BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19495_g1_i3 len=1194 path=[1172:0-458 1631:459-544 1717:545-632
1805:633-675 1848:676-1193]

Length=1194
                                                                      Score     E

ref|XP_006849573.1|  hypothetical protein AMTR_s00024p00189140        52.4    6e-05   
ref|XP_008791878.1|  PREDICTED: uncharacterized protein LOC103708635  51.2    1e-04   
ref|XP_002285673.1|  PREDICTED: uncharacterized protein LOC100251830  51.2    1e-04   Vitis vinifera
ref|XP_010917246.1|  PREDICTED: uncharacterized protein LOC105041884  51.2    2e-04   
ref|XP_007220118.1|  hypothetical protein PRUPE_ppa021264mg           51.2    2e-04   
ref|XP_009385538.1|  PREDICTED: uncharacterized protein LOC103972881  50.1    3e-04   
ref|XP_009403150.1|  PREDICTED: uncharacterized protein LOC103986780  49.7    4e-04   
ref|XP_010531142.1|  PREDICTED: uncharacterized protein LOC104807528  49.3    5e-04   
ref|XP_007149117.1|  hypothetical protein PHAVU_005G042500g           49.3    6e-04   
ref|XP_006295219.1|  hypothetical protein CARUB_v10024302mg           49.3    6e-04   
ref|XP_010257528.1|  PREDICTED: uncharacterized protein LOC104597596  49.3    7e-04   



>ref|XP_006849573.1| hypothetical protein AMTR_s00024p00189140 [Amborella trichopoda]
 gb|ERN11154.1| hypothetical protein AMTR_s00024p00189140 [Amborella trichopoda]
Length=132

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -3

Query  1015  PWGVAFLLVLLLFMISYQSYFRELWFPF  932
             PWGVAF+L+LLLFMISYQSYF E WFP 
Sbjct  101   PWGVAFVLMLLLFMISYQSYFHERWFPL  128



>ref|XP_008791878.1| PREDICTED: uncharacterized protein LOC103708635 [Phoenix dactylifera]
Length=132

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  1015  PWGVAFLLVLLLFMISYQSYFRELWFP  935
             PWGVA +LVLL+FMISYQSYF E WFP
Sbjct  102   PWGVALVLVLLMFMISYQSYFHERWFP  128



>ref|XP_002285673.1| PREDICTED: uncharacterized protein LOC100251830 [Vitis vinifera]
Length=126

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  1015  PWGVAFLLVLLLFMISYQSYFRELWFP  935
             PWGVAFLLV LLFM+SY+SYF+E WFP
Sbjct  96    PWGVAFLLVFLLFMVSYKSYFQERWFP  122



>ref|XP_010917246.1| PREDICTED: uncharacterized protein LOC105041884 [Elaeis guineensis]
Length=132

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  1015  PWGVAFLLVLLLFMISYQSYFRELWFP  935
             PWGVA +LVLL+FMISYQSYF E WFP
Sbjct  102   PWGVALVLVLLMFMISYQSYFHERWFP  128



>ref|XP_007220118.1| hypothetical protein PRUPE_ppa021264mg [Prunus persica]
 gb|EMJ21317.1| hypothetical protein PRUPE_ppa021264mg [Prunus persica]
Length=130

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -3

Query  1027  AS*IPWGVAFLLVLLLFMISYQSYFRELWFP  935
             A   PWGV FLLV L FMISYQSYF+E WFP
Sbjct  96    AGGTPWGVGFLLVFLFFMISYQSYFQERWFP  126



>ref|XP_009385538.1| PREDICTED: uncharacterized protein LOC103972881 [Musa acuminata 
subsp. malaccensis]
Length=133

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = -3

Query  1015  PWGVAFLLVLLLFMISYQSYFRELWFP  935
             PWGVA +LVLL+FMISYQSYF + WFP
Sbjct  103   PWGVALVLVLLMFMISYQSYFHDCWFP  129



>ref|XP_009403150.1| PREDICTED: uncharacterized protein LOC103986780 [Musa acuminata 
subsp. malaccensis]
Length=132

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  1015  PWGVAFLLVLLLFMISYQSYFRELWFP  935
             PWGV  L+VLL+FMISYQSYF E WFP
Sbjct  102   PWGVGLLVVLLMFMISYQSYFHERWFP  128



>ref|XP_010531142.1| PREDICTED: uncharacterized protein LOC104807528 [Tarenaya hassleriana]
Length=123

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -3

Query  1015  PWGVAFLLVLLLFMISYQSYFRELWFPFSPD  923
             PWGVA +LV++ FM+SYQSYF E WFP   D
Sbjct  93    PWGVALVLVVIFFMVSYQSYFHERWFPLGRD  123



>ref|XP_007149117.1| hypothetical protein PHAVU_005G042500g [Phaseolus vulgaris]
 gb|ESW21111.1| hypothetical protein PHAVU_005G042500g [Phaseolus vulgaris]
Length=124

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -3

Query  1015  PWGVAFLLVLLLFMISYQSYFRELWFPF  932
             PWGV F+LVLLLFM+SYQS F+E WFP 
Sbjct  94    PWGVGFVLVLLLFMVSYQSSFQERWFPL  121



>ref|XP_006295219.1| hypothetical protein CARUB_v10024302mg, partial [Capsella rubella]
 gb|EOA28117.1| hypothetical protein CARUB_v10024302mg, partial [Capsella rubella]
Length=133

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = -3

Query  1093  GSHENLRCSSSRCYNMTLSTTYAS*IPWGVAFLLVLLLFMISYQSYFRELWFP  935
             G    ++ SS    N   S   A   PWGVAF+LV L FM+SYQS F+E WFP
Sbjct  79    GVVGGIKMSSLIPLNERESLYRAGGTPWGVAFMLVFLFFMVSYQSKFQERWFP  131



>ref|XP_010257528.1| PREDICTED: uncharacterized protein LOC104597596 [Nelumbo nucifera]
Length=124

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = -3

Query  1015  PWGVAFLLVLLLFMISYQSYFRELWFP  935
             PWGV  LLVLL+FMISYQSYF E WFP
Sbjct  94    PWGVGALLVLLMFMISYQSYFHERWFP  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2965111236698