186

Query  1203  SYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKN  1382
             S+DI+ESM+VHCGFVKG KP   T F+ID+  L E++    V+VASAIFG +D+I +P N
Sbjct  187   SFDIKESMTVHCGFVKGTKPVHQTGFEIDEDILPELDQFHDVIVASAIFGKYDIIQEPVN  246

Query  1383  ISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPYTDARRNGKIPK  1559
             ISE AR N+ FYMF+DE T ++L+N+    + + R+GLWRI+VVH++PYTDARRNGKIPK
Sbjct  247   ISEMARNNIPFYMFIDEETHSYLKNTSSYSDDNKRVGLWRIIVVHNVPYTDARRNGKIPK  306

Query  1560  LLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANK  1739
             LLLHRLFPN RYS+W+D KL+LVVDPYQILERFLWR N+S A+SRHY+RFDVF EAEANK
Sbjct  307   LLLHRLFPNIRYSIWLDAKLQLVVDPYQILERFLWRTNSSIAMSRHYRRFDVFVEAEANK  366

Query  1740  AAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNE  1919
             AA K+DNASID+QVEFYKKEGLTP++ AK PITSDVPEGC IIREHIPI+NLFTC+WFNE
Sbjct  367   AARKYDNASIDYQVEFYKKEGLTPYTDAKLPITSDVPEGCTIIREHIPITNLFTCVWFNE  426

Query  1920  VDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDIL  2063
             VDRFT RDQ+SF+  RDKIR + +W++ MFLDCERRNFV Q YHRD+L
Sbjct  427   VDRFTSRDQLSFAIARDKIREKVDWSINMFLDCERRNFVKQVYHRDVL  474



>ref|XP_010542286.1| PREDICTED: uncharacterized protein LOC104815554 isoform X2 [Tarenaya 
hassleriana]
Length=517

 Score =   483 bits (1243),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 243/367 (66%), Positives = 292/367 (80%), Gaps = 6/367 (2%)
 Frame = +3

Query  960   PPGNPCEGFTLPPPPADKKRTGPRP-CPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEE  1133
             P  +PC+ F+ PPPP    R      CPVCYLP +EA A MP  PS SPVL  L YI +E
Sbjct  134   PLHHPCKSFSFPPPPPPGLRRPGPRPCPVCYLPPDEAFARMPKYPSESPVLKNLTYIRDE  193

Query  1134  T---LsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLG  1304
             +   L     G S FGG+PSL QR++S++IRESM+VHCGFVKG KPG  T F+ID+  L 
Sbjct  194   SILKLEGQGQGSSEFGGFPSLEQRNDSFNIRESMAVHCGFVKGKKPGIQTLFNIDEDILD  253

Query  1305  EMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNS-GDLNSSS  1481
             E+E    V+VASA+FG +D+I +P+NISE A++N+ FYMFVDE TEA+LRN+    N + 
Sbjct  254   ELEQFHDVIVASAVFGKYDIIQEPRNISEVAKKNIPFYMFVDEVTEAYLRNTTAYTNDNK  313

Query  1482  RIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFL  1661
             R+GLWRI+VVH +PY DARRNGK+PKLLLHRLFPN RYS+WID KL+LVVDPYQILERFL
Sbjct  314   RVGLWRIIVVHSVPYDDARRNGKVPKLLLHRLFPNVRYSIWIDAKLQLVVDPYQILERFL  373

Query  1662  WRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITS  1841
             WR N+SFAISRHY+RFD +EE EANKAA K+DN +ID+Q+EFYKKEGLTP+S AK PITS
Sbjct  374   WRVNSSFAISRHYRRFDAYEEGEANKAARKYDNETIDYQMEFYKKEGLTPYSEAKLPITS  433

Query  1842  DVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCE  2021
             DVPEGC IIREHIPI+NLFTC+WFNEV RFT RDQ+SF+ VRDKIR+R +W++ MFLDCE
Sbjct  434   DVPEGCTIIREHIPITNLFTCVWFNEVARFTSRDQLSFAIVRDKIRARVHWSINMFLDCE  493

Query  2022  RRNFVVQ  2042
             RRNFV Q
Sbjct  494   RRNFVKQ  500



>ref|XP_004487707.1| PREDICTED: uncharacterized protein LOC101515599 [Cicer arietinum]
Length=540

 Score =   481 bits (1239),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 235/334 (70%), Positives = 283/334 (85%), Gaps = 3/334 (1%)
 Frame = +3

Query  1077  MPTAPSFSPVL-YLNYIHEETLsene-fggsgfggYPSLRQRDESYDIRESMSVHCGFVK  1250
             MP++PS SP+L  L Y H E LS  E  GGS FGGYPSL +RD S+DI+++M VHCGFVK
Sbjct  1     MPSSPSESPILRTLTYAHNENLSPTEPEGGSDFGGYPSLEERDASFDIKDTMKVHCGFVK  60

Query  1251  GVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVD  1430
             G +PGR T FD D++DL E++    ++VASAIFG +D+I QP+NIS  A++N+ FYMF+D
Sbjct  61    GSRPGRQTGFDFDEEDLLELDQYHDIIVASAIFGNYDVIQQPRNISSEAKKNIPFYMFID  120

Query  1431  EGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWID  1610
             E TE+++RN   L+SS R+GLWRI+VV ++PY D+RRNGKIPKLLLHR+FPN RYS+WID
Sbjct  121   EETESYMRNVSILDSSRRVGLWRIIVVRNIPYADSRRNGKIPKLLLHRIFPNIRYSIWID  180

Query  1611  GKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFY  1790
             GKLELVVDPYQILERFLWR NA+FAISRHY+RFDVF EAEANK AGK++NASID QV+FY
Sbjct  181   GKLELVVDPYQILERFLWRPNATFAISRHYRRFDVFVEAEANKVAGKYENASIDHQVQFY  240

Query  1791  K-KEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVR  1967
             +  +GLT +S AK PITSDVPEGCVIIREHIPI+NLFTCLWFNEVDRFT RDQ+SFSTVR
Sbjct  241   QDHDGLTHYSRAKLPITSDVPEGCVIIREHIPITNLFTCLWFNEVDRFTSRDQLSFSTVR  300

Query  1968  DKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             DKI ++ NW+V MFLDCERRNFV+Q YHRDILE+
Sbjct  301   DKIMAKVNWSVNMFLDCERRNFVIQAYHRDILEN  334



>ref|XP_001755610.1| predicted protein [Physcomitrella patens]
 gb|EDQ79670.1| predicted protein [Physcomitrella patens]
Length=438

 Score =   465 bits (1197),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 234/374 (63%), Positives = 285/374 (76%), Gaps = 5/374 (1%)
 Frame = +3

Query  969   NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSF-SPVLY-LNYIHEETLs  1142
             +PCE F +P PPAD KRTGPRPCPVCYL  E AI+ +P   ++ SPVL  L ++ +   +
Sbjct  14    HPCERFKVPQPPADPKRTGPRPCPVCYLDEELAISQLPAEGTYQSPVLKRLTFVSDPDAA  73

Query  1143  enefggsgfgg---YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEME  1313
             +    G+       YPSL  R  S+++RE M V+CGFVKG  PG  T +D D++D   M 
Sbjct  74    KRPSPGAPGSAFGGYPSLEDRAASFNVREEMKVNCGFVKGPTPGLGTGYDFDEEDRQAML  133

Query  1314  ACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGL  1493
             AC GVVVASAIFG +D + QPKN+S+ A+++VCF+MFVDE TEA L +  +  ++ ++GL
Sbjct  134   ACRGVVVASAIFGNYDQLQQPKNVSDEAKKSVCFFMFVDEETEASLDDYENFRTTKQVGL  193

Query  1494  WRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRN  1673
             WR+VVV +LPY DARR GKIPKLLLHRLFPN R+S+W DGKLE+V DPY+ILERFLWR N
Sbjct  194   WRVVVVRNLPYRDARRTGKIPKLLLHRLFPNVRFSIWADGKLEIVQDPYKILERFLWRTN  253

Query  1674  ASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPE  1853
              +FAIS+HYKRFDVFEEAEANKAA K++N SID Q+ FYKKEGLTP+S AK PITSDVPE
Sbjct  254   ETFAISQHYKRFDVFEEAEANKAAAKYNNKSIDDQINFYKKEGLTPYSTAKLPITSDVPE  313

Query  1854  GCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNF  2033
             GCVIIREH PI+NL +CLWFNEVDRFT RDQ+SF  VRDK+ +   W V MF DCERRNF
Sbjct  314   GCVIIREHTPIANLMSCLWFNEVDRFTSRDQLSFGIVRDKLMAAVPWRVTMFKDCERRNF  373

Query  2034  VVQGYHRDILEHRA  2075
             VVQ YHRD+L  R 
Sbjct  374   VVQVYHRDLLVQRG  387



>gb|EMT07305.1| hypothetical protein F775_32361 [Aegilops tauschii]
Length=451

 Score =   462 bits (1188),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 235/377 (62%), Positives = 278/377 (74%), Gaps = 42/377 (11%)
 Frame = +3

Query  957   LPPGN----PCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNY  1121
             L PGN    PCEGF +PP   DKKRTGPRPCPVCY+ V++A ALMP   S SPVL  L+Y
Sbjct  51    LSPGNFTNHPCEGFAVPPILFDKKRTGPRPCPVCYVSVDQAFALMPLQASPSPVLENLDY  110

Query  1122  IHEETLsenefg-gsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKD  1298
               E++++ N    GS FGG+ SL QR++S+DI  SM+VHCGFV+G KPG+ T FDI D D
Sbjct  111   ALEDSVTANFSNPGSAFGGHLSLEQRNKSFDITNSMTVHCGFVRGKKPGQGTGFDISDDD  170

Query  1299  LGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSS  1478
             L EME C                                     E T A+++NS  L   
Sbjct  171   LLEMEQCH------------------------------------EETMAYVKNSSSLYKD  194

Query  1479  SRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERF  1658
             +++GLWR+VVV +LPY D RR GKIPKLLLHRLFPN R+S+WID KL+LVVDPY +LERF
Sbjct  195   NKVGLWRLVVVRNLPYEDPRRTGKIPKLLLHRLFPNVRFSVWIDAKLQLVVDPYLLLERF  254

Query  1659  LWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPIT  1838
             LWR+N+SFAISRHY+RFDV+EEAEANKAAGK+DNASID Q++FY+ EGLT +S AK PIT
Sbjct  255   LWRKNSSFAISRHYRRFDVYEEAEANKAAGKYDNASIDEQIDFYRNEGLTHYSPAKLPIT  314

Query  1839  SDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDC  2018
             SDVPEGCVIIREH+PISNLFTCLWFNEVDRFT RDQISFSTVRDKIR++  W  +MFLDC
Sbjct  315   SDVPEGCVIIREHVPISNLFTCLWFNEVDRFTARDQISFSTVRDKIRAKVGWMPQMFLDC  374

Query  2019  ERRNFVVQGYHRDILEH  2069
             ERRNFVVQ YHR++LE 
Sbjct  375   ERRNFVVQAYHRELLEQ  391



>gb|EMS52459.1| hypothetical protein TRIUR3_08436 [Triticum urartu]
Length=457

 Score =   435 bits (1119),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 227/377 (60%), Positives = 269/377 (71%), Gaps = 51/377 (14%)
 Frame = +3

Query  957   LPPGN----PCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-YLNY  1121
             L PGN    PCEGF +PP   DKKRTGPR          +A ALMP   S SPVL  L+Y
Sbjct  66    LSPGNFTNHPCEGFAVPPILFDKKRTGPR---------HQAFALMPLQASPSPVLENLDY  116

Query  1122  IHEETLsenefg-gsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKD  1298
               E++++ N    GS FGG+ SL QR++S+DI  SM+VHCGFV+G KPG+ T FDI D D
Sbjct  117   ALEDSVTANFSNPGSAFGGHLSLEQRNKSFDITNSMTVHCGFVRGKKPGQGTGFDISDDD  176

Query  1299  LGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSS  1478
             L EME C                                     E T A+++NS  L   
Sbjct  177   LLEMEQCH------------------------------------EETMAYVKNSSSLYKD  200

Query  1479  SRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERF  1658
             +++GLWR+VVV +LPY D RR GKIPKLLLHRLFPN R+S+WID KL+LVVDPY +LERF
Sbjct  201   NKVGLWRLVVVRNLPYEDPRRTGKIPKLLLHRLFPNVRFSVWIDAKLQLVVDPYLLLERF  260

Query  1659  LWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPIT  1838
             LWR+N+SFAISRHY+RFDV+EEAEANKAAGK+DNASID Q++FY+ EGLT +S AK PIT
Sbjct  261   LWRKNSSFAISRHYRRFDVYEEAEANKAAGKYDNASIDEQIDFYRNEGLTHYSPAKLPIT  320

Query  1839  SDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDC  2018
             SDVPEGCVIIREH+PISNLFTCLWFNEV+RFT RDQISFSTVRDKIR++  W  +MFLDC
Sbjct  321   SDVPEGCVIIREHVPISNLFTCLWFNEVERFTARDQISFSTVRDKIRAKVGWMPQMFLDC  380

Query  2019  ERRNFVVQGYHRDILEH  2069
             ERRNFVVQ YHR++LE 
Sbjct  381   ERRNFVVQAYHRELLEQ  397



>emb|CDY46285.1| BnaC05g21710D [Brassica napus]
Length=365

 Score =   400 bits (1027),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 205/349 (59%), Positives = 251/349 (72%), Gaps = 22/349 (6%)
 Frame = +3

Query  624   KPLKTFKEKEGWFHRIFKFAARKKVGLLLLCAVSAAVFVWVLYVGKGEDARGPEIPTISI  803
             KP K  KE+EG+ H I KFA RKKVG+LLL  +SA VF+ VLY GKGED +  ++P    
Sbjct  34    KPSKMHKEREGFVHWICKFAGRKKVGMLLLFLISAVVFLRVLYAGKGEDGQEVQVPP---  90

Query  804   SATMKDREYSIEPEEKNNIHKTLLAKPNNNRGIASTD---QPPPLPRVYFTGYTLPPGNP  974
             S       +SI           L    N N  I  T+    PP    ++F GYTLP  +P
Sbjct  91    SLHFNGTSHSI----------LLPTNQNQNVNILGTNVILSPP----IHFLGYTLPQRHP  136

Query  975   CEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsene  1151
             C  FTLPPPPAD+KR+GPRPCPVCYLPV+EAIALMP APSFSP+L  L YIHE+ L+ + 
Sbjct  137   CHTFTLPPPPADRKRSGPRPCPVCYLPVQEAIALMPDAPSFSPLLKNLTYIHEDPLNTDT  196

Query  1152  fggsgf-ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGV  1328
               G    GGYP+L+ R+ S+D +E+M++HCGFVKG +PGR T FDID+ DL EM+ C G+
Sbjct  197   EFGGSDFGGYPTLKHRNHSFDFKETMNIHCGFVKGPQPGRNTGFDIDEADLLEMQQCRGI  256

Query  1329  VVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVV  1508
             VVASA+F AFD +  PKNIS+++ E VCFYMFVDEGTE  L+    LN + ++G+WR+VV
Sbjct  257   VVASAVFDAFDDVKAPKNISKHSEETVCFYMFVDEGTETILKRERGLNGNKKVGIWRVVV  316

Query  1509  VHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILER  1655
             VH+LPY D RRNGK+PKLL+HRLFPNARYSLWIDGKLELVVDPYQILER
Sbjct  317   VHNLPYLDGRRNGKVPKLLVHRLFPNARYSLWIDGKLELVVDPYQILER  365



>gb|EYU27975.1| hypothetical protein MIMGU_mgv1a0050832mg, partial [Erythranthe 
guttata]
Length=223

 Score =   330 bits (845),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = +3

Query  1551  IPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAE  1730
             +PKLLLHRLFP ARYSLW+D KLEL VDP QILERFLWR+NASFAISRHYKRFDVFEEAE
Sbjct  1     VPKLLLHRLFPKARYSLWVDAKLELAVDPIQILERFLWRKNASFAISRHYKRFDVFEEAE  60

Query  1731  ANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLW  1910
             ANKAAGK+DNASIDFQ+EFYK EGLT +S AK PITSDVPEGCVIIREHIPISNLFTCLW
Sbjct  61    ANKAAGKYDNASIDFQIEFYKNEGLTTYSTAKLPITSDVPEGCVIIREHIPISNLFTCLW  120

Query  1911  FNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEH  2069
             FNEVDRFT RDQISFSTVRDKIRS+TN+ + MFLDCERRNFVVQGYHRD+LEH
Sbjct  121   FNEVDRFTSRDQISFSTVRDKIRSKTNYTINMFLDCERRNFVVQGYHRDLLEH  173



>ref|XP_002961111.1| hypothetical protein SELMODRAFT_75600 [Selaginella moellendorffii]
 gb|EFJ38650.1| hypothetical protein SELMODRAFT_75600 [Selaginella moellendorffii]
Length=365

 Score =   328 bits (842),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 179/375 (48%), Positives = 239/375 (64%), Gaps = 26/375 (7%)
 Frame = +3

Query  957   LPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY--LNYIHE  1130
             LP G+PC  F  P             C VCYLPV++A+  +P    F  ++   L Y+H 
Sbjct  5     LPQGHPCLRFQSP--------CWFGQCQVCYLPVDQALKALPPQGIFPELILSKLAYLHR  56

Query  1131  ETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVK-GVKPGR-ATSFDI-DDKDL  1301
                  +   G  F    SL +R+ S+ I+ESM V CGF + GV+PGR  + F+I D+ D+
Sbjct  57    ADSRNSTPFGGSF----SLEERERSFKIQESMEVPCGFTRAGVEPGREGSGFEIQDEADM  112

Query  1302  GEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSS  1481
               +  C G+VVASAIFG +D++ QPK +S  +   VCF MFVD  T    R  G     +
Sbjct  113   DYLRECRGIVVASAIFGNYDVLKQPKKLSSTSARTVCFAMFVDVETLESFRIEG-----A  167

Query  1482  RIGLWRIVVVHDLPYT-DARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERF  1658
             + G WR ++V    Y  D R  GKIPK+LLHRL PNAR+S+WID KL++VVDP QILERF
Sbjct  168   QAGAWRTILVRSNAYEGDNRYKGKIPKMLLHRLVPNARFSIWIDAKLQMVVDPIQILERF  227

Query  1659  LWRRNASFAISRHYKRFDVFEEAEANKAAGKF-DNASIDFQVEFYKK-EGLTPFS-AAKF  1829
             LWR N + AIS H++R D F+EAEA     ++   A +D Q++FY+  EGL P+  AA+ 
Sbjct  228   LWRSNDTMAISNHFERADAFQEAEAIIRERRYHSKAKLDAQMDFYRTHEGLLPYDRAARM  287

Query  1830  PITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMF  2009
             P+ SDVPE CV++REH P++NLF+CLWFNE+DRFTPRDQ+SF+ VRDKI ++  W + MF
Sbjct  288   PLVSDVPESCVVLREHTPLTNLFSCLWFNELDRFTPRDQVSFAVVRDKIIAQVPWRINMF  347

Query  2010  LDCERRNFVVQGYHR  2054
              DCERRNFV    H+
Sbjct  348   EDCERRNFVWTMRHK  362



>ref|XP_002960842.1| hypothetical protein SELMODRAFT_75446 [Selaginella moellendorffii]
 gb|EFJ38381.1| hypothetical protein SELMODRAFT_75446 [Selaginella moellendorffii]
Length=384

 Score =   327 bits (837),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 175/385 (45%), Positives = 246/385 (64%), Gaps = 22/385 (6%)
 Frame = +3

Query  927   LPRVYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPV  1106
              P   F    LP G+PC  F    P   +       CPVCY+PV++A+  +P    F  +
Sbjct  13    FPPANFKDPPLPQGHPCRSF----PNPSRAPCWLCNCPVCYVPVDQALKALPLQGIFPEL  68

Query  1107  LY--LNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVK-GVKPGR-AT  1274
             +   L Y+H    + +   G  F    SL +R+ S+ IRESM++ CGF + GV+PGR  +
Sbjct  69    VLSTLTYLHRAGSTNSTPFGGNF----SLEERERSFKIRESMAIPCGFARAGVEPGREGS  124

Query  1275  SFDI-DDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFL  1451
              F+I ++ D+  +  C G+VVASAIFG +D++  P N+S  +   VCF MFVD+ T   L
Sbjct  125   GFEIQEEADMDYLRECRGIVVASAIFGNYDVLKPPANLSSTSARTVCFAMFVDDKTLESL  184

Query  1452  RNSGDLNSSSRIGLWRIVVVHDLPYT-DARRNGKIPKLLLHRLFPNARYSLWIDGKLELV  1628
             +  G     +  G WRI++V    Y  D R  G+IPK+LLHRL PNAR+S+WID KL++V
Sbjct  185   QVEG-----TPAGAWRIILVRSDAYEGDNRSKGEIPKMLLHRLVPNARFSIWIDAKLQMV  239

Query  1629  VDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDN-ASIDFQVEFYKK-EG  1802
              DP QILERFLWR   + AIS H++R D FEEAEA     ++++ A +D Q+EFY+  +G
Sbjct  240   ADPIQILERFLWRSGDTMAISNHFERADAFEEAEATIRYRRYESKAKMDAQMEFYRTHDG  299

Query  1803  LTPFS-AAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIR  1979
             L P+  AA+ P+ SDVP+ C ++REH P++NLF+CLWFNE+DRFTPRDQ+SF+ VRDKI 
Sbjct  300   LLPYDRAARMPLVSDVPDSCAVLREHTPLTNLFSCLWFNELDRFTPRDQVSFAVVRDKII  359

Query  1980  SRTNWNVEMFLDCERRNFVVQGYHR  2054
             ++  W + MF DCE+RNFV +  H+
Sbjct  360   AQVPWRINMFEDCEKRNFVWETPHK  384



>ref|XP_002983830.1| hypothetical protein SELMODRAFT_119385 [Selaginella moellendorffii]
 gb|EFJ14842.1| hypothetical protein SELMODRAFT_119385 [Selaginella moellendorffii]
Length=381

 Score =   326 bits (836),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/387 (45%), Positives = 250/387 (65%), Gaps = 23/387 (6%)
 Frame = +3

Query  924   PLPRVYF-TGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFS  1100
             P+ RV+    + LP G+PC  F  P PP          CPVCY+ V++A+  +P    F 
Sbjct  8     PVLRVFPPANFKLPQGHPCRSFPNPSPPPCWLCN----CPVCYVRVDQALKALPPQGIFP  63

Query  1101  PVLY--LNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVK-GVKPGR-  1268
              ++   L Y+H    + +   G  F    SL +R+ S+ IRESM++ CGF + G++PGR 
Sbjct  64    ELVLSTLTYLHRAGSTNSTPFGGNF----SLEERERSFKIRESMAIPCGFARAGMEPGRE  119

Query  1269  ATSFDI-DDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEA  1445
              + F+I ++ D+  +  C G+VVASAIFG +D++  P N+S  +   VCF MFVD+ T  
Sbjct  120   GSGFEIQEEADMDYLRECRGIVVASAIFGNYDVLKPPANLSSTSARTVCFAMFVDDETLE  179

Query  1446  FLRNSGDLNSSSRIGLWRIVVVHDLPYT-DARRNGKIPKLLLHRLFPNARYSLWIDGKLE  1622
              L+  G     +  G WRI++V    Y  D R  G+IPK+LLHRL PNAR+S+WID KL+
Sbjct  180   SLQMEG-----TPAGAWRIILVRSDAYEGDNRSKGEIPKMLLHRLVPNARFSIWIDAKLQ  234

Query  1623  LVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDN-ASIDFQVEFYKK-  1796
             +V DP QIL+RFLWR   + AIS H++R D FEEAEA     ++++ A +D Q+EFY+  
Sbjct  235   MVADPIQILDRFLWRSGDTMAISNHFERADAFEEAEATIRYRRYESKAKMDAQMEFYRTH  294

Query  1797  EGLTPFS-AAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDK  1973
             +GL P+  AA+ P+ SDVP+ C ++REH P++NLF+CLWFNE+DRFTPRDQ+SF+ VRDK
Sbjct  295   DGLLPYDRAARMPLVSDVPDSCAVLREHTPLTNLFSCLWFNELDRFTPRDQVSFAVVRDK  354

Query  1974  IRSRTNWNVEMFLDCERRNFVVQGYHR  2054
             I ++  W + MF DCERRNFV +  H+
Sbjct  355   IIAQVPWRINMFEDCERRNFVWETPHK  381



>ref|XP_008657707.1| PREDICTED: uncharacterized protein LOC103637253 [Zea mays]
Length=237

 Score =   319 bits (818),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/226 (65%), Positives = 187/226 (83%), Gaps = 2/226 (1%)
 Frame = +3

Query  1230  VHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENV  1409
             VHCGFV+G  PG  T FDID+ D  EM+ C+  VVASAIFG +D++ QP+NIS+++++ V
Sbjct  8     VHCGFVRGKVPGLNTGFDIDEADHSEMQLCQSTVVASAIFGNYDVMQQPENISKFSKDTV  67

Query  1410  CFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNA  1589
             CF+MF++E TEA ++N+  +  + +IGLWR+VVV +LP+TDARRNGK+PKLLLHRLFPNA
Sbjct  68    CFFMFLEEETEAAIKNT-TIGHTKKIGLWRVVVVRNLPFTDARRNGKVPKLLLHRLFPNA  126

Query  1590  RYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASI  1769
             RYS+WIDGKL+LV DPYQ+LERFLWR+N SFAISRHY+RFDVFEEAEANKA GK+DN SI
Sbjct  127   RYSIWIDGKLKLVRDPYQVLERFLWRKNVSFAISRHYRRFDVFEEAEANKAGGKYDNTSI  186

Query  1770  DFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCL  1907
             D+Q+EFYK+EGLT +S+AK PITS      ++IR+ +    LFTCL
Sbjct  187   DYQIEFYKREGLTHYSSAKLPITSG-SYFSLLIRDLLIFLTLFTCL  231



>ref|NP_001168315.1| hypothetical protein [Zea mays]
 gb|ACN27793.1| unknown [Zea mays]
 gb|AFW82506.1| hypothetical protein ZEAMMB73_022884 [Zea mays]
Length=394

 Score =   310 bits (794),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 183/373 (49%), Positives = 240/373 (64%), Gaps = 33/373 (9%)
 Frame = +3

Query  597   SSSFPIPPRKPLK-TFKEKEG--WFHRIFKFAARKKVGLLLLCAVSAAV---FVWVLYVG  758
             SSS P+  RKP K +     G     RI K A R++  +LLL  VS AV   F++   V 
Sbjct  28    SSSPPLAARKPAKMSLGGTSGPRVCARICKLAGRRQR-MLLLLLVSVAVAFCFLFSSLVS  86

Query  759   KGEDARGPEIPTISISATMKDREYSIEPEEKNNIHKTLLAKPNNNRG---IASTDQPPPL  929
             K EDA  P + T+ +        +S       N   T   +P   RG   +   + P  +
Sbjct  87    KDEDA-SPGVETMLV--------FSDHVRSFVNPVWTSSGRPVAQRGSLTVNGLNTPSQM  137

Query  930   PR------VYFTGYTLPPG-----NPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIAL  1076
              +      V     + PP      +PCE F+L PPP D+KRTGPRPCPVCYLPVE+A+AL
Sbjct  138   EKQSDSKQVQELMQSFPPAIVVDHHPCENFSLSPPPVDRKRTGPRPCPVCYLPVEQALAL  197

Query  1077  MPTAPSFSPVLY-LNYIHEETLsenefggsgf-ggYPSLRQRDESYDIRESMSVHCGFVK  1250
              P  PS SPVL  LNY+ EE L   E       GG+PSL +RD+SYDI++SM+VHCGFV+
Sbjct  198   RPAKPSLSPVLQSLNYVLEEILIPKESKSGSLFGGFPSLEERDKSYDIKDSMTVHCGFVR  257

Query  1251  GVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVD  1430
             G  PG  T FDID+ D  EM+ C+  VVASAIFG +D++ QP+NIS+++++ VCF+MF+D
Sbjct  258   GKVPGLNTGFDIDEADHSEMQLCQSTVVASAIFGNYDVMQQPENISKFSKDTVCFFMFLD  317

Query  1431  EGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWID  1610
             E TEA ++N+  +  + +IGLWR+VVV +LP+TDARRNGK+PKLLLHRLFPNARYS+WID
Sbjct  318   EETEAAIKNT-TIGHTKKIGLWRVVVVRNLPFTDARRNGKVPKLLLHRLFPNARYSIWID  376

Query  1611  GKLELVVDPYQIL  1649
             GKL+LV DPYQ+L
Sbjct  377   GKLKLVRDPYQVL  389



>gb|AAT47075.1| unknown protein [Oryza sativa Japonica Group]
Length=394

 Score =   306 bits (783),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 166/344 (48%), Positives = 232/344 (67%), Gaps = 16/344 (5%)
 Frame = +3

Query  642   KEKEGWFHRIFKFAARKKVGLLLLCAVSAA-VFVWVLYVGKGEDARGPEIPTISISATMK  818
             KE+    HR  +   R++ G+LLL A ++A VF  +  V K ++A         ++ T++
Sbjct  40    KERLQLLHRALRLVGRRRAGVLLLLAAASAAVFCSIFAVVKDDNASMIIANNYEVANTIQ  99

Query  819   DREYSIEPEEKNNIHKTLLAKPN--NNRGIASTDQPPPLPRVYFTGYTLPPGNPCEGFTL  992
             +  Y        ++ + L+   +  +   +  T+ P  L R+ F  +T    +PCEGF++
Sbjct  100   NSVYP-------SMTRPLMTSSDQFSASSVNKTELPNRL-RLSFANFT---HHPCEGFSV  148

Query  993   PPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLsenefggsgf  1169
              PP  D KRTGPRPC VCY+PV++A ALMP  PS SPVL  L+Y+ E+ ++ N       
Sbjct  149   APPLVDPKRTGPRPCDVCYVPVDQAFALMPPQPSPSPVLKNLSYVFEDNITANFSNQGSV  208

Query  1170  -ggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAI  1346
              GG+PSL QR++S+DI ESM+VHCGFV+G KPG+ + FDI+D DL EME C  +VVASAI
Sbjct  209   FGGHPSLEQRNKSFDISESMTVHCGFVRGKKPGQGSGFDINDDDLLEMEKCRELVVASAI  268

Query  1347  FGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPY  1526
             FG +D+I  P+N SE+++ N CFYMFVDE TEA+++NS  L  ++++GLWR+VVV +LPY
Sbjct  269   FGNYDMIQHPRNASEFSKANACFYMFVDEETEAYVKNSSSLYRNNKVGLWRLVVVRNLPY  328

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERF  1658
              D RR GKIPKLLLHRLFPN R+S+WID KL+LVVDPY +LER+
Sbjct  329   EDPRRTGKIPKLLLHRLFPNVRFSVWIDAKLKLVVDPYLLLERY  372



>gb|EYU27976.1| hypothetical protein MIMGU_mgv1a0050831mg, partial [Erythranthe 
guttata]
Length=274

 Score =   294 bits (752),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = +3

Query  936   VYFTGYTLPPGNPCEGFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVL-Y  1112
             VYFTGYTLP GNPCE FTLPPPPADKKRTGPRPCPVCYLPVE+AI L+P APSFSPVL  
Sbjct  84    VYFTGYTLPRGNPCESFTLPPPPADKKRTGPRPCPVCYLPVEDAIGLIPNAPSFSPVLKS  143

Query  1113  LNYIHEETLsenefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDD  1292
             L YIH+E L+++EFGGS FGGYPSL +R++SYDI+ESM+VHCGFV+G KPG  T FDIDD
Sbjct  144   LTYIHDENLTKSEFGGSEFGGYPSLIERNDSYDIKESMNVHCGFVRGSKPGHQTGFDIDD  203

Query  1293  KDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLN  1472
              DL EME C GVVVASA+FGAFDLI QPKNISEYA+ N+CF+MFVD  TEAFLRNS +L 
Sbjct  204   SDLLEMETCGGVVVASAVFGAFDLIRQPKNISEYAKRNICFHMFVDNETEAFLRNSSELG  263

Query  1473  SSSRIGLWRIV  1505
             S +++GLWRI+
Sbjct  264   SDNKVGLWRII  274



>ref|XP_008656452.1| PREDICTED: uncharacterized protein LOC103635855 [Zea mays]
Length=297

 Score =   293 bits (750),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 180/220 (82%), Gaps = 3/220 (1%)
 Frame = +3

Query  1002  PADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEETLs-enefggsgfgg  1175
             P D+KRTGPRPCPVCYLPVE+A+AL P  PS SPVL  LNY+ EE L  +    GS FGG
Sbjct  79    PVDRKRTGPRPCPVCYLPVEQALALRPAKPSLSPVLQSLNYVLEEILIPKESKSGSLFGG  138

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             +PSL +RD+SYDI++SM+VHCGFV+G  PG  T FDID+ D  EM+ C+  VVASAIFG 
Sbjct  139   FPSLEERDKSYDIKDSMTVHCGFVRGKVPGLNTGFDIDEADHSEMQLCQSTVVASAIFGN  198

Query  1356  FDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIVVVHDLPYTDA  1535
             +D++ QP+NIS+++++ VCF+MF+DE TEA ++N+  +  + +IGLWR+VVV +LP+TDA
Sbjct  199   YDVMQQPENISKFSKDTVCFFMFLDEETEAAIKNT-TIGHTKKIGLWRVVVVRNLPFTDA  257

Query  1536  RRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILER  1655
             RRNGK+PKLLLHRLFPNARYS+WIDGKL+LV DPYQ+LER
Sbjct  258   RRNGKVPKLLLHRLFPNARYSIWIDGKLKLVRDPYQVLER  297



>gb|ACU18605.1| unknown [Glycine max]
Length=227

 Score =   290 bits (743),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = +3

Query  1575  LFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKF  1754
             + PNA YS+W+DGKLELVVDPYQILERFLWR+NA+FAIS+HY+RFDVF EAEANKAAGK+
Sbjct  1     MVPNAHYSIWLDGKLELVVDPYQILERFLWRKNATFAISKHYRRFDVFVEAEANKAAGKY  60

Query  1755  DNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLFTCLWFNEVDRFT  1934
             +NASIDFQ+EFYK EGLTP++ AK P+ SDVPEGCVI+REH+PIS+LFTCLWFNEVDRFT
Sbjct  61    ENASIDFQIEFYKNEGLTPYTEAKLPLISDVPEGCVIVREHVPISDLFTCLWFNEVDRFT  120

Query  1935  PRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILE  2066
              RDQISFSTVRDK+ SR +++  MFLDCERRNFVVQ YHRDILE
Sbjct  121   SRDQISFSTVRDKLLSRVDFHFLMFLDCERRNFVVQKYHRDILE  164



>ref|XP_010060564.1| PREDICTED: uncharacterized protein LOC104448440 isoform X3 [Eucalyptus 
grandis]
Length=600

 Score =   302 bits (774),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 166/289 (57%), Positives = 210/289 (73%), Gaps = 19/289 (7%)
 Frame = +3

Query  843   EEKNNIHKTLLAKPNNNRGIASTDQPPPLP-------------RVYFTG---YTLPPGNP  974
             E++     +L  K  +  G  S  QPPP+P             R   T     ++P G+ 
Sbjct  194   EDRQKGRGSLGRKTASRSGGRSRAQPPPVPARSHRRARPHPLSRSDSTSPKPGSVPMGHQ  253

Query  975   CEGFTLPPPPA-DKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLY-LNYIHEET-Lse  1145
             C+ F  PPPP  D KR GPRPCPVCY+PVE+AIA MP++P+ SPVL  L YIH+E  +  
Sbjct  254   CKKFAFPPPPPADGKRIGPRPCPVCYVPVEQAIASMPSSPAISPVLRNLTYIHDEDPVKS  313

Query  1146  nefggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEG  1325
              + G S FGGYPSL +RD+S+DI+ESM VHCGFVKG KPGR T FDID+ DL EME    
Sbjct  314   EQHGVSDFGGYPSLTERDDSFDIKESMRVHCGFVKGHKPGRQTGFDIDEADLEEMEQYHD  373

Query  1326  VVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSRIGLWRIV  1505
             V+VASAIFG +D+I +P+NISE A++N+ F+MF+DE TEA+++NS  LNSS R+GLW+I+
Sbjct  374   VIVASAIFGNYDIIQEPRNISEAAKKNIPFFMFIDEETEAYMQNSSVLNSSRRVGLWKII  433

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILE  1652
             VVH++PY DARRNGK+PKLLLHRLFPN RYS+W+DGKL+LVVDPYQILE
Sbjct  434   VVHNIPYADARRNGKVPKLLLHRLFPNVRYSIWVDGKLQLVVDPYQILE  482



>gb|KHN39565.1| hypothetical protein glysoja_041089 [Glycine soja]
Length=195

 Score =   284 bits (727),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 158/195 (81%), Gaps = 0/195 (0%)
 Frame = +3

Query  1284  IDDKDLGEMEACEGVVVASAIFGAFDLIHQPKNISEYARENVCFYMFVDEGTEAFLRNSG  1463
             +D+ DL EME C  VV A AIFG FD I+ P NIS+Y++E +CF MFVDE  E+ LR+S 
Sbjct  1     MDEDDLIEMEQCHDVVDALAIFGNFDEINDPTNISDYSKETICFLMFVDEEIESNLRSSA  60

Query  1464  DLNSSSRIGLWRIVVVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQ  1643
              L +  +IGLWRI+V H+LPYTD R  GKIPKLLLHR+ PNA YS+W+DGKLELVVDPYQ
Sbjct  61    RLGTRKKIGLWRIIVSHNLPYTDPRGTGKIPKLLLHRMVPNAHYSIWLDGKLELVVDPYQ  120

Query  1644  ILERFLWRRNASFAISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAA  1823
             ILER LWR+NA FAIS+HY+ FDVF EAEANKAAGK++NASIDFQ +FYK EGLTP++ A
Sbjct  121   ILERLLWRKNAIFAISKHYRCFDVFVEAEANKAAGKYENASIDFQNDFYKNEGLTPYAEA  180

Query  1824  KFPITSDVPEGCVII  1868
             K P  SDVPEGCVI+
Sbjct  181   KLPFISDVPEGCVIV  195



>ref|XP_008461976.1| PREDICTED: uncharacterized protein LOC103500457 [Cucumis melo]
Length=465

 Score =   292 bits (747),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 166/365 (45%), Positives = 231/365 (63%), Gaps = 18/365 (5%)
 Frame = +3

Query  996   PPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPV--LYLNYI-HEETLsenefggsg  1166
             PP +  +R    PC V +    E++A +     F  V    L +I HEE  SE +     
Sbjct  98    PPTSKHRRKQHFPCDVEF---AESVAYLVEPGGFMNVTQFSLEFIEHEEKESETDLYMPR  154

Query  1167  fggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAI  1346
             FGG+ +L +R+ S+    +  +HCGF+KG     +T FD+D+KD+  M+ C+ V V+S I
Sbjct  155   FGGHQTLEEREISF-YATNQKLHCGFIKGPPGYPSTGFDLDEKDVAYMKTCK-VAVSSCI  212

Query  1347  FGAFDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHD  1517
             FG+ D + +P  K ISEY+++NVCF MFVD+ T + L + G++ +    IGLW+IVVV +
Sbjct  213   FGSSDFLRRPTSKQISEYSKKNVCFVMFVDKQTLSKLSSEGNIPDDKGYIGLWKIVVVRN  272

Query  1518  LPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRH  1697
             LPY D RR GK+PK L HRLFP+ARYS+W+D K+ L VDP  I+E FLWR+ + +AIS H
Sbjct  273   LPYEDMRRTGKVPKFLSHRLFPSARYSIWLDSKMRLQVDPMLIIEYFLWRKKSEYAISNH  332

Query  1698  YKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFP--ITSDVPEGCVIIR  1871
             Y R  V+EE + NK   K+++ +ID Q  FY+ +GL  F  +     + S VPEG  I+R
Sbjct  333   YDRHCVWEEVQQNKRLNKYNHTAIDEQFAFYQSDGLVKFDPSDISSGLPSYVPEGSFIVR  392

Query  1872  EHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVV  2039
              H P+SNLF+CLWFNEVDRFT RDQ+SF+    K+R RTN    +N+ MF DCERR+   
Sbjct  393   AHTPMSNLFSCLWFNEVDRFTSRDQLSFAYTYLKLR-RTNQGTPFNLNMFKDCERRSLAK  451

Query  2040  QGYHR  2054
                HR
Sbjct  452   LFRHR  456



>ref|XP_004511213.1| PREDICTED: uncharacterized protein LOC101512141 isoform X3 [Cicer 
arietinum]
Length=398

 Score =   288 bits (738),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 232/369 (63%), Gaps = 15/369 (4%)
 Frame = +3

Query  984   FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLYLNYI-HEETLsenefgg  1160
             F +  PP  K+R    PC V +L   + +       +F+    L+Y+ HEE  S+ +   
Sbjct  28    FDIGRPPKSKRRKH-FPCDVGFLQSVDGLVEPKNYMNFT-WFSLDYVDHEEKTSKIDLFE  85

Query  1161  sgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVAS  1340
               FGG+P+L +R+ S+  + + +VHCGFVKG     +T FD+D+KD   M +C+ V V+S
Sbjct  86    PRFGGHPTLEERENSFHAK-NQTVHCGFVKGPLGYPSTGFDLDEKDRAYMFSCK-VAVSS  143

Query  1341  AIFGAFDLIHQPKN--ISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVV  1511
              IFG+ D + +P +  IS+Y+++NVCF MF+D+ T + L + G+  + +  IGLW++V+V
Sbjct  144   CIFGSSDFLRRPTSRLISQYSKDNVCFVMFLDDQTMSKLSSEGNQPDDTGHIGLWKVVIV  203

Query  1512  HDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAIS  1691
              +LPY D RR GK+PK L HRLFPN+RYS+W+D K+ L  DP  I+E FLWRR A +AIS
Sbjct  204   KNLPYEDMRRTGKVPKFLSHRLFPNSRYSIWLDSKMRLTSDPMLIIEYFLWRRKAEYAIS  263

Query  1692  RHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF--SAAKFPITSDVPEGCVI  1865
              HY R  V+EE   NK   K+++ +ID Q  FY+ +GL  F  S     + S VPEG  I
Sbjct  264   NHYDRHSVWEEVLQNKRLNKYNHTAIDEQFNFYQSDGLPKFDPSNPNNLLPSYVPEGSFI  323

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNF  2033
             +R H P+SNLF+CLWFNEVDRFT RDQ+SF+    K+R R N    + + MF DCERR  
Sbjct  324   VRAHTPMSNLFSCLWFNEVDRFTSRDQLSFAYTYLKLR-RMNPDRPFRLYMFKDCERRAL  382

Query  2034  VVQGYHRDI  2060
             V    HR +
Sbjct  383   VKLFRHRTV  391



>ref|XP_004511211.1| PREDICTED: uncharacterized protein LOC101512141 isoform X1 [Cicer 
arietinum]
 ref|XP_004511212.1| PREDICTED: uncharacterized protein LOC101512141 isoform X2 [Cicer 
arietinum]
Length=478

 Score =   288 bits (738),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 232/369 (63%), Gaps = 15/369 (4%)
 Frame = +3

Query  984   FTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLYLNYI-HEETLsenefgg  1160
             F +  PP  K+R    PC V +L   + +       +F+    L+Y+ HEE  S+ +   
Sbjct  108   FDIGRPPKSKRRKH-FPCDVGFLQSVDGLVEPKNYMNFT-WFSLDYVDHEEKTSKIDLFE  165

Query  1161  sgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVAS  1340
               FGG+P+L +R+ S+  + + +VHCGFVKG     +T FD+D+KD   M +C+ V V+S
Sbjct  166   PRFGGHPTLEERENSFHAK-NQTVHCGFVKGPLGYPSTGFDLDEKDRAYMFSCK-VAVSS  223

Query  1341  AIFGAFDLIHQPKN--ISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVV  1511
              IFG+ D + +P +  IS+Y+++NVCF MF+D+ T + L + G+  + +  IGLW++V+V
Sbjct  224   CIFGSSDFLRRPTSRLISQYSKDNVCFVMFLDDQTMSKLSSEGNQPDDTGHIGLWKVVIV  283

Query  1512  HDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAIS  1691
              +LPY D RR GK+PK L HRLFPN+RYS+W+D K+ L  DP  I+E FLWRR A +AIS
Sbjct  284   KNLPYEDMRRTGKVPKFLSHRLFPNSRYSIWLDSKMRLTSDPMLIIEYFLWRRKAEYAIS  343

Query  1692  RHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF--SAAKFPITSDVPEGCVI  1865
              HY R  V+EE   NK   K+++ +ID Q  FY+ +GL  F  S     + S VPEG  I
Sbjct  344   NHYDRHSVWEEVLQNKRLNKYNHTAIDEQFNFYQSDGLPKFDPSNPNNLLPSYVPEGSFI  403

Query  1866  IREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNF  2033
             +R H P+SNLF+CLWFNEVDRFT RDQ+SF+    K+R R N    + + MF DCERR  
Sbjct  404   VRAHTPMSNLFSCLWFNEVDRFTSRDQLSFAYTYLKLR-RMNPDRPFRLYMFKDCERRAL  462

Query  2034  VVQGYHRDI  2060
             V    HR +
Sbjct  463   VKLFRHRTV  471



>ref|XP_007224020.1| hypothetical protein PRUPE_ppa015084mg [Prunus persica]
 gb|EMJ25219.1| hypothetical protein PRUPE_ppa015084mg [Prunus persica]
Length=459

 Score =   287 bits (734),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 164/363 (45%), Positives = 224/363 (62%), Gaps = 14/363 (4%)
 Frame = +3

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLYLNYIHEETLsenefggs-gfgg  1175
             PP  K R    PC V +L   E +       +F+    L +I +E +  +       FGG
Sbjct  90    PPRSKHRKQYLPCEVGFLESIEYLVEPKEVMNFTQ-FSLQFIDQEGIPSHSNIYEPRFGG  148

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             + +L +R++S+   ++ ++HCGF+KG     +T FDID KD   M  C+ + V+S IFG+
Sbjct  149   HQTLEEREQSF-FAKNQTLHCGFIKGPPGFSSTGFDIDAKDKAYMNECK-IAVSSCIFGS  206

Query  1356  FDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPY  1526
              D + +P  K ISEY+++NVCF MFVDE T   L + G + + + RIGLWRIV+V +LPY
Sbjct  207   SDFLRRPTSKKISEYSKKNVCFVMFVDEQTLGKLSSEGHVPDVTGRIGLWRIVIVKNLPY  266

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GK+PK L HRLFP++ YS+W+D K+ L  DP  I+E FLWR  + +AIS HY+R
Sbjct  267   EDMRRTGKVPKFLSHRLFPHSWYSIWLDSKMRLNTDPMLIIEYFLWRTKSEYAISNHYER  326

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF--SAAKFPITSDVPEGCVIIREHI  1880
               V EE   NK   KF++ +ID Q  FY+ +GLT F  S    P+ S VPEG  I+R H 
Sbjct  327   HCVSEEVLQNKRLDKFNHTAIDEQFAFYQSDGLTKFDPSDPNTPLPSYVPEGSFIVRAHT  386

Query  1881  PISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGY  2048
             PI+NLF+CLWFNEVDRFT RDQ+SF+    K+R R N    + + MF DCERR  V    
Sbjct  387   PIANLFSCLWFNEVDRFTSRDQLSFAYTYLKLR-RMNPDRPFYLSMFKDCERRALVKLFR  445

Query  2049  HRD  2057
             HR+
Sbjct  446   HRE  448



>ref|XP_010684362.1| PREDICTED: uncharacterized protein LOC104898931 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=457

 Score =   287 bits (734),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 166/367 (45%), Positives = 225/367 (61%), Gaps = 29/367 (8%)
 Frame = +3

Query  1011  KKRTGPR-PCPVCYLPVEEAIALMPTAPSFSPVLYLNYIH--------EETLsenefggs  1163
             KKR+    PC V +    E I          P  YLN+ +        EE          
Sbjct  94    KKRSSKHYPCDVEFAKSVEYI--------LEPKDYLNFTNFDLDYIGKEEKYLTISPYKL  145

Query  1164  gfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASA  1343
              F G+ +L +R+ S+  R + S+HCGF+KG     +T FD+++KD   M++C  VVV+S 
Sbjct  146   RFNGHQTLEERERSFYAR-NQSLHCGFIKGPDGMESTGFDLEEKDQKYMKSC-AVVVSSC  203

Query  1344  IFGAFDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGD-LNSSSRIGLWRIVVVH  1514
             IFG+ D + +P  K ISEY++  VCF MF+D  T + L + G+ L+    +GLWRIVVV 
Sbjct  204   IFGSSDFLRRPTSKLISEYSKTLVCFVMFLDGETLSKLFSEGNVLDERGHMGLWRIVVVK  263

Query  1515  DLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISR  1694
             DLPY D RR GK+PKLL HRLFP++RYS+W+D K+ L  DP  ILE FLWR  + +AIS+
Sbjct  264   DLPYEDMRRTGKVPKLLAHRLFPSSRYSIWLDSKMRLNADPLLILEHFLWRTKSEYAISK  323

Query  1695  HYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAA--KFPITSDVPEGCVII  1868
             HY R  V+EE   NK   K+D+ +ID Q +FY+ +GLT F+A+     + S VPEG +I+
Sbjct  324   HYDRQCVWEEVLQNKRLNKYDHTAIDEQFKFYQADGLTKFNASDPHIALPSYVPEGSLIV  383

Query  1869  REHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWN----VEMFLDCERRNFV  2036
             R H P+SNLF+CLWFNEVDRFT RDQ+SF+    K++ R N +    + MF DCERR  V
Sbjct  384   RAHTPMSNLFSCLWFNEVDRFTSRDQLSFAHTYLKLK-RMNTDRPFFLNMFKDCERRALV  442

Query  2037  VQGYHRD  2057
                 HRD
Sbjct  443   KLFRHRD  449



>ref|XP_008221632.1| PREDICTED: uncharacterized protein LOC103321591 [Prunus mume]
 ref|XP_008221633.1| PREDICTED: uncharacterized protein LOC103321591 [Prunus mume]
 ref|XP_008221634.1| PREDICTED: uncharacterized protein LOC103321591 [Prunus mume]
Length=459

 Score =   286 bits (733),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 165/365 (45%), Positives = 225/365 (62%), Gaps = 14/365 (4%)
 Frame = +3

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLYLNYIHEETLsenefggs-gfgg  1175
             PP  K R    PC V +L   E +       +F+    L +I +E +  +       FGG
Sbjct  90    PPRSKHRKQYLPCEVGFLESVEYLVEPKEVMNFTQ-FSLEFIDQEGIPSHSNIYEPRFGG  148

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             + +L +R++S+   ++ ++HCGF+KG     +T FDID KD   M  C+ + V+S IFG+
Sbjct  149   HQTLEEREQSF-FAKNQTLHCGFIKGPPGFSSTGFDIDAKDKAYMNECK-IAVSSCIFGS  206

Query  1356  FDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPY  1526
              D + +P  K ISEY+++NVCF MFVDE T   L + G + + + +IGLWRIV+V +LPY
Sbjct  207   SDFLRRPTSKKISEYSKKNVCFVMFVDEQTLGKLSSEGHVPDVTGQIGLWRIVIVKNLPY  266

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GK+PK L HRLFP++ YS+W+D K+ L  DP  I+E FLWR  + +AIS HY+R
Sbjct  267   EDMRRTGKVPKFLSHRLFPHSWYSIWLDSKMRLNTDPMLIIEYFLWRTKSEYAISNHYER  326

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF--SAAKFPITSDVPEGCVIIREHI  1880
               V EE   NK   KF++ +ID Q  FY+ +GLT F  S    P+ S VPEG  I+R H 
Sbjct  327   HCVSEEVLQNKRLDKFNHTAIDEQFAFYQSDGLTKFDPSDPNTPLPSYVPEGSFIVRAHT  386

Query  1881  PISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGY  2048
             PISNLF+CLWFNEVDRFT RDQ+SF+    K+R R N    + + MF DCERR  V    
Sbjct  387   PISNLFSCLWFNEVDRFTSRDQLSFAYTYLKLR-RMNPDRPFYLSMFKDCERRALVKLFR  445

Query  2049  HRDIL  2063
             HR+ L
Sbjct  446   HREEL  450



>ref|XP_004298435.1| PREDICTED: uncharacterized protein LOC101306816 [Fragaria vesca 
subsp. vesca]
Length=462

 Score =   286 bits (733),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 164/368 (45%), Positives = 226/368 (61%), Gaps = 15/368 (4%)
 Frame = +3

Query  987   TLPPPPADKKRTGPRPCPVCYLPVEEAIALM--PTAPSFSPVLYLNYI-HEETLsenefg  1157
             T   PPAD K    +    C + ++E++  +  P          L YI  EE LS +   
Sbjct  89    TKESPPADGKSKHRKKYVPCEIGLKESVDFIKEPREVMNFTQFSLEYIDQEERLSSSGVY  148

Query  1158  gsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVA  1337
                FGG+P+L +R+ S+    + ++HCGFV+G     +T FDID KD   M  C+ V V+
Sbjct  149   EPSFGGHPTLEERERSF-YAVNQTLHCGFVRGPAASSSTGFDIDAKDKAYMNGCK-VAVS  206

Query  1338  SAIFGAFDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVV  1508
             S IFG+ D + +P  + IS+Y+++NVCF MF+DE T A + + G + + +  IGLW+IV+
Sbjct  207   SCIFGSSDFLRRPTSRKISDYSKKNVCFVMFLDEETLAKVTSEGHVPDDTGHIGLWKIVI  266

Query  1509  VHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAI  1688
             V +LPY D RR GK+PKLL HRLFP++ YS+W+D KL L  DP QI+E FLWR  + FAI
Sbjct  267   VKNLPYADMRRTGKVPKLLSHRLFPSSWYSIWLDSKLRLNTDPMQIIEHFLWRAKSEFAI  326

Query  1689  SRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAA--KFPITSDVPEGCV  1862
             S HY R  V+EE   NK   K+++  ID Q  FY+ +GL  F+++    P+ S VPEG  
Sbjct  327   SNHYDRHCVWEEVLQNKRLNKYNHKMIDEQFRFYQSDGLVMFNSSDPNTPLPSYVPEGSF  386

Query  1863  IIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRN  2030
             I+R H P+SNLF+CLWFNEVDRFT RDQ+SF+    K+R R N    + + MF DCERR 
Sbjct  387   IVRAHTPMSNLFSCLWFNEVDRFTSRDQLSFAYTFLKLR-RMNPDRPFYLNMFKDCERRA  445

Query  2031  FVVQGYHR  2054
                   HR
Sbjct  446   LTKLFRHR  453



>ref|XP_008352988.1| PREDICTED: uncharacterized protein LOC103416523 [Malus domestica]
Length=452

 Score =   286 bits (731),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 164/363 (45%), Positives = 223/363 (61%), Gaps = 14/363 (4%)
 Frame = +3

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLYLNYIHEETLsenefggs-gfgg  1175
             PP  K+R    PC V  L   E +       +F+    L YI +E L          FGG
Sbjct  86    PPRSKRRAKYLPCEVGLLESVEYLVEPWEVRNFTH-FSLEYIDQEGLPSRSNIYKPRFGG  144

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             + +L +R++S+   ++ ++HCGFVKG     ++ FD+D KD   M  C+ +VV+S IFG+
Sbjct  145   HQTLEEREQSF-FAKNQTLHCGFVKGPLGFSSSGFDLDVKDKAYMNGCK-IVVSSCIFGS  202

Query  1356  FDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPY  1526
              D + +P  K +SEY+++NVCF MFVDE T A L   G + + + RIGLWR V+V +LPY
Sbjct  203   SDFLRRPTSKKMSEYSKKNVCFVMFVDEQTLAKLSTEGHVPDDTGRIGLWRXVIVKNLPY  262

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GK+PKLL HRLFPN+ YS+W+D K+ L  DP  I+E FLWR  + +AIS HY R
Sbjct  263   EDMRRTGKVPKLLSHRLFPNSWYSIWLDSKMRLNTDPMLIIEYFLWRTKSEYAISNHYGR  322

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF--SAAKFPITSDVPEGCVIIREHI  1880
               V++E   NK   K+++ +ID Q  FY+ +GLT F  S    P+ S VPEG  I+R H 
Sbjct  323   HCVWDEVLQNKRLDKYNHTAIDEQFTFYQSDGLTKFDPSDPNTPLPSYVPEGSFIVRAHT  382

Query  1881  PISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGY  2048
             PISNLF+CLWFNEV+RFT RDQ+SF+    K+R R N    + + MF DCERR       
Sbjct  383   PISNLFSCLWFNEVNRFTSRDQLSFAYTYLKLR-RMNPERPFYLNMFKDCERRALTKLFQ  441

Query  2049  HRD  2057
             HR+
Sbjct  442   HRE  444



>ref|XP_008368244.1| PREDICTED: uncharacterized protein LOC103431852 [Malus domestica]
Length=452

 Score =   285 bits (730),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 164/363 (45%), Positives = 223/363 (61%), Gaps = 14/363 (4%)
 Frame = +3

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLYLNYIHEETLsenefggs-gfgg  1175
             PP  K+R    PC V  L   E +       +F+    L YI +E L          FGG
Sbjct  86    PPRSKRRAKYLPCEVGLLESVEYLVEPWEVRNFTH-FSLEYIDQEGLPSRSNIYKPRFGG  144

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             + +L +R++S+   ++ ++HCGFVKG     ++ FD+D KD   M  C+ +VV+S IFG+
Sbjct  145   HQTLEEREQSF-FAKNQTLHCGFVKGPLGFSSSGFDLDVKDKAYMNGCK-IVVSSCIFGS  202

Query  1356  FDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPY  1526
              D + +P  K +SEY+++NVCF MFVDE T A L   G + + + RIGLWR V+V +LPY
Sbjct  203   SDFLRRPTSKKMSEYSKKNVCFVMFVDEQTLAKLSTEGHVPDDTGRIGLWRXVIVKNLPY  262

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GK+PKLL HRLFPN+ YS+W+D K+ L  DP  I+E FLWR  + +AIS HY R
Sbjct  263   EDMRRTGKVPKLLSHRLFPNSWYSIWLDSKMRLNTDPMLIIEYFLWRTKSEYAISNHYGR  322

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF--SAAKFPITSDVPEGCVIIREHI  1880
               V++E   NK   K+++ +ID Q  FY+ +GLT F  S    P+ S VPEG  I+R H 
Sbjct  323   HCVWDEVLQNKRLDKYNHTAIDEQFTFYQSDGLTKFDPSDPNTPLPSYVPEGSFIVRAHT  382

Query  1881  PISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGY  2048
             PISNLF+CLWFNEV+RFT RDQ+SF+    K+R R N    + + MF DCERR       
Sbjct  383   PISNLFSCLWFNEVNRFTSRDQLSFAYTYLKLR-RMNPERPFYLNMFKDCERRALTKLFQ  441

Query  2049  HRD  2057
             HR+
Sbjct  442   HRE  444



>ref|XP_002976845.1| hypothetical protein SELMODRAFT_416871 [Selaginella moellendorffii]
 gb|EFJ21955.1| hypothetical protein SELMODRAFT_416871 [Selaginella moellendorffii]
Length=429

 Score =   284 bits (727),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 159/359 (44%), Positives = 222/359 (62%), Gaps = 21/359 (6%)
 Frame = +3

Query  1026  PRPCPVCYLPVEEAIALMPTAPSF----SPVLYLNYIHEETLsenefggs-gfggYPSLR  1190
             P+P   C +PV      +   PSF    S +  L YI  + ++E +      FGGY + +
Sbjct  53    PKPIHRCSIPVARNPQFVQI-PSFRHDSSILRKLTYITNDRVAEADQSKRPLFGGYQTWK  111

Query  1191  QRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIH  1370
             +RDES+ I+ +M VHCGF+        +  DI  +D   ++ CE  VVAS IF  +D+ H
Sbjct  112   ERDESFKIKPAMQVHCGFMNN------SGGDIHPRDKTYLKRCE-FVVASGIFDGYDMPH  164

Query  1371  QPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSR----IGLWRIVVVHDLPYTDAR  1538
             QP N+S+ +R   CF M VDE +   ++  G L    +     G+WR+V++ +LPY + R
Sbjct  165   QPSNLSDASRSLFCFAMVVDEISLDSIKAEGLLTEDDKGGRWSGIWRLVLLKNLPYDEPR  224

Query  1539  RNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVF  1718
             RNGK+PKLL HR+FP A+YS+WIDGK+ELVVDP  ILER+LWR    FAI+RH     ++
Sbjct  225   RNGKVPKLLTHRIFPAAKYSIWIDGKMELVVDPILILERYLWRGGHKFAIARHKHHKSIY  284

Query  1719  EEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLF  1898
             EEA+ANK   ++    ID  +E YK+EG+ P+S AK P+ SDVPEG VIIREH P++NLF
Sbjct  285   EEADANKRRKRYARPLIDKHMEIYKREGMQPWSKAKLPVLSDVPEGAVIIREHTPLTNLF  344

Query  1899  TCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
              CLWFNEV+RFTPRDQ+SF  V  ++    ++ + MF +CE     V   H+   EH +
Sbjct  345   CCLWFNEVNRFTPRDQLSFGYVVHRLNG--SFPLFMFPNCEYNALFV--LHKHTREHSS  399



>ref|XP_010257167.1| PREDICTED: uncharacterized protein LOC104597382 [Nelumbo nucifera]
 ref|XP_010257178.1| PREDICTED: uncharacterized protein LOC104597382 [Nelumbo nucifera]
 ref|XP_010257185.1| PREDICTED: uncharacterized protein LOC104597382 [Nelumbo nucifera]
 ref|XP_010257194.1| PREDICTED: uncharacterized protein LOC104597382 [Nelumbo nucifera]
Length=467

 Score =   285 bits (730),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 151/305 (50%), Positives = 200/305 (66%), Gaps = 12/305 (4%)
 Frame = +3

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             + +L +R+ES+  R + ++HCGFVKG +   +T FD+ + D   M  C  VVV+S IFG+
Sbjct  159   HQTLEEREESFYAR-NQTLHCGFVKGPEGSPSTGFDLCENDKEYMSTCH-VVVSSCIFGS  216

Query  1356  FDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPY  1526
              D + +P  K ISEY++ NVCF MF+DE T A L + G + N    IGLWR VVV +LPY
Sbjct  217   SDYLRRPTSKKISEYSKNNVCFVMFLDEQTMATLSSEGHVPNDRGYIGLWRTVVVRNLPY  276

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR+GK+PK L HRLFP+ARYS+W+D K+ L  DP  I+E FLWR+ + +AIS HY R
Sbjct  277   VDMRRSGKVPKFLSHRLFPSARYSIWLDSKMRLHTDPMLIIEYFLWRKGSEYAISNHYSR  336

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF--SAAKFPITSDVPEGCVIIREHI  1880
               V+EE   NK   K+++ +ID Q  FY+ +GL  F  S    P+ S VPEG  I+R H 
Sbjct  337   HSVWEEVLQNKRLNKYNHTAIDEQFAFYQSDGLNIFDPSDPNTPLPSYVPEGSFIVRAHT  396

Query  1881  PISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGY  2048
             P+SNLF+CLWFNEVDRFT RDQ+SF+    K+R R N    +++ MF DCERR  V    
Sbjct  397   PMSNLFSCLWFNEVDRFTSRDQLSFAYTYLKLR-RMNPDRPFSLNMFEDCERRALVKLFQ  455

Query  2049  HRDIL  2063
             HR  L
Sbjct  456   HRTTL  460



>ref|XP_002980574.1| hypothetical protein SELMODRAFT_420226 [Selaginella moellendorffii]
 gb|EFJ18225.1| hypothetical protein SELMODRAFT_420226 [Selaginella moellendorffii]
Length=429

 Score =   284 bits (727),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 158/359 (44%), Positives = 222/359 (62%), Gaps = 21/359 (6%)
 Frame = +3

Query  1026  PRPCPVCYLPVEEAIALMPTAPSF----SPVLYLNYIHEETLsenefggs-gfggYPSLR  1190
             P+P   C +PV      +   PSF    S +  L YI  + +++ +      FGGY + +
Sbjct  53    PKPIHRCSIPVARNPQFVQI-PSFRHDSSILRKLTYITNDRVAKGDQSKRPLFGGYQTWK  111

Query  1191  QRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIH  1370
             +RDES+ I+ +M VHCGF+        +  DI  +D   ++ CE  VVAS IF  +D+ H
Sbjct  112   ERDESFKIKPAMQVHCGFMNN------SGGDIHPRDKTYLKRCE-FVVASGIFDGYDMPH  164

Query  1371  QPKNISEYARENVCFYMFVDEGTEAFLRNSGDLNSSSR----IGLWRIVVVHDLPYTDAR  1538
             QP N+S+ +R   CF M VDE +   ++  G L    +     G+WR+V++ +LPY + R
Sbjct  165   QPSNLSDASRSLFCFAMVVDEISLDSIKAEGLLTEDDKGGRWSGIWRLVLLKNLPYDEPR  224

Query  1539  RNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVF  1718
             RNGK+PKLL HR+FP A+YS+WIDGK+ELVVDP  ILER+LWR    FAI+RH     ++
Sbjct  225   RNGKVPKLLTHRIFPAAKYSIWIDGKMELVVDPILILERYLWRGGHKFAIARHKHHKSIY  284

Query  1719  EEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPISNLF  1898
             EEA+ANK   ++    ID  +E YK+EG+ P+S AK P+ SDVPEG VIIREH P++NLF
Sbjct  285   EEADANKRRKRYARPLIDKHMEIYKREGMQPWSKAKLPVLSDVPEGAVIIREHTPLTNLF  344

Query  1899  TCLWFNEVDRFTPRDQISFSTVRDKIRSRTNWNVEMFLDCERRNFVVQGYHRDILEHRA  2075
              CLWFNEV+RFTPRDQ+SF  V  ++    ++ + MF +CE     V   H+   EH +
Sbjct  345   CCLWFNEVNRFTPRDQLSFGYVVHRLNG--SFPLFMFPNCEYNALFV--LHKHTREHSS  399



>gb|AET02842.2| transmembrane protein [Medicago truncatula]
Length=470

 Score =   283 bits (725),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 163/363 (45%), Positives = 227/363 (63%), Gaps = 14/363 (4%)
 Frame = +3

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLYLNYI-HEETLsenefggsgfgg  1175
             PP  K+R    PC V  L   + +       +F+    L+Y+  EE   EN      FGG
Sbjct  106   PPKSKRRKH-FPCEVGLLQSVDGLVEPKNYMNFT-WFSLDYVDREEKTMENNLFEPRFGG  163

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             +P+L +R+ S+   ++ ++HCGFVKG     +T FD+D+KD   M +C+ V V+S IFG+
Sbjct  164   HPTLEERENSF-YAKNQTIHCGFVKGPPGYPSTGFDLDEKDRAYMSSCK-VAVSSCIFGS  221

Query  1356  FDLIHQPKN--ISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPY  1526
              D + +P +  IS+Y+++NVCF MF+D+ T + L + G+  +    IGLW++VVV +LPY
Sbjct  222   SDFLRRPTSRLISQYSKDNVCFVMFLDDQTLSKLSSEGNPPDERGYIGLWKVVVVENLPY  281

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GK+PK L HRLFPN+RYS+W+D K+ L  DP  I+E FLWRR A +AIS HY R
Sbjct  282   EDMRRTGKVPKFLSHRLFPNSRYSIWLDSKMRLNSDPMLIIEYFLWRRKAEYAISNHYDR  341

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKF-PITSDVPEGCVIIREHIP  1883
               V+EE   NK   K+++ +ID Q +FY+ +GL  F  +   P+ S VPEG  I+R H P
Sbjct  342   HSVWEEVLQNKRLNKYNHTAIDEQFKFYESDGLPKFEPSNHNPLPSYVPEGSFIVRAHTP  401

Query  1884  ISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGYH  2051
             +SNLF+CLWFNEVDRFT RDQ+SF+    K+R R N      + MF DCERR  V    H
Sbjct  402   MSNLFSCLWFNEVDRFTSRDQLSFAYTYLKLR-RMNPDRPLQLYMFKDCERRALVKLFRH  460

Query  2052  RDI  2060
             R +
Sbjct  461   RAV  463



>ref|XP_004139647.1| PREDICTED: uncharacterized protein LOC101206756 [Cucumis sativus]
Length=465

 Score =   283 bits (724),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 164/365 (45%), Positives = 227/365 (62%), Gaps = 18/365 (5%)
 Frame = +3

Query  996   PPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPV--LYLNYIH-EETLsenefggsg  1166
             PP +  +R    PC V +    E++A +     F  V    L +I  EE   E +     
Sbjct  98    PPTSKHRRKQHFPCDVEF---AESVAYLVEPEGFMNVTQFSLEFIEREEKELEADLHMPR  154

Query  1167  fggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAI  1346
             FGG+ +L +R+ S+    +  +HCGF+KG     +T FD+D+KD   M+ C+ V V+S I
Sbjct  155   FGGHQTLEEREISF-YATNQKLHCGFIKGPPGYPSTGFDLDEKDDAYMKTCK-VAVSSCI  212

Query  1347  FGAFDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHD  1517
             FG+ D + +P  K ISEY+++NVCF MFVD+ T + L   G++ +    IGLW+IVVV +
Sbjct  213   FGSSDFLRRPTSKQISEYSKKNVCFVMFVDKQTLSKLSAEGNIPDDKGCIGLWKIVVVSN  272

Query  1518  LPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRH  1697
             LPY D RR GK+PK L HRLFP+ARYS+W+D K+ L VDP  I+E FLWR+ + +AIS H
Sbjct  273   LPYEDMRRTGKVPKFLSHRLFPSARYSIWLDSKMRLQVDPMLIIEYFLWRKKSEYAISNH  332

Query  1698  YKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF--SAAKFPITSDVPEGCVIIR  1871
             Y R  V+EE + NK   K+++ +ID Q  FY+ +GL  F  S     + S VPEG  I+R
Sbjct  333   YDRHCVWEEVQQNKRLNKYNHTAIDEQFAFYQSDGLVKFDPSDINSGLPSYVPEGSFIVR  392

Query  1872  EHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVV  2039
              H P+SNLF+CLWFNEV+RFT RDQ+SF+    K+R RTN    +N+ MF DCERR+   
Sbjct  393   AHTPMSNLFSCLWFNEVNRFTSRDQLSFAYTYLKLR-RTNQGIPFNLNMFKDCERRSLAK  451

Query  2040  QGYHR  2054
                HR
Sbjct  452   LFRHR  456



>ref|XP_003628366.1| hypothetical protein MTR_8g055930 [Medicago truncatula]
Length=469

 Score =   283 bits (723),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 161/362 (44%), Positives = 225/362 (62%), Gaps = 13/362 (4%)
 Frame = +3

Query  999   PPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLYLNYI-HEETLsenefggsgfgg  1175
             PP  K+R    PC V  L   + +       +F+    L+Y+  EE   EN      FGG
Sbjct  106   PPKSKRRKH-FPCEVGLLQSVDGLVEPKNYMNFT-WFSLDYVDREEKTMENNLFEPRFGG  163

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             +P+L +R+ S+   ++ ++HCGFVKG     +T FD+D+KD   M +C+ V V+S IFG+
Sbjct  164   HPTLEERENSF-YAKNQTIHCGFVKGPPGYPSTGFDLDEKDRAYMSSCK-VAVSSCIFGS  221

Query  1356  FDLIHQPKN--ISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPY  1526
              D + +P +  IS+Y+++NVCF MF+D+ T + L + G+  +    IGLW++VVV +LPY
Sbjct  222   SDFLRRPTSRLISQYSKDNVCFVMFLDDQTLSKLSSEGNPPDERGYIGLWKVVVVENLPY  281

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GK+PK L HRLFPN+RYS+W+D K+ L  DP  I+E FLWRR A +AIS HY R
Sbjct  282   EDMRRTGKVPKFLSHRLFPNSRYSIWLDSKMRLNSDPMLIIEYFLWRRKAEYAISNHYDR  341

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAKFPITSDVPEGCVIIREHIPI  1886
               V+EE   NK   K+++ +ID Q +FY+ +GL  F  +      +VPEG  I+R H P+
Sbjct  342   HSVWEEVLQNKRLNKYNHTAIDEQFKFYESDGLPKFEPSNHNPLPNVPEGSFIVRAHTPM  401

Query  1887  SNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGYHR  2054
             SNLF+CLWFNEVDRFT RDQ+SF+    K+R R N      + MF DCERR  V    HR
Sbjct  402   SNLFSCLWFNEVDRFTSRDQLSFAYTYLKLR-RMNPDRPLQLYMFKDCERRALVKLFRHR  460

Query  2055  DI  2060
              +
Sbjct  461   AV  462



>ref|XP_002522418.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39910.1| conserved hypothetical protein [Ricinus communis]
Length=363

 Score =   279 bits (713),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 200/304 (66%), Gaps = 12/304 (4%)
 Frame = +3

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             + +L +R++S+  R + ++HCGFV+G     +  FD+D+K    M  C  VVV+S IFG+
Sbjct  56    HQTLEEREKSFYAR-NQTLHCGFVQGTPGLPSNGFDLDEKHRAYMSTCR-VVVSSCIFGS  113

Query  1356  FDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPY  1526
              D + +P  K ISE++++NVCF MFVDE T++ L + G + + S  IGLW++VVV +LPY
Sbjct  114   SDFLRRPTSKKISEFSKKNVCFVMFVDESTQSKLSSDGHIPDDSGHIGLWKLVVVRNLPY  173

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GK+PK L HRLFP++ YS+W+D K+ L  DP  ILE FLWR  + +AIS HY R
Sbjct  174   EDMRRTGKVPKFLSHRLFPSSSYSIWLDSKMRLNTDPMLILEYFLWRTRSEYAISNHYDR  233

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAA--KFPITSDVPEGCVIIREHI  1880
               V+EE   NK   K+++ +ID Q  FY+ +GLT F ++    P+ S VPEG  I+R H 
Sbjct  234   HCVWEEVLQNKHLNKYNHTAIDEQFNFYQSDGLTKFDSSDPNTPLPSYVPEGSFIVRAHT  293

Query  1881  PISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGY  2048
             P+SNLF+CLWFNEVDRFT RDQ+SF+    K+R R N    + + MF DCERR       
Sbjct  294   PMSNLFSCLWFNEVDRFTSRDQLSFAYTYLKLR-RLNPDHLFYLNMFKDCERRALAKLFR  352

Query  2049  HRDI  2060
             HR +
Sbjct  353   HRAL  356



>ref|XP_004173659.1| PREDICTED: uncharacterized LOC101206756, partial [Cucumis sativus]
Length=357

 Score =   279 bits (713),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 146/302 (48%), Positives = 201/302 (67%), Gaps = 12/302 (4%)
 Frame = +3

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             + +L +R+ S+    +  +HCGF+KG     +T FD+D+KD   M+ C+ V V+S IFG+
Sbjct  50    HQTLEEREISF-YATNQKLHCGFIKGPPGYPSTGFDLDEKDDAYMKTCK-VAVSSCIFGS  107

Query  1356  FDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPY  1526
              D + +P  K ISEY+++NVCF MFVD+ T + L   G++ +    IGLW+IVVV +LPY
Sbjct  108   SDFLRRPTSKQISEYSKKNVCFVMFVDKQTLSKLSAEGNIPDDKGCIGLWKIVVVSNLPY  167

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GK+PK L HRLFP+ARYS+W+D K+ L VDP  I+E FLWR+ + +AIS HY R
Sbjct  168   EDMRRTGKVPKFLSHRLFPSARYSIWLDSKMRLQVDPMLIIEYFLWRKKSEYAISNHYDR  227

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF--SAAKFPITSDVPEGCVIIREHI  1880
               V+EE + NK   K+++ +ID Q  FY+ +GL  F  S     + S VPEG  I+R H 
Sbjct  228   HCVWEEVQQNKRLNKYNHTAIDEQFAFYQSDGLVKFDPSDINSGLPSYVPEGSFIVRAHT  287

Query  1881  PISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGY  2048
             P+SNLF+CLWFNEV+RFT RDQ+SF+    K+R RTN    +N+ MF DCERR+      
Sbjct  288   PMSNLFSCLWFNEVNRFTSRDQLSFAYTYLKLR-RTNQGIPFNLNMFKDCERRSLAKLFR  346

Query  2049  HR  2054
             HR
Sbjct  347   HR  348



>ref|XP_010044734.1| PREDICTED: uncharacterized protein LOC104433624 [Eucalyptus grandis]
 gb|KCW86837.1| hypothetical protein EUGRSUZ_B03434 [Eucalyptus grandis]
Length=473

 Score =   283 bits (723),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 169/371 (46%), Positives = 231/371 (62%), Gaps = 23/371 (6%)
 Frame = +3

Query  981   GFTLPPPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPV--LYLNYIHEETLsenef  1154
             G  +   P  K R    PC V    + E++  +    SF       L+YI +E   EN F
Sbjct  109   GSDVGKKPTSKHRKRHLPCEVT---LSESVNNLVEPSSFMNFTQFSLDYIEKE---ENSF  162

Query  1155  ggsgfggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVV  1334
                 FGG+ +L +R+ S+    S  +HCGFVKG  P  +T FD+D+KD   M+ C+ VVV
Sbjct  163   SIPRFGGHQTLGERENSFHAI-SQKLHCGFVKG--PA-STGFDLDEKDRIYMDTCK-VVV  217

Query  1335  ASAIFGAFDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIV  1505
             +S IFG+ D + +P  K ++EY+++NVCF MFVDE T + L + G+  + +  IGLW+IV
Sbjct  218   SSCIFGSSDFLRRPTTKRMTEYSKKNVCFVMFVDEETLSTLSSEGNTPDDTGHIGLWKIV  277

Query  1506  VVHDLPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFA  1685
             VV +LPY D RR GK+PKLL HRLFP++RYS+W+D K+ L  DP  I+E FLWR  + +A
Sbjct  278   VVKNLPYKDMRRTGKVPKLLSHRLFPSSRYSIWLDSKMRLNTDPMLIIEYFLWRTKSEYA  337

Query  1686  ISRHYKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAA--KFPITSDVPEGC  1859
             IS HY R  V+EE   NK   K+++ +ID Q  FY+ +GLT F       P+ S VPEG 
Sbjct  338   ISNHYDRHCVWEEVLQNKRLNKYNHTAIDEQFLFYQSDGLTKFDPTDPNTPLPSYVPEGS  397

Query  1860  VIIREHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERR  2027
              I+R H P+SNLF+CLWFNEVDRFT RDQ+SF+    K+R R N    + + MF DCERR
Sbjct  398   FIVRAHTPMSNLFSCLWFNEVDRFTSRDQLSFAYTYLKLR-RLNPDRQFYLHMFKDCERR  456

Query  2028  NFVVQGYHRDI  2060
               V   +HR++
Sbjct  457   ALVKLFHHREL  467



>ref|NP_001130321.1| hypothetical protein [Zea mays]
 gb|ACF78504.1| unknown [Zea mays]
 gb|AFW73413.1| hypothetical protein ZEAMMB73_602374 [Zea mays]
Length=478

 Score =   283 bits (723),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 163/362 (45%), Positives = 225/362 (62%), Gaps = 14/362 (4%)
 Frame = +3

Query  1002  PADKKRTGPR--PCPVCYLPVEEAIALMPTAPSFSPVLYLNYIHEETLsenefggsgfgg  1175
             P  +K+   R  PC + +LP  + +       +F+       + EE L  N+F    FGG
Sbjct  93    PKSRKKLHKRYAPCQIQFLPSVDDLVEPAHYGNFTQFSLSYILKEEVLLHNDFFEPLFGG  152

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             Y SLR R+E+Y  ++  ++HCGFV+      +T FD+D+ D   M+ C  V V+S IFG+
Sbjct  153   YQSLRDREETYHAKDQ-TLHCGFVRWPDDYPSTGFDLDENDRRYMDTCH-VAVSSCIFGS  210

Query  1356  FDLIHQPKN--ISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPY  1526
              D + +P    I  YA++NVCF MF+DE T A L + G + + +  IGLWR VVV +LPY
Sbjct  211   SDYLRRPTKSRIGSYAKKNVCFVMFMDELTLATLSSEGHVPDGNGFIGLWRSVVVKNLPY  270

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GK+PK L HRLFP+A YS+W+D KL L  DP  I+E FLWR+ A +AIS HY R
Sbjct  271   KDMRRAGKVPKFLAHRLFPSATYSIWLDSKLRLHADPMLIIEYFLWRKKAEYAISMHYDR  330

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFS-AAKFPIT-SDVPEGCVIIREHI  1880
               V+EE   NK   K+++ +ID Q  FY+ +GL  F+ + + P+  S VPEG  I+R H 
Sbjct  331   SCVWEEVVQNKRLNKYNHTAIDEQFHFYQSDGLVKFNDSGQLPVLPSYVPEGSFIVRAHT  390

Query  1881  PISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGY  2048
             P+SNLF+CLWFNEV+RFT RDQ+SF+    K+R RTN    +++ MF DCERR  V   +
Sbjct  391   PMSNLFSCLWFNEVNRFTSRDQLSFTYTYLKLR-RTNPGKPFHLNMFKDCERRAIVKLFH  449

Query  2049  HR  2054
             HR
Sbjct  450   HR  451



>gb|EYU22427.1| hypothetical protein MIMGU_mgv1a009507mg [Erythranthe guttata]
Length=339

 Score =   278 bits (710),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 143/303 (47%), Positives = 207/303 (68%), Gaps = 13/303 (4%)
 Frame = +3

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKG-VKPGRATSFDIDDKDLGEMEACEGVVVASAIFG  1352
             + SL+ R++SY+   + ++HCGFVK   +   +T FD+++KD   M  C+ +VV+S IFG
Sbjct  37    HQSLKDREKSYNA-TNQTIHCGFVKFPNETSSSTGFDLNEKDKEYMNTCK-IVVSSCIFG  94

Query  1353  AFDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLP  1523
             + D + +P  K ISEY+++NVCF MFVDE + A L + G++ +    IGLW+IVVV +LP
Sbjct  95    SSDFLRRPTSKVISEYSKKNVCFVMFVDEQSLAKLSSEGNVVDERGNIGLWKIVVVKNLP  154

Query  1524  YTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYK  1703
             Y D R+ GK+PK L HRLFP++RYS+W+D KL L  DP +I+E FLWR+ + +AIS HY 
Sbjct  155   YNDNRKTGKVPKFLSHRLFPSSRYSIWLDSKLRLNADPMKIIEYFLWRKGSEYAISNHYI  214

Query  1704  RFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAA--KFPITSDVPEGCVIIREH  1877
             R  V++E   NK   K++++++D Q  FY+ +GLT + ++  K P+ S VPEG  I+R H
Sbjct  215   RHCVWDEILQNKRLNKYNHSALDEQFYFYQSDGLTKYDSSDPKIPLPSFVPEGSFIVRAH  274

Query  1878  IPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQG  2045
              P+SNLF+CLWFNEVDRFT RDQ+SF+    K++ R N    +++ MF DCERR      
Sbjct  275   TPMSNLFSCLWFNEVDRFTSRDQLSFAYTYLKLK-RLNPDKRFHLNMFKDCERRTITKLF  333

Query  2046  YHR  2054
              HR
Sbjct  334   RHR  336



>ref|XP_007153601.1| hypothetical protein PHAVU_003G049500g [Phaseolus vulgaris]
 gb|ESW25595.1| hypothetical protein PHAVU_003G049500g [Phaseolus vulgaris]
Length=484

 Score =   282 bits (721),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 163/359 (45%), Positives = 226/359 (63%), Gaps = 14/359 (4%)
 Frame = +3

Query  1014  KRTGPRPCPVCYLPVEEAIALMPTAPSFSPVLYLNYI-HEETLsenefggsgfggYPSLR  1190
             KR    PC V +L   + + + P +   S    L Y+ HEE  S+N+     FGG+ +  
Sbjct  123   KRRKHFPCEVGFLESVDGL-VEPKSYMNSTWFSLEYVDHEERTSKNDLFEPRFGGHQTQE  181

Query  1191  QRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFDLIH  1370
             +R+ S+   ++ ++HCGFVKG     +T FDI+DKD   M  C+ V V+S IFG+ D + 
Sbjct  182   ERENSF-YAKNQTLHCGFVKGPPGHPSTGFDINDKDKAYMYKCK-VAVSSCIFGSSDFLR  239

Query  1371  QPKN--ISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPYTDARR  1541
             +P +  IS+Y+++NVCF MF+D+ T + L + G+  +    IGLW+IVVV +LP+ D RR
Sbjct  240   RPTSRLISQYSKDNVCFVMFLDDQTLSKLSSEGNRPDERGHIGLWKIVVVKNLPFEDMRR  299

Query  1542  NGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFDVFE  1721
              GK+PK L HRLFPN+RYS+W+D K+ L  DP  I+E FLWRR A +AIS HY R +V+E
Sbjct  300   TGKVPKFLSHRLFPNSRYSIWLDSKMRLNSDPMLIIEYFLWRRKAEYAISNHYDRHNVWE  359

Query  1722  EAEANKAAGKFDNASIDFQVEFYKKEGLTPFSAAK--FPITSDVPEGCVIIREHIPISNL  1895
             E   NK   K+++ +ID Q  FY+ +GL     +K   P+ S VPEG  IIR H P+SNL
Sbjct  360   EVLQNKRLNKYNHTAIDEQFNFYQSDGLPKVDPSKPNDPLPSYVPEGSFIIRAHTPLSNL  419

Query  1896  FTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGYHRDI  2060
             F+CLWFNEVDRFT RDQ+SF+    K+R R N    + + MF DCERR  V    HR +
Sbjct  420   FSCLWFNEVDRFTSRDQLSFAYTYLKLR-RMNPERPFQLYMFKDCERRALVKLFRHRSL  477



>gb|KGN44543.1| hypothetical protein Csa_7G328310 [Cucumis sativus]
Length=541

 Score =   282 bits (722),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 164/365 (45%), Positives = 227/365 (62%), Gaps = 18/365 (5%)
 Frame = +3

Query  996   PPPADKKRTGPRPCPVCYLPVEEAIALMPTAPSFSPV--LYLNYIH-EETLsenefggsg  1166
             PP +  +R    PC V +    E++A +     F  V    L +I  EE   E +     
Sbjct  174   PPTSKHRRKQHFPCDVEF---AESVAYLVEPEGFMNVTQFSLEFIEREEKELEADLHMPR  230

Query  1167  fggYPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAI  1346
             FGG+ +L +R+ S+    +  +HCGF+KG     +T FD+D+KD   M+ C+ V V+S I
Sbjct  231   FGGHQTLEEREISF-YATNQKLHCGFIKGPPGYPSTGFDLDEKDDAYMKTCK-VAVSSCI  288

Query  1347  FGAFDLIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHD  1517
             FG+ D + +P  K ISEY+++NVCF MFVD+ T + L   G++ +    IGLW+IVVV +
Sbjct  289   FGSSDFLRRPTSKQISEYSKKNVCFVMFVDKQTLSKLSAEGNIPDDKGCIGLWKIVVVSN  348

Query  1518  LPYTDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRH  1697
             LPY D RR GK+PK L HRLFP+ARYS+W+D K+ L VDP  I+E FLWR+ + +AIS H
Sbjct  349   LPYEDMRRTGKVPKFLSHRLFPSARYSIWLDSKMRLQVDPMLIIEYFLWRKKSEYAISNH  408

Query  1698  YKRFDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF--SAAKFPITSDVPEGCVIIR  1871
             Y R  V+EE + NK   K+++ +ID Q  FY+ +GL  F  S     + S VPEG  I+R
Sbjct  409   YDRHCVWEEVQQNKRLNKYNHTAIDEQFAFYQSDGLVKFDPSDINSGLPSYVPEGSFIVR  468

Query  1872  EHIPISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVV  2039
              H P+SNLF+CLWFNEV+RFT RDQ+SF+    K+R RTN    +N+ MF DCERR+   
Sbjct  469   AHTPMSNLFSCLWFNEVNRFTSRDQLSFAYTYLKLR-RTNQGIPFNLNMFKDCERRSLAK  527

Query  2040  QGYHR  2054
                HR
Sbjct  528   LFRHR  532



>ref|XP_002454281.1| hypothetical protein SORBIDRAFT_04g027980 [Sorghum bicolor]
 gb|EES07257.1| hypothetical protein SORBIDRAFT_04g027980 [Sorghum bicolor]
Length=478

 Score =   280 bits (715),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 161/362 (44%), Positives = 222/362 (61%), Gaps = 14/362 (4%)
 Frame = +3

Query  1002  PADKKRTGPR--PCPVCYLPVEEAIALMPTAPSFSPVLYLNYIHEETLsenefggsgfgg  1175
             P  +K+   R  PC + +LP  + +       +F+       + E+ L  N F    FGG
Sbjct  93    PKSRKKPHKRYAPCEIQFLPSVDDLVEPAHYGNFTQFSLSYILKEKVLLGNGFFEPVFGG  152

Query  1176  YPSLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGA  1355
             + SL  R+E+Y  ++  ++HCGFV+G     +T FD+D+ D   M  C  V V+S IFG+
Sbjct  153   HQSLGDREETYHAKDQ-TLHCGFVRGPDDYPSTGFDLDENDRRYMATCH-VAVSSCIFGS  210

Query  1356  FDLIHQPKN--ISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPY  1526
              D + +P    I  YA++NVCF MF+DE T A L + G + + +  IGLWR VVV +LPY
Sbjct  211   SDYLRRPTKSRIGSYAKKNVCFVMFMDELTMATLSSEGHMPDGNGFIGLWRSVVVKNLPY  270

Query  1527  TDARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKR  1706
              D RR GK+PK L HRLFP+A YS+W+D KL L  DP  I+E FLWR+ A +AIS HY R
Sbjct  271   KDMRRAGKVPKFLAHRLFPSAMYSIWLDSKLRLHADPMLIIEYFLWRKKAEYAISMHYDR  330

Query  1707  FDVFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF-SAAKFPIT-SDVPEGCVIIREHI  1880
               V+EE   NK   K+++ +ID Q  FY+ +GL  F ++ + P+  S VPEG  I+R H 
Sbjct  331   SCVWEEVLQNKRLNKYNHTAIDEQFHFYRSDGLVKFNNSGQLPVLPSYVPEGSFIVRAHT  390

Query  1881  PISNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGY  2048
             PISNLF+CLWFNEV+RFT RDQ+SF+    K+R RTN    +++ MF DCERR      +
Sbjct  391   PISNLFSCLWFNEVNRFTSRDQLSFTYTYLKLR-RTNPGKPFHLNMFKDCERRAIAKLFH  449

Query  2049  HR  2054
             HR
Sbjct  450   HR  451



>emb|CBI31972.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   279 bits (713),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 198/302 (66%), Gaps = 12/302 (4%)
 Frame = +3

Query  1182  SLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFD  1361
             SL +R++S+  R + ++HCGFVKG +   +T FD+D  D   M  C+ VVV+S IFG  D
Sbjct  158   SLEEREKSFYAR-NQTLHCGFVKGPEGSPSTGFDLDANDKTYMNTCK-VVVSSCIFGNSD  215

Query  1362  LIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPYTD  1532
              + +P  K ISEY+++NVCF MFVDE T + L + G+  +    IGLW+IVVV +LPY D
Sbjct  216   FLRRPTSKRISEYSKKNVCFVMFVDEQTLSKLSSEGNFPDDGGYIGLWKIVVVRNLPYKD  275

Query  1533  ARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFD  1712
              RR GK+PK L HRLFP++ YS+W+D K+ L  DP  ILE FLWR  + +AIS HY R  
Sbjct  276   MRRTGKVPKFLSHRLFPSSMYSIWLDSKMRLNTDPMLILEYFLWRMRSEYAISNHYDRHC  335

Query  1713  VFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF--SAAKFPITSDVPEGCVIIREHIPI  1886
             V+EE   NK   K+++++ID Q  FY+ +GLT F  S    PI S VPEG  I+R H P+
Sbjct  336   VWEEVLQNKRLNKYNHSAIDEQFNFYQSDGLTKFDPSDPNNPIPSYVPEGSFIVRAHTPM  395

Query  1887  SNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGYHR  2054
             SNLF+CLWFNEVDRFT RDQ+SF+    K+R R N    + + MF DCERR       H+
Sbjct  396   SNLFSCLWFNEVDRFTSRDQLSFAYTYLKLR-RMNPDRPFFLNMFKDCERRALAKLFRHK  454

Query  2055  DI  2060
              +
Sbjct  455   AV  456



>ref|XP_002274071.2| PREDICTED: uncharacterized protein LOC100243155 [Vitis vinifera]
 ref|XP_010652142.1| PREDICTED: uncharacterized protein LOC100243155 [Vitis vinifera]
Length=464

 Score =   279 bits (713),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 198/302 (66%), Gaps = 12/302 (4%)
 Frame = +3

Query  1182  SLRQRDESYDIRESMSVHCGFVKGVKPGRATSFDIDDKDLGEMEACEGVVVASAIFGAFD  1361
             SL +R++S+  R + ++HCGFVKG +   +T FD+D  D   M  C+ VVV+S IFG  D
Sbjct  159   SLEEREKSFYAR-NQTLHCGFVKGPEGSPSTGFDLDANDKTYMNTCK-VVVSSCIFGNSD  216

Query  1362  LIHQP--KNISEYARENVCFYMFVDEGTEAFLRNSGDL-NSSSRIGLWRIVVVHDLPYTD  1532
              + +P  K ISEY+++NVCF MFVDE T + L + G+  +    IGLW+IVVV +LPY D
Sbjct  217   FLRRPTSKRISEYSKKNVCFVMFVDEQTLSKLSSEGNFPDDGGYIGLWKIVVVRNLPYKD  276

Query  1533  ARRNGKIPKLLLHRLFPNARYSLWIDGKLELVVDPYQILERFLWRRNASFAISRHYKRFD  1712
              RR GK+PK L HRLFP++ YS+W+D K+ L  DP  ILE FLWR  + +AIS HY R  
Sbjct  277   MRRTGKVPKFLSHRLFPSSMYSIWLDSKMRLNTDPMLILEYFLWRMRSEYAISNHYDRHC  336

Query  1713  VFEEAEANKAAGKFDNASIDFQVEFYKKEGLTPF--SAAKFPITSDVPEGCVIIREHIPI  1886
             V+EE   NK   K+++++ID Q  FY+ +GLT F  S    PI S VPEG  I+R H P+
Sbjct  337   VWEEVLQNKRLNKYNHSAIDEQFNFYQSDGLTKFDPSDPNNPIPSYVPEGSFIVRAHTPM  396

Query  1887  SNLFTCLWFNEVDRFTPRDQISFSTVRDKIRSRTN----WNVEMFLDCERRNFVVQGYHR  2054
             SNLF+CLWFNEVDRFT RDQ+SF+    K+R R N    + + MF DCERR       H+
Sbjct  397   SNLFSCLWFNEVDRFTSRDQLSFAYTYLKLR-RMNPDRPFFLNMFKDCERRALAKLFRHK  455

Query  2055  DI  2060
              +
Sbjct  456   AV  457



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7980484609792