BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19479_g1_i1 len=662 path=[1041:0-661]

Length=662
                                                                      Score     E

gb|KDP45695.1|  hypothetical protein JCGZ_17302                         147   8e-39   
gb|AHF22089.1|  CYP79D33                                                150   1e-38   
ref|XP_007146887.1|  hypothetical protein PHAVU_006G0788000g            147   1e-38   
gb|AJD25192.1|  cytochrome P450 CYP79D40                                149   2e-38   
ref|XP_007146888.1|  hypothetical protein PHAVU_006G078900g             148   6e-38   
ref|XP_007146890.1|  hypothetical protein PHAVU_006G079100g             148   7e-38   
gb|KCW75040.1|  hypothetical protein EUGRSUZ_E03816                     139   4e-37   
gb|EEE60610.1|  hypothetical protein OsJ_14019                          140   6e-37   Oryza sativa Japonica Group [Japonica rice]
gb|KDP45699.1|  hypothetical protein JCGZ_17306                         144   7e-37   
ref|NP_001052153.1|  Os04g0174100                                       140   7e-37   Oryza sativa Japonica Group [Japonica rice]
gb|KDP45703.1|  hypothetical protein JCGZ_17310                         145   8e-37   
gb|KHN24730.1|  Isoleucine N-monooxygenase 2                            144   1e-36   
ref|XP_003537358.1|  PREDICTED: isoleucine N-monooxygenase 2-like       144   1e-36   
ref|XP_008349636.1|  PREDICTED: tyrosine N-monooxygenase-like           138   2e-36   
ref|XP_003543894.1|  PREDICTED: isoleucine N-monooxygenase 2-like       143   3e-36   
gb|KEH34486.1|  cytochrome P450 family protein                          143   3e-36   
ref|XP_011071676.1|  PREDICTED: isoleucine N-monooxygenase 1-like       143   4e-36   
ref|XP_011071674.1|  PREDICTED: isoleucine N-monooxygenase 1-like       142   6e-36   
gb|KDP45698.1|  hypothetical protein JCGZ_17305                         142   6e-36   
ref|XP_007146892.1|  hypothetical protein PHAVU_006G0792000g            136   7e-36   
gb|EYU45627.1|  hypothetical protein MIMGU_mgv1a004405mg                142   7e-36   
ref|XP_007134794.1|  hypothetical protein PHAVU_010G076800g             142   8e-36   
gb|EEC76870.1|  hypothetical protein OsI_15062                          140   9e-36   Oryza sativa Indica Group [Indian rice]
gb|KEH34488.1|  cytochrome P450 family protein                          142   1e-35   
gb|EYU45628.1|  hypothetical protein MIMGU_mgv1a023130mg                141   1e-35   
gb|KDP45693.1|  hypothetical protein JCGZ_17300                         140   2e-35   
ref|XP_009780952.1|  PREDICTED: isoleucine N-monooxygenase 2-like       141   2e-35   
emb|CAH66094.1|  OSIGBa0114I04.1                                        140   2e-35   Oryza sativa [red rice]
gb|EMS59576.1|  Tyrosine N-monooxygenase                                135   2e-35   
ref|XP_011075711.1|  PREDICTED: valine N-monooxygenase 1-like           140   2e-35   
gb|KCW74950.1|  hypothetical protein EUGRSUZ_E03692                     140   2e-35   
ref|XP_010059479.1|  PREDICTED: tyrosine N-monooxygenase-like           140   2e-35   
ref|XP_009782885.1|  PREDICTED: isoleucine N-monooxygenase 2-like       140   3e-35   
ref|XP_009765490.1|  PREDICTED: isoleucine N-monooxygenase 2-like...    140   3e-35   
ref|NP_001052148.1|  Os04g0171800                                       140   3e-35   Oryza sativa Japonica Group [Japonica rice]
emb|CAI44620.1|  B1168G10.4                                             140   3e-35   Oryza sativa [red rice]
ref|XP_011098373.1|  PREDICTED: valine N-monooxygenase 1-like           140   3e-35   
gb|EAZ29960.1|  hypothetical protein OsJ_14015                          140   3e-35   Oryza sativa Japonica Group [Japonica rice]
gb|KEH34491.1|  cytochrome P450 family protein                          140   3e-35   
gb|KDP45690.1|  hypothetical protein JCGZ_17297                         140   4e-35   
ref|XP_010059539.1|  PREDICTED: tryptophan N-monooxygenase 1-like       138   4e-35   
ref|XP_007011304.1|  Cytochrome p450 79a2                               140   4e-35   
gb|EAY90707.1|  hypothetical protein OsI_12308                          133   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_007011294.1|  Cytochrome p450 79a2                               137   1e-34   
ref|XP_009601899.1|  PREDICTED: LOW QUALITY PROTEIN: isoleucine N...    138   2e-34   
ref|XP_010027351.1|  PREDICTED: tyrosine N-monooxygenase-like           138   2e-34   
ref|XP_011071563.1|  PREDICTED: isoleucine N-monooxygenase 1-like       138   2e-34   
gb|KDP45702.1|  hypothetical protein JCGZ_17309                         137   2e-34   
ref|XP_011084186.1|  PREDICTED: isoleucine N-monooxygenase 1-like       137   3e-34   
gb|KCW62252.1|  hypothetical protein EUGRSUZ_H04912                     137   3e-34   
ref|XP_008349637.1|  PREDICTED: isoleucine N-monooxygenase 1-like       137   3e-34   
ref|XP_004237294.1|  PREDICTED: isoleucine N-monooxygenase 1-like       137   3e-34   
ref|XP_010253086.1|  PREDICTED: phenylalanine N-monooxygenase           138   3e-34   
emb|CDP19035.1|  unnamed protein product                                137   3e-34   
gb|KDP45692.1|  hypothetical protein JCGZ_17299                         137   3e-34   
ref|XP_008385015.1|  PREDICTED: isoleucine N-monooxygenase 1-like       137   3e-34   
gb|KCW62239.1|  hypothetical protein EUGRSUZ_H04899                     137   4e-34   
ref|XP_010027355.1|  PREDICTED: tyrosine N-monooxygenase-like           137   4e-34   
ref|XP_009342222.1|  PREDICTED: isoleucine N-monooxygenase 1-like       137   4e-34   
ref|XP_008359055.1|  PREDICTED: isoleucine N-monooxygenase 1-like       138   4e-34   
ref|XP_009369526.1|  PREDICTED: isoleucine N-monooxygenase 1-like       137   4e-34   
ref|XP_009599475.1|  PREDICTED: isoleucine N-monooxygenase 2-like       137   5e-34   
ref|XP_010429154.1|  PREDICTED: tryptophan N-monooxygenase 2-like       134   5e-34   
ref|XP_007011293.1|  Cytochrome p450 79a2                               137   6e-34   
ref|XP_011071673.1|  PREDICTED: isoleucine N-monooxygenase 1-like       137   6e-34   
ref|XP_009623062.1|  PREDICTED: isoleucine N-monooxygenase 2-like       137   6e-34   
ref|XP_007011298.1|  Cytochrome p450 79a2                               137   6e-34   
emb|CDP18411.1|  unnamed protein product                                137   6e-34   
gb|KCW62254.1|  hypothetical protein EUGRSUZ_H04914                     137   6e-34   
ref|XP_010539173.1|  PREDICTED: dihomomethionine N-hydroxylase-like     137   7e-34   
gb|EEC70622.1|  hypothetical protein OsI_01880                          136   7e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_010050614.1|  PREDICTED: tyrosine N-monooxygenase-like           133   9e-34   
emb|CDP17747.1|  unnamed protein product                                135   1e-33   
gb|EMS67140.1|  Tyrosine N-monooxygenase                                136   1e-33   
emb|CDY04944.1|  BnaAnng01260D                                          132   1e-33   
emb|CDP18412.1|  unnamed protein product                                135   1e-33   
ref|XP_010027354.1|  PREDICTED: tyrosine N-monooxygenase-like           137   1e-33   
emb|CDP19033.1|  unnamed protein product                                135   1e-33   
ref|XP_003629157.1|  Cytochrome P450                                    135   2e-33   
gb|EMT03957.1|  Tyrosine N-monooxygenase                                135   2e-33   
ref|XP_006480303.1|  PREDICTED: uncharacterized protein LOC102610907    139   2e-33   
gb|KCW62253.1|  hypothetical protein EUGRSUZ_H04913                     135   2e-33   
ref|XP_007011296.1|  Cytochrome p450 79a2                               135   2e-33   
ref|XP_010543679.1|  PREDICTED: phenylalanine N-monooxygenase           135   2e-33   
ref|XP_010025546.1|  PREDICTED: tyrosine N-monooxygenase-like           135   2e-33   
gb|KHN24731.1|  Isoleucine N-monooxygenase 1                            135   2e-33   
ref|XP_008385013.1|  PREDICTED: isoleucine N-monooxygenase 2-like       135   2e-33   
gb|AAD22364.1|  putative cytochrome P450                                135   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179820.2|  tryptophan N-monooxygenase 2                          135   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878610.1|  CYP79B3                                            135   3e-33   
emb|CBI25373.3|  unnamed protein product                                130   3e-33   
ref|XP_006591735.1|  PREDICTED: isoleucine N-monooxygenase 1-like       135   3e-33   
gb|EMT11661.1|  Tyrosine N-monooxygenase                                135   3e-33   
ref|XP_010472222.1|  PREDICTED: tryptophan N-monooxygenase 2            135   3e-33   
dbj|BAF01576.1|  putative cytochrome P450                               135   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296223.1|  hypothetical protein CARUB_v10025388mg             135   3e-33   
gb|AAK59526.1|  putative cytochrome P450 protein                        129   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006495331.1|  PREDICTED: phenylalanine N-monooxygenase-like      132   4e-33   
ref|XP_011098372.1|  PREDICTED: phenylalanine N-monooxygenase-like      134   5e-33   
ref|XP_006484922.1|  PREDICTED: phenylalanine N-monooxygenase-like      134   5e-33   
ref|XP_006437149.1|  hypothetical protein CICLE_v10033385mg             135   5e-33   
ref|XP_010416994.1|  PREDICTED: tryptophan N-monooxygenase 2-like       134   5e-33   
ref|XP_006404952.1|  hypothetical protein EUTSA_v10000278mg             131   5e-33   
emb|CDP20403.1|  unnamed protein product                                134   5e-33   
gb|KEH20391.1|  cytochrome P450 family protein                          134   6e-33   
ref|XP_006428266.1|  hypothetical protein CICLE_v10013842mg             134   6e-33   
gb|KDO39922.1|  hypothetical protein CISIN_1g035533mg                   134   6e-33   
gb|AAG24796.1|  cytochrome P450 CYP79F2                                 134   8e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563995.2|  Hexahomomethionine N-hydroxylase                      134   8e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010030374.1|  PREDICTED: tyrosine N-monooxygenase-like           133   9e-33   
emb|CDP12474.1|  unnamed protein product                                133   1e-32   
ref|XP_004509509.1|  PREDICTED: isoleucine N-monooxygenase 2-like       133   1e-32   
gb|KFK30571.1|  hypothetical protein AALP_AA7G279100                    133   1e-32   
ref|NP_001050517.1|  Os03g0570100                                       133   1e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010491059.1|  PREDICTED: phenylalanine N-monooxygenase-like      133   1e-32   
gb|KCW54304.1|  hypothetical protein EUGRSUZ_I00267                     133   1e-32   
ref|XP_010030372.1|  PREDICTED: tyrosine N-monooxygenase-like           133   1e-32   
ref|XP_009797054.1|  PREDICTED: valine N-monooxygenase 1                129   1e-32   
ref|XP_006492162.1|  PREDICTED: phenylalanine N-monooxygenase-like      133   1e-32   
gb|KHG04035.1|  Tyrosine N-monooxygenase                                133   1e-32   
gb|AAG59648.1|AC084319_6  putative cytochrome p450tyr                   133   1e-32   Oryza sativa [red rice]
ref|XP_003629158.1|  Cytochrome P450                                    133   1e-32   
ref|XP_006420514.1|  hypothetical protein CICLE_v10004690mg             132   2e-32   
ref|XP_007011306.1|  Cytochrome p450 79a2                               133   2e-32   
gb|KFK32823.1|  hypothetical protein AALP_AA6G292300                    132   2e-32   
emb|CDY43061.1|  BnaA03g12080D                                          132   2e-32   
ref|XP_010456404.1|  PREDICTED: phenylalanine N-monooxygenase           132   2e-32   
ref|XP_004245410.1|  PREDICTED: isoleucine N-monooxygenase 1-like       132   2e-32   
ref|XP_008359054.1|  PREDICTED: tyrosine N-monooxygenase-like           129   2e-32   
ref|XP_006464296.1|  PREDICTED: phenylalanine N-monooxygenase-like      132   2e-32   
ref|XP_003580014.1|  PREDICTED: tyrosine N-monooxygenase-like           132   2e-32   
ref|XP_006464327.1|  PREDICTED: phenylalanine N-monooxygenase-like      132   2e-32   
ref|XP_010555368.1|  PREDICTED: tryptophan N-monooxygenase 2-like       132   2e-32   
emb|CBI24346.3|  unnamed protein product                                132   2e-32   
ref|XP_006363575.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    132   2e-32   
ref|XP_002466099.1|  hypothetical protein SORBIDRAFT_01g001200          132   2e-32   Sorghum bicolor [broomcorn]
ref|XP_009132654.1|  PREDICTED: dihomomethionine N-hydroxylase          132   2e-32   
gb|KCW74807.1|  hypothetical protein EUGRSUZ_E03537                     132   2e-32   
ref|XP_006356653.1|  PREDICTED: isoleucine N-monooxygenase 1-like       132   3e-32   
ref|XP_006428115.1|  hypothetical protein CICLE_v10025240mg             132   3e-32   
ref|XP_009122135.1|  PREDICTED: phenylalanine N-monooxygenase           132   3e-32   
ref|XP_006428111.1|  hypothetical protein CICLE_v10025237mg             132   3e-32   
ref|XP_004237224.2|  PREDICTED: isoleucine N-monooxygenase 1-like       132   3e-32   
ref|XP_007207880.1|  hypothetical protein PRUPE_ppa021326mg             132   3e-32   
emb|CDP21660.1|  unnamed protein product                                132   3e-32   
dbj|BAP15884.1|  cytochrome P450 79D16                                  132   3e-32   
gb|AGN12777.1|  tryptophan N-hydroxylase 1                              132   3e-32   
ref|XP_002269843.2|  PREDICTED: phenylalanine N-monooxygenase           132   3e-32   Vitis vinifera
gb|ABD84027.1|  cytochrome P450                                         132   3e-32   Bambusa ventricosa [Buddha bamboo]
ref|XP_010059403.1|  PREDICTED: tyrosine N-monooxygenase-like           132   3e-32   
ref|XP_008231301.1|  PREDICTED: isoleucine N-monooxygenase 2-like       132   3e-32   
gb|EMT22070.1|  hypothetical protein F775_52105                         132   3e-32   
gb|ACG29984.1|  cytochrome P450 CYP79A33                                132   3e-32   Zea mays [maize]
gb|ADM34983.1|  CYP79D16                                                132   4e-32   
gb|EMT14945.1|  Tyrosine N-monooxygenase                                132   4e-32   
gb|AGN12803.1|  tryptophan N-hydroxylase 1                              132   4e-32   
ref|XP_008644663.1|  PREDICTED: tyrosine N-monooxygenase-like           132   4e-32   
ref|XP_002274952.2|  PREDICTED: phenylalanine N-monooxygenase-like      131   4e-32   Vitis vinifera
gb|AGN12785.1|  tryptophan N-hydroxylase 1                              132   4e-32   
ref|XP_006486168.1|  PREDICTED: phenylalanine N-monooxygenase-like      131   4e-32   
ref|XP_006435921.1|  hypothetical protein CICLE_v10031099mg             132   4e-32   
emb|CAN61661.1|  hypothetical protein VITISV_000261                     132   4e-32   Vitis vinifera
ref|XP_006486167.1|  PREDICTED: phenylalanine N-monooxygenase-like      131   4e-32   
gb|ACR10255.1|  cytochrome P450 79b3                                    131   5e-32   Brassica rapa subsp. pekinensis [bai cai]
emb|CDY25587.1|  BnaA04g12790D                                          131   5e-32   
ref|XP_009140345.1|  PREDICTED: tryptophan N-monooxygenase 2            131   5e-32   
gb|ADW54459.1|  cytochrome P450 79B1                                    131   6e-32   
emb|CDY63922.1|  BnaC07g51280D                                          131   6e-32   
ref|XP_002866896.1|  CYP79B2                                            131   6e-32   
gb|AGS49165.1|  cytochrome P450 CYP79B2                                 131   6e-32   
ref|XP_010030373.1|  PREDICTED: valine N-monooxygenase 1-like           131   6e-32   
gb|AGM16417.1|  cytochrome P450 79B2                                    131   6e-32   
ref|XP_010519775.1|  PREDICTED: dihomomethionine N-hydroxylase-like     131   6e-32   
ref|XP_009785421.1|  PREDICTED: isoleucine N-monooxygenase 2-like       127   7e-32   
ref|XP_006411796.1|  hypothetical protein EUTSA_v10024861mg             131   7e-32   
ref|XP_009138546.1|  PREDICTED: cytochrome P450 79B1-like               131   7e-32   
gb|KCW54305.1|  hypothetical protein EUGRSUZ_I00268                     130   7e-32   
gb|EMT14947.1|  Tyrosine N-monooxygenase                                130   7e-32   
ref|XP_004509430.1|  PREDICTED: isoleucine N-monooxygenase 2-like       130   7e-32   
ref|XP_006367541.1|  PREDICTED: isoleucine N-monooxygenase 1-like       130   8e-32   
ref|XP_010446562.1|  PREDICTED: tryptophan N-monooxygenase 1-like       130   8e-32   
ref|NP_178055.2|  cytochrome P450, family 79, subfamily C, polype...    130   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010474492.1|  PREDICTED: dihomomethionine N-hydroxylase          130   8e-32   
ref|XP_010446588.1|  PREDICTED: tryptophan N-monooxygenase 1-like...    130   8e-32   
ref|XP_002890164.1|  CYP79F1                                            130   9e-32   
ref|XP_010437120.1|  PREDICTED: tryptophan N-monooxygenase 1-like       130   9e-32   
gb|AFR34030.1|  cytochrome p450 BCMA2                                   130   1e-31   
emb|CBI25370.3|  unnamed protein product                                130   1e-31   
ref|XP_002464334.1|  hypothetical protein SORBIDRAFT_01g016480          130   1e-31   Sorghum bicolor [broomcorn]
gb|AAD03416.1|  cytochrome P450                                         129   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563996.2|  dihomomethionine N-hydroxylase                        130   1e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CBI25369.3|  unnamed protein product                                132   1e-31   
ref|XP_002274920.1|  PREDICTED: phenylalanine N-monooxygenase-like      130   1e-31   Vitis vinifera
gb|AAD34693.1|AC006341_21  Similar to gb|AF069494 cytochrome P450...    130   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KFK24947.1|  hypothetical protein AALP_AA8G046600                    130   1e-31   
sp|O81345.1|C79B1_SINAL  RecName: Full=Cytochrome P450 79B1             130   1e-31   Sinapis alba [bai jie]
ref|XP_002274698.2|  PREDICTED: phenylalanine N-monooxygenase-like      130   1e-31   Vitis vinifera
ref|XP_006305874.1|  hypothetical protein CARUB_v10010983mg             130   2e-31   
ref|XP_002319424.1|  hypothetical protein POPTR_0013s15320g             130   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_009358329.1|  PREDICTED: LOW QUALITY PROTEIN: tyrosine N-m...    125   2e-31   
ref|XP_010431975.1|  PREDICTED: tryptophan N-monooxygenase 1            130   2e-31   
ref|XP_007017085.1|  Cytochrome p450 79a2, putative                     130   2e-31   
ref|NP_195705.1|  tryptophan N-monooxygenase 1                          130   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125594.1|  PREDICTED: phenylalanine N-monooxygenase-like      130   2e-31   
gb|ACR10256.1|  cytochrome P450 79a2                                    130   2e-31   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010529568.1|  PREDICTED: dihomomethionine N-hydroxylase-like     130   2e-31   
ref|XP_006404690.1|  hypothetical protein EUTSA_v10000114mg             130   2e-31   
gb|EEC74210.1|  hypothetical protein OsI_09370                          129   2e-31   Oryza sativa Indica Group [Indian rice]
gb|AGC13081.1|  cytochrome P450 79B2                                    129   2e-31   
ref|XP_002887782.1|  CYP79C1                                            129   2e-31   
gb|ACR10253.1|  cytochrome P450 79b2                                    129   2e-31   Brassica rapa subsp. pekinensis [bai cai]
gb|AAN76810.1|AF453287_1  cytochrome P450                               129   2e-31   Brassica napus [oilseed rape]
ref|XP_004509432.1|  PREDICTED: isoleucine N-monooxygenase 2-like       129   2e-31   
emb|CDX69373.1|  BnaC01g00800D                                          129   2e-31   
emb|CDY14123.1|  BnaC02g02400D                                          129   2e-31   
ref|XP_006398988.1|  hypothetical protein EUTSA_v10015246mg             129   3e-31   
ref|XP_006283476.1|  hypothetical protein CARUB_v10004524mg             129   3e-31   
ref|XP_004139122.1|  PREDICTED: isoleucine N-monooxygenase 1-like       124   3e-31   
ref|XP_006363576.1|  PREDICTED: isoleucine N-monooxygenase 1-like       129   3e-31   
gb|AHF20913.1|  cytochrome P450                                         129   3e-31   
emb|CDY39472.1|  BnaC03g60820D                                          129   3e-31   
ref|XP_002274641.1|  PREDICTED: phenylalanine N-monooxygenase-like      129   3e-31   Vitis vinifera
ref|XP_002890163.1|  CYP79F2                                            129   3e-31   
ref|XP_006387420.1|  hypothetical protein POPTR_1061s00200g             129   3e-31   
gb|AFV31131.1|  cytochrome P450 79B1                                    129   3e-31   
emb|CDX90374.1|  BnaA08g16100D                                          129   3e-31   
emb|CBI25374.3|  unnamed protein product                                129   3e-31   
ref|XP_010526660.1|  PREDICTED: tryptophan N-monooxygenase 1-like       129   3e-31   
ref|XP_006435923.1|  hypothetical protein CICLE_v10031311mg             129   3e-31   
ref|XP_006486508.1|  PREDICTED: phenylalanine N-monooxygenase-like      129   4e-31   
ref|XP_010462740.1|  PREDICTED: dihomomethionine N-hydroxylase-like     128   4e-31   
ref|XP_010531370.1|  PREDICTED: tryptophan N-monooxygenase 1            129   4e-31   
ref|XP_006651559.1|  PREDICTED: tyrosine N-monooxygenase-like           128   4e-31   
ref|XP_002873202.1|  CYP79A2                                            129   5e-31   
ref|XP_006376556.1|  hypothetical protein POPTR_0013s15310g             128   5e-31   
gb|AHF20912.1|  cytochrome P450                                         128   5e-31   
gb|EMT28582.1|  Tyrosine N-monooxygenase                                127   6e-31   
ref|XP_006435920.1|  hypothetical protein CICLE_v10031309mg             128   6e-31   
dbj|BAK08222.1|  predicted protein                                      128   7e-31   
ref|XP_006486509.1|  PREDICTED: tyrosine N-monooxygenase-like           125   8e-31   
ref|NP_568153.1|  cytochrome P450 CYP79A2                               128   8e-31   Arabidopsis thaliana [mouse-ear cress]
gb|KHG05899.1|  Phenylalanine N-monooxygenase -like protein             128   8e-31   
ref|XP_006304976.1|  hypothetical protein CARUB_v10011470mg             128   8e-31   
ref|XP_010476751.1|  PREDICTED: dihomomethionine N-hydroxylase          128   8e-31   
sp|Q9FLC8.1|C79A2_ARATH  RecName: Full=Phenylalanine N-monooxygen...    128   9e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008644689.1|  PREDICTED: tyrosine N-monooxygenase-like           128   9e-31   
emb|CAN74072.1|  hypothetical protein VITISV_035799                     127   9e-31   Vitis vinifera
gb|AHI88992.1|  CYP79D6v4                                               127   1e-30   
gb|KHN48839.1|  Isoleucine N-monooxygenase 2                            127   1e-30   
ref|XP_004252024.1|  PREDICTED: isoleucine N-monooxygenase 1-like       127   1e-30   
ref|XP_003556848.1|  PREDICTED: isoleucine N-monooxygenase 2-like       127   1e-30   
ref|XP_006301545.1|  hypothetical protein CARUB_v10021979mg             127   2e-30   
gb|EMS45429.1|  Tyrosine N-monooxygenase                                127   2e-30   
gb|AFR34028.1|  cytochrome P40 BCMA3                                    127   2e-30   
ref|XP_003633447.1|  PREDICTED: phenylalanine N-monooxygenase-like      126   2e-30   
ref|XP_006416821.1|  hypothetical protein EUTSA_v10007301mg             127   2e-30   
emb|CBI25368.3|  unnamed protein product                                126   2e-30   
ref|XP_007011301.1|  Cytochrome p450 79a2, putative                     126   2e-30   
ref|XP_010529074.1|  PREDICTED: dihomomethionine N-hydroxylase-like     122   3e-30   
ref|XP_002264201.1|  PREDICTED: phenylalanine N-monooxygenase           126   3e-30   Vitis vinifera
ref|XP_010497819.1|  PREDICTED: dihomomethionine N-hydroxylase-like     126   4e-30   
ref|XP_003576934.1|  PREDICTED: tyrosine N-monooxygenase-like           126   4e-30   
gb|EMT05143.1|  Tyrosine N-monooxygenase                                126   4e-30   
ref|XP_010497823.1|  PREDICTED: dihomomethionine N-hydroxylase-like     126   4e-30   
gb|KFK43843.1|  hypothetical protein AALP_AA1G181100                    126   4e-30   
ref|XP_002276655.1|  PREDICTED: phenylalanine N-monooxygenase-like      126   4e-30   Vitis vinifera
gb|AFR34029.1|  cytochrome P450 BCMA1                                   125   5e-30   
tpg|DAA51522.1|  TPA: putative cytochrome P450 superfamily protein      126   5e-30   
ref|XP_006367899.1|  PREDICTED: isoleucine N-monooxygenase 2-like       125   5e-30   
emb|CAN75997.1|  hypothetical protein VITISV_022990                     125   5e-30   Vitis vinifera
ref|XP_008665466.1|  PREDICTED: tyrosine N-monooxygenase-like           125   5e-30   
ref|XP_004154649.1|  PREDICTED: isoleucine N-monooxygenase 1-like       125   6e-30   
ref|NP_198441.1|  cytochrome P450, family 79, subfamily A, polype...    119   6e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008450475.1|  PREDICTED: LOW QUALITY PROTEIN: isoleucine N...    124   7e-30   
gb|EMT29850.1|  Tyrosine N-monooxygenase                                123   7e-30   
gb|EMT15372.1|  Tyrosine N-monooxygenase                                125   8e-30   
ref|XP_010529075.1|  PREDICTED: dihomomethionine N-hydroxylase-like     124   8e-30   
ref|XP_002446424.1|  hypothetical protein SORBIDRAFT_06g015920          125   9e-30   Sorghum bicolor [broomcorn]
ref|XP_010068482.1|  PREDICTED: cytochrome P450 79B1-like               122   9e-30   
ref|XP_011021045.1|  PREDICTED: isoleucine N-monooxygenase 2-like       125   9e-30   
ref|XP_010459182.1|  PREDICTED: dihomomethionine N-hydroxylase-like     125   9e-30   
gb|AAD30239.1|AC007202_21  This gene is continued from gene 1 (si...    119   1e-29   
ref|XP_004173157.1|  PREDICTED: isoleucine N-monooxygenase 1-like       118   1e-29   
ref|XP_006435922.1|  hypothetical protein CICLE_v10031307mg             124   1e-29   
ref|XP_009129057.1|  PREDICTED: cytochrome P450 79B1                    124   2e-29   
ref|XP_004966053.1|  PREDICTED: tyrosine N-monooxygenase-like           124   2e-29   
ref|XP_006411457.1|  hypothetical protein EUTSA_v10017915mg             124   2e-29   
gb|EMT24111.1|  hypothetical protein F775_52527                         124   2e-29   
sp|Q6J540.1|C79D4_LOTJA  RecName: Full=Isoleucine N-monooxygenase...    124   2e-29   
sp|Q6J541.1|C79D3_LOTJA  RecName: Full=Isoleucine N-monooxygenase...    124   2e-29   
gb|EMT14944.1|  Tyrosine N-monooxygenase                                124   3e-29   
ref|XP_002438593.1|  hypothetical protein SORBIDRAFT_10g022470          124   3e-29   
ref|XP_010476752.1|  PREDICTED: dihomomethionine N-hydroxylase-like     123   3e-29   
ref|XP_009354042.1|  PREDICTED: isoleucine N-monooxygenase 2-like       123   4e-29   
gb|EMT02883.1|  hypothetical protein F775_52211                         123   4e-29   
ref|XP_004139123.1|  PREDICTED: isoleucine N-monooxygenase 1-like       122   4e-29   
ref|XP_008450368.1|  PREDICTED: isoleucine N-monooxygenase 1-like       123   5e-29   
ref|XP_004165284.1|  PREDICTED: isoleucine N-monooxygenase 2-like       122   5e-29   
ref|XP_002449720.1|  hypothetical protein SORBIDRAFT_05g022070          122   5e-29   
emb|CDP13907.1|  unnamed protein product                                122   5e-29   
emb|CDY31634.1|  BnaA05g09130D                                          122   6e-29   
ref|XP_004154686.1|  PREDICTED: isoleucine N-monooxygenase 1-like       122   6e-29   
ref|XP_002464333.1|  hypothetical protein SORBIDRAFT_01g016470          122   7e-29   
gb|EMS49024.1|  Tyrosine N-monooxygenase                                122   8e-29   
ref|XP_008659696.1|  PREDICTED: tyrosine N-monooxygenase-like           122   8e-29   
ref|XP_010508657.1|  PREDICTED: dihomomethionine N-hydroxylase-like     122   1e-28   
ref|XP_009144065.1|  PREDICTED: dihomomethionine N-hydroxylase-like     122   1e-28   
ref|XP_004151554.1|  PREDICTED: isoleucine N-monooxygenase 1-like       122   1e-28   
ref|XP_004151661.1|  PREDICTED: isoleucine N-monooxygenase 1-like       121   1e-28   
gb|AAF66544.1|AF140610_1  cytochrome P450 CYP79E2                       122   1e-28   
ref|XP_010517680.1|  PREDICTED: dihomomethionine N-hydroxylase-like     121   1e-28   
ref|XP_007203677.1|  hypothetical protein PRUPE_ppa026605mg             121   2e-28   
ref|XP_008450479.1|  PREDICTED: tyrosine N-monooxygenase-like           121   2e-28   
ref|XP_004295627.1|  PREDICTED: isoleucine N-monooxygenase 2-like       121   2e-28   
ref|XP_009354043.1|  PREDICTED: isoleucine N-monooxygenase 2-like       121   2e-28   
emb|CDP18124.1|  unnamed protein product                                120   2e-28   
ref|XP_008349639.1|  PREDICTED: isoleucine N-monooxygenase 2-like       115   2e-28   
gb|AFR34033.1|  cytochrome P450 BCMA3                                   121   2e-28   
gb|AFR34031.1|  cytochrome P450 BCMA3                                   121   2e-28   
gb|EMT13826.1|  Tyrosine N-monooxygenase                                121   2e-28   
ref|XP_002450980.1|  hypothetical protein SORBIDRAFT_05g022010          121   2e-28   
gb|AGS49166.1|  cytochrome P450 CYP79F1                                 121   2e-28   
ref|XP_004237225.1|  PREDICTED: isoleucine N-monooxygenase 1-like       120   3e-28   
gb|KFK43335.1|  hypothetical protein AALP_AA1G111500                    121   3e-28   
ref|XP_011005474.1|  PREDICTED: cytochrome P450 79B1-like               120   3e-28   
ref|XP_008450367.1|  PREDICTED: isoleucine N-monooxygenase 1-like       120   3e-28   
gb|KEH34365.1|  cytochrome P450 family protein                          120   3e-28   
ref|XP_008808383.1|  PREDICTED: phenylalanine N-monooxygenase-like      120   3e-28   
ref|XP_010537826.1|  PREDICTED: dihomomethionine N-hydroxylase-like     120   3e-28   
ref|XP_006289651.1|  hypothetical protein CARUB_v10003209mg             120   3e-28   
ref|XP_010523407.1|  PREDICTED: dihomomethionine N-hydroxylase-like     121   4e-28   
dbj|BAP15883.1|  cytochrome P450 79A68                                  120   4e-28   
ref|XP_008241408.1|  PREDICTED: isoleucine N-monooxygenase 2            120   4e-28   
gb|AHY21753.1|  cytochrome P450 79D15                                   120   4e-28   
gb|AHY21761.1|  cytochrome P450 79D15                                   120   4e-28   
gb|AHY21762.1|  cytochrome P450 79D15                                   120   4e-28   
emb|CDX99717.1|  BnaC02g36030D                                          119   5e-28   
ref|XP_004139121.1|  PREDICTED: isoleucine N-monooxygenase 2-like       120   6e-28   
gb|KFK37032.1|  hypothetical protein AALP_AA4G203300                    120   6e-28   
emb|CDY14795.1|  BnaC04g47920D                                          120   6e-28   
gb|EMT29010.1|  Tyrosine N-monooxygenase                                118   6e-28   
ref|XP_010905900.1|  PREDICTED: tyrosine N-monooxygenase-like           119   7e-28   
gb|AHY21757.1|  cytochrome P450 79D15                                   119   7e-28   
gb|ACB15189.1|  cytochrome P450                                         119   8e-28   
ref|XP_006605683.1|  PREDICTED: isoleucine N-monooxygenase 2-like       119   8e-28   
ref|XP_008456975.1|  PREDICTED: isoleucine N-monooxygenase 1            119   9e-28   
gb|AAF66543.1|AF140609_1  cytochrome P450 CYP79E1                       119   1e-27   
gb|AHY21751.1|  cytochrome P450 79D15                                   119   1e-27   
gb|KFK25907.1|  hypothetical protein AALP_AA8G178100                    118   1e-27   
ref|XP_002305081.2|  Cytochrome P450 79B2 family protein                119   1e-27   
ref|XP_002464329.1|  hypothetical protein SORBIDRAFT_01g016460          119   1e-27   
gb|AHY21800.1|  cytochrome P450 79D15                                   118   2e-27   
gb|AHY21801.1|  cytochrome P450 79D15                                   118   2e-27   
gb|AHY21802.1|  cytochrome P450 79D15                                   118   2e-27   
gb|ACB15194.1|  cytochrome P450                                         118   2e-27   
gb|AHY21758.1|  cytochrome P450 79D15                                   118   2e-27   
gb|AHY21799.1|  cytochrome P450 79D15                                   118   2e-27   
gb|AHY21803.1|  cytochrome P450 79D15                                   118   2e-27   
gb|AHY21754.1|  cytochrome P450 79D15                                   118   2e-27   
gb|ACB15193.1|  cytochrome P450                                         118   2e-27   
gb|AHY21766.1|  cytochrome P450 79D15                                   118   2e-27   
gb|AHY21755.1|  cytochrome P450 79D15                                   118   2e-27   
gb|AHY21763.1|  cytochrome P450 79D15                                   118   2e-27   
gb|AHY21774.1|  cytochrome P450 79D15                                   118   2e-27   
gb|EMT03570.1|  Tyrosine N-monooxygenase                                120   2e-27   
gb|AHY21765.1|  cytochrome P450 79D15                                   118   2e-27   
gb|EMT13892.1|  Tyrosine N-monooxygenase                                114   2e-27   
gb|AHY21782.1|  cytochrome P450 79D15                                   118   2e-27   
gb|AHY21778.1|  cytochrome P450 79D15                                   118   2e-27   
gb|AHY21764.1|  cytochrome P450 79D15                                   118   2e-27   
ref|XP_007203073.1|  hypothetical protein PRUPE_ppa023521mg             118   2e-27   
gb|AHY21767.1|  cytochrome P450 79D15                                   118   2e-27   
gb|KFK37030.1|  hypothetical protein AALP_AA4G203000                    118   2e-27   
gb|ACR10252.1|  cytochrome P450 79f1                                    118   2e-27   
ref|XP_009149073.1|  PREDICTED: dihomomethionine N-hydroxylase-like     118   2e-27   
emb|CDY35091.1|  BnaA06g11010D                                          118   2e-27   
ref|XP_002886713.1|  CYP79C2                                            118   3e-27   
gb|AHY21806.1|  cytochrome P450 79D15                                   117   3e-27   
gb|ACB15157.1|  cytochrome P450                                         117   3e-27   
gb|ACB15183.1|  cytochrome P450                                         117   3e-27   
gb|ACB15184.1|  cytochrome P450                                         117   3e-27   
ref|XP_007145972.1|  hypothetical protein PHAVU_006G002300g             118   3e-27   
gb|AHY21808.1|  cytochrome P450 79D15                                   117   4e-27   
gb|ACB15165.1|  cytochrome P450                                         117   4e-27   
gb|ACB15159.1|  cytochrome P450                                         117   4e-27   
ref|XP_008450288.1|  PREDICTED: phenylalanine N-monooxygenase-lik...    117   4e-27   
gb|ACB15182.1|  cytochrome P450                                         117   4e-27   
gb|AHY21746.1|  cytochrome P450 79D15                                   117   4e-27   
gb|AHY21785.1|  cytochrome P450 79D15                                   117   4e-27   
gb|ACB15168.1|  cytochrome P450                                         117   4e-27   
gb|AHY21807.1|  cytochrome P450 79D15                                   117   4e-27   
gb|ACB15154.1|  cytochrome P450                                         117   4e-27   
gb|ACB15153.1|  cytochrome P450                                         117   4e-27   
gb|ACB15162.1|  cytochrome P450                                         117   4e-27   
gb|AHY21798.1|  cytochrome P450 79D15                                   117   4e-27   
gb|AHY21742.1|  cytochrome P450 79D15                                   117   4e-27   
gb|ACB15191.1|  cytochrome P450                                         117   4e-27   
gb|ACM24114.1|  cytochrome P450                                         117   5e-27   
ref|XP_003576933.1|  PREDICTED: tyrosine N-monooxygenase-like           117   5e-27   
ref|XP_009142023.1|  PREDICTED: dihomomethionine N-hydroxylase-like     117   5e-27   
gb|ACB15192.1|  cytochrome P450                                         117   5e-27   
emb|CDY06898.1|  BnaA04g24170D                                          117   5e-27   
ref|XP_006293982.1|  hypothetical protein CARUB_v10022973mg             117   5e-27   
ref|XP_008450287.1|  PREDICTED: phenylalanine N-monooxygenase-lik...    117   5e-27   
ref|XP_004983125.1|  PREDICTED: tyrosine N-monooxygenase-like iso...    117   6e-27   
gb|AGO59948.1|  CYP79F1                                                 117   6e-27   
gb|ACB59213.1|  CYP79F1                                                 117   6e-27   
emb|CDY33331.1|  BnaC05g12520D                                          117   6e-27   
gb|ADC54226.1|  cytochrome P450 CYP79F1                                 117   6e-27   
dbj|BAJ86038.1|  predicted protein                                      117   6e-27   
gb|AHY21794.1|  cytochrome P450 79D15                                   116   8e-27   
gb|EMT25189.1|  Tyrosine N-monooxygenase                                113   9e-27   
gb|AHY21795.1|  cytochrome P450 79D15                                   116   9e-27   
gb|AHY21791.1|  cytochrome P450 79D15                                   116   1e-26   
gb|ACB15190.1|  cytochrome P450                                         115   1e-26   
gb|AHY21787.1|  cytochrome P450 79D15                                   115   2e-26   
gb|AHY21788.1|  cytochrome P450 79D15                                   115   2e-26   
gb|AHY21786.1|  cytochrome P450 79D15                                   115   2e-26   
gb|AHY21797.1|  cytochrome P450 79D15                                   115   2e-26   
gb|AHY21793.1|  cytochrome P450 79D15                                   115   2e-26   
gb|AHY21790.1|  cytochrome P450 79D15                                   115   2e-26   
ref|XP_010110140.1|  Isoleucine N-monooxygenase 2                       115   2e-26   
ref|NP_176122.2|  cytochrome p450 79c2                                  115   2e-26   
emb|CDY14122.1|  BnaC02g02390D                                          115   3e-26   
gb|AHY21773.1|  cytochrome P450 79D15                                   115   3e-26   
ref|XP_010110139.1|  Phenylalanine N-monooxygenase                      114   3e-26   
ref|XP_010513418.1|  PREDICTED: hexahomomethionine N-hydroxylase        115   4e-26   
ref|XP_004967230.1|  PREDICTED: tyrosine N-monooxygenase-like           115   4e-26   
ref|XP_010532334.1|  PREDICTED: dihomomethionine N-hydroxylase-like     114   7e-26   
sp|Q9M7B8.1|C79D1_MANES  RecName: Full=Valine N-monooxygenase 1; ...    114   7e-26   
gb|EAZ11857.1|  hypothetical protein OsJ_01731                          107   2e-25   
emb|CAI44623.1|  B1168G10.7                                             108   2e-25   
gb|AAD34692.1|AC006341_20  Similar to gb|AF069494 cytochrome P450...    112   3e-25   
ref|XP_006301603.1|  hypothetical protein CARUB_v10022042mg             112   4e-25   
ref|XP_006651654.1|  PREDICTED: tyrosine N-monooxygenase-like           110   7e-25   
gb|AAV97889.1|  N-hydroxylating cytochrome P450 CYP79D1                 111   8e-25   
gb|ADG21961.1|  cytochrome P450                                         104   1e-24   
sp|Q9M7B7.1|C79D2_MANES  RecName: Full=Valine N-monooxygenase 2; ...    110   3e-24   
gb|ACJ70085.1|  cytochrome P450                                         109   3e-24   
ref|XP_003629369.1|  Cytochrome P450                                    109   4e-24   
ref|XP_010045992.1|  PREDICTED: valine N-monooxygenase 1-like           108   5e-24   
gb|KDP29696.1|  hypothetical protein JCGZ_18631                         108   7e-24   
gb|AAV97888.1|  N-hydroxylating cytochrome P450 CYP79D2                 108   7e-24   
ref|XP_010651524.1|  PREDICTED: phenylalanine N-monooxygenase-like      102   1e-23   
gb|EYU45630.1|  hypothetical protein MIMGU_mgv1a018745mg                106   1e-23   
gb|KDP29695.1|  hypothetical protein JCGZ_18630                         105   2e-23   
ref|XP_010651522.1|  PREDICTED: phenylalanine N-monooxygenase-like      101   2e-23   
gb|KDP20491.1|  hypothetical protein JCGZ_05367                         106   4e-23   
gb|KDP29694.1|  hypothetical protein JCGZ_18629                         106   5e-23   
ref|NP_001052147.1|  Os04g0171600                                       105   6e-23   
gb|KCW84703.1|  hypothetical protein EUGRSUZ_B01522                     105   7e-23   
ref|XP_010532014.1|  PREDICTED: tyrosine N-monooxygenase-like           105   1e-22   
ref|XP_010476750.1|  PREDICTED: dihomomethionine N-hydroxylase-like   99.4    2e-22   
ref|XP_002466899.1|  hypothetical protein SORBIDRAFT_01g016150          102   6e-22   
gb|KDP35215.1|  hypothetical protein JCGZ_09374                         101   2e-21   
ref|XP_010497873.1|  PREDICTED: phenylalanine N-monooxygenase         94.7    2e-21   
emb|CAN67567.1|  hypothetical protein VITISV_017718                     100   2e-21   
gb|KCW75037.1|  hypothetical protein EUGRSUZ_E03811                     100   3e-21   
ref|XP_010658311.1|  PREDICTED: cytochrome P450 79B1-like             96.7    3e-21   
ref|XP_002989844.1|  hypothetical protein SELMODRAFT_235879           98.2    3e-20   
ref|XP_002990094.1|  hypothetical protein SELMODRAFT_43356            98.2    3e-20   
ref|XP_002532045.1|  flavonoid 3-hydroxylase, putative                97.8    5e-20   
ref|XP_010532013.1|  PREDICTED: dihomomethionine N-hydroxylase-like   96.3    2e-19   
ref|XP_002965839.1|  hypothetical protein SELMODRAFT_230667           95.9    2e-19   
ref|XP_011093925.1|  PREDICTED: cytochrome P450 703A2                 96.3    2e-19   
ref|XP_002983090.1|  hypothetical protein SELMODRAFT_155508           95.5    2e-19   
ref|XP_007221131.1|  hypothetical protein PRUPE_ppa019068mg           94.4    7e-19   
gb|EYU24031.1|  hypothetical protein MIMGU_mgv1a004909mg              94.0    1e-18   
ref|XP_011078642.1|  PREDICTED: cytochrome P450 CYP736A12-like        92.8    3e-18   
emb|CDO99831.1|  unnamed protein product                              90.5    3e-18   
gb|EAZ27538.1|  hypothetical protein OsJ_11492                        92.0    4e-18   
emb|CDP12931.1|  unnamed protein product                              93.6    4e-18   
sp|H2DH18.1|C7A12_PANGI  RecName: Full=Cytochrome P450 CYP736A12      92.0    5e-18   
dbj|BAD15331.1|  cytochrome P450                                      92.0    5e-18   
ref|XP_002310005.2|  hypothetical protein POPTR_0007s06240g           91.7    6e-18   
ref|XP_008440671.1|  PREDICTED: cytochrome P450 CYP736A12-like        91.7    8e-18   
gb|AFK79031.1|  cytochrome P450 CYP736A54                             91.3    8e-18   
gb|AJD25256.1|  cytochrome P450 CYP736A121                            91.3    8e-18   
ref|XP_008440668.1|  PREDICTED: cytochrome P450 CYP736A12-like        91.3    9e-18   
ref|XP_008227122.1|  PREDICTED: cytochrome P450 CYP736A12-like        90.9    1e-17   
ref|XP_007211842.1|  hypothetical protein PRUPE_ppa004664mg           90.9    1e-17   
emb|CDX70164.1|  BnaA10g25130D                                        90.9    1e-17   
gb|EMS57417.1|  Flavonoid 3',5'-hydroxylase                           91.3    1e-17   
dbj|BAK06020.1|  predicted protein                                    90.9    1e-17   
ref|XP_010100729.1|  Flavonoid 3'-monooxygenase                       90.9    1e-17   
gb|KDO59983.1|  hypothetical protein CISIN_1g038070mg                 86.3    1e-17   
ref|XP_004162312.1|  PREDICTED: cytochrome P450 750A1-like            90.5    2e-17   
ref|XP_004143494.1|  PREDICTED: cytochrome P450 750A1-like            90.5    2e-17   
ref|XP_002310008.2|  hypothetical protein POPTR_0007s06270g           90.5    2e-17   
ref|XP_002967231.1|  hypothetical protein SELMODRAFT_168652           90.1    2e-17   
ref|XP_004143567.1|  PREDICTED: cytochrome P450 71A1-like             89.0    2e-17   
ref|NP_680351.1|  cytochrome P450, family 79, subfamily A, polype...  90.5    2e-17   
gb|KDO38935.1|  hypothetical protein CISIN_1g045398mg                 86.3    2e-17   
ref|XP_010556597.1|  PREDICTED: cytochrome P450 703A2                 90.5    2e-17   
gb|KDO59988.1|  hypothetical protein CISIN_1g037605mg                 86.3    2e-17   
ref|XP_002974934.1|  hypothetical protein SELMODRAFT_102826           88.2    3e-17   
emb|CDX98829.1|  BnaC09g50060D                                        89.7    3e-17   
ref|XP_002523334.1|  flavonoid 3-hydroxylase, putative                89.7    3e-17   
ref|XP_008227118.1|  PREDICTED: cytochrome P450 CYP736A12-like        89.7    4e-17   
emb|CDP18035.1|  unnamed protein product                              89.4    4e-17   



>gb|KDP45695.1| hypothetical protein JCGZ_17302 [Jatropha curcas]
Length=334

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+NYFIPKDSHVI+SR GLGRNP+VW+EP KF PERH+KNDGS V+  +P+
Sbjct  195  PHVSITDTTVANYFIPKDSHVILSRVGLGRNPKVWDEPHKFKPERHIKNDGSGVTLTEPD  254

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHDlllahpl  309
            LR +SFS GRRGC  + +G+ ++ ML ARL+QGF W        I+L+ES+ DL LA PL
Sbjct  255  LRFISFSMGRRGCARVTMGTSITLMLFARLLQGFTWNVPRNETSIDLKESESDLTLAKPL  314

Query  308  halakprlpHYIYSSL  261
              LAKPRLP Y+Y  +
Sbjct  315  VLLAKPRLPAYVYDQI  330



>gb|AHF22089.1| CYP79D33 [Maesa lanceolata]
Length=550

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDT V+ YFIP+ SHV++SRPGLGRNPRVW EPL+F+PERHLK+DGS V   DP+
Sbjct  412  PHVSISDTNVAGYFIPRGSHVLLSRPGLGRNPRVWSEPLRFIPERHLKDDGSNVGLTDPD  471

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LRILSFS GRRGC G+ LGS ++ ML ARL+  F W       +IEL+ES  D
Sbjct  472  LRILSFSIGRRGCAGVTLGSTITVMLFARLLHSFSWSLPPDVPKIELKESPDD  524



>ref|XP_007146887.1| hypothetical protein PHAVU_006G0788000g, partial [Phaseolus vulgaris]
 gb|ESW18881.1| hypothetical protein PHAVU_006G0788000g, partial [Phaseolus vulgaris]
Length=355

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  SDT V NYFIPK SHV++SR  LGRNP+VW EP KF PERHLK+DG +V   +P
Sbjct  220  PPHVSMSDTMVGNYFIPKGSHVLLSRQELGRNPKVWNEPYKFKPERHLKSDGDDVVLTEP  279

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
             L+++SFSTGRRGCPG+ LG+ ++ ML ARL+ GF W        I L ES HD
Sbjct  280  NLKLISFSTGRRGCPGVMLGTTMTVMLFARLLHGFTWTAPPNVSTINLSESDHD  333



>gb|AJD25192.1| cytochrome P450 CYP79D40 [Salvia miltiorrhiza]
Length=522

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 86/114 (75%), Gaps = 3/114 (3%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            P H+ + D  V  Y IPK SHV++SRPGLGRNPRVW+EPL+F P RH+ ++ SEV  VD 
Sbjct  388  PTHVSSKDLVVGGYLIPKGSHVLLSRPGLGRNPRVWDEPLRFKPGRHIVDESSEVVLVDH  447

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            ELR+LSFSTGRRGCPGI LGS +S+MLLARL+QGF W   +    I+L ES HD
Sbjct  448  ELRMLSFSTGRRGCPGIVLGSTISTMLLARLIQGFSWRPPLGMDNIDLVESGHD  501



>ref|XP_007146888.1| hypothetical protein PHAVU_006G078900g [Phaseolus vulgaris]
 gb|ESW18882.1| hypothetical protein PHAVU_006G078900g [Phaseolus vulgaris]
Length=537

 Score =   148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  SDT V NYFIPK SHV++SR  LGRNP+VW EP KF PERHLK+DG +V   +P
Sbjct  402  PPHVSMSDTMVGNYFIPKGSHVLLSRQELGRNPKVWNEPYKFKPERHLKSDGDDVVLTEP  461

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
             L+++SFSTGRRGCPG+ LG+ ++ ML ARL+ GF W        I L ES HD
Sbjct  462  NLKLISFSTGRRGCPGVMLGTTMTVMLFARLLHGFTWTAPPNVSTINLSESDHD  515



>ref|XP_007146890.1| hypothetical protein PHAVU_006G079100g [Phaseolus vulgaris]
 gb|ESW18884.1| hypothetical protein PHAVU_006G079100g [Phaseolus vulgaris]
Length=538

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  SDT V NYFIPK SHV++SR  LGRNP+VW EP KF PERHLK+DG +V   +P
Sbjct  401  PPHVSMSDTMVGNYFIPKGSHVLLSRQELGRNPKVWNEPYKFKPERHLKSDGDDVVLTEP  460

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
             L+++SFSTGRRGCPG+ LG+ ++ ML ARL+ GF W        I L ES HD
Sbjct  461  NLKLISFSTGRRGCPGVMLGTTMTVMLFARLLHGFSWTAPPNVSTINLSESDHD  514



>gb|KCW75040.1| hypothetical protein EUGRSUZ_E03816 [Eucalyptus grandis]
Length=194

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD  V+ Y IPK SH+++SR GLGRNP+VW+EPLKF PERH+ +D  EV   DP+
Sbjct  60   PHVALSDAVVAGYRIPKGSHILVSRMGLGRNPKVWDEPLKFKPERHIMSDAVEVVLTDPD  119

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRESKHD  330
            LR++SFSTGRRGC  +QLG+ ++ MLLARL+QGF+W +      I L ES  D
Sbjct  120  LRLISFSTGRRGCIAMQLGTTMTVMLLARLIQGFNWSKPPSVSSINLIESMDD  172



>gb|EEE60610.1| hypothetical protein OsJ_14019 [Oryza sativa Japonica Group]
Length=235

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  +DTTV+ Y IPK SHV++SR GLGRNPR W++PL+F PERHLKN G+ V   +P
Sbjct  97   PPHVAIADTTVAGYMIPKGSHVMLSRIGLGRNPRAWDKPLEFQPERHLKNTGT-VVLAEP  155

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            ELR +SFS GRRGCP + LG+ ++ ML ARL+QGF W       RIEL+ES
Sbjct  156  ELRFVSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSIPPGGDRIELQES  206



>gb|KDP45699.1| hypothetical protein JCGZ_17306 [Jatropha curcas]
Length=465

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 84/110 (76%), Gaps = 3/110 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D TV+NYFIPK SHV++SR GLGRNP+VW EP KF PERH+KNDGS V+  +P+
Sbjct  334  PHVSIADATVANYFIPKGSHVLLSRMGLGRNPKVWNEPYKFKPERHIKNDGSGVTLTEPD  393

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            LR +SFSTGRRGC G+ +G+ ++ ML ARL+QGF W        I+L+ES
Sbjct  394  LRFISFSTGRRGCAGVTMGTSMTLMLFARLLQGFTWNVPPNQASIDLKES  443



>ref|NP_001052153.1| Os04g0174100 [Oryza sativa Japonica Group]
 dbj|BAF14067.1| Os04g0174100 [Oryza sativa Japonica Group]
Length=253

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  +DTTV+ Y IPK SHV++SR GLGRNPR W++PL+F PERHLKN G+ V   +P
Sbjct  115  PPHVAIADTTVAGYMIPKGSHVMLSRIGLGRNPRAWDKPLEFQPERHLKNTGT-VVLAEP  173

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            ELR +SFS GRRGCP + LG+ ++ ML ARL+QGF W       RIEL+ES
Sbjct  174  ELRFVSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSIPPGGDRIELQES  224



>gb|KDP45703.1| hypothetical protein JCGZ_17310 [Jatropha curcas]
Length=519

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+NYFIPK SHV++SR GLGRNP++W+EP KF PERH+KNDGS+V+ ++P 
Sbjct  380  PHVSITDTTVANYFIPKGSHVLLSRVGLGRNPKIWDEPHKFKPERHIKNDGSQVTLIEPY  439

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESK  336
            L  +SFSTGRRGCP + +G+ ++ ML ARL+ GF W        IEL+ES+
Sbjct  440  LNFISFSTGRRGCPAVTMGTSMTLMLFARLLHGFTWNVPSNQTSIELKESE  490



>gb|KHN24730.1| Isoleucine N-monooxygenase 2 [Glycine soja]
Length=537

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  SDT V+NYFIPK SHV++SR  LGRNP+VW E  KF PERHLK+DGS+V   +P
Sbjct  402  PPHVSMSDTMVANYFIPKGSHVMLSRQELGRNPKVWNETYKFKPERHLKSDGSDVDLTEP  461

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
             L+ +SFSTGRRGCPG+ LG+ ++ ML ARL+ GF W        I L ES  D
Sbjct  462  NLKFISFSTGRRGCPGVMLGTTMTVMLFARLLHGFTWTAPPNVSSINLAESNDD  515



>ref|XP_003537358.1| PREDICTED: isoleucine N-monooxygenase 2-like [Glycine max]
Length=537

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  SDT V+NYFIPK SHV++SR  LGRNP+VW E  KF PERHLK+DGS+V   +P
Sbjct  402  PPHVSMSDTMVANYFIPKGSHVMLSRQELGRNPKVWNETYKFKPERHLKSDGSDVDLTEP  461

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
             L+ +SFSTGRRGCPG+ LG+ ++ ML ARL+ GF W        I L ES  D
Sbjct  462  NLKFISFSTGRRGCPGVMLGTTMTVMLFARLLHGFTWTAPPNVSSINLAESNDD  515



>ref|XP_008349636.1| PREDICTED: tyrosine N-monooxygenase-like [Malus domestica]
 ref|XP_008359051.1| PREDICTED: tyrosine N-monooxygenase-like [Malus domestica]
Length=198

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 81/113 (72%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV +YFIPK SHVI+SR GLGRNP+VW+EPLKF PERHLK+DGS V   + E
Sbjct  72   PHVSMADTTVGDYFIPKGSHVILSRVGLGRNPKVWDEPLKFKPERHLKDDGSGVVLTESE  131

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTG RGC    LG+ ++ ML ARL+ GF W        IEL ES +D
Sbjct  132  LRFISFSTGMRGCVASTLGTAMTVMLFARLLHGFTWHVPPTESSIELTESTND  184



>ref|XP_003543894.1| PREDICTED: isoleucine N-monooxygenase 2-like [Glycine max]
 gb|KHN02647.1| Isoleucine N-monooxygenase 2 [Glycine soja]
Length=537

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  SDT V NYFIPK SHV++SR  LGRNP+VW E  KF PERHLK+DGS+V   +P
Sbjct  402  PPHVSMSDTMVGNYFIPKGSHVMLSRQELGRNPKVWNETYKFKPERHLKSDGSDVDLTEP  461

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
             L+ +SFSTGRRGCPG+ LG+ ++ ML ARL+ GF W        I L ES  D
Sbjct  462  NLKFISFSTGRRGCPGVMLGTTMTVMLFARLLHGFTWTAPPNVSSINLAESNDD  515



>gb|KEH34486.1| cytochrome P450 family protein [Medicago truncatula]
Length=533

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 80/110 (73%), Gaps = 3/110 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DT V +YFIPK SHV++ R GLGRNP+VW EP KF PERHLKNDGS ++  +PE
Sbjct  399  PHVSIKDTMVGDYFIPKGSHVLLGRSGLGRNPKVWTEPYKFKPERHLKNDGSNIALTEPE  458

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            L+ ++FS GRRGCPGI LGS ++ MLLARL+ GF W       RI+  ES
Sbjct  459  LKFITFSIGRRGCPGIMLGSTMTIMLLARLLHGFTWCLPPNTTRIKFVES  508



>ref|XP_011071676.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=530

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ + DT V  Y IPK S V++SRPGLGRNPR+WE+PL + PERH+ N  SEV  VD E
Sbjct  392  PHVSSKDTIVGGYLIPKGSQVLLSRPGLGRNPRIWEDPLMYKPERHIVNKDSEVVLVDHE  451

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ----CGRIELRESKHD  330
            LR+LSFSTGRRGCPGI LGS ++++LLARL+QGF+W         I+L ES+ D
Sbjct  452  LRMLSFSTGRRGCPGIVLGSTMTTILLARLIQGFNWSTPPNGQSNIDLAESEGD  505



>ref|XP_011071674.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=529

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ + DT V  YFIPK S V++SR GLGRNPR+WE+PL + PERH+ N  SEV  VD E
Sbjct  391  PHVSSKDTIVGGYFIPKGSQVLLSRLGLGRNPRIWEDPLVYKPERHIVNKDSEVMLVDHE  450

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR+LSFSTGRRGCPGI LGS ++S+LLARL+QGF+W
Sbjct  451  LRMLSFSTGRRGCPGIMLGSTMTSILLARLIQGFNW  486



>gb|KDP45698.1| hypothetical protein JCGZ_17305 [Jatropha curcas]
Length=534

 Score =   142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 85/111 (77%), Gaps = 3/111 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+NYFIPK SHV++SR GLGRN ++W+EP KF PERH+KNDGS+V  V+P 
Sbjct  395  PHVSMTDTTVANYFIPKGSHVLLSRVGLGRNSKIWDEPHKFKPERHIKNDGSQVKLVEPY  454

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESK  336
            L  +SFSTGRRGCPG+ +G+ ++ ML ARL+ GF W        I+L+ES+
Sbjct  455  LNFISFSTGRRGCPGVTMGTSMTLMLFARLLHGFTWNVPPNQTSIDLKESE  505



>ref|XP_007146892.1| hypothetical protein PHAVU_006G0792000g, partial [Phaseolus vulgaris]
 gb|ESW18886.1| hypothetical protein PHAVU_006G0792000g, partial [Phaseolus vulgaris]
Length=209

 Score =   136 bits (343),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+ ++DT V NYFIPK SHV++SR GLGRNPRVW EP KF PERH  NDGS V+  +P
Sbjct  74   PPHVSSNDTMVGNYFIPKGSHVLLSRHGLGRNPRVWNEPHKFKPERHEMNDGSMVALSEP  133

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            +L+ ++F TGRRGCP + LGS ++ ML ARL+  F W
Sbjct  134  DLKFITFGTGRRGCPAVILGSTMTVMLFARLIHAFSW  170



>gb|EYU45627.1| hypothetical protein MIMGU_mgv1a004405mg [Erythranthe guttata]
Length=529

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 85/110 (77%), Gaps = 2/110 (2%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ T D  V  YFIP+ SHV++SRPGLGRNPRVWE PL++ PERH+  + ++V  VD +
Sbjct  396  PHVSTEDAVVGGYFIPRGSHVLLSRPGLGRNPRVWENPLEYKPERHMVFESAQVELVDHD  455

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ--CGRIELRESK  336
            LR+LSFSTGRRGCPG+ LGS ++ MLLARL+ GFDW+     RI+L ES+
Sbjct  456  LRMLSFSTGRRGCPGVTLGSTMAVMLLARLLHGFDWMAPPGVRIDLVESE  505



>ref|XP_007134794.1| hypothetical protein PHAVU_010G076800g [Phaseolus vulgaris]
 gb|ESW06788.1| hypothetical protein PHAVU_010G076800g [Phaseolus vulgaris]
Length=533

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKND-GSEVSFVD  486
            PPH+  SDTTV NYFIPK SHVI+SR  LGRNP+VW EPLKF PERHLK D GS V   +
Sbjct  397  PPHVSMSDTTVGNYFIPKGSHVILSRKELGRNPKVWNEPLKFKPERHLKIDNGSNVVLTE  456

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            P LR +SFSTGRR CPG+ LGS ++ ML ARL+ GF W       ++ + ES
Sbjct  457  PNLRFISFSTGRRSCPGVMLGSTMTVMLFARLLHGFTWTAPSNVSKVNVAES  508



>gb|EEC76870.1| hypothetical protein OsI_15062 [Oryza sativa Indica Group]
Length=376

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  +DTTV+ Y IPK SHV++SR GLGRNPR W++PL+F PERHLKN G+ V   +P
Sbjct  238  PPHVAIADTTVAGYMIPKGSHVMLSRIGLGRNPRAWDKPLEFQPERHLKNTGT-VVLAEP  296

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            ELR +SFS GRRGCP + LG+ ++ ML ARL+QGF W       RIEL+ES
Sbjct  297  ELRFVSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSIPPGGDRIELQES  347



>gb|KEH34488.1| cytochrome P450 family protein [Medicago truncatula]
Length=528

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ T+DT V NYFIPK SHV++ R GLGRN  VW EP KF PERHLKNDGS ++  +PE
Sbjct  394  PHVSTNDTMVGNYFIPKGSHVLLGRRGLGRNRNVWAEPYKFKPERHLKNDGSAIALTEPE  453

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            L+ +SFSTGRRGCP + LGS ++ MLLARL+ GF W
Sbjct  454  LKFISFSTGRRGCPAVMLGSTMTIMLLARLLHGFTW  489



>gb|EYU45628.1| hypothetical protein MIMGU_mgv1a023130mg [Erythranthe guttata]
Length=526

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 84/112 (75%), Gaps = 2/112 (2%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ T D  V  YFIP+ SHV++SRPGLGRNPRVWE PL++ PERH+  + ++V  VD +
Sbjct  393  PHVSTEDAVVGGYFIPRGSHVLLSRPGLGRNPRVWENPLEYNPERHMVVESAQVELVDHD  452

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ--CGRIELRESKHD  330
            LR+LSFSTGRRGCPG+ LGS ++ MLLARL+ GFDW      RI L ES+ D
Sbjct  453  LRMLSFSTGRRGCPGVTLGSTMAVMLLARLLHGFDWTAPPGVRIGLGESEGD  504



>gb|KDP45693.1| hypothetical protein JCGZ_17300 [Jatropha curcas]
Length=494

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 85/111 (77%), Gaps = 3/111 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D TV+NYFIPK SHV++SR GLG NP+VW+EP KF PERH+KNDGS V+  +P+
Sbjct  355  PHVSIADATVANYFIPKGSHVLLSRMGLGWNPKVWKEPHKFKPERHIKNDGSGVTLTEPD  414

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESK  336
            LR +SFSTGRRGC G+ +G+ ++ ML ARL+QGF W        I+L+ES+
Sbjct  415  LRFISFSTGRRGCAGVTMGTSMTLMLFARLLQGFTWNVPPNQTSIDLKESE  465



>ref|XP_009780952.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana sylvestris]
Length=534

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD+ V  YFIPK S V++SR GLGRNPRVW++P+KF PERH+  +G +V F D E
Sbjct  399  PHVSISDSVVGEYFIPKGSAVLLSRLGLGRNPRVWDDPMKFKPERHISEEGGDVVFTDSE  458

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR+LSFS GRRGCPG++LGS +++MLLARL+QGF W
Sbjct  459  LRLLSFSIGRRGCPGVKLGSTITTMLLARLLQGFTW  494



>emb|CAH66094.1| OSIGBa0114I04.1 [Oryza sativa Indica Group]
Length=458

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  +DTTV+ Y IPK SHV++SR GLGRNPR W++PL+F PERHLKN G+ V   +P
Sbjct  320  PPHVAIADTTVAGYMIPKGSHVMLSRIGLGRNPRAWDKPLEFQPERHLKNTGT-VVLAEP  378

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            ELR +SFS GRRGCP + LG+ ++ ML ARL+QGF W       RIEL+ES
Sbjct  379  ELRFVSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSIPPGGDRIELQES  429



>gb|EMS59576.1| Tyrosine N-monooxygenase [Triticum urartu]
Length=205

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 82/111 (74%), Gaps = 5/111 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTT++ Y IPKDSH+++SR GLGRNP++W EPL+F PERHL  + + V  +DP 
Sbjct  74   PHVAMADTTIAGYTIPKDSHILLSRLGLGRNPKIWTEPLEFQPERHL--NTANVLLIDPG  131

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRESK  336
            LR +SFS+GRRGCPGI LG+ ++ ML AR++QGF W +      I L+ES 
Sbjct  132  LRFISFSSGRRGCPGISLGTSITMMLFARMLQGFTWTKLPGVKSISLQESN  182



>ref|XP_011075711.1| PREDICTED: valine N-monooxygenase 1-like [Sesamum indicum]
Length=522

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DTTV  YFIPKDSHV++SR GLGRN RVW++PL + PERH+ N  S+V  VD E
Sbjct  384  PHVSIKDTTVGGYFIPKDSHVLLSRRGLGRNSRVWKDPLIYKPERHIINKDSKVLLVDHE  443

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR+LSFSTGRRGCPGI LGS ++ MLLARL+QGF W
Sbjct  444  LRMLSFSTGRRGCPGIVLGSTMTIMLLARLIQGFSW  479



>gb|KCW74950.1| hypothetical protein EUGRSUZ_E03692, partial [Eucalyptus grandis]
Length=515

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD  V+ Y IPK SH+++SR GLGRNP+VW+EPLKF PERH  ND  EV   DP+
Sbjct  381  PHVALSDAVVAGYRIPKGSHILVSRMGLGRNPKVWDEPLKFKPERHFMNDAVEVVLTDPD  440

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRESKHD  330
            LR++SFSTGRRGC  +QLG+ ++ MLLARL+QGF+W +      I L ES  D
Sbjct  441  LRLISFSTGRRGCIAMQLGTTMTVMLLARLIQGFNWSKPPSVSSINLIESMDD  493



>ref|XP_010059479.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=524

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD  V+ Y IPK SH+++SR GLGRNP+VW+EPLKF PERH  ND  EV   DP+
Sbjct  390  PHVALSDAVVAGYRIPKGSHILVSRMGLGRNPKVWDEPLKFKPERHFMNDAVEVVLTDPD  449

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRESKHD  330
            LR++SFSTGRRGC  +QLG+ ++ MLLARL+QGF+W +      I L ES  D
Sbjct  450  LRLISFSTGRRGCIAMQLGTTMTVMLLARLIQGFNWSKPPSVSSINLIESMDD  502



>ref|XP_009782885.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana sylvestris]
Length=543

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD+ V  YFIPK S V++SR GLGRNPRVW++P+KF PERH+  +G +V F D E
Sbjct  408  PHVSVSDSVVGEYFIPKGSVVLLSRFGLGRNPRVWDDPMKFKPERHISEEGGDVVFTDSE  467

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR+LSFS GRRGCPG+ LGS +++MLLARL+QGF W
Sbjct  468  LRLLSFSIGRRGCPGVNLGSTITTMLLARLLQGFTW  503



>ref|XP_009765490.1| PREDICTED: isoleucine N-monooxygenase 2-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765491.1| PREDICTED: isoleucine N-monooxygenase 2-like isoform X2 [Nicotiana 
sylvestris]
Length=543

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD+ V  YFIPK S V++SR GLGRNPRVW++P+KF PERH+  +G +V F D E
Sbjct  408  PHVSVSDSVVGEYFIPKGSVVLLSRLGLGRNPRVWDDPMKFKPERHISEEGGDVVFTDSE  467

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR+LSFS GRRGCPG+ LGS +++MLLARL+QGF W
Sbjct  468  LRLLSFSIGRRGCPGVNLGSTITTMLLARLLQGFTW  503



>ref|NP_001052148.1| Os04g0171800 [Oryza sativa Japonica Group]
 dbj|BAF14062.1| Os04g0171800 [Oryza sativa Japonica Group]
 dbj|BAH00328.1| unnamed protein product [Oryza sativa Japonica Group]
Length=550

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  +DTTV+ Y IPK SHV++SR GLGRNPR W++PL+F PERHLKN G+ V   +P
Sbjct  412  PPHVAIADTTVAGYMIPKGSHVMLSRIGLGRNPRAWDKPLEFQPERHLKNTGT-VVLAEP  470

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            ELR +SFS GRRGCP + LG+ ++ ML ARL+QGF W       RIEL+ES
Sbjct  471  ELRFVSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSIPPGGDRIELQES  521



>emb|CAI44620.1| B1168G10.4 [Oryza sativa Japonica Group]
Length=520

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  +DTTV+ Y IPK SHV++SR GLGRNPR W++PL+F PERHLKN G+ V   +P
Sbjct  382  PPHVAIADTTVAGYMIPKGSHVMLSRIGLGRNPRAWDKPLEFQPERHLKNTGT-VVLAEP  440

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            ELR +SFS GRRGCP + LG+ ++ ML ARL+QGF W       RIEL+ES
Sbjct  441  ELRFVSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSIPPGGDRIELQES  491



>ref|XP_011098373.1| PREDICTED: valine N-monooxygenase 1-like [Sesamum indicum]
Length=529

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   +TTV  YFIPK+SHV++SR GLGRNPR+WE+PL + PERH+ N  SEV  +D +
Sbjct  392  PHVSVEETTVGGYFIPKNSHVLLSRHGLGRNPRIWEDPLVYKPERHIVNKDSEVVLMDHD  451

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR++SFSTGRRGCPG+ LGS ++++LLARL+QGF+W
Sbjct  452  LRMISFSTGRRGCPGVVLGSTMATILLARLIQGFNW  487



>gb|EAZ29960.1| hypothetical protein OsJ_14015 [Oryza sativa Japonica Group]
Length=520

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  +DTTV+ Y IPK SHV++SR GLGRNPR W++PL+F PERHLKN G+ V   +P
Sbjct  382  PPHVAIADTTVAGYMIPKGSHVMLSRIGLGRNPRAWDKPLEFQPERHLKNTGT-VVLAEP  440

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            ELR +SFS GRRGCP + LG+ ++ ML ARL+QGF W       RIEL+ES
Sbjct  441  ELRFVSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSIPPGGDRIELQES  491



>gb|KEH34491.1| cytochrome P450 family protein [Medicago truncatula]
Length=539

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+   + TVS Y IPK SHV++S+ GLGRNP+VW EP KF PERHLKNDGS V   +P
Sbjct  403  PPHVAMDNITVSKYMIPKGSHVLLSKQGLGRNPKVWNEPHKFQPERHLKNDGSMVVLSEP  462

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            +L+ +SFSTGRRGCPGI LG+ ++ MLL RL+ GFDW
Sbjct  463  DLKFISFSTGRRGCPGIVLGTSMTMMLLGRLLHGFDW  499



>gb|KDP45690.1| hypothetical protein JCGZ_17297 [Jatropha curcas]
Length=543

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+N+FIPK SHV++SR GLGRNP++W+EP KF PE H+KN+GS+V+ +DP 
Sbjct  404  PHVSMTDTTVANFFIPKGSHVLLSRVGLGRNPKIWDEPHKFKPEHHIKNNGSQVTLIDPY  463

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            L  +S STGRRGCPG+ +G+ ++ ML ARL+QGF W
Sbjct  464  LNFISLSTGRRGCPGVTMGTSMTLMLFARLLQGFTW  499



>ref|XP_010059539.1| PREDICTED: tryptophan N-monooxygenase 1-like [Eucalyptus grandis]
Length=380

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD  V+ Y IPK SH+++SR GLGRNP+VW+EPLKF PERH+ +D  EV   DP+
Sbjct  246  PHVALSDAVVAGYRIPKGSHILVSRMGLGRNPKVWDEPLKFKPERHIMSDAVEVVLTDPD  305

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRESKHD  330
            LR++SFSTGRRGC  +QLG+ ++ MLLARL+QGF+W +      I L ES  D
Sbjct  306  LRLISFSTGRRGCIAMQLGTTMTVMLLARLIQGFNWSKPPSVSSINLIESMDD  358



>ref|XP_007011304.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20114.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=554

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 83/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D  V+ YFIPK SHV++SR GLGRNP+VW+EPLKF PERHLK+   EV   + E
Sbjct  416  PHVSNTDVIVAGYFIPKGSHVLLSRVGLGRNPKVWDEPLKFKPERHLKDGSIEVDLTETE  475

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
            LR +SFSTGRRGC G+ LGS ++ MLLARL+QGF W       +I+L ES+ D
Sbjct  476  LRFISFSTGRRGCMGVALGSEMTIMLLARLIQGFAWKAQPDEAKIDLSESEDD  528



>gb|EAY90707.1| hypothetical protein OsI_12308 [Oryza sativa Indica Group]
Length=216

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 10/117 (9%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL-------KNDGS  504
            PP +  +DTT++ Y IPK S VI+SR GLGRNPRVW++PL+F PERHL       + D  
Sbjct  72   PPRVAMADTTIAGYTIPKGSQVILSRVGLGRNPRVWDDPLEFRPERHLSPYPAGGRGDAG  131

Query  503  EVSFVDPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRE  342
             V+  + ELR +SFSTGRRGCPG+ LG+L++  L ARL+QGF+W +     R+ELRE
Sbjct  132  VVALTEAELRFVSFSTGRRGCPGVSLGTLITVTLFARLLQGFEWSKPAGVKRVELRE  188



>ref|XP_007011294.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20104.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=419

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 84/113 (74%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ T+D TV+ YFIPK SHV++SR GLGRNP+VW++PLKF PERHLK+    V   + +
Sbjct  284  PHVSTADATVAGYFIPKGSHVLLSRYGLGRNPKVWDDPLKFNPERHLKDGSMCVGLTETD  343

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTGRRGC G+ LG+ ++ MLLARL+QGF+W        I+L E+K D
Sbjct  344  LRFISFSTGRRGCMGVALGTAMTVMLLARLLQGFNWRVPPNEANIDLSEAKDD  396



>ref|XP_009601899.1| PREDICTED: LOW QUALITY PROTEIN: isoleucine N-monooxygenase 2-like 
[Nicotiana tomentosiformis]
Length=528

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = -1

Query  659  PHLCTSDTTVS-NYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PH+  SDT +S  YFIPK S V++SR GLGRNPRVWEEP+KF PERHLK +  EV   D 
Sbjct  393  PHVSVSDTIISEKYFIPKGSVVLLSRLGLGRNPRVWEEPMKFKPERHLKENNGEVVLNDS  452

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            ELR+LSFS GRRGCPG++LGS +++MLLARL+ GF W
Sbjct  453  ELRLLSFSIGRRGCPGVKLGSTITTMLLARLLHGFSW  489



>ref|XP_010027351.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
 gb|KCW62237.1| hypothetical protein EUGRSUZ_H04897 [Eucalyptus grandis]
Length=531

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDT V+ Y IPK SH+++SR GLGRNP+VWEEPLKF P+RH+ +D +EV   +P 
Sbjct  397  PHVAMSDTVVAGYRIPKGSHILLSRVGLGRNPKVWEEPLKFKPDRHITSDQAEVVLTEPN  456

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRESKHD  330
            LR +SFSTGRRGC G  LG+ ++ MLLARL+QGF W +      I L ES++D
Sbjct  457  LRFISFSTGRRGCMGATLGTTMTVMLLARLIQGFSWSKPSNLSSISLAESRND  509



>ref|XP_011071563.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=529

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ + DT    YFIPK S V++SR GLGRNPR+WE+PL + PERH+ N  SEV  VD E
Sbjct  391  PHVSSKDTIAGGYFIPKGSQVLLSRLGLGRNPRIWEDPLVYKPERHIVNKNSEVVLVDHE  450

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ----CGRIELRESKHD  330
            L +LSFSTGRRGCPGI LGS ++++LLARL+QGF+W         I+L ES+ D
Sbjct  451  LHMLSFSTGRRGCPGIVLGSTMTTILLARLIQGFNWSAPPNGQSNIDLTESEGD  504



>gb|KDP45702.1| hypothetical protein JCGZ_17309 [Jatropha curcas]
Length=454

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+N FIPK SHV++S  GLGRNP++W+EP KF PERH+KNDGS V+  +P+
Sbjct  342  PHVPITDTTVANCFIPKGSHVLLSGVGLGRNPKIWDEPHKFKPERHIKNDGSGVTLTEPD  401

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR +SFSTGRRGC G+ +G+ ++ ML ARL+QGF W
Sbjct  402  LRFISFSTGRRGCAGVTMGTSITLMLFARLLQGFTW  437



>ref|XP_011084186.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=523

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DT V  YFIPK S V++SR GLGRNPRVWE+PL + PERH+ +  SEV  VD E
Sbjct  392  PHVSIEDTVVGGYFIPKGSQVLLSRLGLGRNPRVWEDPLVYKPERHIVDKDSEVVLVDHE  451

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR++SFSTGRRGCPGI LGS ++++LLARL+QGF+W
Sbjct  452  LRMISFSTGRRGCPGIVLGSTMTTILLARLIQGFNW  487



>gb|KCW62252.1| hypothetical protein EUGRSUZ_H04912 [Eucalyptus grandis]
Length=473

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 81/113 (72%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD  ++ Y IPK SH++ISR GLGRNP VW+EPLKF PERH+ +D  EV   +P+
Sbjct  339  PHVALSDAVMAGYRIPKGSHILISRLGLGRNPEVWDEPLKFKPERHITSDTEEVLLAEPD  398

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTGRRGC   QLG+ ++ MLLARL+QGF+W        I L+ESK D
Sbjct  399  LRFISFSTGRRGCIATQLGTTMTVMLLARLIQGFNWSPLANDSSINLKESKDD  451



>ref|XP_008349637.1| PREDICTED: isoleucine N-monooxygenase 1-like [Malus domestica]
Length=534

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV +YFIPK SHVI+SR GLGRNP+VW+EPLKF PERHLK+DGS V   + E
Sbjct  398  PHVSMADTTVGDYFIPKGSHVILSRVGLGRNPKVWDEPLKFKPERHLKDDGSGVVLTESE  457

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTG RGC    LG+ ++ ML ARL+ GF W        IEL ES++D
Sbjct  458  LRFISFSTGMRGCVASGLGTXMTVMLFARLLHGFSWHVPPTESSIELTESQND  510



>ref|XP_004237294.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=443

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 79/98 (81%), Gaps = 2/98 (2%)
 Frame = -1

Query  659  PHLCTSDTTVS-NYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLK-NDGSEVSFVD  486
            PH+  SDT +S  YFI K S VI+SR GLGRNPRVW++PLKF PERHLK  DGSEV   D
Sbjct  307  PHVSVSDTIISEKYFIAKGSVVILSRLGLGRNPRVWKDPLKFNPERHLKMKDGSEVVLTD  366

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
             +LR+LSFS GRRGCPG++LGS +++MLLARL+QGF W
Sbjct  367  SKLRLLSFSLGRRGCPGVKLGSTITTMLLARLLQGFTW  404



>ref|XP_010253086.1| PREDICTED: phenylalanine N-monooxygenase [Nelumbo nucifera]
Length=588

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 87/120 (73%), Gaps = 10/120 (8%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKND-------GSE  501
            PH+  +D+TV+ YFIPK SHV++SR GLGRNP+VW+EPL+F PERHL+ D        +E
Sbjct  443  PHVSNADSTVAGYFIPKGSHVLLSRIGLGRNPKVWDEPLRFKPERHLQLDNGRAEATAAE  502

Query  500  VSFVDPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            V  V+P+LR +SFSTGRRGC G  LGS ++ MLLARL+QGF W       +I+L ES +D
Sbjct  503  VELVEPDLRFISFSTGRRGCMGAALGSAMTVMLLARLLQGFSWQVPPGLSQIDLSESTND  562



>emb|CDP19035.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKN-DGSEVSFVDP  483
            PH+ T DT V  YFIPK SHVI+SRPGLGRNPR+WE+PLK+ PERH+K+ + + +   DP
Sbjct  408  PHVSTQDTVVGGYFIPKGSHVILSRPGLGRNPRIWEDPLKYKPERHMKDMEDARMDLNDP  467

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            EL + SFSTGRRGCPG+ LGS ++ MLLARL+Q F W
Sbjct  468  ELNMFSFSTGRRGCPGVLLGSTLTVMLLARLLQCFSW  504



>gb|KDP45692.1| hypothetical protein JCGZ_17299 [Jatropha curcas]
Length=465

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 83/108 (77%), Gaps = 3/108 (3%)
 Frame = -1

Query  644  SDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPELRILS  465
            +DTT+ NY+IPK SH ++SR GLGRNP+VW+EP KF PERH+KNDGS V+  +P+LR +S
Sbjct  331  TDTTLENYYIPKGSHALLSRVGLGRNPKVWDEPHKFKPERHIKNDGSGVTLTEPDLRFIS  390

Query  464  FSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            FSTGRRGC G+ +G+ ++ ML ARL+QGF W        I+L+ES+ D
Sbjct  391  FSTGRRGCAGVTMGTSITLMLFARLLQGFTWNVPRNETSIDLKESESD  438



>ref|XP_008385015.1| PREDICTED: isoleucine N-monooxygenase 1-like [Malus domestica]
Length=534

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV +YFIPK SHVI+SR GLGRNP+VW+EPLKF PERHLK+DGS V   + E
Sbjct  398  PHVSMADTTVGDYFIPKGSHVILSRVGLGRNPKVWDEPLKFKPERHLKDDGSGVVLTESE  457

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTG RGC    LG+ ++ ML ARL+ GF W        IEL ES++D
Sbjct  458  LRFISFSTGMRGCVASGLGTXMTVMLFARLLHGFSWHVPPTESSIELTESQND  510



>gb|KCW62239.1| hypothetical protein EUGRSUZ_H04899 [Eucalyptus grandis]
Length=531

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDT V+ Y IPK SH+++SR GLGRNP+VW+EPLKF P+RH+ +D +EV   +P+
Sbjct  397  PHVAMSDTMVAGYRIPKGSHILLSRVGLGRNPKVWDEPLKFNPDRHITSDQAEVVLTEPD  456

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRESKHD  330
            LR +SFSTGRRGC    LG+ ++ MLLARL+QGF W +     RI L ES+ D
Sbjct  457  LRFISFSTGRRGCMAAALGTTMTVMLLARLIQGFSWSKPSNLSRINLAESRDD  509



>ref|XP_010027355.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=546

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD  V+ Y IPK SH+++SR GLGRNP+VW EPLKF PERH+ +D  EV   DP+
Sbjct  412  PHVALSDAIVAGYRIPKGSHILVSRMGLGRNPKVWNEPLKFKPERHIMSDAVEVVLTDPD  471

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR++SFSTGRRGC  +QLG+ ++ MLLARL+QGF+W
Sbjct  472  LRLISFSTGRRGCIAMQLGTTMTVMLLARLIQGFNW  507



>ref|XP_009342222.1| PREDICTED: isoleucine N-monooxygenase 1-like [Pyrus x bretschneideri]
Length=534

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 81/113 (72%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV +YFIPK SHVI+SR GLGRNP+VW+EPLKF PERHLK+DGS V   + E
Sbjct  399  PHVSMADTTVGDYFIPKGSHVILSRVGLGRNPKVWDEPLKFKPERHLKDDGSGVVLTESE  458

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTG RGC    LG+ ++ ML ARL+ GF W        IEL ES +D
Sbjct  459  LRFISFSTGMRGCVASTLGTAMTVMLFARLLHGFTWHVPPTESSIELTESTND  511



>ref|XP_008359055.1| PREDICTED: isoleucine N-monooxygenase 1-like [Malus domestica]
Length=637

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV +YFIPK SHVI+SR GLGRNP+VW+EPLKF PERHLK+DGS V   + E
Sbjct  501  PHVSMADTTVGDYFIPKGSHVILSRVGLGRNPKVWDEPLKFKPERHLKDDGSGVVLTESE  560

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTG RGC    LG+ ++ ML ARL+ GF W        IEL ES++D
Sbjct  561  LRFISFSTGMRGCVASGLGTTMTVMLFARLLHGFSWHVPPTESSIELTESQND  613



>ref|XP_009369526.1| PREDICTED: isoleucine N-monooxygenase 1-like [Pyrus x bretschneideri]
Length=534

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 81/113 (72%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV +YFIPK SHVI+SR GLGRNP+VW+EPLKF PERHLK+DGS V   + E
Sbjct  399  PHVSMADTTVGDYFIPKGSHVILSRVGLGRNPKVWDEPLKFKPERHLKDDGSGVVLTESE  458

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTG RGC    LG+ ++ ML ARL+ GF W        IEL ES +D
Sbjct  459  LRFISFSTGMRGCVASTLGTAMTVMLFARLLHGFTWHVPPTESSIELTESTND  511



>ref|XP_009599475.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana tomentosiformis]
Length=544

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDT V  YFIPK S V++SR GLGRNPRVWE+P+KF PE HL  +G EV   D E
Sbjct  410  PHVSVSDTIVGEYFIPKGSVVLLSRLGLGRNPRVWEDPMKFKPEHHLNEEGGEVVLNDSE  469

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            L + SFS GRRGCPG++LGS +++MLLARL+QGF+W
Sbjct  470  LHLFSFSIGRRGCPGVKLGSTITTMLLARLLQGFNW  505



>ref|XP_010429154.1| PREDICTED: tryptophan N-monooxygenase 2-like [Camelina sativa]
Length=304

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  169  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECSEVTLTEND  227

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W   G   R+EL ES HD
Sbjct  228  LRFISFSTGKRGCAAPALGTAITTMMLARLLQGFKWKLVGGETRVELMESIHD  280



>ref|XP_007011293.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20103.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=553

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ T+D TV+ YFIPK SHV++SR GLGRNP+VW++PLKF PERHLK+    V   + +
Sbjct  418  PHVSTADATVAGYFIPKGSHVLLSRYGLGRNPKVWDDPLKFNPERHLKDGSMCVGLTETD  477

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTGRRGC G+ LG+ ++ MLLARL+QGF W        I+L E+K D
Sbjct  478  LRFISFSTGRRGCMGVALGTAMTVMLLARLLQGFTWRVPPNEANIDLSEAKDD  530



>ref|XP_011071673.1| PREDICTED: isoleucine N-monooxygenase 1-like [Sesamum indicum]
Length=528

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   D TV  YFIPK SHV++SR GLGRNPRVWE+PL + PERH+ +  SEV  VD E
Sbjct  391  PHVSVKDATVGGYFIPKGSHVLLSRRGLGRNPRVWEDPLVYKPERHIVSKDSEVMLVDHE  450

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            L +LSFSTGRRGCPG+ LGS+++++LLARL+QGF W
Sbjct  451  LCMLSFSTGRRGCPGVVLGSIMTTILLARLIQGFVW  486



>ref|XP_009623062.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana tomentosiformis]
Length=543

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD+ V +YFIPK S V++SR GLGRNPRVW++P+KF PERH+  +G +V F D +
Sbjct  408  PHVSLSDSVVGDYFIPKGSVVLLSRLGLGRNPRVWDDPMKFKPERHMNEEGGDVVFTDSK  467

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            L  LSFS GRRGCPG++LGS +++MLLARL+QGF W
Sbjct  468  LHFLSFSIGRRGCPGVKLGSTITTMLLARLLQGFTW  503



>ref|XP_007011298.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20108.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=534

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 82/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D  V+ YFIPK SHV++SR GLGRN +VW+EPLKF PERHLK+   EV   + E
Sbjct  396  PHVSNTDVIVAGYFIPKGSHVLLSRVGLGRNSQVWDEPLKFKPERHLKDGSIEVDLTETE  455

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
            LR +SFSTGRRGC G+ LGS ++ MLLARL+QGF W       +I+L ES+ D
Sbjct  456  LRFISFSTGRRGCMGVALGSEMTIMLLARLIQGFAWKAQPDEAKIDLSESEDD  508



>emb|CDP18411.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKN-DGSEVSFVDP  483
            PH+ T DT V  YFIPK SHVI+SRPGL RNPR+WE+PLK+ PERH+K+ D + +   DP
Sbjct  407  PHVSTQDTVVGGYFIPKGSHVILSRPGLSRNPRIWEDPLKYKPERHMKDMDDARMDLNDP  466

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            EL + SFSTGRRGCPG+ LGS ++ MLLARL+Q F W
Sbjct  467  ELNMFSFSTGRRGCPGVLLGSTLTVMLLARLLQCFSW  503



>gb|KCW62254.1| hypothetical protein EUGRSUZ_H04914 [Eucalyptus grandis]
Length=519

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD  V+ Y IPK SH+++SR GLGRNP+VW EPLKF PERH+ +D  EV   DP+
Sbjct  385  PHVALSDAIVAGYRIPKGSHILVSRMGLGRNPKVWNEPLKFKPERHIMSDAVEVVLTDPD  444

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR++SFSTGRRGC  +QLG+ ++ MLLARL+QGF+W
Sbjct  445  LRLISFSTGRRGCIAMQLGTTMTVMLLARLIQGFNW  480



>ref|XP_010539173.1| PREDICTED: dihomomethionine N-hydroxylase-like [Tarenaya hassleriana]
Length=582

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 86/113 (76%), Gaps = 5/113 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFV  489
            PPH+   DTT++ YF+PK SHV++SR GLGR+P++WE+P  F PERH+  DG   EVS +
Sbjct  442  PPHIAIEDTTLAGYFVPKGSHVMVSRVGLGRSPKIWEDPHVFKPERHISRDGCSEEVSLM  501

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            +PE+R ++FSTGRRGC G+++G+ ++ MLLARL+QGF W      GR+EL ES
Sbjct  502  EPEMRFVTFSTGRRGCIGVKIGTYMTVMLLARLLQGFTWSLPPDLGRVELVES  554



>gb|EEC70622.1| hypothetical protein OsI_01880 [Oryza sativa Indica Group]
Length=445

 Score =   136 bits (342),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  SDT ++ Y IPKDSHV++SR GLGRNPRVW  PL+F PERHL N  S +   +P
Sbjct  307  PPHVAISDTIIAGYLIPKDSHVMLSRIGLGRNPRVWVNPLEFRPERHLNNATSTMVLAEP  366

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            ELR +SF   RRGCP + LG+ ++ ML ARL+QGF W       +IEL+ES
Sbjct  367  ELRFVSFGASRRGCPAVSLGTSITMMLFARLLQGFTWSIPPGADKIELQES  417



>ref|XP_010050614.1| PREDICTED: tyrosine N-monooxygenase-like, partial [Eucalyptus 
grandis]
Length=278

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 93/135 (69%), Gaps = 3/135 (2%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD  V+ Y IPK SH+++SR GLGRNP VW+EP KF PERH+  D  EV   +P+
Sbjct  144  PHVALSDAVVAGYHIPKGSHILVSRMGLGRNPEVWDEPTKFKPERHIMGDAVEVVLTEPD  203

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHDlllahpl  309
            LR +SFS+GRRGC   QLG+ ++ MLLARL+QGF+W        I L ES+ DL LA PL
Sbjct  204  LRFISFSSGRRGCIAAQLGTTMTVMLLARLIQGFNWSTPPNIYSINLNESRDDLSLAEPL  263

Query  308  halakprlpHYIYSS  264
               A+ RLP+Y+Y +
Sbjct  264  VLQAELRLPNYLYPT  278



>emb|CDP17747.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 4/112 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKN-DGSEVSFVDP  483
            PH+ T DT V  YFIPK SHVI+SRPGLGRNPR+WE+ LKF PERH+ + D + +   DP
Sbjct  255  PHVSTLDTVVGGYFIPKGSHVILSRPGLGRNPRIWEDSLKFKPERHMNHMDDARIDLNDP  314

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESK  336
            E  + SFSTGRRGCPG+ LGS ++ MLLARL+Q F+W       +I+L E K
Sbjct  315  EFNMFSFSTGRRGCPGVLLGSTLTVMLLARLLQCFNWKIPSGLSQIDLAEGK  366



>gb|EMS67140.1| Tyrosine N-monooxygenase [Triticum urartu]
Length=541

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 5/112 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  +DTTV+ Y IPK SHVI+SR GLGRNP++W EPL+F PERHL  + + V   +P
Sbjct  404  PPHVAMADTTVAGYTIPKGSHVILSRFGLGRNPKIWVEPLEFRPERHL--NAANVLLTEP  461

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRESK  336
             LR +SFSTGRRGCPGI LG+ V+ ML+AR++QGF W +      I+L+ESK
Sbjct  462  GLRFISFSTGRRGCPGISLGTSVTMMLIARMLQGFTWTKSPGVHSIDLQESK  513



>emb|CDY04944.1| BnaAnng01260D [Brassica napus]
Length=268

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = -1

Query  656  HLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPEL  477
            H+ T+D  V  YFIPK SHV+ISR G+GRNP VW++PLKF PERH+ N+   V   DP+L
Sbjct  136  HMSTADAVVDGYFIPKGSHVLISRLGIGRNPNVWDKPLKFDPERHMGNN-KNVELNDPDL  194

Query  476  RILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
             I+SFS GRRGC G  +GS ++ MLLARL+QGF W       +I++ ESK+D
Sbjct  195  NIISFSAGRRGCMGSNIGSAMTYMLLARLIQGFTWSSVHGEDKIDISESKND  246



>emb|CDP18412.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 81/111 (73%), Gaps = 4/111 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKN-DGSEVSFVDP  483
            PH+ T DT V  YFIPK SHV++SR GLGRNPR+WE+PLKF PERHL++ D  +V F + 
Sbjct  292  PHVSTQDTIVGGYFIPKGSHVLLSRLGLGRNPRIWEDPLKFKPERHLEDLDEVKVDFNNQ  351

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            EL  LSFS GRRGCPG+QLGS +S MLLARL+  F W       RI+L ES
Sbjct  352  ELHFLSFSIGRRGCPGVQLGSTMSIMLLARLLHSFTWEIPRGLSRIDLTES  402



>ref|XP_010027354.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=687

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 81/113 (72%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD  ++ Y IPK SH++ISR GLGRNP VW+EPLKF PERH+ +D  EV   +P+
Sbjct  553  PHVALSDAVMAGYRIPKGSHILISRLGLGRNPEVWDEPLKFKPERHITSDTEEVLLAEPD  612

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTGRRGC   QLG+ ++ MLLARL+QGF+W        I L+ESK D
Sbjct  613  LRFISFSTGRRGCIATQLGTTMTVMLLARLIQGFNWSPLANDSSINLKESKDD  665



>emb|CDP19033.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKN-DGSEVSFVDP  483
            PH+ T DT V  Y IPK SHVI+SRPGL RNPR+WE+PLK+ PERH+K+ D + +   DP
Sbjct  323  PHVSTQDTVVGGYLIPKGSHVILSRPGLSRNPRIWEDPLKYKPERHMKDMDDARMDLNDP  382

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            EL + SFSTGRRGCPG+ LGS ++ MLLARL+Q F W
Sbjct  383  ELNMFSFSTGRRGCPGVLLGSTLTVMLLARLLQCFSW  419



>ref|XP_003629157.1| Cytochrome P450 [Medicago truncatula]
 gb|AET03633.1| cytochrome P450 family protein [Medicago truncatula]
Length=527

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DTT++NYFIPK SHV + R GLG NPR+WEEPLKF PERHLK DGS ++  DP 
Sbjct  392  PHVAMKDTTLANYFIPKGSHVYLRRQGLGTNPRIWEEPLKFNPERHLKIDGSNLNLADPS  451

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            L +++F TGRRGC G+ LG+ ++ ML ARL+ GF W
Sbjct  452  LDLITFGTGRRGCSGVMLGTSMTIMLFARLIHGFTW  487



>gb|EMT03957.1| Tyrosine N-monooxygenase [Aegilops tauschii]
Length=541

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 84/112 (75%), Gaps = 5/112 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  +DTTV+ Y IPK SHVI+SR GLGRNP++W EPL+F PERHL  + + V   +P
Sbjct  404  PPHVAMADTTVAGYTIPKGSHVILSRFGLGRNPKIWVEPLEFRPERHL--NSANVLLTEP  461

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRESK  336
             LR +SFSTGRRGCPGI LG+ V+ ML+AR++QGF W +      I+L+ESK
Sbjct  462  GLRFISFSTGRRGCPGISLGTSVTVMLIARMLQGFTWTKPPGVHSIDLQESK  513



>ref|XP_006480303.1| PREDICTED: uncharacterized protein LOC102610907 [Citrus sinensis]
Length=1231

 Score =   139 bits (349),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 65/115 (57%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = -1

Query  659   PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGS--EVSFVD  486
             PH+ T D T++ YFIPK SHV++SR GLGRNP VW++PLKFMPERH+ +     +V   +
Sbjct  1092  PHVSTRDATIAGYFIPKGSHVLLSRLGLGRNPNVWKDPLKFMPERHIGSTDHHLQVELTE  1151

Query  485   PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
             PELR +SF  GRRGC G+ LGS +S +LLARL+QGFDW       +I+L ESK+D
Sbjct  1152  PELRFVSFGRGRRGCMGVALGSEMSVILLARLLQGFDWSLPSHEEKIDLAESKYD  1206



>gb|KCW62253.1| hypothetical protein EUGRSUZ_H04913 [Eucalyptus grandis]
Length=473

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 80/113 (71%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD  ++ Y IPK SH+++SR GLGRNP+VW+EPLKF PERH+ +D  EV   +P 
Sbjct  339  PHVALSDAVMAGYRIPKGSHILVSRMGLGRNPKVWDEPLKFKPERHITSDTEEVLLAEPN  398

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFS GRRGC   QLG+ ++ MLLARL+QGF+W        I L ESK+D
Sbjct  399  LRFISFSMGRRGCIAAQLGTTMTVMLLARLIQGFNWSPLANDSSINLNESKND  451



>ref|XP_007011296.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20106.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=554

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  +D  V+ YFIPK SHV++SR GLGRNP+VW+EP KF PERH K+   EV+  + 
Sbjct  415  PPHVSNADAIVAGYFIPKGSHVLLSRVGLGRNPQVWDEPSKFKPERHFKDGSMEVNLTET  474

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            ELR +SFSTGRRGC G+ LGS ++ ML ARL+QGF W       +I+L ES+ +
Sbjct  475  ELRFISFSTGRRGCIGVALGSEMTIMLFARLIQGFAWKVPPDEAKIDLSESEDN  528



>ref|XP_010543679.1| PREDICTED: phenylalanine N-monooxygenase [Tarenaya hassleriana]
Length=536

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 4/114 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DT V  YFIPK SHV++SR GLGRNP VW+ PL+F P RHL+N  + V   +P+
Sbjct  399  PHVSNADTVVDGYFIPKGSHVLLSRVGLGRNPSVWDNPLRFEPGRHLRNGNTSVELNEPD  458

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV----QCGRIELRESKHD  330
            L  LSFSTGRRGC G+ LGS+++ MLLARLVQGF W       G+I++ ES+ D
Sbjct  459  LNFLSFSTGRRGCMGVSLGSVMTIMLLARLVQGFSWTVPGGGEGKIDISESEGD  512



>ref|XP_010025546.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=528

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 80/113 (71%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD  ++ Y IPK SH+++SR GLGRNP+VW+EPLKF PERH+ +D  EV   +P 
Sbjct  394  PHVALSDAVMAGYRIPKGSHILVSRMGLGRNPKVWDEPLKFKPERHITSDTEEVLLAEPN  453

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFS GRRGC   QLG+ ++ MLLARL+QGF+W        I L ESK+D
Sbjct  454  LRFISFSMGRRGCIAAQLGTTMTVMLLARLIQGFNWSPLANDSSINLNESKND  506



>gb|KHN24731.1| Isoleucine N-monooxygenase 1 [Glycine soja]
Length=508

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWE-EPLKFMPERHLKNDGSEVSFVD  486
            PPH+ T+DT V NYFIPK SHV++SR GLGRN +VW  EP KF PERH+KNDGS +   +
Sbjct  372  PPHVSTNDTMVGNYFIPKGSHVLLSRHGLGRNLKVWNNEPHKFKPERHIKNDGSMIVLSE  431

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            P+L+ +SF TGRRGCP I LGS ++ MLLARLV  F W
Sbjct  432  PDLKFISFGTGRRGCPAIVLGSTMTVMLLARLVHAFSW  469



>ref|XP_008385013.1| PREDICTED: isoleucine N-monooxygenase 2-like, partial [Malus 
domestica]
Length=508

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 80/113 (71%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV +YFIPK SHVI+SR GLGRNP+VW+EPLKF PE HLK+DGS V   + E
Sbjct  373  PHVSMADTTVGDYFIPKGSHVILSRVGLGRNPKVWDEPLKFKPEXHLKDDGSGVVLTESE  432

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTG RGC    LG+ ++ ML ARL+ GF W        IEL ES +D
Sbjct  433  LRFISFSTGMRGCVASTLGTAMTVMLFARLLHGFTWHVPPTESXIELTESTND  485



>gb|AAD22364.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAM15431.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=566

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  431  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECSEVTLTEND  489

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W   G   R+EL ES HD
Sbjct  490  LRFISFSTGKRGCAAPALGTAITTMMLARLLQGFKWKLAGSETRVELMESSHD  542



>ref|NP_179820.2| tryptophan N-monooxygenase 2 [Arabidopsis thaliana]
 sp|Q501D8.1|C79B3_ARATH RecName: Full=Tryptophan N-monooxygenase 2; AltName: Full=Cytochrome 
P450 79B3; AltName: Full=Tryptophan N-hydroxylase 2 
[Arabidopsis thaliana]
 gb|AAY25441.1| At2g22330 [Arabidopsis thaliana]
 gb|AEC07294.1| tryptophan N-hydroxylase 2 [Arabidopsis thaliana]
Length=543

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  408  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECSEVTLTEND  466

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W   G   R+EL ES HD
Sbjct  467  LRFISFSTGKRGCAAPALGTAITTMMLARLLQGFKWKLAGSETRVELMESSHD  519



>ref|XP_002878610.1| CYP79B3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54869.1| CYP79B3 [Arabidopsis lyrata subsp. lyrata]
Length=543

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  408  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECSEVTLTEND  466

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W   G   R+EL ES HD
Sbjct  467  LRFISFSTGKRGCAAPALGTAITTMMLARLLQGFKWKLAGSETRVELMESSHD  519



>emb|CBI25373.3| unnamed protein product [Vitis vinifera]
Length=247

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 5/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D  V+ YFIPK SHV++SR GLGRNPRVWEEPLKF PERH+ ++   V   +PE
Sbjct  115  PHVSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEV--VDLAEPE  172

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTGRRGCPG  LG+ ++  LLARL+Q F W       +I+L ES ++
Sbjct  173  LRFISFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQDQIDLTESMNE  225



>ref|XP_006591735.1| PREDICTED: isoleucine N-monooxygenase 1-like [Glycine max]
Length=529

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWE-EPLKFMPERHLKNDGSEVSFVD  486
            PPH+ T+DT V NYFIPK SHV++SR GLGRN +VW  EP KF PERH+KNDGS +   +
Sbjct  393  PPHVSTNDTMVGNYFIPKGSHVLLSRHGLGRNLKVWNNEPHKFKPERHIKNDGSMIVLSE  452

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            P+L+ +SF TGRRGCP I LGS ++ MLLARLV  F W
Sbjct  453  PDLKFISFGTGRRGCPAIVLGSTMTVMLLARLVHAFSW  490



>gb|EMT11661.1| Tyrosine N-monooxygenase [Aegilops tauschii]
Length=518

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 81/112 (72%), Gaps = 5/112 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+   DTT++ Y IPKDSHVI+SR GLGRNP++W EPL F PERHL  + + V   +P
Sbjct  383  PPHVAMVDTTIAGYTIPKDSHVILSRMGLGRNPKIWNEPLDFQPERHL--NTANVLLSEP  440

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRESK  336
             LR +SFS+GRRGCPGI LG+ V+ ML AR++QGF W +     RI L+ES 
Sbjct  441  GLRFISFSSGRRGCPGISLGTSVTVMLFARMLQGFTWTKPPGVDRISLQESN  492



>ref|XP_010472222.1| PREDICTED: tryptophan N-monooxygenase 2 [Camelina sativa]
Length=543

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  408  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECSEVTLTEND  466

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W   G   R+EL ES HD
Sbjct  467  LRFISFSTGKRGCAAPALGTAITTMMLARLLQGFKWKLVGGETRVELMESSHD  519



>dbj|BAF01576.1| putative cytochrome P450 [Arabidopsis thaliana]
Length=543

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  408  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECSEVTLTEYD  466

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W   G   R+EL ES HD
Sbjct  467  LRFISFSTGKRGCAAPALGTAITTMMLARLLQGFKWKLAGSETRVELMESSHD  519



>ref|XP_006296223.1| hypothetical protein CARUB_v10025388mg [Capsella rubella]
 gb|EOA29121.1| hypothetical protein CARUB_v10025388mg [Capsella rubella]
Length=544

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  409  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECSEVTLTEND  467

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W   G   R+EL ES HD
Sbjct  468  LRFISFSTGKRGCAAPALGTAITTMMLARLLQGFRWKLAGSETRVELMESSHD  520



>gb|AAK59526.1| putative cytochrome P450 protein [Arabidopsis thaliana]
Length=201

 Score =   129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFV  489
            P HL   DTT+  YFIPK SH+ + RPGLGRNP++W++PL + PERHL+ DG   EV+ V
Sbjct  61   PSHLARQDTTLGGYFIPKGSHIHVCRPGLGRNPKIWKDPLVYKPERHLQGDGITKEVTLV  120

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            + E+R +SFSTGRRGC G+++G+++  MLLAR +QGF+W
Sbjct  121  ETEMRFVSFSTGRRGCIGVKVGTIMMVMLLARFLQGFNW  159



>ref|XP_006495331.1| PREDICTED: phenylalanine N-monooxygenase-like, partial [Citrus 
sinensis]
Length=352

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERH--LKNDGSEVSFVD  486
            PH+ T D T++ YFIPK SHV++SR GLGRNP VWE+PLKF PERH  L +   +V   +
Sbjct  216  PHVSTCDATIAGYFIPKGSHVLLSRQGLGRNPEVWEDPLKFKPERHINLADHHHQVELTE  275

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            PEL+ +SFS GRRGC G+ LGS ++ MLLARL+ GFDW       +I+L ESK D
Sbjct  276  PELKFISFSRGRRGCMGVALGSEMTVMLLARLLHGFDWSVPSNEEKIDLAESKSD  330



>ref|XP_011098372.1| PREDICTED: phenylalanine N-monooxygenase-like [Sesamum indicum]
Length=535

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   +TTV  YFIPK+SHV++SR GLGRNPR+WE+PL + P+RH+ N  +EV  +D +
Sbjct  392  PHVSMEETTVGGYFIPKNSHVLLSRYGLGRNPRIWEDPLVYKPDRHIVNKDTEVVLMDHD  451

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR++SFSTGRRGCPG  LGS ++ +LLARL+QGF W
Sbjct  452  LRMISFSTGRRGCPGAVLGSTMAVILLARLIQGFSW  487



>ref|XP_006484922.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=556

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGS--EVSFVD  486
            PH+ T D T++ YFIPK SHV++SR GLGRNP VW++PLKFMPERH+ +     +V   +
Sbjct  421  PHVSTRDATIAGYFIPKGSHVLLSRLGLGRNPNVWKDPLKFMPERHIGSTDHHLQVELTE  480

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            PELR +SFS GRRGC G  LGS +S +LLARL+QGFDW       +I+L ESK+D
Sbjct  481  PELRFVSFSRGRRGCMGAALGSEMSVILLARLLQGFDWSLPSNEEKIDLAESKYD  535



>ref|XP_006437149.1| hypothetical protein CICLE_v10033385mg [Citrus clementina]
 gb|ESR50389.1| hypothetical protein CICLE_v10033385mg [Citrus clementina]
Length=621

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGS--EVSFVD  486
            PH+ T D T++ YFIPK SHV++SR GLGRNP VW++PLKFMPERH+ +     +V   +
Sbjct  486  PHVSTRDATIAGYFIPKGSHVLLSRLGLGRNPNVWKDPLKFMPERHIGSTDHHLQVELTE  545

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            PELR +SFS GRRGC G  LGS +S +LLARL+QGFDW       +I+L ESK+D
Sbjct  546  PELRFVSFSRGRRGCMGAALGSEMSVILLARLLQGFDWSLPSNEEKIDLAESKYD  600



>ref|XP_010416994.1| PREDICTED: tryptophan N-monooxygenase 2-like [Camelina sativa]
Length=542

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  407  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECSEVTLTEND  465

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W   G   R+EL ES HD
Sbjct  466  LRFISFSTGKRGCAAPALGTAITTMMLARLLQGFKWKLVGGETRVELMESIHD  518



>ref|XP_006404952.1| hypothetical protein EUTSA_v10000278mg [Eutrema salsugineum]
 gb|ESQ46405.1| hypothetical protein EUTSA_v10000278mg [Eutrema salsugineum]
Length=283

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  148  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  206

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  207  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHD  259



>emb|CDP20403.1| unnamed protein product [Coffea canephora]
Length=502

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKN-DGSEVSFVDP  483
            PH+   DT V  YFIPK SHVI+SRPGLGRNPR+WE+ LKF PERH+ + D + +   DP
Sbjct  370  PHVSAQDTVVGGYFIPKGSHVILSRPGLGRNPRIWEDSLKFKPERHMNHMDDARIDLNDP  429

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            E  + SFSTGRRGCPG+ LGS ++ MLLARL+Q F+W
Sbjct  430  EFNMFSFSTGRRGCPGVLLGSTLTVMLLARLLQCFNW  466



>gb|KEH20391.1| cytochrome P450 family protein [Medicago truncatula]
Length=518

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            P ++   DTT++NYFIPK SHV + R GLG NPRVW+EPLKF PERHLK DGS +S  DP
Sbjct  382  PTYVAMKDTTLANYFIPKGSHVYLRRQGLGINPRVWKEPLKFNPERHLKIDGSNLSLADP  441

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
             L +++F TGRRGC G+ LG+ ++ ML ARL+ GF W
Sbjct  442  SLDLITFGTGRRGCSGVMLGTSMTIMLFARLIHGFTW  478



>ref|XP_006428266.1| hypothetical protein CICLE_v10013842mg, partial [Citrus clementina]
 gb|ESR41506.1| hypothetical protein CICLE_v10013842mg, partial [Citrus clementina]
Length=508

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGS--EVSFVD  486
            PH+ T D T++ YFIPK SHV++SR GLGRNP VW++PLKFMPERH+ +     +V   +
Sbjct  369  PHVSTRDATIAGYFIPKGSHVLLSRLGLGRNPNVWKDPLKFMPERHIGSTDHHLQVELTE  428

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            PELR +SF  GRRGC G+ LGS +S +LLARL+QGFDW       +I+L ESK+D
Sbjct  429  PELRFVSFGRGRRGCMGVALGSEMSVILLARLLQGFDWSLPSHEEKIDLAESKYD  483



>gb|KDO39922.1| hypothetical protein CISIN_1g035533mg [Citrus sinensis]
Length=503

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGS--EVSFVD  486
            PH+ T D T++ YFIPK SHV++SR GLGRNP VW++PLKFMPERH+ +     +V   +
Sbjct  364  PHVSTRDATIAGYFIPKGSHVLLSRLGLGRNPNVWKDPLKFMPERHIGSTDHHLQVELTE  423

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            PELR +SF  GRRGC G+ LGS +S +LLARL+QGFDW       +I+L ESK+D
Sbjct  424  PELRFVSFGRGRRGCMGVALGSEMSVILLARLLQGFDWSLPSHEEKIDLAESKYD  478



>gb|AAG24796.1| cytochrome P450 CYP79F2 [Arabidopsis thaliana]
 gb|AAL47360.1| Similar to cytochrome P450 [Arabidopsis thaliana]
Length=535

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 79/99 (80%), Gaps = 2/99 (2%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFV  489
            PPH+   DTT+  YFIPK SH+ + RPGLGRNP++W++PL + PERHL+ DG   EV+ V
Sbjct  395  PPHVARQDTTLGGYFIPKGSHIHVCRPGLGRNPKIWKDPLAYEPERHLQGDGITKEVTLV  454

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            + E+R +SFSTGRRGC G+++G+++ +M+LAR +QGF+W
Sbjct  455  ETEMRFVSFSTGRRGCVGVKVGTIMMAMMLARFLQGFNW  493



>ref|NP_563995.2| Hexahomomethionine N-hydroxylase [Arabidopsis thaliana]
 sp|Q9FUY7.2|C79F2_ARATH RecName: Full=Hexahomomethionine N-hydroxylase; AltName: Full=Cytochrome 
P450 79F2 [Arabidopsis thaliana]
 gb|AAK43889.1|AF370512_1 cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE29446.1| Hexahomomethionine N-hydroxylase [Arabidopsis thaliana]
Length=537

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 79/99 (80%), Gaps = 2/99 (2%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFV  489
            PPH+   DTT+  YFIPK SH+ + RPGLGRNP++W++PL + PERHL+ DG   EV+ V
Sbjct  397  PPHVARQDTTLGGYFIPKGSHIHVCRPGLGRNPKIWKDPLAYEPERHLQGDGITKEVTLV  456

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            + E+R +SFSTGRRGC G+++G+++ +M+LAR +QGF+W
Sbjct  457  ETEMRFVSFSTGRRGCVGVKVGTIMMAMMLARFLQGFNW  495



>ref|XP_010030374.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
 gb|KCW54306.1| hypothetical protein EUGRSUZ_I00270 [Eucalyptus grandis]
Length=509

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 80/114 (70%), Gaps = 3/114 (3%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  SD  V+ YFIPK SHV++SR GLGRNP+VW +PL+F PERH  +D +EV   +P
Sbjct  375  PPHMAMSDAIVAGYFIPKGSHVLLSRLGLGRNPKVWNKPLEFRPERHFTSDCTEVQLTEP  434

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            +L  +SFSTGRRGC    LG+ ++ MLLAR+VQGF+W+       I L ES  D
Sbjct  435  DLHFISFSTGRRGCVAPMLGTAMTVMLLARMVQGFNWMALPNVTSINLDESFED  488



>emb|CDP12474.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKN-DGSEVSFVDP  483
            PH+ T DT V  YFIPK SHVI+ RPGLGRNPR+W + LKF PERH+ + D + +   DP
Sbjct  406  PHVSTQDTVVGGYFIPKGSHVILCRPGLGRNPRIWGDSLKFKPERHMNDMDDARMDLNDP  465

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            EL +LSFSTGRRGCPG+ LGS ++ MLLARL+Q F+W
Sbjct  466  ELNMLSFSTGRRGCPGVLLGSTLTVMLLARLLQCFNW  502



>ref|XP_004509509.1| PREDICTED: isoleucine N-monooxygenase 2-like [Cicer arietinum]
Length=532

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DT VSN+FIPK SHVI+ R GLG NPRVW+EP  F PERHLK DGS +S  DP 
Sbjct  398  PHVSMKDTVVSNFFIPKGSHVILRRQGLGLNPRVWKEPFNFKPERHLKKDGSNLSLEDPS  457

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            L  + FSTGRRGCPGI LG+ +  ML ARL+ GF W
Sbjct  458  LNSIIFSTGRRGCPGIMLGTSMIIMLFARLLHGFTW  493



>gb|KFK30571.1| hypothetical protein AALP_AA7G279100 [Arabis alpina]
Length=541

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  406  PHVSLSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECSEVTLTEND  464

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++MLLARL+QGF W   G   R+EL ES HD
Sbjct  465  LRFISFSTGKRGCAAPALGTALTTMLLARLLQGFTWKLPGNETRVELMESSHD  517



>ref|NP_001050517.1| Os03g0570100 [Oryza sativa Japonica Group]
 gb|ABF97194.1| Cytochrome P450 79A1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12431.1| Os03g0570100 [Oryza sativa Japonica Group]
 dbj|BAG99697.1| unnamed protein product [Oryza sativa Japonica Group]
Length=547

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 10/117 (9%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL-------KNDGS  504
            PP +  +DTT++ Y IPK S VI+SR GLGRNPRVW++PL+F PERHL       + D  
Sbjct  403  PPRVAMADTTIAGYTIPKGSQVILSRVGLGRNPRVWDDPLEFRPERHLSPYPAGGRGDAG  462

Query  503  EVSFVDPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRE  342
             V+  + ELR +SFSTGRRGCPG+ LG+L++  L ARL+QGF+W +     R+ELRE
Sbjct  463  VVALTEAELRFVSFSTGRRGCPGVSLGTLITVTLFARLLQGFEWSKPAGVERVELRE  519



>ref|XP_010491059.1| PREDICTED: phenylalanine N-monooxygenase-like [Camelina sativa]
Length=532

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ T+D  V  YFIPK SHV+ISR G+GRNP VW++PLKF PERHL N+   V   DP+
Sbjct  399  PHMSTADAVVDGYFIPKGSHVMISRMGIGRNPSVWDKPLKFDPERHLGNNIC-VELNDPD  457

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
            L I+SFS GRRGC G+ +GS ++ MLLARL+QGF W       +++L ESK D
Sbjct  458  LNIISFSAGRRGCMGVDIGSAMTYMLLARLIQGFTWSPVPGENKVDLSESKSD  510



>gb|KCW54304.1| hypothetical protein EUGRSUZ_I00267 [Eucalyptus grandis]
Length=529

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  SD  V+ YFIPK SHV++SR GLGRNP+VW +PL+F PERH  +  +EV   +P
Sbjct  395  PPHMAMSDAIVAGYFIPKGSHVLLSRLGLGRNPKVWNKPLEFRPERHFTSGFTEVHLTEP  454

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            +LR +SFSTGRRGC   +LG+ ++ MLLAR+VQGFDW
Sbjct  455  DLRFISFSTGRRGCVAPKLGTTMTVMLLARMVQGFDW  491



>ref|XP_010030372.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=509

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  SD  V+ YFIPK SHV++SR GLGRNP+VW +PL+F PERH  +  +EV   +P
Sbjct  375  PPHMAMSDAIVAGYFIPKGSHVLLSRLGLGRNPKVWNKPLEFRPERHFTSGFTEVHLTEP  434

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            +LR +SFSTGRRGC   +LG+ ++ MLLAR+VQGFDW
Sbjct  435  DLRFISFSTGRRGCVAPKLGTTMTVMLLARMVQGFDW  471



>ref|XP_009797054.1| PREDICTED: valine N-monooxygenase 1 [Nicotiana sylvestris]
Length=247

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            P++   DT V  YFIPK + V +SR GLGRNPRVWE+ +KF PERH+  +  EV   D E
Sbjct  113  PYVSVFDTIVGEYFIPKGNVVQLSRIGLGRNPRVWEDTMKFKPERHVNEESREVVLTDSE  172

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR+LSFS GRRGCPG+QLGS ++ ML+ARL+QGF W
Sbjct  173  LRLLSFSIGRRGCPGMQLGSTITIMLIARLLQGFTW  208



>ref|XP_006492162.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=542

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL--KNDGSEVSFVD  486
            PH+   DTT++ YFIPK SHV+ISR GLG+NP VW++PLKF+PERH+   +   +V   +
Sbjct  404  PHVSNRDTTIAGYFIPKGSHVLISRVGLGQNPNVWKDPLKFIPERHISAADPHHQVEITE  463

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            PELR L+FS GRR C G+ LGS +S MLLARL+QGFDW       +I+L ESK+D
Sbjct  464  PELRFLTFSRGRRSCMGMALGSEMSVMLLARLLQGFDWSVPSHEEKIDLAESKYD  518



>gb|KHG04035.1| Tyrosine N-monooxygenase [Gossypium arboreum]
Length=550

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 101/137 (74%), Gaps = 4/137 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+NYFIPK SHV++SR GLGRNP+ W++PLKF PERHLK  G  ++  + E
Sbjct  411  PHVSVADTTVANYFIPKGSHVLLSRTGLGRNPKFWDDPLKFKPERHLKGGGVSLALTESE  470

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW----VQCGRIELRESKHDlllahp  312
            LR +SFSTG RGC G+ LG+ ++ ML ARL+Q F W         I+L E+K +L LA+P
Sbjct  471  LRFISFSTGMRGCKGVLLGTSMTVMLFARLLQCFTWTIPPTSQKPIDLSEAKDNLFLANP  530

Query  311  lhalakprlpHYIYSSL  261
            L A+AKPRLP ++Y+SL
Sbjct  531  LVAVAKPRLPSHVYASL  547



>gb|AAG59648.1|AC084319_6 putative cytochrome p450tyr [Oryza sativa Japonica Group]
Length=543

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 83/117 (71%), Gaps = 10/117 (9%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL-------KNDGS  504
            PP +  +DTT++ Y IPK S VI+SR GLGRNPRVW++PL+F PERHL       + D  
Sbjct  399  PPRVAMADTTIAGYTIPKGSQVILSRVGLGRNPRVWDDPLEFRPERHLSPYPAGGRGDAG  458

Query  503  EVSFVDPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRE  342
             V+  + ELR +SFSTGRRGCPG+ LG+L++  L ARL+QGF+W +     R+ELRE
Sbjct  459  VVALTEAELRFVSFSTGRRGCPGVSLGTLITVTLFARLLQGFEWSKPAGVERVELRE  515



>ref|XP_003629158.1| Cytochrome P450 [Medicago truncatula]
 gb|AET03634.1| cytochrome P450 family protein [Medicago truncatula]
Length=531

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            P +   DT ++NYFIPK SHV + R GLG NPR+WEEPLKF PERHLK DGS +S  DP 
Sbjct  396  PRVAMKDTILANYFIPKGSHVYLRRQGLGTNPRIWEEPLKFNPERHLKIDGSNLSLADPS  455

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            L +++F TGRRGC G+ LG+ ++ ML ARL+ GF W
Sbjct  456  LNVITFGTGRRGCSGVMLGTSMTIMLFARLIHGFTW  491



>ref|XP_006420514.1| hypothetical protein CICLE_v10004690mg [Citrus clementina]
 gb|ESR33754.1| hypothetical protein CICLE_v10004690mg [Citrus clementina]
 gb|KDO43050.1| hypothetical protein CISIN_1g009152mg [Citrus sinensis]
Length=542

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL--KNDGSEVSFVD  486
            PH+   DTT++ YFIPK SHV+ISR GLG+NP VW++PLKF+PERH+   +   +V   +
Sbjct  404  PHVSNRDTTIAGYFIPKGSHVLISRVGLGQNPNVWKDPLKFIPERHISAADPHHQVEITE  463

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            PELR L+FS GRR C G+ LGS +S MLLARL+QGFDW       +I+L ESK+D
Sbjct  464  PELRFLTFSRGRRSCMGMALGSEMSVMLLARLLQGFDWSVPSHEEKIDLAESKYD  518



>ref|XP_007011306.1| Cytochrome p450 79a2 [Theobroma cacao]
 gb|EOY20116.1| Cytochrome p450 79a2 [Theobroma cacao]
Length=553

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ T+D TV+ YFIPK SHV++SR GLGRNP+VW++PLKF PERHLK+    V   + +
Sbjct  418  PHVSTADATVAGYFIPKGSHVLLSRYGLGRNPKVWDDPLKFKPERHLKDGSMCVDLTETD  477

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTGRRGC  + LG+ ++ MLLARL+QGF W        I+L E+  D
Sbjct  478  LRFISFSTGRRGCMAVALGTAMTVMLLARLLQGFTWRVPPNEASIDLSEANDD  530



>gb|KFK32823.1| hypothetical protein AALP_AA6G292300 [Arabis alpina]
Length=543

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+  EV+  + +
Sbjct  408  PHVALADTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECLEVTLTEND  466

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF+W   G   R+EL ES HD
Sbjct  467  LRFISFSTGKRGCAAPALGTAITTMMLARLLQGFEWKLAGGETRVELMESSHD  519



>emb|CDY43061.1| BnaA03g12080D [Brassica napus]
Length=531

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 82/113 (73%), Gaps = 5/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DTT++ YF+PK SH+++SRPG+GRNP+ W+EPL + PERHL   G EV   +P+
Sbjct  393  PHMARQDTTLAGYFVPKGSHILVSRPGIGRNPKTWDEPLIYKPERHLT--GDEVMLTEPD  450

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            +R++SF TGRRGC G +LG+ +   LL RL+QGFDW    +  ++EL ESK +
Sbjct  451  MRLVSFGTGRRGCVGTKLGTYMIVTLLGRLLQGFDWTLPPKTAKVELVESKEN  503



>ref|XP_010456404.1| PREDICTED: phenylalanine N-monooxygenase, partial [Camelina sativa]
Length=513

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ T++  V  YFIPK SHV+ISR G+GRNP VW++PLKF PERHL N+   V   DP+
Sbjct  380  PHMSTANAVVDGYFIPKGSHVLISRMGIGRNPSVWDKPLKFDPERHLGNNIC-VELYDPD  438

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
            L I+SFS GRRGC G+ +GS ++ MLLARL+QGF W       +++L ESK D
Sbjct  439  LNIISFSAGRRGCMGVDIGSAMTYMLLARLIQGFTWSPVSGENKVDLSESKSD  491



>ref|XP_004245410.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=488

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 76/99 (77%), Gaps = 3/99 (3%)
 Frame = -1

Query  659  PHLCTSDTTV-SNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFV  489
            PH+  SD  +   YFIPK S V++SR GLGRNPRVWE+PLKF PERHL  DG   EV   
Sbjct  351  PHVSISDAIIGEKYFIPKGSRVLLSRLGLGRNPRVWEDPLKFKPERHLIEDGVGGEVVLT  410

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            D +LR+LSFSTGRRGCPG++LGS +++MLLARL+ GF W
Sbjct  411  DSKLRLLSFSTGRRGCPGVKLGSTIATMLLARLLHGFSW  449



>ref|XP_008359054.1| PREDICTED: tyrosine N-monooxygenase-like, partial [Malus domestica]
Length=281

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV +YFIPK SHVI+SR  LGRNP+VW+EPLKF PERHLK+DGS V   + E
Sbjct  148  PHVSMADTTVGDYFIPKGSHVILSRVRLGRNPKVWDEPLKFKPERHLKDDGSGVVLTESE  207

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
            L  + FSTG RGC    LG+ ++ ML ARL+ GF W        IEL ES +D
Sbjct  208  LGFILFSTGMRGCVASGLGTAMTVMLFARLLHGFTWHVLPTESSIELTESHND  260



>ref|XP_006464296.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=552

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERH--LKNDGSEVSFVD  486
            PH+ T D T++ YFIPK SHV++SR GLGRNP VWE+PLKF PERH  L +   +V   +
Sbjct  416  PHVSTCDATIAGYFIPKGSHVLLSRQGLGRNPEVWEDPLKFKPERHINLADHHHQVELTE  475

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            PEL+ +SFS GRRGC G+ LGS ++ MLLARL+ GFDW       +I+L ESK D
Sbjct  476  PELKFISFSRGRRGCMGVALGSEMTVMLLARLLHGFDWSVPSNEEKIDLAESKSD  530



>ref|XP_003580014.1| PREDICTED: tyrosine N-monooxygenase-like [Brachypodium distachyon]
Length=554

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D TV+ Y IPKDSHVI+SR GLGRNP+VW EPL+F PERHL  +   V   DP+
Sbjct  420  PHVAIADITVAGYTIPKDSHVILSRTGLGRNPKVWIEPLEFRPERHL--NTPNVRLNDPD  477

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRESK  336
            LR +SFSTGRRGCPGI LG+ V+ ML AR++QGF W +      I L E K
Sbjct  478  LRFVSFSTGRRGCPGISLGTSVTMMLFARMLQGFTWTKPPGVSTISLEEGK  528



>ref|XP_006464327.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=554

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERH--LKNDGSEVSFVD  486
            PH+ T D T++ YFIPK SHV++SR GLGRNP VWE+PLKF PERH  L +   +V   +
Sbjct  418  PHVSTCDATIAGYFIPKGSHVLLSRQGLGRNPEVWEDPLKFKPERHINLADHHHQVELTE  477

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            PEL+ +SFS GRRGC G+ LGS ++ MLLARL+ GFDW       +I+L ESK D
Sbjct  478  PELKFISFSRGRRGCMGVALGSEMTVMLLARLLHGFDWSVPSNEEKIDLAESKSD  532



>ref|XP_010555368.1| PREDICTED: tryptophan N-monooxygenase 2-like [Tarenaya hassleriana]
Length=543

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DTTV+ Y IPK S V++SR GLGRNP+VW EPL F PERHL N+ SEV+ ++ +
Sbjct  408  PHVSLCDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSEPLSFKPERHL-NECSEVTLIEND  466

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTGRRGC    LG+ +++MLLARL+QGF W       R+EL ES HD
Sbjct  467  LRFISFSTGRRGCAAPALGTAITTMLLARLLQGFTWKLPEGVTRVELVESSHD  519



>emb|CBI24346.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 81/114 (71%), Gaps = 4/114 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL-KNDGSEVSFVDP  483
            PH+ T D  V+ YFIPK SHV++SR GLGRN R+WEEPL+F PERHL +  G  V   +P
Sbjct  291  PHVSTCDAVVAGYFIPKGSHVLLSRLGLGRNGRIWEEPLRFKPERHLSEGTGKMVELTEP  350

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            +LR +SF TGRRGCPG   GS ++ MLLARL+QGF W    +   I+L ES++D
Sbjct  351  DLRFISFGTGRRGCPGKATGSAMTVMLLARLLQGFTWSAPPEQKEIDLSESRND  404



>ref|XP_006363575.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine N-monooxygenase-like 
[Solanum tuberosum]
Length=518

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = -1

Query  659  PHLCTSDTTVSN-YFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLK-NDGSEVSFVD  486
            PH+  SDT VS  YFIPK S V++SR GLGRNPR+W++PLKF PERHLK  DG EV   D
Sbjct  382  PHVSVSDTIVSKKYFIPKGSVVLLSRLGLGRNPRIWKDPLKFKPERHLKMEDGGEVVLTD  441

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
              L +LSFS GRRGCP ++LGS +++MLLARL+QGF W
Sbjct  442  SNLHLLSFSIGRRGCPAVKLGSTITTMLLARLLQGFTW  479



>ref|XP_002466099.1| hypothetical protein SORBIDRAFT_01g001200 [Sorghum bicolor]
 sp|Q43135.3|C79A1_SORBI RecName: Full=Tyrosine N-monooxygenase; AltName: Full=Cytochrome 
P450 79A1; AltName: Full=Cytochrome P450Tyr [Sorghum bicolor]
 gb|AAA85440.1| cytochrome P-450 [Sorghum bicolor]
 gb|EER93097.1| hypothetical protein SORBIDRAFT_01g001200 [Sorghum bicolor]
Length=558

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 80/113 (71%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTT++ Y +PK SHVI+SR GLGRNPRVW+EPL+F P+RHL    S+V+  + +
Sbjct  421  PHVALADTTIAGYRVPKGSHVILSRTGLGRNPRVWDEPLRFYPDRHLATAASDVALTEND  480

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCGRIE---LRESKHD  330
            LR +SFSTGRRGC    LG+ +S ML  RL+QGF W +   +E   L ESK D
Sbjct  481  LRFISFSTGRRGCIAASLGTAMSVMLFGRLLQGFTWSKPAGVEAVDLSESKSD  533



>ref|XP_009132654.1| PREDICTED: dihomomethionine N-hydroxylase [Brassica rapa]
Length=530

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 82/113 (73%), Gaps = 5/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DTT++ YF+PK SH+++SRPG+GRNP+ W+EPL + PERHL   G EV   +P+
Sbjct  392  PHMARQDTTLAGYFVPKGSHILVSRPGIGRNPKTWDEPLIYKPERHLT--GDEVMLTEPD  449

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            +R++SF TGRRGC G +LG+ +   LL RL+QGFDW    +  ++EL ESK +
Sbjct  450  MRLVSFGTGRRGCVGTKLGTYMIVTLLGRLLQGFDWTLPPKTAKVELVESKEN  502



>gb|KCW74807.1| hypothetical protein EUGRSUZ_E03537 [Eucalyptus grandis]
Length=473

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD  V+ Y IPK SH+++SR GLGRNP VW+EP KF PERH+  D  EV   +P+
Sbjct  339  PHVALSDAVVAGYHIPKGSHILVSRMGLGRNPEVWDEPTKFKPERHIMGDAVEVVLTEPD  398

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFS+GRRGC   QLG+ ++ MLLARL+QGF+W        I L ES+ D
Sbjct  399  LRFISFSSGRRGCIAAQLGTTMTVMLLARLIQGFNWSTPPNIYSISLNESRDD  451



>ref|XP_006356653.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum tuberosum]
Length=495

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = -1

Query  659  PHLCTSDTTV-SNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL-KNDGSEVSFVD  486
            PH+  SD  +   YFIPK S V++SR GLGRNPRVWE+PLKF PERHL K  G EV   D
Sbjct  359  PHVSISDAIIGEKYFIPKGSRVLLSRLGLGRNPRVWEDPLKFKPERHLIKEGGGEVVLTD  418

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
             +LR+LSFSTGRRGCPG++LGS +++MLLARL+ GF W
Sbjct  419  SKLRLLSFSTGRRGCPGVKLGSTITTMLLARLLHGFAW  456



>ref|XP_006428115.1| hypothetical protein CICLE_v10025240mg [Citrus clementina]
 gb|ESR41355.1| hypothetical protein CICLE_v10025240mg [Citrus clementina]
Length=583

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERH--LKNDGSEVSFVD  486
            PH+ T D T++ YFIPK SHV++SR GLGRNP VWE+PLKF PERH  L +   +V   +
Sbjct  447  PHVSTCDATIAGYFIPKGSHVLLSRQGLGRNPEVWEDPLKFKPERHINLADHHHQVELTE  506

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            PEL+ +SFS GRRGC G+ LGS ++ MLLARL+ GFDW       +I+L ESK D
Sbjct  507  PELKFISFSRGRRGCMGVALGSEMTVMLLARLLHGFDWSVPSNEEKIDLAESKSD  561



>ref|XP_009122135.1| PREDICTED: phenylalanine N-monooxygenase [Brassica rapa]
Length=525

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 79/113 (70%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ T+D  V  YFIPK SHV+ISR G+GRNP VW++PLKF PERHL  D   V   DP+
Sbjct  392  PHMSTADAVVDGYFIPKGSHVLISRLGIGRNPNVWDKPLKFDPERHL-GDNKNVELNDPD  450

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
            L I+SFS GRRGC G  +GS ++ MLLARL+QGF W       ++++ ESK D
Sbjct  451  LNIISFSAGRRGCMGSNIGSAMTYMLLARLIQGFTWSSMPGEDKVDITESKTD  503



>ref|XP_006428111.1| hypothetical protein CICLE_v10025237mg [Citrus clementina]
 gb|ESR41351.1| hypothetical protein CICLE_v10025237mg [Citrus clementina]
Length=585

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 82/115 (71%), Gaps = 5/115 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERH--LKNDGSEVSFVD  486
            PH+ T D T++ YFIPK SHV++SR GLGRNP VWE+PLKF PERH  L +   +V   +
Sbjct  449  PHVSTCDATIAGYFIPKGSHVLLSRQGLGRNPEVWEDPLKFKPERHINLADHHHQVELTE  508

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            PEL+ +SFS GRRGC G+ LGS ++ MLLARL+ GFDW       +I+L ESK D
Sbjct  509  PELKFISFSRGRRGCMGVALGSEMTVMLLARLLHGFDWSVPSNEEKIDLAESKSD  563



>ref|XP_004237224.2| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=517

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = -1

Query  659  PHLCTSDTTV-SNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLK-NDGSEVSFVD  486
            PH+  SDT +   YFIPK S V++SR GLGRN RVWE+PLKF PERHLK  DG EV   D
Sbjct  381  PHVSVSDTIIGEKYFIPKGSIVLLSRLGLGRNSRVWEDPLKFKPERHLKMKDGGEVVLTD  440

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
              LR+LSFS GRRGCP ++LGS +++MLLARL+QGF W
Sbjct  441  SNLRLLSFSIGRRGCPAVKLGSTITTMLLARLLQGFTW  478



>ref|XP_007207880.1| hypothetical protein PRUPE_ppa021326mg [Prunus persica]
 gb|EMJ09079.1| hypothetical protein PRUPE_ppa021326mg [Prunus persica]
Length=514

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 80/110 (73%), Gaps = 3/110 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV +YFIPK SHV++SR GLGRNP++W+EPLK+ PERHLK+DGS V   + E
Sbjct  380  PHVSMADTTVGDYFIPKGSHVMLSRIGLGRNPKIWDEPLKYKPERHLKDDGSGVVLTESE  439

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            LR +SFSTG RGC    LG+ ++ ML ARL+ GF W       RI+L E+
Sbjct  440  LRFISFSTGMRGCVASTLGTSMTVMLFARLLHGFTWEAPPNESRIDLTEA  489



>emb|CDP21660.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKN-DGSEVSFVDP  483
            PH+ T DT V  YFIPK SHVI+ RPGLGRNPR+W + LKF PERH+ + D + +   DP
Sbjct  368  PHVSTQDTVVGGYFIPKGSHVILCRPGLGRNPRIWGDSLKFKPERHMNDMDDARMDLNDP  427

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            EL + SFSTGRRGCPG+ LGS ++ MLLARL+Q F+W
Sbjct  428  ELNMFSFSTGRRGCPGVLLGSTLTVMLLARLLQCFNW  464



>dbj|BAP15884.1| cytochrome P450 79D16 [Prunus mume]
Length=534

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 80/110 (73%), Gaps = 3/110 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV +YFIPK SHV++SR GLGRNP++W+EPLK+ PERHLK+DGS V   + E
Sbjct  400  PHVSMADTTVGDYFIPKGSHVMLSRIGLGRNPKIWDEPLKYKPERHLKDDGSGVVLTESE  459

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            LR +SFSTG RGC    LG+ ++ ML ARL+ GF W       RI+L E+
Sbjct  460  LRFISFSTGMRGCVASTLGTSMTVMLFARLLHGFTWEAPPNESRIDLTEA  509



>gb|AGN12777.1| tryptophan N-hydroxylase 1 [Leavenworthia alabamica]
Length=525

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  388  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  446

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++MLLARL+QGF W       R+EL ES HD
Sbjct  447  LRFISFSTGKRGCAAPALGTALTTMLLARLLQGFTWKLPENETRVELMESSHD  499



>ref|XP_002269843.2| PREDICTED: phenylalanine N-monooxygenase [Vitis vinifera]
Length=493

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 81/114 (71%), Gaps = 4/114 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL-KNDGSEVSFVDP  483
            PH+ T D  V+ YFIPK SHV++SR GLGRN R+WEEPL+F PERHL +  G  V   +P
Sbjct  355  PHVSTCDAVVAGYFIPKGSHVLLSRLGLGRNGRIWEEPLRFKPERHLSEGTGKMVELTEP  414

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            +LR +SF TGRRGCPG   GS ++ MLLARL+QGF W    +   I+L ES++D
Sbjct  415  DLRFISFGTGRRGCPGKATGSAMTVMLLARLLQGFTWSAPPEQKEIDLSESRND  468



>gb|ABD84027.1| cytochrome P450 [Bambusa ventricosa]
Length=519

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 79/114 (69%), Gaps = 4/114 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKND-GSEVSFVDP  483
            PH+  +DTT++ Y +PK SHVI+SR GLGRNPRVW+EPL+F PERH+  D  S V+  + 
Sbjct  383  PHVALADTTIAGYRVPKGSHVILSRTGLGRNPRVWDEPLRFRPERHMAADPTSAVALTEN  442

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            ELR +SFSTGRRGC    LG+ +S ML  RL+QGF W        +EL ES HD
Sbjct  443  ELRFISFSTGRRGCIAASLGTAMSVMLFGRLLQGFTWSMPAGVAAVELSESTHD  496



>ref|XP_010059403.1| PREDICTED: tyrosine N-monooxygenase-like [Eucalyptus grandis]
Length=528

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD  V+ Y IPK SH+++SR GLGRNP VW+EP KF PERH+  D  EV   +P+
Sbjct  394  PHVALSDAVVAGYHIPKGSHILVSRMGLGRNPEVWDEPTKFKPERHIMGDAVEVVLTEPD  453

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFS+GRRGC   QLG+ ++ MLLARL+QGF+W        I L ES+ D
Sbjct  454  LRFISFSSGRRGCIAAQLGTTMTVMLLARLIQGFNWSTPPNIYSISLNESRDD  506



>ref|XP_008231301.1| PREDICTED: isoleucine N-monooxygenase 2-like [Prunus mume]
Length=534

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 80/110 (73%), Gaps = 3/110 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV +YFIPK SHV++SR GLGRNP++W+EPLK+ PERHLK+DGS V   + E
Sbjct  400  PHVSMADTTVGDYFIPKGSHVMLSRIGLGRNPKIWDEPLKYKPERHLKDDGSGVVLTESE  459

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            LR +SFSTG RGC    LG+ ++ ML ARL+ GF W       RI+L E+
Sbjct  460  LRFISFSTGMRGCVASTLGTSMTVMLFARLLHGFTWEAPPNESRIDLTEA  509



>gb|EMT22070.1| hypothetical protein F775_52105 [Aegilops tauschii]
Length=579

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 78/113 (69%), Gaps = 3/113 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DT V+ Y IPK SHVI+SR GLGRNP +W+EPL+FMPERH+     +V+  + E
Sbjct  442  PHVALADTNVAGYHIPKGSHVILSRTGLGRNPTIWDEPLRFMPERHINTTTHDVALTENE  501

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTGRRGC    LG+ +  ML  RL+QGF W   V    I+L ES+HD
Sbjct  502  LRFISFSTGRRGCVATSLGTAMCMMLFGRLLQGFTWSKPVGLAAIDLSESEHD  554



>gb|ACG29984.1| cytochrome P450 CYP79A33 [Zea mays]
Length=550

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DT VS Y +PK SHV++SR  LGRNP VW+EPL+F PERHL NDG +V   +P+
Sbjct  415  PHVAMEDTVVSGYLVPKGSHVLLSRLALGRNPDVWDEPLQFRPERHLVNDG-DVVLTEPD  473

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR +SFS GRRGCPG+ LGS ++ ML ARL+QGF W
Sbjct  474  LRFISFSAGRRGCPGVSLGSSITMMLFARLLQGFAW  509



>gb|ADM34983.1| CYP79D16 [Prunus dulcis]
Length=534

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 80/110 (73%), Gaps = 3/110 (3%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV +YFIPK SHV++SR GLGRNP++W+EPLK+ PERHLK+DGS V   + E
Sbjct  400  PHVSMADTTVGDYFIPKGSHVMLSRIGLGRNPKIWDEPLKYKPERHLKDDGSGVVLTESE  459

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            LR +SFSTG RGC    LG+ ++ ML ARL+ GF W       RI+L E+
Sbjct  460  LRFISFSTGMRGCVASTLGTSMTVMLFARLLHGFTWEAPPNESRIDLTEA  509



>gb|EMT14945.1| Tyrosine N-monooxygenase [Aegilops tauschii]
Length=524

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+ Y IPKDSH+++SR GLGRNP++W EPL+F PERHL  + + V   DP 
Sbjct  393  PHVAMADTTVAGYTIPKDSHILLSRLGLGRNPKIWTEPLEFQPERHL--NTANVLLTDPG  450

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ  366
            LR +SFS+GRRGCPGI LG+ ++ ML AR++QGF W +
Sbjct  451  LRFISFSSGRRGCPGISLGTSMTMMLFARMLQGFTWTK  488



>gb|AGN12803.1| tryptophan N-hydroxylase 1 [Leavenworthia alabamica]
Length=543

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  406  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  464

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++MLLARL+QGF W       R+EL ES HD
Sbjct  465  LRFISFSTGKRGCAAPALGTALTTMLLARLLQGFTWKLPENETRVELMESSHD  517



>ref|XP_008644663.1| PREDICTED: tyrosine N-monooxygenase-like [Zea mays]
 gb|AFW68244.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=550

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%), Gaps = 1/96 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DT VS Y +PK SHV++SR  LGRNP VW+EPL+F PERHL NDG +V   +P+
Sbjct  415  PHVAMEDTVVSGYLVPKGSHVLLSRLALGRNPDVWDEPLQFRPERHLVNDG-DVVLTEPD  473

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR +SFS GRRGCPG+ LGS ++ ML ARL+QGF W
Sbjct  474  LRFISFSAGRRGCPGVSLGSSITMMLFARLLQGFAW  509



>ref|XP_002274952.2| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=495

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 81/113 (72%), Gaps = 5/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D  V+ YFIPK SHV++SR GLGRNPRVWEEPLKF PERH+ ++   V   +PE
Sbjct  363  PHVSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEV--VDLAEPE  420

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTGRRGCPG  LG+ ++  LLARL+Q F W       +I+L ES +D
Sbjct  421  LRFISFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQDQIDLTESMND  473



>gb|AGN12785.1| tryptophan N-hydroxylase 1 [Leavenworthia alabamica]
Length=543

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  406  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  464

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++MLLARL+QGF W       R+EL ES HD
Sbjct  465  LRFISFSTGKRGCAAPALGTALTTMLLARLLQGFTWKLPENETRVELMESSHD  517



>ref|XP_006486168.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=482

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 6/116 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL---KNDGSEVSFV  489
            PH+ T D TV+ YFIPK SHV++SR GLGRNP VW++PLKF+PERH+    +   +V   
Sbjct  344  PHVSTRDATVAGYFIPKGSHVLLSRIGLGRNPNVWKDPLKFIPERHIGSPDDHHHQVELT  403

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            +PELR LSFS GRRGC G+ LGS +S MLLARL+QGF+W        ++L ESK D
Sbjct  404  EPELRFLSFSRGRRGCMGMALGSEMSVMLLARLLQGFNWSAPSDEEMVDLSESKCD  459



>ref|XP_006435921.1| hypothetical protein CICLE_v10031099mg [Citrus clementina]
 gb|ESR49161.1| hypothetical protein CICLE_v10031099mg [Citrus clementina]
Length=569

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 6/116 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL---KNDGSEVSFV  489
            PH+ T D TV+ YFIPK SHV++SR GLGRNP VW++PLKF+PERH+    +   +V   
Sbjct  430  PHVSTRDATVAGYFIPKGSHVLLSRIGLGRNPNVWKDPLKFIPERHIGSPDDHHHQVELT  489

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            +PELR LSFS GRRGC G+ LGS +S MLLARL+QGF+W        ++L ESK D
Sbjct  490  EPELRFLSFSRGRRGCMGMALGSEMSVMLLARLLQGFNWSAPSDEEMVDLSESKCD  545



>emb|CAN61661.1| hypothetical protein VITISV_000261 [Vitis vinifera]
Length=572

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 81/114 (71%), Gaps = 4/114 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL-KNDGSEVSFVDP  483
            PH+ T D  V+ YFIPK SHV++SR GLGRN R+WEEPL+F PERHL +  G  V   +P
Sbjct  434  PHVSTCDAVVAGYFIPKGSHVLLSRLGLGRNGRIWEEPLRFKPERHLSEGTGKMVELTEP  493

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            +LR +SF TGRRGCPG   GS ++ MLLARL+QGF W    +   I+L ES++D
Sbjct  494  DLRFISFGTGRRGCPGKATGSAMTVMLLARLLQGFTWSAPPEQKEIDLSESRND  547



>ref|XP_006486167.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=521

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 6/116 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL---KNDGSEVSFV  489
            PH+ T D TV+ YFIPK SHV++SR GLGRNP VW++PLKF+PERH+    +   +V   
Sbjct  382  PHVSTRDATVAGYFIPKGSHVLLSRIGLGRNPNVWKDPLKFIPERHIGSPDDHHHQVELT  441

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            +PELR LSFS GRRGC G+ LGS +S MLLARL+QGF+W        ++L ESK D
Sbjct  442  EPELRFLSFSRGRRGCMGMALGSEMSVMLLARLLQGFNWSAPSDEEMVDLSESKCD  497



>gb|ACR10255.1| cytochrome P450 79b3 [Brassica rapa subsp. pekinensis]
Length=543

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+  EV+  + +
Sbjct  408  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECLEVTLTEND  466

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ ++ M+LARL+QGF W   G   R+EL ES HD
Sbjct  467  LRFISFSTGKRGCAAPALGTAITVMMLARLLQGFKWKLAGGETRVELMESSHD  519



>emb|CDY25587.1| BnaA04g12790D [Brassica napus]
Length=543

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+  EV+  + +
Sbjct  408  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECLEVTLTEND  466

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ ++ M+LARL+QGF W   G   R+EL ES HD
Sbjct  467  LRFISFSTGKRGCAAPALGTAITVMMLARLLQGFKWKLAGGETRVELMESSHD  519



>ref|XP_009140345.1| PREDICTED: tryptophan N-monooxygenase 2 [Brassica rapa]
Length=543

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+  EV+  + +
Sbjct  408  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECLEVTLTEND  466

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ ++ M+LARL+QGF W   G   R+EL ES HD
Sbjct  467  LRFISFSTGKRGCAAPALGTAITVMMLARLLQGFKWKLAGGETRVELMESSHD  519



>gb|ADW54459.1| cytochrome P450 79B1 [Brassica oleracea var. botrytis]
Length=541

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  406  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  464

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  465  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHD  517



>emb|CDY63922.1| BnaC07g51280D [Brassica napus]
Length=541

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  406  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  464

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  465  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHD  517



>ref|XP_002866896.1| CYP79B2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43155.1| CYP79B2 [Arabidopsis lyrata subsp. lyrata]
Length=541

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  406  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  464

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  465  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHD  517



>gb|AGS49165.1| cytochrome P450 CYP79B2 [Eruca vesicaria subsp. sativa]
Length=543

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+  EV+ ++ +
Sbjct  408  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECLEVTLIEND  466

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ ++ M+LARL+QGF W   G   R+EL ES HD
Sbjct  467  LRFISFSTGKRGCAAPALGTAITVMMLARLLQGFKWKLPGGETRVELMESSHD  519



>ref|XP_010030373.1| PREDICTED: valine N-monooxygenase 1-like [Eucalyptus grandis]
Length=533

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 3/114 (3%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  SD  V+ YFIPK SHV++SR GLGRNP+VW +PL+F PERH  +D  EV   +P
Sbjct  399  PPHMAMSDAIVAGYFIPKGSHVLLSRFGLGRNPKVWNKPLEFRPERHFTSDCIEVPLTEP  458

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
             LR +SFSTGRRGC    LG+ ++ +LLAR+VQGF+W+       I L ES  D
Sbjct  459  NLRFISFSTGRRGCVAPMLGTAMTVILLARMVQGFNWMAPPNVTSINLDESFED  512



>gb|AGM16417.1| cytochrome P450 79B2 [Eruca vesicaria subsp. sativa]
Length=542

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  407  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  465

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  466  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKMPENETRVELMESSHD  518



>ref|XP_010519775.1| PREDICTED: dihomomethionine N-hydroxylase-like [Tarenaya hassleriana]
Length=528

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 84/111 (76%), Gaps = 5/111 (5%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+   DTT++ YF+PK SHV++SR GLGRNP++W+EP  F PERHL +  +EV+ ++P
Sbjct  392  PPHVAMEDTTLAGYFVPKGSHVLVSRVGLGRNPKIWDEPDVFRPERHLGS--TEVNLLEP  449

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRES  339
            E+R +SFSTGRRGC G +LG+ ++ MLLARL+QGF W       R+EL ES
Sbjct  450  EMRFVSFSTGRRGCIGGKLGTYMTVMLLARLLQGFTWSLPPGSERVELMES  500



>ref|XP_009785421.1| PREDICTED: isoleucine N-monooxygenase 2-like [Nicotiana sylvestris]
Length=257

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH   SDT V   FIPK S V++SR GLGRNPRV E+P+KF PE HLK +G EV   D E
Sbjct  123  PHESVSDTIVGESFIPKGSVVLLSRLGLGRNPRVLEDPMKFKPEHHLKEEGGEVVLNDLE  182

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            L +LSFSTGRRG PG++LGS +++MLLARL+QGF W
Sbjct  183  LHLLSFSTGRRGYPGVKLGSTITTMLLARLLQGFSW  218



>ref|XP_006411796.1| hypothetical protein EUTSA_v10024861mg [Eutrema salsugineum]
 gb|ESQ53249.1| hypothetical protein EUTSA_v10024861mg [Eutrema salsugineum]
Length=541

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  407  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  465

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  466  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPKNETRVELMESSHD  518



>ref|XP_009138546.1| PREDICTED: cytochrome P450 79B1-like [Brassica rapa]
 gb|ACR10254.1| cytochrome P450 79b2 [Brassica rapa subsp. pekinensis]
Length=541

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  406  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWTDPLSFKPERHL-NECSEVTLTEND  464

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  465  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHD  517



>gb|KCW54305.1| hypothetical protein EUGRSUZ_I00268 [Eucalyptus grandis]
Length=505

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 3/114 (3%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PPH+  SD  V+ YFIPK SHV++SR GLGRNP+VW +PL+F PERH  +D  EV   +P
Sbjct  371  PPHMAMSDAIVAGYFIPKGSHVLLSRFGLGRNPKVWNKPLEFRPERHFTSDCIEVPLTEP  430

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
             LR +SFSTGRRGC    LG+ ++ +LLAR+VQGF+W+       I L ES  D
Sbjct  431  NLRFISFSTGRRGCVAPMLGTAMTVILLARMVQGFNWMAPPNVTSINLDESFED  484



>gb|EMT14947.1| Tyrosine N-monooxygenase [Aegilops tauschii]
Length=484

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+ Y IPKDSH+++SR GLGRNP++W EPL+F PERHL  + + V   DP 
Sbjct  353  PHVAMADTTVAGYTIPKDSHILLSRLGLGRNPKIWTEPLEFQPERHL--NTANVLLTDPG  410

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ  366
            LR +SFS+GRRGCPG+ LG+ ++ ML AR++QGF W +
Sbjct  411  LRFISFSSGRRGCPGMSLGTSMTMMLFARMLQGFTWTK  448



>ref|XP_004509430.1| PREDICTED: isoleucine N-monooxygenase 2-like [Cicer arietinum]
Length=531

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DT V+NY IPKDS VI+ R G+G NPRVWEEPLKF PER+LK +GS +S  D  
Sbjct  398  PHVAMKDTVVANYIIPKDSQVILRRQGIGLNPRVWEEPLKFKPERYLKENGSNLSLADTS  457

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            L  + FSTGRRGCPGI LG+ ++ ML AR + GF W
Sbjct  458  LDTIIFSTGRRGCPGIMLGTSMTIMLFARFLHGFTW  493



>ref|XP_006367541.1| PREDICTED: isoleucine N-monooxygenase 1-like, partial [Solanum 
tuberosum]
Length=507

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = -1

Query  659  PHLCTSDTTV-SNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKN-DGSEVSFVD  486
            PH+  SDT +   YFIPK S V++SR GLGRNPRVW++PLKF PERHLK  DG EV   D
Sbjct  371  PHVSVSDTIIGEKYFIPKGSIVLLSRLGLGRNPRVWKDPLKFKPERHLKKKDGDEVVLTD  430

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
             +LR+LSFS GRRGCP ++LGS +++MLLARL+Q F W
Sbjct  431  SKLRLLSFSIGRRGCPAVKLGSTITTMLLARLLQEFTW  468



>ref|XP_010446562.1| PREDICTED: tryptophan N-monooxygenase 1-like [Camelina sativa]
Length=542

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  407  PHVALADTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  465

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTG+RGC    LGS +++M+LARL+QGF W       R+EL ES HD
Sbjct  466  LRFISFSTGKRGCAAPALGSALTTMMLARLLQGFTWKLPKNETRVELMESSHD  518



>ref|NP_178055.2| cytochrome P450, family 79, subfamily C, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AEE36235.1| cytochrome P450, family 79, subfamily C, polypeptide 1 [Arabidopsis 
thaliana]
Length=546

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 82/114 (72%), Gaps = 6/114 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DTT++ YFIPK SH+++SRPG+GRNP+ W+EPL + PERH+   G+EV   +P+
Sbjct  407  PHMARHDTTLAGYFIPKGSHILVSRPGVGRNPKTWDEPLIYRPERHIT--GNEVVLTEPD  464

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV----QCGRIELRESKHD  330
            LR++SF TGRRGC G +LG+ +   LL RL+QGFDW        R+EL ESK +
Sbjct  465  LRLVSFGTGRRGCVGAKLGTSMIVTLLGRLLQGFDWTIPPGTTDRVELVESKEN  518



>ref|XP_010474492.1| PREDICTED: dihomomethionine N-hydroxylase [Camelina sativa]
Length=484

 Score =   130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 81/114 (71%), Gaps = 6/114 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DTT++ YFIPK SH+++SRPG+GRNP+ W+EPL + PERH+   G EV   +P+
Sbjct  345  PHMARHDTTLAGYFIPKGSHILVSRPGVGRNPKTWDEPLIYRPERHIT--GKEVMLTEPD  402

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV----QCGRIELRESKHD  330
            LR++SF TGRRGC G +LG+ +   LL RL+QGFDW        +IEL ESK +
Sbjct  403  LRLVSFGTGRRGCVGAKLGTSMIVTLLGRLLQGFDWTIPPGTTDKIELVESKEN  456



>ref|XP_010446588.1| PREDICTED: tryptophan N-monooxygenase 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010446589.1| PREDICTED: tryptophan N-monooxygenase 1-like isoform X2 [Camelina 
sativa]
Length=542

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  407  PHVALADTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  465

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTG+RGC    LGS +++M+LARL+QGF W       R+EL ES HD
Sbjct  466  LRFISFSTGKRGCAAPALGSALTTMMLARLLQGFTWKLPKNETRVELMESSHD  518



>ref|XP_002890164.1| CYP79F1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66423.1| CYP79F1 [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFV  489
            P HL   DTT+  YFIPK SH+ +SRPGLGRNP++W++PL + PERHL+ DG   EV+ V
Sbjct  398  PSHLARQDTTLGGYFIPKGSHIHVSRPGLGRNPKIWKDPLVYKPERHLQGDGITKEVTLV  457

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            + E+R +SFSTGRRGC G+++G+ +  M+LAR +QGF+W
Sbjct  458  ETEMRFVSFSTGRRGCIGVKVGTTMMVMMLARFLQGFNW  496



>ref|XP_010437120.1| PREDICTED: tryptophan N-monooxygenase 1-like [Camelina sativa]
Length=542

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  407  PHVALADTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  465

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTG+RGC    LGS +++M+LARL+QGF W       R+EL ES HD
Sbjct  466  LRFISFSTGKRGCAAPALGSALTTMMLARLLQGFTWKLPKNETRVELMESSHD  518



>gb|AFR34030.1| cytochrome p450 BCMA2 [Boechera stricta]
 gb|AFR34032.1| cytochrome P450 BCMA2 [Boechera stricta]
Length=540

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKND--GSEVSFV  489
            PPH+   DTT+  YFIPK SH+ + RPGLGRNP++W++PL + PERHL+ D    EV+ V
Sbjct  400  PPHVARQDTTLGGYFIPKGSHIHVCRPGLGRNPKIWKDPLVYQPERHLQGDRITKEVTLV  459

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            + E+R +SFSTGRRGC G+++G+++  M+LAR +QGF+W
Sbjct  460  EAEMRFVSFSTGRRGCIGVKVGTIMMVMMLARFIQGFNW  498



>emb|CBI25370.3| unnamed protein product [Vitis vinifera]
Length=499

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 5/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D  V+ YFIPK SHV++SR GLGRNPRVWEEPLKF PERH+ ++   V   +PE
Sbjct  367  PHVSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEV--VDLAEPE  424

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTGRRGCPG  LG+ ++  LLARL+Q F W       +I+L ES ++
Sbjct  425  LRFISFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQDQIDLTESMNE  477



>ref|XP_002464334.1| hypothetical protein SORBIDRAFT_01g016480 [Sorghum bicolor]
 gb|EER91332.1| hypothetical protein SORBIDRAFT_01g016480 [Sorghum bicolor]
Length=557

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 79/114 (69%), Gaps = 6/114 (5%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKND---GSEVSF  492
            PPH+   D  VS Y IPK +HV++SR G+GRNP VW+ PL+F PERHL N+   G  V  
Sbjct  418  PPHVAMEDAIVSGYLIPKGTHVLLSRLGIGRNPNVWDAPLQFCPERHLMNNKQSGHHVVL  477

Query  491  VDPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRES  339
             +P+LR +SFS GRRGCPG+ LGS V+ ML ARL+QGF W +      ++L+ES
Sbjct  478  TEPDLRFVSFSVGRRGCPGVSLGSSVTVMLFARLLQGFTWTKPPGIRTVDLKES  531



>gb|AAD03416.1| cytochrome P450, partial [Arabidopsis thaliana]
Length=382

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  247  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLCFKPERHL-NECSEVTLTEND  305

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  306  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHD  358



>ref|NP_563996.2| dihomomethionine N-hydroxylase [Arabidopsis thaliana]
 sp|Q949U1.1|C79F1_ARATH RecName: Full=Dihomomethionine N-hydroxylase; AltName: Full=Cytochrome 
P450 79F1; AltName: Full=Protein BUSHY 1; AltName: 
Full=Protein SUPERSHOOT 1; AltName: Full=Trihomomethionine 
N-hydroxylase [Arabidopsis thaliana]
 gb|AAK92827.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM45122.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE29448.1| dihomomethionine N-hydroxylase [Arabidopsis thaliana]
Length=538

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFV  489
            P HL   DTT+  YFIPK SH+ + RPGLGRNP++W++PL + PERHL+ DG   EV+ V
Sbjct  398  PSHLARQDTTLGGYFIPKGSHIHVCRPGLGRNPKIWKDPLVYKPERHLQGDGITKEVTLV  457

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            + E+R +SFSTGRRGC G+++G+++  MLLAR +QGF+W
Sbjct  458  ETEMRFVSFSTGRRGCIGVKVGTIMMVMLLARFLQGFNW  496



>emb|CBI25369.3| unnamed protein product [Vitis vinifera]
Length=666

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 81/113 (72%), Gaps = 5/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D  V+ YFIPK SHV++SR GLGRNPRVWEEPLKF PERH+ ++   V   +PE
Sbjct  534  PHVSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEV--VDLAEPE  591

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTGRRGCPG  LG+ ++  LLARL+Q F W       +I+L ES +D
Sbjct  592  LRFISFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQDQIDLTESMND  644


 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 61/83 (73%), Gaps = 2/83 (2%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PHL   D  V+ YFIPK SHV++++ GLGRNP+VWEEPL+F PERH+ +D  +++  +PE
Sbjct  63   PHLSMVDAIVAGYFIPKGSHVLLNQVGLGRNPKVWEEPLRFKPERHMNDDVLDLA--EPE  120

Query  479  LRILSFSTGRRGCPGIQLGSLVS  411
            +R +SFS  R+ C G  LG+ ++
Sbjct  121  VRFISFSAKRQWCFGTALGTTLT  143



>ref|XP_002274920.1| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=495

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 5/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D  V+ YFIPK SHV++SR GLGRNPRVWEEPLKF PERH+ ++   V   +PE
Sbjct  363  PHVSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEV--VDLAEPE  420

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTGRRGCPG  LG+ ++  LLARL+Q F W       +I+L ES ++
Sbjct  421  LRFISFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQDQIDLTESMNE  473



>gb|AAD34693.1|AC006341_21 Similar to gb|AF069494 cytochrome P450 from Sinapis alba and 
is a member of the PF|00067 Cytochrome P450 family. EST gb|F14190 
comes from this gene [Arabidopsis thaliana]
Length=537

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFV  489
            P HL   DTT+  YFIPK SH+ + RPGLGRNP++W++PL + PERHL+ DG   EV+ V
Sbjct  397  PSHLARQDTTLGGYFIPKGSHIHVCRPGLGRNPKIWKDPLVYKPERHLQGDGITKEVTLV  456

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            + E+R +SFSTGRRGC G+++G+++  MLLAR +QGF+W
Sbjct  457  ETEMRFVSFSTGRRGCIGVKVGTIMMVMLLARFLQGFNW  495



>gb|KFK24947.1| hypothetical protein AALP_AA8G046600 [Arabis alpina]
Length=535

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DT V  YFIPK SHV+ISR G+GRN  VW++PLKF PERHL N+  +V   DP+
Sbjct  399  PHMSIADTVVDGYFIPKGSHVLISRMGIGRNSNVWDKPLKFDPERHLGNN-VDVELNDPD  457

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
            L ++SFS GRRGC GI +GS ++ MLLARL+QGF W      G+  + ESK+D
Sbjct  458  LNLISFSAGRRGCMGINIGSAMTYMLLARLIQGFTWSLMPGEGKNYISESKND  510



>sp|O81345.1|C79B1_SINAL RecName: Full=Cytochrome P450 79B1 [Sinapis alba]
 gb|AAD03415.1| cytochrome P450 [Sinapis alba]
Length=542

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD TV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  407  PHVALSDATVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  465

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++MLLARL+QGF W       R+EL ES HD
Sbjct  466  LRFISFSTGKRGCAAPALGTALTTMLLARLLQGFTWKLPENETRVELMESSHD  518



>ref|XP_002274698.2| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=563

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 5/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D  V+ YFIPK SHV++SR GLGRNPRVWEEPLKF PERH+ ++   V   +PE
Sbjct  431  PHVSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEV--VDLAEPE  488

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTGRRGCPG  LG+ ++  LLARL+Q F W       +I+L ES ++
Sbjct  489  LRFISFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQDQIDLTESMNE  541



>ref|XP_006305874.1| hypothetical protein CARUB_v10010983mg [Capsella rubella]
 gb|EOA38772.1| hypothetical protein CARUB_v10010983mg [Capsella rubella]
Length=537

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 78/99 (79%), Gaps = 2/99 (2%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFV  489
            P H+   DTT+  YFIP+ SHV +SRPGLGRNP++W++PL + PERHL+ DG   EV+ V
Sbjct  398  PTHVARQDTTLGGYFIPQGSHVHVSRPGLGRNPKIWKDPLVYKPERHLQEDGITKEVTLV  457

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            + E+R +SFSTGRRGC G+++G+++  M+LAR +QGF+W
Sbjct  458  ETEMRFVSFSTGRRGCVGVKVGTVMMVMMLARFLQGFNW  496



>ref|XP_002319424.1| hypothetical protein POPTR_0013s15320g [Populus trichocarpa]
 gb|EEE95347.1| hypothetical protein POPTR_0013s15320g [Populus trichocarpa]
Length=528

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+NYFIPK S+V++SR GLGRNP+VW+EPLKF PERHL N+  +V   +  
Sbjct  394  PHVSAADTTVANYFIPKGSYVLLSRLGLGRNPKVWDEPLKFKPERHL-NEMEKVVLTENN  452

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR +SFSTG+RGC G+ LG+ +++ML ARL+Q F W
Sbjct  453  LRFISFSTGKRGCKGVTLGTSMTTMLFARLLQAFTW  488



>ref|XP_009358329.1| PREDICTED: LOW QUALITY PROTEIN: tyrosine N-monooxygenase [Pyrus 
x bretschneideri]
Length=208

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV +YFIPK SHVI+SR GL RN +VW EP KF PERHLK+DGS V   + E
Sbjct  72   PHVSMADTTVGDYFIPKVSHVILSRVGLERNRKVWNEPFKFKPERHLKDDGSGVVLTESE  131

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            L  +SFSTG RGC   +LG+ ++ ML ARL+ GF W
Sbjct  132  LXFISFSTGMRGCVASRLGTAMTVMLFARLLHGFSW  167



>ref|XP_010431975.1| PREDICTED: tryptophan N-monooxygenase 1 [Camelina sativa]
Length=542

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  407  PHVALADTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  465

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  466  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPKNETRVELMESSHD  518



>ref|XP_007017085.1| Cytochrome p450 79a2, putative [Theobroma cacao]
 gb|EOY34704.1| Cytochrome p450 79a2, putative [Theobroma cacao]
Length=557

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%), Gaps = 6/116 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKND-GSEVSFVDP  483
            PH+  +DTTV++YFIPK SH+++SR GLGRNP+VW+EPLK+ PERHLK D G+ +S  + 
Sbjct  420  PHVSVADTTVADYFIPKGSHLLLSRTGLGRNPKVWDEPLKYKPERHLKADHGTPLSLTET  479

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV-----QCGRIELRESKHD  330
            +LR +SFSTG RGC G+ LG+ ++ ML ARL+Q F W      Q   I L E+K +
Sbjct  480  DLRFISFSTGMRGCKGVLLGTSMTVMLFARLLQCFTWSIPPDQQGQAINLTEAKEN  535



>ref|NP_195705.1| tryptophan N-monooxygenase 1 [Arabidopsis thaliana]
 sp|O81346.2|C79B2_ARATH RecName: Full=Tryptophan N-monooxygenase 1; AltName: Full=Cytochrome 
P450 79B2; AltName: Full=Tryptophan N-hydroxylase 1 
[Arabidopsis thaliana]
 emb|CAB38908.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80658.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AAK76691.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AAM14376.1| putative cytochrome P450 protein [Arabidopsis thaliana]
 gb|AEE87143.1| tryptophan N-monooxygenase 1 [Arabidopsis thaliana]
Length=541

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  406  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLCFKPERHL-NECSEVTLTEND  464

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  465  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHD  517



>ref|XP_009125594.1| PREDICTED: phenylalanine N-monooxygenase-like [Brassica rapa]
Length=532

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = -1

Query  656  HLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPEL  477
            H+ T+D  V  YFIPK SHV+ISR G+GRNP VW++PLKF PERH+ N+ + V   DP+L
Sbjct  400  HMSTADAVVDGYFIPKGSHVLISRLGIGRNPNVWDKPLKFDPERHMGNNKN-VELNDPDL  458

Query  476  RILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
             I+SFS GRRGC G  +GS ++ MLLARL+QGF W       +I++ ESK D
Sbjct  459  NIISFSAGRRGCMGSNIGSAMTYMLLARLIQGFTWSSVHGEDKIDISESKSD  510



>gb|ACR10256.1| cytochrome P450 79a2 [Brassica rapa subsp. pekinensis]
Length=529

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = -1

Query  656  HLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPEL  477
            H+ T+D  V  YFIPK SHV+ISR G+GRNP VW++PLKF PERH+ N+ + V   DP+L
Sbjct  397  HMSTADAVVDGYFIPKGSHVLISRLGIGRNPNVWDKPLKFDPERHMGNNKN-VELNDPDL  455

Query  476  RILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
             I+SFS GRRGC G  +GS ++ MLLARL+QGF W       +I++ ESK D
Sbjct  456  NIISFSAGRRGCMGSNIGSAMTYMLLARLIQGFTWSSVHGEDKIDISESKSD  507



>ref|XP_010529568.1| PREDICTED: dihomomethionine N-hydroxylase-like [Tarenaya hassleriana]
Length=538

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DTT++ YFIPK S V++SR GLGRNP++WEEP  F PERHL N   EVS  + +
Sbjct  401  PHVAREDTTLAGYFIPKGSIVLVSRVGLGRNPKIWEEPDAFRPERHLNNGPVEVSLAEQD  460

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            +R +SFSTGRRGC G +LG+ ++ MLLARL+QGFDW
Sbjct  461  MRFVSFSTGRRGCVGYRLGTSMTVMLLARLLQGFDW  496



>ref|XP_006404690.1| hypothetical protein EUTSA_v10000114mg [Eutrema salsugineum]
 gb|ESQ46143.1| hypothetical protein EUTSA_v10000114mg [Eutrema salsugineum]
Length=543

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 80/113 (71%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDT V+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+  EV+  + +
Sbjct  408  PHVALSDTAVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECLEVTLTEND  466

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTG+RGC    LG+ ++ M+LARL+QGF W   G   R+EL ES HD
Sbjct  467  LRFISFSTGKRGCAAPALGTAITVMMLARLLQGFKWKLAGGETRVELMESSHD  519



>gb|EEC74210.1| hypothetical protein OsI_09370 [Oryza sativa Indica Group]
Length=519

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 78/110 (71%), Gaps = 4/110 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            P H+  ++ T++ + IPK SH+I+SR GLGRNPR W+ PL+F PERHLKN  + V   +P
Sbjct  354  PSHVAIANITIAGFMIPKGSHIILSRIGLGRNPRAWDNPLEFRPERHLKNTDN-VVLAEP  412

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRE  342
            ELR LSFS GRRGCP + LG+ ++ ML ARL+QGF W       RIEL+E
Sbjct  413  ELRFLSFSAGRRGCPAVSLGTSITMMLFARLLQGFSWSISPGANRIELQE  462



>gb|AGC13081.1| cytochrome P450 79B2 [Brassica oleracea var. italica]
Length=540

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD TV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  405  PHVALSDATVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  463

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  464  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHD  516



>ref|XP_002887782.1| CYP79C1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64041.1| CYP79C1 [Arabidopsis lyrata subsp. lyrata]
Length=546

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 82/114 (72%), Gaps = 6/114 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DTT++ YFIPK SH+++SRPG+GRNP+ W+EPL + PERH+   G+EV   +P+
Sbjct  407  PHMARHDTTLAGYFIPKGSHILVSRPGVGRNPKTWDEPLIYRPERHIT--GNEVMLTEPD  464

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV----QCGRIELRESKHD  330
            LR++SF TGRRGC G +LG+ +   LL RL+QGFDW        ++EL ESK +
Sbjct  465  LRLVSFGTGRRGCVGAKLGTSMIVTLLGRLLQGFDWTIPPGTTDKVELVESKEN  518



>gb|ACR10253.1| cytochrome P450 79b2 [Brassica rapa subsp. pekinensis]
Length=540

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD TV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  405  PHVALSDATVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  463

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  464  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHD  516



>gb|AAN76810.1|AF453287_1 cytochrome P450 [Brassica napus]
 emb|CDY63895.1| BnaA01g34610D [Brassica napus]
Length=540

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD TV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  405  PHVALSDATVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  463

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  464  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHD  516



>ref|XP_004509432.1| PREDICTED: isoleucine N-monooxygenase 2-like [Cicer arietinum]
Length=532

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DT V+NY IPKDS VI+ R G+G NPRVWEEPLKF PER+LK +GS +S  D  
Sbjct  397  PHVAMKDTVVANYIIPKDSQVILRRQGIGLNPRVWEEPLKFKPERYLKENGSNLSLADTS  456

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            L  L FSTGRRGC GI LG+ ++ ML ARL+ GF W
Sbjct  457  LDTLIFSTGRRGCSGILLGTSMTIMLFARLLHGFTW  492



>emb|CDX69373.1| BnaC01g00800D [Brassica napus]
Length=540

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD TV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  405  PHVALSDATVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  463

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  464  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHD  516



>emb|CDY14123.1| BnaC02g02400D [Brassica napus]
Length=434

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 78/112 (70%), Gaps = 4/112 (4%)
 Frame = -1

Query  656  HLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPEL  477
            H+ T+D  V  YFIPK SHV+ISR G+GRNP VW++PLKF PERH+ N+   V   DP+L
Sbjct  302  HMSTADAVVDGYFIPKGSHVLISRLGIGRNPNVWDKPLKFDPERHMGNN-KNVELNDPDL  360

Query  476  RILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
             I+SFS GRRGC G  +GS ++ MLLARL+QGF W       + ++ ESK D
Sbjct  361  NIISFSAGRRGCMGSNIGSAMTYMLLARLIQGFTWSSVHGEDKFDISESKSD  412



>ref|XP_006398988.1| hypothetical protein EUTSA_v10015246mg [Eutrema salsugineum]
 gb|ESQ40441.1| hypothetical protein EUTSA_v10015246mg [Eutrema salsugineum]
Length=498

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (72%), Gaps = 6/114 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ T+D  V  YFIPK SHV+ISR G+GRNP VW++PLKF PERHL N+ + V   D +
Sbjct  365  PHMSTADAVVDGYFIPKGSHVLISRMGIGRNPNVWDKPLKFNPERHLGNNKN-VDLNDQD  423

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV----QCGRIELRESKHD  330
            L ++SFS GRRGC G  +GS ++ MLLARL+QGF W     +C +I++ ESK D
Sbjct  424  LNLISFSAGRRGCLGSSIGSAMTYMLLARLIQGFTWSPVPGEC-KIDISESKSD  476



>ref|XP_006283476.1| hypothetical protein CARUB_v10004524mg [Capsella rubella]
 gb|EOA16374.1| hypothetical protein CARUB_v10004524mg [Capsella rubella]
Length=547

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  S+TTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  412  PHVALSETTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  470

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++MLLARL+QGF W       R+EL ES HD
Sbjct  471  LRFISFSTGKRGCAAPALGTALTTMLLARLLQGFTWKLPESETRVELIESSHD  523



>ref|XP_004139122.1| PREDICTED: isoleucine N-monooxygenase 1-like [Cucumis sativus]
Length=214

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -1

Query  656  HLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPEL  477
            H+  SD  V+ YFIPK S V++SR GLGRNPR+WE+P+KF PERHLK+   E+   +P L
Sbjct  76   HVSNSDIVVAGYFIPKGSEVLLSRSGLGRNPRIWEDPMKFDPERHLKDGTVELGISEPTL  135

Query  476  RILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV  369
            R ++F+ GRRGCPG  LG+ ++ ML ARL+QGF W 
Sbjct  136  RFITFTRGRRGCPGSSLGTNITMMLFARLLQGFSWT  171



>ref|XP_006363576.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum tuberosum]
Length=506

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 3/99 (3%)
 Frame = -1

Query  659  PHLCTSDTTV-SNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKND--GSEVSFV  489
            PH+  SDT V   YFIPK S V++SR GLGRNPR+W++PL F PERHLK +  G +V   
Sbjct  369  PHVSISDTIVGEKYFIPKGSVVLLSRLGLGRNPRIWKDPLNFKPERHLKMEDGGDQVVLT  428

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            D  LR+LSFSTGRRGCP ++LGS +++MLLARL+QGF W
Sbjct  429  DSNLRLLSFSTGRRGCPAVKLGSTITTMLLARLLQGFTW  467



>gb|AHF20913.1| cytochrome P450 [Populus trichocarpa]
Length=528

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+NYFIPK S+V++SR GLGRNP+VW+EPLKF PERHL N+  +V   +  
Sbjct  394  PHVSAADTTVANYFIPKGSYVLLSRLGLGRNPKVWDEPLKFKPERHL-NEMEKVVLTENN  452

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR +SFSTG+RGC G+ LG+ +++ML ARL+Q F W
Sbjct  453  LRFISFSTGKRGCIGVSLGTSMTTMLFARLLQAFTW  488



>emb|CDY39472.1| BnaC03g60820D [Brassica napus]
Length=518

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD TV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  383  PHVALSDATVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  441

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  442  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSHD  494



>ref|XP_002274641.1| PREDICTED: phenylalanine N-monooxygenase-like [Vitis vinifera]
Length=494

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 5/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D  V+ YFIPK SHV++SR GLGRNPRVWEEPLKF PERH+ ++   V   + E
Sbjct  362  PHVSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEV--VDLAESE  419

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTGRRGCPG  LG+ ++  LLARL+Q F W       +I+L+ES ++
Sbjct  420  LRFISFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQNQIDLKESMNE  472



>ref|XP_002890163.1| CYP79F2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66422.1| CYP79F2 [Arabidopsis lyrata subsp. lyrata]
Length=537

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 82/112 (73%), Gaps = 5/112 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFV  489
            PPH+   DTT+  Y IPK SH+ + RPGLGRNP++W++PL + PERHL+ +G   EV+ V
Sbjct  397  PPHVARQDTTLGGYLIPKGSHIHVCRPGLGRNPKIWKDPLVYEPERHLQGEGITKEVTLV  456

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRE  342
            + E+R +SFSTGRRGC G+++G+++  M+LAR +QGF+W     CG + L E
Sbjct  457  ETEMRFVSFSTGRRGCVGVKVGTIMMVMMLARFLQGFNWKLYQGCGPLSLEE  508



>ref|XP_006387420.1| hypothetical protein POPTR_1061s00200g [Populus trichocarpa]
 gb|ERP46334.1| hypothetical protein POPTR_1061s00200g [Populus trichocarpa]
Length=541

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+NYFIPK S+V++SR GLGRNP+VW+EPLKF PERHL N+  +V   +  
Sbjct  407  PHVSAADTTVANYFIPKGSYVLLSRLGLGRNPKVWDEPLKFKPERHL-NEMEKVVLTENN  465

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR +SFSTG+RGC G+ LG+ +++ML ARL+Q F W
Sbjct  466  LRFISFSTGKRGCIGVSLGTSMTTMLFARLLQAFTW  501



>gb|AFV31131.1| cytochrome P450 79B1 [Brassica napus]
Length=541

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  406  PHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  464

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES +D
Sbjct  465  LRFISFSTGKRGCAAPALGTALTTMMLARLLQGFTWKLPENETRVELMESSYD  517



>emb|CDX90374.1| BnaA08g16100D [Brassica napus]
Length=518

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SD TV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+  + +
Sbjct  383  PHVALSDATVAGYHIPKGSQVLLSRYGLGRNPKVWADPLSFKPERHL-NECSEVTLTEND  441

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTG+RGC    LG+ +++M+LARL+QGF W       R+EL ES HD
Sbjct  442  LRFISFSTGKRGCAAPTLGTALTTMMLARLLQGFTWKLPENETRVELMESSHD  494



>emb|CBI25374.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 5/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D  V+ YFIPK SHV++SR GLGRNPRVWEEPLKF PERH+ ++   V   + E
Sbjct  444  PHVSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEV--VDLAESE  501

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTGRRGCPG  LG+ ++  LLARL+Q F W       +I+L+ES ++
Sbjct  502  LRFISFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQNQIDLKESMNE  554



>ref|XP_010526660.1| PREDICTED: tryptophan N-monooxygenase 1-like [Tarenaya hassleriana]
Length=531

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 84/113 (74%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  SDTTV+ + +PK S V++SR GLGRNP+VW +PL F PERH+ N+ SEV+ ++ +
Sbjct  396  PHVALSDTTVAGFHVPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHM-NECSEVTLIEND  454

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
            LR +SFSTGRRGC    LG+++++MLLAR++QGF W       R+EL ES HD
Sbjct  455  LRFISFSTGRRGCAAPALGTVITTMLLARVLQGFTWKLPEGETRVELVESSHD  507



>ref|XP_006435923.1| hypothetical protein CICLE_v10031311mg [Citrus clementina]
 gb|ESR49163.1| hypothetical protein CICLE_v10031311mg [Citrus clementina]
Length=501

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 83/116 (72%), Gaps = 6/116 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL---KNDGSEVSFV  489
            PH+ T D TV+ YFIPK SHV++SR GLGRNP VW++PLKF+PERH+    +   +V   
Sbjct  364  PHVSTRDATVAGYFIPKGSHVLLSRIGLGRNPNVWKDPLKFIPERHIGSVDDHHHQVELA  423

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            + ELR LSFS GRR C G+ LGS +S +LLARL+QGF+W       +I+L ESK+D
Sbjct  424  ETELRFLSFSRGRRSCMGMALGSEMSVVLLARLLQGFEWSAPSGEEKIDLSESKYD  479



>ref|XP_006486508.1| PREDICTED: phenylalanine N-monooxygenase-like [Citrus sinensis]
Length=502

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 83/116 (72%), Gaps = 6/116 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL---KNDGSEVSFV  489
            PH+ T D TV+ YFIPK SHV++SR GLGRNP VW++PLKF+PERH+    +   +V   
Sbjct  364  PHVSTRDATVAGYFIPKGSHVLLSRIGLGRNPNVWKDPLKFIPERHIGSVDDHHHQVELA  423

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            + ELR LSFS GRR C G+ LGS +S +LLARL+QGF+W       +I+L ESK+D
Sbjct  424  ETELRFLSFSRGRRSCMGMALGSEMSVVLLARLLQGFEWSAPSGEEKIDLSESKYD  479



>ref|XP_010462740.1| PREDICTED: dihomomethionine N-hydroxylase-like [Camelina sativa]
Length=476

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFV  489
            P H+   DTT+  YFIP+ SHV + RPGLGRNP++W++PL + PERHL+ DG   EV+ V
Sbjct  336  PTHVARQDTTLGGYFIPQGSHVHVCRPGLGRNPKIWKDPLVYKPERHLQGDGITKEVTLV  395

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            + E+R +SFSTGRRGC G+++G+++  M+LAR +QGF+W
Sbjct  396  EKEMRFVSFSTGRRGCIGVKVGTVMMVMMLARFLQGFNW  434



>ref|XP_010531370.1| PREDICTED: tryptophan N-monooxygenase 1 [Tarenaya hassleriana]
Length=545

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 82/113 (73%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+   DTTV+ Y IPK S V++SR GLGRNP+VW +PL F PERHL N+ SEV+ ++ +
Sbjct  410  PHVALCDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHL-NECSEVTLIEND  468

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            LR +SFSTGRRGC    LG+ +++M+LAR++QGF W       R+EL ES HD
Sbjct  469  LRFISFSTGRRGCAAPALGTAITTMMLARILQGFTWKLPEGERRVELVESSHD  521



>ref|XP_006651559.1| PREDICTED: tyrosine N-monooxygenase-like [Oryza brachyantha]
Length=513

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 82/113 (73%), Gaps = 5/113 (4%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGS--EVSFV  489
            PP +  +DTT++ Y +P+ S VI+SR GLGRNPRVW+ PL+F PERHL    S    +  
Sbjct  373  PPRVAMADTTIAGYSVPRGSQVILSRVGLGRNPRVWDNPLEFRPERHLSPPPSTEAAALT  432

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCGRIE---LRES  339
            +PELR +SFSTGRRGCPG+ LG+L++ ML ARL+QGF+W +   +E   LRE+
Sbjct  433  EPELRFISFSTGRRGCPGVSLGTLITVMLFARLLQGFEWSKPRGVESVALREA  485



>ref|XP_002873202.1| CYP79A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49461.1| CYP79A2 [Arabidopsis lyrata subsp. lyrata]
Length=532

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ T+D  V  YFIPK SHV+ISR G+GRNP VW++PLKF PERHL N+   V   +P+
Sbjct  399  PHMSTADAVVDGYFIPKGSHVLISRMGIGRNPSVWDKPLKFDPERHLFNNIG-VDPNEPD  457

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
            L I+SFS GRRGC G+ +GS ++ MLLARL+QGF W       +I++ ESK D
Sbjct  458  LNIISFSAGRRGCMGVDIGSAMTYMLLARLIQGFTWSPVPGESKIDISESKSD  510



>ref|XP_006376556.1| hypothetical protein POPTR_0013s15310g [Populus trichocarpa]
 gb|ERP54353.1| hypothetical protein POPTR_0013s15310g [Populus trichocarpa]
Length=528

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+NYFIPK S+V++SR GLGRNP+VW+EPLKF PERHL N+  +V   +  
Sbjct  394  PHVSAADTTVANYFIPKGSYVLLSRLGLGRNPKVWDEPLKFKPERHL-NEMEKVVLTENN  452

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR +SFSTG+RGC G+ LG+ +++ML ARL+Q F W
Sbjct  453  LRFISFSTGKRGCIGVTLGTSMTTMLFARLLQAFTW  488



>gb|AHF20912.1| cytochrome P450 [Populus trichocarpa]
Length=528

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+NYFIPK S+V++SR GLGRNP+VW+EPLKF PERHL N+  +V   +  
Sbjct  394  PHVSAADTTVANYFIPKGSYVLLSRLGLGRNPKVWDEPLKFKPERHL-NEMEKVVLTENN  452

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR +SFSTG+RGC G+ LG+ +++ML ARL+Q F W
Sbjct  453  LRFISFSTGKRGCIGVTLGTSMTTMLFARLLQAFTW  488



>gb|EMT28582.1| Tyrosine N-monooxygenase [Aegilops tauschii]
Length=433

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 80/117 (68%), Gaps = 8/117 (7%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLK----NDGSEVSF  492
            PH+  SDTTV+ Y +PK SHVI+SR GLGRNP VW+EPL+F PERH+     +DG  V+ 
Sbjct  293  PHVALSDTTVAGYRVPKGSHVILSRIGLGRNPAVWDEPLRFKPERHINMAAGSDGG-VAL  351

Query  491  VDPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRESKHD  330
             + ELR +SFSTGRRGC    LG+ +  ML  RL+QGF W +      I+L E+KHD
Sbjct  352  TENELRFISFSTGRRGCVAASLGTAMCMMLFGRLIQGFTWSKPTGVAAIDLSEAKHD  408



>ref|XP_006435920.1| hypothetical protein CICLE_v10031309mg [Citrus clementina]
 gb|ESR49160.1| hypothetical protein CICLE_v10031309mg [Citrus clementina]
Length=502

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 82/116 (71%), Gaps = 6/116 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL---KNDGSEVSFV  489
            PH+ T D T++ YFIPK SHV++SR GLGRNP VW++PLKF+PERH+    +   +V   
Sbjct  364  PHVSTRDATIAGYFIPKGSHVLLSRIGLGRNPNVWKDPLKFIPERHIGSVDDHHHQVELA  423

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            + ELR LSFS GRRGC G+ LGS +S MLLARL+QGF+W        ++L ESK D
Sbjct  424  ETELRFLSFSRGRRGCMGMALGSEMSVMLLARLLQGFNWSAPSDEEMVDLSESKCD  479



>dbj|BAK08222.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 3/112 (3%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDP  483
            PP +  + TTV+ Y IP+ S V++SR  LGRNPR W +PL+F PERHL  D + V+  +P
Sbjct  407  PPRVAMAGTTVAGYSIPRGSQVVLSRVALGRNPRAWADPLEFRPERHLTGDDAAVALSEP  466

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESK  336
            ELR +SFS GRRGCPG+ LG+L + ML ARL+QGF W        +ELRE++
Sbjct  467  ELRFVSFSAGRRGCPGVALGTLFTVMLFARLLQGFTWSVPPGVDGVELRETQ  518



>ref|XP_006486509.1| PREDICTED: tyrosine N-monooxygenase-like [Citrus sinensis]
Length=289

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 82/116 (71%), Gaps = 6/116 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL---KNDGSEVSFV  489
            PH+ T D T++ YFIPK SHV++SR GLGRNP VW++ LKF+PERH+    +   ++   
Sbjct  150  PHVSTRDATIAGYFIPKGSHVLLSRIGLGRNPNVWKDSLKFIPERHIGSVDDHHHQLELA  209

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQCG---RIELRESKHD  330
            + ELR LSFS GRR C G+ LGS +S +LLARL+QGF+W       +I+L ESK+D
Sbjct  210  ETELRFLSFSRGRRSCMGMALGSEMSVVLLARLLQGFEWSAPSGEEKIDLSESKYD  265



>ref|NP_568153.1| cytochrome P450 CYP79A2 [Arabidopsis thaliana]
 gb|AAF70255.1|AF245302_1 cytochrome P450 CYP79A2 [Arabidopsis thaliana]
 gb|AED90847.1| cytochrome P450 CYP79A2 [Arabidopsis thaliana]
Length=523

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ T+DT V  YFIPK SHV+ISR G+GRNP VW++P KF PERHL  +   V   + +
Sbjct  390  PHMSTTDTVVDGYFIPKGSHVLISRMGIGRNPSVWDKPHKFDPERHLSTNTC-VDLNESD  448

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
            L I+SFS GRRGC G+ +GS ++ MLLARL+QGF W+      +I++ ESK+D
Sbjct  449  LNIISFSAGRRGCMGVDIGSAMTYMLLARLIQGFTWLPVPGKNKIDISESKND  501



>gb|KHG05899.1| Phenylalanine N-monooxygenase -like protein [Gossypium arboreum]
Length=549

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 81/115 (70%), Gaps = 6/115 (5%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFVD  486
            PH+   D  V+ YFIPK SHV++SR GLGRNP+VW+EPL F PERHLK DG   EV   +
Sbjct  412  PHVSNVDAIVAGYFIPKGSHVLLSRLGLGRNPKVWDEPLGFKPERHLK-DGCIEEVDLTE  470

Query  485  PELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW---VQCGRIELRESKHD  330
             ELR +SFSTGRRGC G+ LGS ++ M+LARL+QGF W        I+L  S++D
Sbjct  471  TELRFISFSTGRRGCMGVALGSAMTVMVLARLIQGFSWRVPSNEANIDLSVSEND  525



>ref|XP_006304976.1| hypothetical protein CARUB_v10011470mg [Capsella rubella]
 gb|EOA37874.1| hypothetical protein CARUB_v10011470mg [Capsella rubella]
Length=539

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFV  489
            P H+   DTT+  YFIP+ SHV I RPGLGRNP++W++PL + PERHL+ DG   EV+ V
Sbjct  399  PTHVARQDTTLGGYFIPQGSHVHICRPGLGRNPKIWKDPLVYKPERHLQGDGITKEVTLV  458

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            + E+R +SFSTGRRGC G+++G+ +  M+LAR +QGF+W
Sbjct  459  ETEMRFVSFSTGRRGCVGVKVGTAMMVMMLARFLQGFNW  497



>ref|XP_010476751.1| PREDICTED: dihomomethionine N-hydroxylase [Camelina sativa]
Length=542

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDG--SEVSFV  489
            P H+   DTT+  YFIP+ SHV + RPGLGRNP++W++PL + PERHL+ DG   EV+ V
Sbjct  402  PTHVARQDTTLGGYFIPQGSHVHVCRPGLGRNPKIWKDPLVYKPERHLQGDGITKEVTLV  461

Query  488  DPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            + E+R +SFSTGRRGC G+++G+++  M+LAR +QGF+W
Sbjct  462  ETEMRFVSFSTGRRGCIGVKVGTVMMVMMLARFLQGFNW  500



>sp|Q9FLC8.1|C79A2_ARATH RecName: Full=Phenylalanine N-monooxygenase; AltName: Full=Cytochrome 
P450 79A2; AltName: Full=Phenylalanine N-hydroxylase 
[Arabidopsis thaliana]
 dbj|BAB09969.1| cytochrome P450 [Arabidopsis thaliana]
Length=529

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+ T+DT V  YFIPK SHV+ISR G+GRNP VW++P KF PERHL  +   V   + +
Sbjct  396  PHMSTTDTVVDGYFIPKGSHVLISRMGIGRNPSVWDKPHKFDPERHLSTNTC-VDLNESD  454

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQC---GRIELRESKHD  330
            L I+SFS GRRGC G+ +GS ++ MLLARL+QGF W+      +I++ ESK+D
Sbjct  455  LNIISFSAGRRGCMGVDIGSAMTYMLLARLIQGFTWLPVPGKNKIDISESKND  507



>ref|XP_008644689.1| PREDICTED: tyrosine N-monooxygenase-like [Zea mays]
 gb|AFW68322.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=546

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 80/119 (67%), Gaps = 11/119 (9%)
 Frame = -1

Query  662  PPHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHL---KNDGSE---  501
            PPH+ T D  VS Y IPK SHV++SR GLGRNP VW+ PL+F PERHL   +ND  +   
Sbjct  402  PPHVATEDAVVSGYLIPKGSHVLLSRVGLGRNPDVWDAPLQFRPERHLMMNENDDVDDRY  461

Query  500  --VSFVDPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWVQ---CGRIELRES  339
              V   +P+LR +SFS GRRGCPG+ LGS V+ ML ARL+QGF W +      I L+ES
Sbjct  462  HHVVLTEPDLRFISFSAGRRGCPGVSLGSSVTMMLFARLLQGFTWTKPPGVRAIRLQES  520



>emb|CAN74072.1| hypothetical protein VITISV_035799 [Vitis vinifera]
Length=457

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 80/113 (71%), Gaps = 5/113 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +D  V+ YFIPK SHV++SR GLGRNPRVWEEPLKF PERH+ ++   V   + E
Sbjct  325  PHVSMADAVVAGYFIPKGSHVLLSRVGLGRNPRVWEEPLKFKPERHMNDEV--VDLAEXE  382

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            LR +SFSTGRRGCPG  LG+ ++  LLARL+Q F W       +I+L ES ++
Sbjct  383  LRFISFSTGRRGCPGTALGTALTVTLLARLLQCFSWSVPPNQDQIDLTESMNE  435



>gb|AHI88992.1| CYP79D6v4 [Populus nigra]
Length=528

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKNDGSEVSFVDPE  480
            PH+  +DTTV+NYFIPK S+V++SR GLGRNP+VW+EPLKF PERHL N+  +V   +  
Sbjct  394  PHVPAADTTVANYFIPKGSYVLLSRLGLGRNPKVWDEPLKFKPERHL-NEMEKVVLTENN  452

Query  479  LRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
            LR +SFSTG+RGC G+ LG+ +++ML ARL+Q F W
Sbjct  453  LRFISFSTGKRGCIGVTLGTSMTTMLFARLLQAFTW  488



>gb|KHN48839.1| Isoleucine N-monooxygenase 2 [Glycine soja]
Length=473

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 77/114 (68%), Gaps = 5/114 (4%)
 Frame = -1

Query  659  PHLCTSDTTVSNYFIPKDSHVIISRPGLGRNPRVW-EEPLKFMPERHLKNDGSEVSFVDP  483
            PH+   DT V NY IPK SH+++SR  LGRNP+VW +EPLKF PERHL N  S+V   D 
Sbjct  339  PHVSLKDTIVGNYLIPKGSHILLSRQELGRNPKVWNDEPLKFKPERHLINK-SDVVLTDQ  397

Query  482  ELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDWV---QCGRIELRESKHD  330
            +L ++SFSTGRRGCPG  LG+ ++ ML ARL+  F W+       I L ES HD
Sbjct  398  DLNLISFSTGRRGCPGFMLGTTMTVMLFARLLHAFTWIAPPNVSHINLAESSHD  451



>ref|XP_004252024.1| PREDICTED: isoleucine N-monooxygenase 1-like [Solanum lycopersicum]
Length=526

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 75/100 (75%), Gaps = 4/100 (4%)
 Frame = -1

Query  659  PHLCTSDTTV-SNYFIPKDSHVIISRPGLGRNPRVWEEPLKFMPERHLKN---DGSEVSF  492
            PH+  SDT +   +FIPK S V++SR GLGRNPRVW+ PLKF PERHLK    D  EV  
Sbjct  387  PHVSVSDTIIGEKHFIPKGSIVLLSRLGLGRNPRVWKNPLKFKPERHLKKKKKDDGEVVL  446

Query  491  VDPELRILSFSTGRRGCPGIQLGSLVSSMLLARLVQGFDW  372
             D +LR+LSFS GRRGCP ++LGS +++MLLARL+QGF W
Sbjct  447  TDSKLRLLSFSIGRRGCPAVKLGSTITTMLLARLLQGFTW  486



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 959982664718