BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19426_g5_i1 len=901 path=[879:0-900]

Length=901
                                                                      Score     E

ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          556   0.0      
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     555   0.0      
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     553   0.0      
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     552   0.0      
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     552   0.0      
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                551   0.0      
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          551   0.0      
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like     551   0.0      
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     551   0.0      
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          550   0.0      
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          549   0.0      
ref|XP_011078615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    548   0.0      
emb|CDX93092.1|  BnaA03g38140D                                          548   0.0      
emb|CDY50939.1|  BnaC03g74390D                                          548   0.0      
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     548   0.0      
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    548   0.0      
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       546   0.0      
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          548   0.0      
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type          547   0.0      
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             547   0.0      
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like     546   0.0      
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...    548   0.0      
emb|CAN61424.1|  hypothetical protein VITISV_027272                     548   0.0      Vitis vinifera
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          547   0.0      Vitis vinifera
ref|XP_010097155.1|  ATPase 9, plasma membrane-type                     545   0.0      
gb|AAV49159.1|  plasma membrane proton ATPase 5                         545   0.0      Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002309321.1|  ATPase 6 family protein                            546   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     545   0.0      
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                545   0.0      
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...    545   0.0      
ref|XP_010468541.1|  PREDICTED: ATPase 6, plasma membrane-type-like     540   0.0      
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    543   0.0      
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like     543   0.0      
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like     542   0.0      
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          543   0.0      
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     543   0.0      
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        543   0.0      Lilium longiflorum [Easter lily]
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          543   0.0      
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    542   0.0      
ref|XP_004287218.1|  PREDICTED: ATPase 8, plasma membrane-type-like     542   0.0      
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          542   0.0      
ref|XP_010431653.1|  PREDICTED: ATPase 9, plasma membrane-type-like     531   0.0      
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          542   0.0      
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          542   0.0      
gb|AAR32129.2|  proton P-ATPase                                         542   0.0      Nicotiana tabacum [American tobacco]
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     541   0.0      
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg             541   0.0      
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     541   0.0      
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like     541   0.0      
ref|XP_007138427.1|  hypothetical protein PHAVU_009G208000g             538   0.0      
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          540   0.0      
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     540   0.0      
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    539   0.0      
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    539   0.0      
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     540   0.0      
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     540   0.0      
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     539   0.0      
ref|NP_178762.1|  H(+)-ATPase 6                                         539   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAA98916.1|  Theoretical protein with similarity to Swiss-Prot...    536   0.0      
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...    537   0.0      
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     539   0.0      
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             539   0.0      
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     539   0.0      
ref|XP_004251768.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    538   0.0      
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                    538   0.0      
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         538   0.0      
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          538   0.0      
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             538   0.0      
ref|XP_007023380.1|  H(+)-ATPase 9                                      538   0.0      
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    538   0.0      
ref|XP_004159431.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 8, pl...    537   0.0      
ref|XP_006350073.1|  PREDICTED: ATPase 8, plasma membrane-type-like     537   0.0      
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             538   0.0      
gb|KEH32174.1|  plasma membrane H+-ATPase                               538   0.0      
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     537   0.0      
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           538   0.0      
gb|EPS57651.1|  hypothetical protein M569_17165                         538   0.0      
ref|XP_004139271.1|  PREDICTED: ATPase 8, plasma membrane-type-like     536   0.0      
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     537   0.0      
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    537   0.0      
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     537   0.0      
ref|XP_004508384.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    534   0.0      
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             536   0.0      
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     536   0.0      
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type-like     536   0.0      
ref|XP_002324564.1|  ATPase 6 family protein                            536   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             536   0.0      
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   536   0.0      
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          536   0.0      
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             536   0.0      
ref|XP_002307856.1|  ATPase 6 family protein                            536   1e-180   Populus trichocarpa [western balsam poplar]
ref|NP_189850.1|  H(+)-ATPase 8                                         536   1e-180   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     536   1e-180   
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           536   1e-180   
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          535   1e-180   
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    533   2e-180   
ref|XP_007023381.1|  H(+)-ATPase 9                                      535   2e-180   
ref|XP_007012006.1|  H(+)-ATPase 8                                      535   2e-180   
ref|XP_010417679.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    535   2e-180   
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                 533   2e-180   
gb|AAK31799.2|  plasma membrane H+ ATPase                               535   2e-180   Lilium longiflorum [Easter lily]
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4                535   2e-180   
gb|KHN01287.1|  Plasma membrane ATPase 4                                533   3e-180   
gb|KEH39623.1|  plasma membrane H+-ATPase                               535   3e-180   
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    535   3e-180   
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    534   4e-180   
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    535   4e-180   
ref|NP_178181.1|  H(+)-ATPase 9                                         534   5e-180   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472895.1|  PREDICTED: ATPase 9, plasma membrane-type is...    535   6e-180   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             534   6e-180   
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             534   7e-180   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    533   7e-180   
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    533   8e-180   
gb|KEH37844.1|  plasma membrane H+-ATPase                               532   9e-180   
gb|ABA18112.1|  putative plasma membrane ATPase                         533   9e-180   Arabidopsis arenosa
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          533   1e-179   
gb|KHN18583.1|  ATPase 8, plasma membrane-type                          532   1e-179   
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...    534   1e-179   
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           533   1e-179   
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           533   1e-179   
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     533   1e-179   
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    533   2e-179   
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    533   2e-179   
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 533   2e-179   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     533   2e-179   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             533   2e-179   
gb|AAD46186.1|  plasma membrane proton ATPase                           533   2e-179   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CDP14278.1|  unnamed protein product                                542   2e-179   
ref|XP_006341374.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    533   2e-179   
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 531   2e-179   
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like           532   3e-179   
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like           532   3e-179   
ref|XP_008776221.1|  PREDICTED: ATPase 8, plasma membrane-type-like     530   4e-179   
gb|KDP38637.1|  hypothetical protein JCGZ_03990                         531   4e-179   
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             531   8e-179   
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             531   8e-179   
emb|CAN64375.1|  hypothetical protein VITISV_014422                     531   9e-179   Vitis vinifera
gb|ABA18090.1|  putative plasma membrane ATPase                         531   1e-178   Olimarabidopsis pumila
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                531   1e-178   Vitis vinifera
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          532   1e-178   
ref|XP_006597964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     528   1e-178   
gb|KHN18251.1|  ATPase 8, plasma membrane-type                          528   1e-178   
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           530   2e-178   
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          530   2e-178   
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             530   2e-178   
ref|XP_009773901.1|  PREDICTED: plasma membrane ATPase 4-like           530   2e-178   
emb|CAN78639.1|  hypothetical protein VITISV_031738                     530   3e-178   Vitis vinifera
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             529   3e-178   
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                530   3e-178   
gb|AAB17186.1|  plasma membrane H+-ATPase                               529   3e-178   Solanum lycopersicum
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    529   3e-178   
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             529   3e-178   Vitis vinifera
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                529   4e-178   
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             529   4e-178   
gb|KHN38020.1|  Plasma membrane ATPase                                  527   5e-178   
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    529   7e-178   
gb|KDO67286.1|  hypothetical protein CISIN_1g002203mg                   519   9e-178   
ref|XP_002437958.1|  hypothetical protein SORBIDRAFT_10g005500          526   1e-177   Sorghum bicolor [broomcorn]
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     526   1e-177   
emb|CBI35956.3|  unnamed protein product                                528   2e-177   
ref|XP_007011593.1|  Plasma membrane ATPase 4 isoform 2                 518   3e-177   
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      527   3e-177   
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  527   4e-177   
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     522   4e-177   
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           526   4e-177   
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           527   4e-177   
gb|KHN22097.1|  ATPase 8, plasma membrane-type                          533   4e-177   
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  526   4e-177   
ref|XP_010227956.1|  PREDICTED: ATPase 6, plasma membrane-type-li...    523   4e-177   
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     526   5e-177   
ref|XP_008658955.1|  PREDICTED: uncharacterized protein LOC100501...    523   5e-177   
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    526   5e-177   
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...    526   7e-177   
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    526   7e-177   
gb|AEO22063.1|  plasma membrane H+-ATPase                               526   7e-177   
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                526   9e-177   
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             526   9e-177   
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          525   1e-176   
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           525   1e-176   
gb|AAB84202.2|  plasma membrane proton ATPase                           525   1e-176   Kosteletzkya virginica [seashore mallow]
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             523   2e-176   
gb|KHN15309.1|  Plasma membrane ATPase 4                                525   2e-176   
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    525   2e-176   
gb|EMS46830.1|  ATPase 9, plasma membrane-type                          516   2e-176   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           525   2e-176   
ref|XP_003564205.1|  PREDICTED: ATPase 6, plasma membrane-type-li...    525   2e-176   
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    524   2e-176   
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           525   2e-176   
gb|AAB41898.1|  H+-transporting ATPase                                  525   3e-176   Mesembryanthemum crystallinum
dbj|BAL41366.1|  plasma membrane H+-ATPase                              524   4e-176   
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           524   4e-176   
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     524   4e-176   
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    524   4e-176   
gb|KEH39757.1|  plasma membrane H+-ATPase                               520   4e-176   
gb|AAY42949.1|  plasma membrane H+ ATPase                               524   4e-176   Lupinus albus
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    522   4e-176   
gb|KHN22686.1|  Plasma membrane ATPase 4                                524   4e-176   
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           524   4e-176   
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    522   5e-176   
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             524   5e-176   
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                524   6e-176   
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         523   6e-176   
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                   520   7e-176   
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like     523   8e-176   
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           523   9e-176   
gb|KHN17608.1|  Plasma membrane ATPase 4                                523   1e-175   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             523   1e-175   
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             523   1e-175   
dbj|BAG94605.1|  unnamed protein product                                521   1e-175   Oryza sativa Japonica Group [Japonica rice]
gb|AFM52333.1|  plasma membrane H+-ATPase                               523   1e-175   
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   523   1e-175   
gb|KEH39753.1|  plasma membrane H+-ATPase                               523   1e-175   
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          523   1e-175   
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                   521   1e-175   
emb|CAC29436.1|  P-type H+-ATPase                                       523   2e-175   Vicia faba [broad bean]
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like           523   2e-175   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                523   2e-175   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                522   2e-175   
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  522   2e-175   
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  522   2e-175   
gb|AEQ27822.1|  PM H+-ATPase R                                          522   2e-175   
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     522   3e-175   
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     522   3e-175   
gb|ACL54575.1|  unknown                                                 522   3e-175   Zea mays [maize]
ref|NP_001054118.1|  Os04g0656100                                       521   4e-175   Oryza sativa Japonica Group [Japonica rice]
gb|KEH39758.1|  plasma membrane H+-ATPase                               521   4e-175   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          521   4e-175   Oryza sativa Japonica Group [Japonica rice]
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                   520   4e-175   
ref|XP_004966679.1|  PREDICTED: ATPase 6, plasma membrane-type-like     520   4e-175   
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             521   4e-175   
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          521   4e-175   
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                   520   4e-175   
ref|NP_200545.1|  H(+)-ATPase 3                                         521   4e-175   Arabidopsis thaliana [mouse-ear cress]
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         521   5e-175   
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             521   5e-175   
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 521   6e-175   
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          521   6e-175   Sorghum bicolor [broomcorn]
gb|AAL09726.1|  AT5g57350/MJB24_16                                      521   6e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    521   6e-175   
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          521   6e-175   
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     521   6e-175   
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             521   6e-175   
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           521   7e-175   
ref|XP_010094202.1|  Plasma membrane ATPase 4                           521   7e-175   
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             521   8e-175   
dbj|BAH56991.1|  AT4G30190                                              516   8e-175   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002438748.1|  hypothetical protein SORBIDRAFT_10g025470          521   9e-175   Sorghum bicolor [broomcorn]
emb|CAB69823.1|  plasma membrane H+ ATPase                              521   9e-175   Prunus persica
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          521   9e-175   
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...    518   9e-175   
dbj|BAD19091.1|  putative H+-exporting ATPase                           520   9e-175   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             521   1e-174   
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             520   1e-174   
gb|KEH35952.1|  plasma membrane H+-ATPase                               520   1e-174   
gb|KEH19962.1|  plasma membrane H+-ATPase                               520   1e-174   
ref|NP_001048395.2|  Os02g0797300                                       520   1e-174   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                520   1e-174   Vitis vinifera
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           520   1e-174   
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                520   2e-174   
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    520   2e-174   
dbj|BAF03589.1|  P-type H+-ATPase                                       520   2e-174   Zostera marina
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    520   2e-174   
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4                520   2e-174   
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           520   2e-174   
emb|CAD29312.1|  plasma membrane H+-ATPase                              519   2e-174   Oryza sativa [red rice]
gb|KHN16462.1|  Plasma membrane ATPase 4                                520   2e-174   
gb|KFK29576.1|  h(+)-atpase 2                                           519   2e-174   
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      520   2e-174   
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g             517   3e-174   
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                520   3e-174   
ref|XP_008659774.1|  PREDICTED: plasma membrane ATPase 4-like           519   3e-174   
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                519   3e-174   
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    519   3e-174   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010111939.1|  Plasma membrane ATPase 4                           518   3e-174   
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like     518   3e-174   
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          519   3e-174   
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       519   4e-174   
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like           519   4e-174   
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    519   4e-174   
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          519   4e-174   
dbj|BAC77531.1|  plasma membrane H+-ATPase                              519   4e-174   
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             519   4e-174   
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    519   4e-174   
ref|NP_194748.1|  H(+)-ATPase 2                                         519   4e-174   
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    518   4e-174   
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...    518   5e-174   
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          519   5e-174   
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     519   6e-174   
ref|NP_001190870.1|  H(+)-ATPase 2                                      519   6e-174   
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             518   6e-174   
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          518   6e-174   
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           518   7e-174   
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           518   7e-174   
ref|XP_008649034.1|  PREDICTED: ATPase 2, plasma membrane-type-like     518   7e-174   
ref|XP_010691624.1|  PREDICTED: ATPase 9, plasma membrane-type is...    518   7e-174   
gb|ACE77057.1|  plasma membrane proton pump                             518   8e-174   
ref|XP_002452983.1|  hypothetical protein SORBIDRAFT_04g036040          518   8e-174   
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     518   8e-174   
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4                516   9e-174   
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             518   9e-174   
ref|NP_001056980.1|  Os06g0181500                                       515   1e-173   
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           518   1e-173   
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     518   1e-173   
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             518   1e-173   
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    518   1e-173   
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     518   1e-173   
emb|CDX72217.1|  BnaC07g42390D                                          516   1e-173   
emb|CDY14186.1|  BnaA08g13170D                                          517   1e-173   
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          518   1e-173   
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             518   1e-173   
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       518   1e-173   
ref|XP_006654259.1|  PREDICTED: plasma membrane ATPase 4-like           517   1e-173   
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           518   1e-173   
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             518   1e-173   
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           517   2e-173   
ref|XP_006382164.1|  H+-ATPase family protein                           518   2e-173   
dbj|BAD72314.1|  plasma membrane H+-ATPase                              515   2e-173   
emb|CAD29316.1|  plasma membrane H+-ATPase                              514   2e-173   
ref|XP_010313836.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    516   2e-173   
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           517   2e-173   
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          517   2e-173   
emb|CDY51650.1|  BnaAnng10900D                                          516   2e-173   
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       517   2e-173   
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     518   2e-173   
gb|AAY42948.1|  plasma membrane H+ ATPase                               517   2e-173   
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...    517   3e-173   
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     516   3e-173   
gb|AAV44084.1|  putative plasma membrane H+ ATPase                      515   5e-173   
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                516   5e-173   
dbj|BAK05828.1|  predicted protein                                      516   5e-173   
emb|CDY51651.1|  BnaAnng10910D                                          514   5e-173   
ref|NP_179486.1|  H(+)-ATPase 1                                         516   8e-173   
ref|NP_001185450.1|  H(+)-ATPase 9                                      515   8e-173   
dbj|BAD16688.1|  plasma membrane H+-ATPase                              515   8e-173   
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             516   9e-173   
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           515   9e-173   
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           515   9e-173   
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           515   9e-173   
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4-like           515   1e-172   
emb|CAA59799.1|  H(+)-transporting ATPase                               515   1e-172   
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   515   1e-172   
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    514   1e-172   
emb|CDP02997.1|  unnamed protein product                                515   1e-172   
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    515   1e-172   
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       515   1e-172   
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    515   1e-172   
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                515   2e-172   
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type          514   2e-172   
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             515   2e-172   
emb|CDO98206.1|  unnamed protein product                                515   2e-172   
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    515   2e-172   
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           514   2e-172   
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like     514   2e-172   
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                514   2e-172   
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       515   3e-172   
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  514   3e-172   
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             514   3e-172   
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     514   3e-172   
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    514   3e-172   
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like           516   4e-172   
gb|AAN15220.1|  plasma membrane P-type proton pump ATPase               514   4e-172   
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             513   5e-172   
emb|CDY67153.1|  BnaAnng23670D                                          513   5e-172   
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like             513   6e-172   
emb|CAD29313.1|  plasma membrane H+-ATPase                              513   6e-172   
gb|AHK23067.1|  plasma membrane ATPase 4                                513   7e-172   
emb|CDY30730.1|  BnaA02g33520D                                          508   7e-172   
emb|CDX72218.1|  BnaC07g42400D                                          512   7e-172   
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          513   8e-172   
emb|CDY69631.1|  BnaCnng64550D                                          499   8e-172   
gb|AAV71150.1|  plasma membrane H+-ATPase                               513   1e-171   
gb|EMT26270.1|  Plasma membrane ATPase                                  513   1e-171   
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    513   1e-171   
gb|ABW25091.1|  plasma membrane proton pump                             512   2e-171   
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                512   2e-171   
ref|NP_001055186.1|  Os05g0319800                                       514   2e-171   
ref|XP_011034499.1|  PREDICTED: plasma membrane ATPase 4-like           512   2e-171   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             511   3e-171   
dbj|BAA37150.1|  p-type H+-ATPase                                       511   3e-171   
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    511   3e-171   
gb|ABR18001.1|  unknown                                                 511   4e-171   
ref|XP_010273791.1|  PREDICTED: plasma membrane ATPase-like isofo...    509   4e-171   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  511   4e-171   
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          511   4e-171   
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                511   5e-171   
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    511   5e-171   
ref|XP_006401213.1|  hypothetical protein EUTSA_v10015530mg             510   5e-171   
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    511   8e-171   
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             510   8e-171   
emb|CDY47940.1|  BnaA02g08160D                                          510   1e-170   
emb|CBW30173.1|  Plasma membrane ATPase 4                               510   1e-170   
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                510   1e-170   
ref|XP_008346827.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    497   1e-170   
emb|CAD29297.1|  plasma membrane H+ ATPase                              510   1e-170   
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           510   1e-170   
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    511   1e-170   
ref|XP_002864812.1|  AHA11-ATPASE 11                                    509   2e-170   
emb|CBW30211.1|  Plasma membrane ATPase                                 509   2e-170   
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like             509   2e-170   
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like             509   2e-170   
gb|EPS65442.1|  hypothetical protein M569_09334                         509   3e-170   
gb|EPS73574.1|  hypothetical protein M569_01174                         502   3e-170   
dbj|BAD16684.1|  plasma membrane H+-ATPase                              509   3e-170   
gb|AFW76177.1|  hypothetical protein ZEAMMB73_418989                    508   3e-170   
gb|AAY42950.1|  plasma membrane H+ ATPase                               509   4e-170   
ref|XP_010273789.1|  PREDICTED: ATPase 10, plasma membrane-type-l...    508   4e-170   
ref|NP_201073.1|  H(+)-ATPase 11                                        509   4e-170   
dbj|BAO45902.1|  plasma membrane H+-ATPase                              508   4e-170   
gb|KFK27283.1|  h(+)-atpase 3                                           508   5e-170   
gb|EPS66977.1|  hypothetical protein M569_07799                         508   5e-170   
emb|CAB41144.1|  H+-transporting ATPase-like protein                    508   5e-170   
ref|XP_003594954.1|  Plasma membrane ATPase                             508   5e-170   
dbj|BAD16685.1|  plasma membrane H+-ATPase                              508   6e-170   
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    508   7e-170   
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             508   7e-170   
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    508   8e-170   
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type          508   8e-170   
ref|NP_190378.2|  H(+)-ATPase 4                                         508   8e-170   
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    508   8e-170   
ref|XP_006293643.1|  hypothetical protein CARUB_v10022598mg             507   1e-169   
dbj|BAM20989.1|  plasma membrane H+-ATPase                              508   1e-169   
gb|EEC78976.1|  hypothetical protein OsI_19456                          508   1e-169   
gb|EMS60594.1|  Plasma membrane ATPase                                  508   1e-169   
emb|CDY25913.1|  BnaC09g32850D                                          507   1e-169   
ref|XP_008341531.1|  PREDICTED: plasma membrane ATPase 1-like           507   2e-169   
ref|XP_002304716.2|  H+-ATPase family protein                           508   2e-169   
emb|CDY45757.1|  BnaC02g42250D                                          507   2e-169   
emb|CDY38294.1|  BnaA10g11420D                                          507   2e-169   
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           506   3e-169   
dbj|BAD16687.1|  plasma membrane H+-ATPase                              506   3e-169   
ref|XP_009335819.1|  PREDICTED: plasma membrane ATPase 1-like           506   3e-169   
ref|XP_007217692.1|  hypothetical protein PRUPE_ppa000950mg             506   3e-169   
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                506   3e-169   
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    506   3e-169   
gb|AFW04239.1|  plasma membrane H+-ATPase                               506   4e-169   
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like    506   4e-169   
ref|XP_010937233.1|  PREDICTED: ATPase 10, plasma membrane-type i...    502   4e-169   
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           506   5e-169   
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             506   6e-169   
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                506   6e-169   
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg                506   6e-169   
gb|KCW56159.1|  hypothetical protein EUGRSUZ_I01911                     506   7e-169   
ref|XP_008342517.1|  PREDICTED: ATPase 10, plasma membrane-type         505   7e-169   
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         505   9e-169   
ref|XP_008228092.1|  PREDICTED: ATPase 10, plasma membrane-type         505   9e-169   
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    505   1e-168   
gb|AEQ27823.1|  PM H+-ATPase L                                          505   1e-168   
ref|XP_011082991.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    505   1e-168   
ref|XP_009398402.1|  PREDICTED: plasma membrane ATPase 1-like           505   1e-168   
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          505   1e-168   
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg             505   1e-168   
tpg|DAA54787.1|  TPA: hypothetical protein ZEAMMB73_074525              500   1e-168   
ref|XP_009398401.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     505   1e-168   
ref|XP_010029522.1|  PREDICTED: ATPase 10, plasma membrane-type         504   2e-168   
gb|KDO76027.1|  hypothetical protein CISIN_1g005866mg                   495   2e-168   
ref|XP_010937232.1|  PREDICTED: ATPase 10, plasma membrane-type i...    502   2e-168   
gb|KDO76029.1|  hypothetical protein CISIN_1g005866mg                   495   2e-168   
ref|XP_010685193.1|  PREDICTED: ATPase 10, plasma membrane-type i...    501   3e-168   
dbj|BAC77530.1|  plasma membrane H+-ATPase                              504   3e-168   
gb|EYU24620.1|  hypothetical protein MIMGU_mgv1a001404mg                500   3e-168   
ref|XP_010053511.1|  PREDICTED: ATPase 11, plasma membrane-type-like    504   3e-168   
ref|XP_009398400.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     504   3e-168   
ref|XP_010539792.1|  PREDICTED: ATPase 3, plasma membrane-type-like     503   4e-168   
gb|KEH31901.1|  plasma membrane H+-ATPase                               504   4e-168   
ref|XP_010429431.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    497   4e-168   
emb|CAN80223.1|  hypothetical protein VITISV_027896                     503   4e-168   
gb|EAZ21357.1|  hypothetical protein OsJ_37014                          503   5e-168   
gb|EEC69747.1|  hypothetical protein OsI_39279                          503   5e-168   
ref|XP_004508788.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    503   6e-168   
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like           503   7e-168   
gb|EYU35893.1|  hypothetical protein MIMGU_mgv1a0008591mg               494   7e-168   
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    503   8e-168   
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    503   8e-168   
emb|CDP14881.1|  unnamed protein product                                503   9e-168   
ref|XP_010654358.1|  PREDICTED: ATPase 10, plasma membrane-type         503   9e-168   
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    503   1e-167   
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     503   1e-167   
ref|XP_004508787.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    503   1e-167   
ref|XP_010937229.1|  PREDICTED: ATPase 10, plasma membrane-type i...    502   1e-167   
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           502   1e-167   
gb|KDO72464.1|  hypothetical protein CISIN_1g0021762mg                  499   1e-167   
ref|NP_001067382.1|  Os12g0638700                                       502   1e-167   
gb|KFK32649.1|  hypothetical protein AALP_AA6G270500                    498   2e-167   
ref|XP_006595243.1|  PREDICTED: plasma membrane ATPase 1-like           501   2e-167   
ref|XP_003578172.1|  PREDICTED: plasma membrane ATPase 1                502   2e-167   
ref|XP_003554288.1|  PREDICTED: plasma membrane ATPase 1-like           502   2e-167   
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3                501   2e-167   
ref|XP_002533320.1|  H(\+)-transporting atpase plant/fungi plasma...    495   2e-167   
gb|EPS63245.1|  hypothetical protein M569_11541                         501   2e-167   
gb|KCW83495.1|  hypothetical protein EUGRSUZ_B00400                     501   2e-167   
ref|XP_010685192.1|  PREDICTED: ATPase 10, plasma membrane-type i...    501   3e-167   
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           501   3e-167   
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          501   3e-167   
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type         501   3e-167   
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                501   3e-167   
emb|CDY62140.1|  BnaCnng39300D                                          493   4e-167   
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                501   4e-167   
gb|KDP40607.1|  hypothetical protein JCGZ_24606                         501   4e-167   
dbj|BAJ34124.1|  unnamed protein product                                501   4e-167   
gb|KHN13245.1|  Plasma membrane ATPase 1                                501   5e-167   



>ref|XP_008443886.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis melo]
Length=948

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/300 (89%), Positives = 283/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEI+VM+PIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAVGMVIEILVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVFV +  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVPNMDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  ARASRVENQDAIDACIVGML DPKEARAGI EVHFLPFNPVDKRTAITYIDS G
Sbjct  359  TVMLFAARASRVENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDSDG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII+LCEL+GE  +KAHEIIDN+ANRGLRSLAVGRQ+V +K KES G P
Sbjct  419  NWHRSSKGAPEQIIDLCELKGEIRRKAHEIIDNYANRGLRSLAVGRQTVKDKDKESAGEP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>ref|XP_010687728.1| PREDICTED: ATPase 8, plasma membrane-type-like [Beta vulgaris 
subsp. vulgaris]
Length=954

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/300 (87%), Positives = 289/300 (96%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCI SI VG++IEI+VMFPIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTSIGNFCIISIVVGMVIEIIVMFPIQHRRYREGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D  +D
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKALIEVFTKDVDRD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
            +++LLGARASRVENQDAIDACIVGMLSDPKEARAGI+E+HFLPFNPV+KRTAITYIDS+G
Sbjct  362  NLVLLGARASRVENQDAIDACIVGMLSDPKEARAGIEEIHFLPFNPVEKRTAITYIDSNG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +W+RVSKGAPEQIIELC+L+GE +KKAH +ID++A+RGLRSLAV RQSVPEKTKES G P
Sbjct  422  NWYRVSKGAPEQIIELCDLKGEIMKKAHAVIDSYADRGLRSLAVARQSVPEKTKESAGSP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  541



>ref|XP_011084027.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/300 (87%), Positives = 284/300 (95%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCICSIA+G++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QQVLTAIGNFCICSIALGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++A KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR+ENQDAIDA IV ML DPKEARAGI EVHFLPFNPV+KRTAITY DS+G
Sbjct  360  TVVLLAARASRIENQDAIDASIVNMLGDPKEARAGIIEVHFLPFNPVEKRTAITYYDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+GETLK+AHEIIDNFANRGLRSL V RQ++PEK KES G P
Sbjct  420  NWHRCSKGAPEQIIELCELKGETLKRAHEIIDNFANRGLRSLGVARQTIPEKNKESAGGP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETIK+A++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_010520558.1| PREDICTED: ATPase 8, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/300 (87%), Positives = 284/300 (95%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIEIV+M+P+QHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIAVGMLIEIVIMYPVQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D   D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDLDAD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAIDACIVGMLSDPKEARAGI E+HFLPFNPV+KRTA TY+D++G
Sbjct  360  SVLLHAARASRVENQDAIDACIVGMLSDPKEARAGITELHFLPFNPVEKRTANTYVDANG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LCEL+GETLKKAHE+ID++A RGLRSLA+ RQ+VPEKTKES G P
Sbjct  420  DWHRSSKGAPEQIIDLCELKGETLKKAHEVIDSYAERGLRSLAIARQTVPEKTKESVGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIG ETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSSS  539



>ref|XP_004146701.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004165941.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=948

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/300 (88%), Positives = 282/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEI+VM+PIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAVGMVIEILVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVFV +  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVPNMDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  ARASRVENQDAIDACIVGML DPKEARAGI EVHFLPFNPV+KRTAITYID  G
Sbjct  359  TVMLFAARASRVENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDGDG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII+LCEL+GE  +KAHEIIDN+ANRGLRSLAVGRQ+V +K KES G P
Sbjct  419  NWHRSSKGAPEQIIDLCELKGEIRRKAHEIIDNYANRGLRSLAVGRQTVKDKDKESAGEP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/300 (88%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+LIE+VVM+PIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  238  QKVLTSIGNFCICSIAVGMLIEVVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVT  297

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVF Q+A +D
Sbjct  298  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFPQNADQD  357

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASRVENQDAIDA IV ML DPKEARAGI EVHFLPFNPVDKRTAITY D+ G
Sbjct  358  TVLLLAARASRVENQDAIDASIVNMLDDPKEARAGITEVHFLPFNPVDKRTAITYYDTDG  417

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+GE LK+AHEIIDNFANRGLRSL V RQ+V EKTKES G  
Sbjct  418  NWHRCSKGAPEQIIELCELKGEVLKRAHEIIDNFANRGLRSLGVARQTVSEKTKESAGDS  477

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  478  WEFVGLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  537



>ref|XP_011084025.1| PREDICTED: ATPase 8, plasma membrane-type [Sesamum indicum]
Length=949

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/300 (87%), Positives = 284/300 (95%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIALGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++A KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR+ENQDAIDA IV ML DPKEARAGI EVHFLPFNPV+KRTAITY DS+G
Sbjct  360  TVVLLAARASRIENQDAIDASIVNMLGDPKEARAGIIEVHFLPFNPVEKRTAITYYDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+GETLK+AHEIIDNFANRGLRSL V RQ++PEK KES G P
Sbjct  420  NWHRCSKGAPEQIIELCELKGETLKRAHEIIDNFANRGLRSLGVARQTIPEKNKESAGGP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETIK+A++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_011084028.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/300 (87%), Positives = 284/300 (95%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIALGMIIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++A KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IV MLSDPKEARAGI EVHFLPFNPVDKRTAITY DS+G
Sbjct  360  TVILLAARASRTENQDAIDASIVNMLSDPKEARAGIIEVHFLPFNPVDKRTAITYYDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC+L+G+ LK+AHEIIDNFANRGLRSLAV RQ++PEK KES G P
Sbjct  420  NWHRCSKGAPEQIIELCQLKGDNLKRAHEIIDNFANRGLRSLAVARQTIPEKNKESAGDP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETIK+A++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  539



>ref|XP_011084026.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/300 (87%), Positives = 285/300 (95%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIALGMIIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++A KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR+ENQDAIDA IV ML DPKEARAGI EVHFLPFNPVDKRTAITY DS+G
Sbjct  360  TVVLLAARASRIENQDAIDASIVNMLGDPKEARAGIIEVHFLPFNPVDKRTAITYYDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC+L+G+TLK+AHEIIDNFANRGLRSLAV RQ++PEK KES G P
Sbjct  420  NWHRCSKGAPEQIIELCKLKGDTLKRAHEIIDNFANRGLRSLAVARQTIPEKNKESEGDP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETIK+A+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIKKALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  539



>ref|XP_008228760.1| PREDICTED: ATPase 9, plasma membrane-type [Prunus mume]
Length=954

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/300 (87%), Positives = 283/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAIGMIIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++VEVFV+D  KD
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++LLGARASRVENQDAID CIVGML DPKEAR GI EVHFLPFNPV+KRTAITYIDS G
Sbjct  362  GLILLGARASRVENQDAIDTCIVGMLGDPKEAREGITEVHFLPFNPVEKRTAITYIDSEG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L+G+ +KKAH IID FA+RGLRSLAV RQ+VPEK+KES G P
Sbjct  422  NWHRVSKGAPEQIIELCNLKGDPMKKAHAIIDKFADRGLRSLAVARQTVPEKSKESPGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  541



>ref|XP_011033475.1| PREDICTED: ATPase 8, plasma membrane-type [Populus euphratica]
Length=949

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/300 (87%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+EI+VM+PIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAIGMLVEIIVMYPIQHRRYREGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF++D  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFIKDTDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++LL ARASR+ENQDAIDA IVGML DPKEARA I EVHFLPFNPV+KRTAITY D++G
Sbjct  359  TLVLLAARASRIENQDAIDASIVGMLGDPKEARAEITEVHFLPFNPVEKRTAITYYDNNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELC L+GET KKAHEIIDNFA RGLRSL V RQ +PEKTKES G P
Sbjct  419  DWHRSSKGAPEQIIELCNLKGETKKKAHEIIDNFAERGLRSLGVARQRIPEKTKESEGAP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>ref|XP_011078615.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X2 [Sesamum 
indicum]
Length=932

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/300 (86%), Positives = 282/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLT+IGNFCICSIA+G+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QQVLTSIGNFCICSIALGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF +    D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPKGVDAD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR+ENQDAIDA IV MLSDPKEARAGI EVHFLPFNPV+KRTAITY D++G
Sbjct  360  TVVLLAARASRIENQDAIDASIVNMLSDPKEARAGITEVHFLPFNPVEKRTAITYYDNNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELCEL+GE L+KAHEIIDNFANRGLRSL V RQ++PEKTKES G P
Sbjct  420  DWHRCSKGAPEQIIELCELKGENLRKAHEIIDNFANRGLRSLGVARQTIPEKTKESAGGP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  539



>emb|CDX93092.1| BnaA03g38140D [Brassica napus]
Length=949

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/300 (87%), Positives = 280/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q VLTAIGNFCICSIA+G+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QTVLTAIGNFCICSIAIGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++A KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFCKNADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIV ML DPKEARAGI EVHFLPFNPV+KRTAITYID  G
Sbjct  360  TVILLSARASRVENQDAIDACIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDGSG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII LC+L+GE LK+AH+IID FA RGLRSL VGRQ+VPEK KES G P
Sbjct  420  DWHRCSKGAPEQIISLCDLKGEALKRAHDIIDKFAERGLRSLGVGRQTVPEKDKESAGTP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>emb|CDY50939.1| BnaC03g74390D [Brassica napus]
Length=949

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/300 (87%), Positives = 280/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q VLTAIGNFCICSIA+G+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QTVLTAIGNFCICSIAIGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++A KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFCKNADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIV ML DPKEARAGI EVHFLPFNPV+KRTAITYID  G
Sbjct  360  TVILLSARASRVENQDAIDACIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDGSG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII LC+L+GE LK+AH+IID FA RGLRSL VGRQ+VPEK KES G P
Sbjct  420  DWHRCSKGAPEQIISLCDLKGEALKRAHDIIDKFAERGLRSLGVGRQTVPEKDKESAGTP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_010103366.1| ATPase 8, plasma membrane-type [Morus notabilis]
 gb|EXB95573.1| ATPase 8, plasma membrane-type [Morus notabilis]
Length=948

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/300 (86%), Positives = 283/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEI+VM+PIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIALGMVIEIIVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF +DA KD
Sbjct  299  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFSKDADKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +++L ARASRVENQDAIDA IVGMLSDPKEARAGI E+HFLPFNPVDKRTAITY D++G
Sbjct  359  TLIVLAARASRVENQDAIDASIVGMLSDPKEARAGITEIHFLPFNPVDKRTAITYTDNNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LC+L+GE   KAH IIDN+A RGLRSLAV +Q++PEKTKES G P
Sbjct  419  DWHRCSKGAPEQIIDLCDLKGEKRTKAHAIIDNYAERGLRSLAVAQQTIPEKTKESAGSP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>ref|XP_011078614.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X1 [Sesamum 
indicum]
Length=952

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/300 (86%), Positives = 282/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLT+IGNFCICSIA+G+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QQVLTSIGNFCICSIALGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF +    D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPKGVDAD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR+ENQDAIDA IV MLSDPKEARAGI EVHFLPFNPV+KRTAITY D++G
Sbjct  360  TVVLLAARASRIENQDAIDASIVNMLSDPKEARAGITEVHFLPFNPVEKRTAITYYDNNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELCEL+GE L+KAHEIIDNFANRGLRSL V RQ++PEKTKES G P
Sbjct  420  DWHRCSKGAPEQIIELCELKGENLRKAHEIIDNFANRGLRSLGVARQTIPEKTKESAGGP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  539



>gb|KGN52915.1| hypothetical protein Csa_4G006220 [Cucumis sativus]
Length=890

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/300 (87%), Positives = 283/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEIVVM+PIQHR YR+GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  178  QKVLTAIGNFCICSIAMGMVIEIVVMYPIQHRRYRDGINNLLVLLIGGIPIAMPTVLSVT  237

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS++EVFV+D  KD
Sbjct  238  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKD  297

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
            +++LLGARASRVENQDAIDACIVGML DPKEAR GI+EVHFLPFNPVDKRTAIT+ID+ G
Sbjct  298  NLVLLGARASRVENQDAIDACIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITFIDNDG  357

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHRVSKGAPEQIIELC+L  +  KKAH IID FA+RGLRSLAV RQ+VPEKTKES G P
Sbjct  358  SWHRVSKGAPEQIIELCDLREDIKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGP  417

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  418  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  477



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/300 (87%), Positives = 284/300 (95%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEIVVM+PIQHR YR+GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIALGMVIEIVVMYPIQHRRYRDGINNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS++EVFV+D  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
            +++LLGARASRVENQDAIDACIVGML DPKEAR GI+EVHFLPFNPVDKRTAITYID+ G
Sbjct  359  NLVLLGARASRVENQDAIDACIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITYIDNDG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC+L  +  KKAH IID FA+RGLRSLAV RQ+VPEKTKES G P
Sbjct  419  NWHRVSKGAPEQIIELCDLRDDIKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>ref|XP_008384624.1| PREDICTED: ATPase 8, plasma membrane-type [Malus domestica]
Length=947

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/300 (87%), Positives = 283/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTSIGNFCICSIAVGMVIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF ++  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPKNVDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA IV ML+DPKEARAGI EVHFLPFNPVDKRTAITYID++G
Sbjct  359  XVVLLSARASRVENQDAIDASIVNMLADPKEARAGITEVHFLPFNPVDKRTAITYIDANG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LC+L+GET KKAH +IDN+A RGLRSL V RQ+VPEKTKES G P
Sbjct  419  DWHRCSKGAPEQIIDLCDLKGETRKKAHAVIDNYAERGLRSLGVARQTVPEKTKESAGSP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  538



>ref|XP_007217150.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
 gb|EMJ18349.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
Length=954

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/300 (87%), Positives = 282/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAIGMIIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++VEVFV+D  KD
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++LLGARASRVENQDAID CIVGML DPKEAR GI EVHFLPFNPV+KRTAITYIDS G
Sbjct  362  GLILLGARASRVENQDAIDTCIVGMLGDPKEAREGITEVHFLPFNPVEKRTAITYIDSEG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L+G+ +KKAH II  FA+RGLRSLAV RQ+VPEK+KES G P
Sbjct  422  NWHRVSKGAPEQIIELCNLKGDPMKKAHAIIGKFADRGLRSLAVARQTVPEKSKESPGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  541



>ref|XP_009775735.1| PREDICTED: ATPase 9, plasma membrane-type-like [Nicotiana sylvestris]
Length=925

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSI VG++IEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIVVGIVIEILVMWPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++A KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIV ML+DPKEAR GIQEVHF PFNPVDKRTAITYID  G
Sbjct  360  TVMLLAARASRVENQDAIDACIVNMLNDPKEAREGIQEVHFFPFNPVDKRTAITYIDESG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC+L+G+ LKKAHEIIDNFANRGLRSL V RQ+VPEK K+S G P
Sbjct  420  NWHRASKGAPEQIIELCDLKGDVLKKAHEIIDNFANRGLRSLGVARQTVPEKNKDSAGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  539



>ref|XP_009136182.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 6, plasma membrane-type 
[Brassica rapa]
Length=980

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/300 (87%), Positives = 280/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q VLTAIGNFCICSIA+G+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QTVLTAIGNFCICSIAIGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++A KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFCKNADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIV ML DPKEARAGI EVHFLPFNPV+KRTAITYID  G
Sbjct  360  TVILLSARASRVENQDAIDACIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDGSG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII LC+L+GE LK+AH+IID FA RGLRSL VGRQ+VPEK KES G P
Sbjct  420  DWHRCSKGAPEQIISLCDLKGEALKRAHDIIDKFAERGLRSLGVGRQTVPEKDKESAGTP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>emb|CAN61424.1| hypothetical protein VITISV_027272 [Vitis vinifera]
Length=967

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/300 (87%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L+EIVVM+PIQ R YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  255  QKVLTAIGNFCICSIAVGMLVEIVVMYPIQQRKYREGIDNLLVLLIGGIPIAMPTVLSVT  314

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D  KD
Sbjct  315  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDMDKD  374

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA IVGML DPKEARAGI EVHFLPFNPVDKRTAITYID++G
Sbjct  375  SVVLLAARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDANG  434

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LCEL+G+   KAH IIDN+A+RGLRSLAV RQ++PEKTKES G P
Sbjct  435  DWHRCSKGAPEQIIDLCELKGDVKDKAHSIIDNYADRGLRSLAVARQTIPEKTKESXGKP  494

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  495  WEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  554



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/300 (87%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L+EIVVM+PIQ R YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIAVGMLVEIVVMYPIQQRKYREGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D  KD
Sbjct  300  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDMDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA IVGML DPKEARAGI EVHFLPFNPVDKRTAITYID++G
Sbjct  360  SVVLLAARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDANG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LCEL+G+   KAH IIDN+A+RGLRSLAV RQ++PEKTKES G P
Sbjct  420  DWHRCSKGAPEQIIDLCELKGDVKDKAHSIIDNYADRGLRSLAVARQTIPEKTKESAGKP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_010097155.1| ATPase 9, plasma membrane-type [Morus notabilis]
 gb|EXB67222.1| ATPase 9, plasma membrane-type [Morus notabilis]
Length=878

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 282/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IE+VVM+PIQ R YR+GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  165  QKVLTAIGNFCICSIALGMVIELVVMYPIQKRKYRDGINNLLVLLIGGIPIAMPTVLSVT  224

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+++EVFV+D  KD
Sbjct  225  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNMIEVFVKDVDKD  284

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
            D++LLGARASRVENQDAIDACIVGML DPKEAR GI EVHFLPFNPVDKRTAITYIDS G
Sbjct  285  DLILLGARASRVENQDAIDACIVGMLGDPKEAREGITEVHFLPFNPVDKRTAITYIDSKG  344

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC+L G+T KKA+ II  FA RGLRSLAV RQ+VPEKTKES G P
Sbjct  345  NWHRASKGAPEQIIELCKLRGDTSKKANAIISKFAERGLRSLAVARQTVPEKTKESAGGP  404

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  405  WQFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  464



>gb|AAV49159.1| plasma membrane proton ATPase 5 [Nicotiana plumbaginifolia]
 gb|AAV49160.1| plasma membrane proton ATPase 5 [Nicotiana plumbaginifolia]
Length=925

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSI +G++IEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIVLGIVIEILVMWPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++A KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIV ML+DPKEAR GIQEVHF PFNPVDKRTAITYID  G
Sbjct  360  TVMLLAARASRVENQDAIDACIVNMLNDPKEAREGIQEVHFFPFNPVDKRTAITYIDDSG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC+L+G+ LKKAHEIIDNFANRGLRSL V RQ+VPEK K+S G P
Sbjct  420  NWHRASKGAPEQIIELCDLKGDVLKKAHEIIDNFANRGLRSLGVARQTVPEKNKDSAGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  539



>ref|XP_002309321.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE92844.1| ATPase 6 family protein [Populus trichocarpa]
Length=949

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/300 (87%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+EI+VM+PIQ+R YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAIGMLVEIIVMYPIQNRRYREGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF++D  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFIKDMDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +LLL ARASR+ENQDAIDA IVGML DPKEARA I EVHFLPFNPV+KRTAITY D++G
Sbjct  359  TLLLLAARASRIENQDAIDASIVGMLGDPKEARAEITEVHFLPFNPVEKRTAITYYDNNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELC ++GET KKAHEIIDNFA RGLRSL V RQ +PEKTKES G P
Sbjct  419  DWHRSSKGAPEQIIELCNVKGETKKKAHEIIDNFAERGLRSLGVARQRIPEKTKESEGAP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/300 (87%), Positives = 283/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEIVVM+PIQHR YR+GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAMGMVIEIVVMYPIQHRRYRDGINNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS++EVFV+D  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
            +++LLGARASRVENQDAIDACIVGML DPKEAR GI+EVHFLPFNPVDKRTAIT+ID+ G
Sbjct  359  NLVLLGARASRVENQDAIDACIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITFIDNDG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHRVSKGAPEQIIELC+L  +  KKAH IID FA+RGLRSLAV RQ+VPEKTKES G P
Sbjct  419  SWHRVSKGAPEQIIELCDLREDIKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>gb|EYU31795.1| hypothetical protein MIMGU_mgv1a000883mg [Erythranthe guttata]
Length=951

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/300 (87%), Positives = 280/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEIVVM+PIQ R YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIALGMIIEIVVMYPIQRRKYREGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF  +A KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPDNADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA IV MLSDPKEARAGI EVHFLPFNPV+KRTAITY D+ G
Sbjct  360  TVILLAARASRVENQDAIDASIVNMLSDPKEARAGITEVHFLPFNPVEKRTAITYYDAQG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC+L+G  LKKAH+IIDNFANRGLRSL + RQ+VPEKTKE  G P
Sbjct  420  NWHRSSKGAPEQIIELCQLKGAVLKKAHDIIDNFANRGLRSLGIARQTVPEKTKEGSGGP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_009341817.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009341823.1| PREDICTED: ATPase 8, plasma membrane-type [Pyrus x bretschneideri]
Length=947

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/300 (86%), Positives = 282/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTSIGNFCICSIAVGMVIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF ++  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPKNVDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA IV ML+DPKEARAGI EVHFLPFNPVDKRTAITYID++G
Sbjct  359  GVVLLSARASRVENQDAIDASIVNMLADPKEARAGITEVHFLPFNPVDKRTAITYIDANG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LC+L+GE  KKAH +IDN+A RGLRSL V RQ+VPEKTKES G P
Sbjct  419  DWHRCSKGAPEQIIDLCDLKGEARKKAHAVIDNYAERGLRSLGVARQTVPEKTKESAGNP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  538



>ref|XP_010468541.1| PREDICTED: ATPase 6, plasma membrane-type-like [Camelina sativa]
Length=797

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G+LIE+++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR+ENQDAID  IV ML DPKEARAGI EVHFLPFNPV+KRTAITYIDS+G
Sbjct  360  TVILLSARASRIENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+GET ++AHEIID FA RGLRSL V RQ+VP K KES G P
Sbjct  420  EWHRCSKGAPEQIIELCELKGETKRRAHEIIDKFAERGLRSLGVARQTVPAKDKESAGTP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>gb|KFK39922.1| hypothetical protein AALP_AA3G306500 [Arabis alpina]
Length=949

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 280/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G+LIEI++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIGIGMLIEIIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++  KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNVDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IV ML DPKEARAGI EVHFLPFNPV+KRTAITYIDS+G
Sbjct  360  TVILLSARASRTENQDAIDASIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII LCEL+GET K+AH+IID FA RGLRSL VGRQ+VPEK+KES G P
Sbjct  420  DWHRCSKGAPEQIITLCELKGETKKRAHDIIDKFAERGLRSLGVGRQTVPEKSKESAGTP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_009366133.1| PREDICTED: ATPase 8, plasma membrane-type-like [Pyrus x bretschneideri]
Length=947

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTSIGNFCICSIAVGMVIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF ++  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPKNVDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA IV ML+DPKEARAGI EVHFLPFNPVDKRTAITYID++G
Sbjct  359  GVVLLSARASRVENQDAIDASIVNMLADPKEARAGITEVHFLPFNPVDKRTAITYIDANG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LC+L+GE  KKAH +IDN+A RGLRSL V RQ+VPEK KES G P
Sbjct  419  DWHRCSKGAPEQIIDLCDLKGEARKKAHAVIDNYAERGLRSLGVARQTVPEKAKESTGNP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  538



>ref|XP_009610942.1| PREDICTED: ATPase 9, plasma membrane-type-like [Nicotiana tomentosiformis]
Length=926

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSI VG++IEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241  QKVLTSIGNFCICSIVVGIVIEILVMWPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++A KD
Sbjct  301  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKD  360

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIV ML++PKEAR GIQEVHF PFNPVDKRTAITYID  G
Sbjct  361  TVMLLAARASRVENQDAIDACIVNMLNNPKEAREGIQEVHFFPFNPVDKRTAITYIDDSG  420

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC+L+G+ L+KAHEIIDNFANRGLRSL V RQ+VPEK K+S G P
Sbjct  421  NWHRASKGAPEQIIELCDLKGDILRKAHEIIDNFANRGLRSLGVARQTVPEKDKDSAGSP  480

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  481  WEFVGLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  540



>ref|XP_010533093.1| PREDICTED: ATPase 6, plasma membrane-type [Tarenaya hassleriana]
Length=949

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/300 (86%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSI VG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIGVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++  KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKNVDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IV ML DPKEARAGI+EVHFLPFNPVDKRTAITYIDS+G
Sbjct  360  TVILLSARASRTENQDAIDASIVNMLGDPKEARAGIKEVHFLPFNPVDKRTAITYIDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LC L+GE  K+AHEIID FA+RGLRSL V RQ+VPEK KES G P
Sbjct  420  DWHRCSKGAPEQIIDLCALKGEARKRAHEIIDKFADRGLRSLGVSRQTVPEKDKESEGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETIKRA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIKRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_011084023.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 284/300 (95%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIALGMVIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++A KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR+ENQDAIDA IV MLSDPKEARAGI EVHFLPFNPV+KRTAITY DS+G
Sbjct  360  TVVLLAARASRIENQDAIDASIVNMLSDPKEARAGIIEVHFLPFNPVEKRTAITYYDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +W+R SKGAPEQIIELC+L+G+ LKKAHEIIDNFANRGLRSLAV RQ++PEK KES G P
Sbjct  420  NWYRCSKGAPEQIIELCQLKGQILKKAHEIIDNFANRGLRSLAVARQTIPEKNKESAGDP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPR DSAETIK+A++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRDDSAETIKKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>gb|ABO15469.2| plasma membrane H+-ATPase LilHA2 [Lilium longiflorum]
Length=954

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/300 (86%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+ +EIVVM+PIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSIAVGMFVEIVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  303  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFGKDADKD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAIDACIVGML+DPKEARAGIQEVHFLPFNPVDKRTA TYIDS+G
Sbjct  363  AVLLYAARASRVENQDAIDACIVGMLADPKEARAGIQEVHFLPFNPVDKRTANTYIDSNG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQII+LC L+ +T KK HEIID FA+RGLRSL V RQ VPE +KES G P
Sbjct  423  KWHRASKGAPEQIIDLCNLKEDTKKKVHEIIDKFADRGLRSLGVARQQVPEASKESAGGP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  483  WEFMGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  542



>ref|XP_008381054.1| PREDICTED: ATPase 9, plasma membrane-type [Malus domestica]
Length=954

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG++IE++VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIGVGIVIEVIVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++VEVFV+D  KD
Sbjct  302  MAIGSHRLSTQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++LLGARASRVENQDAID CIVGML DPKEAR GI EVHFLPFNPV+KRTAITYID  G
Sbjct  362  GLILLGARASRVENQDAIDTCIVGMLGDPKEAREGINEVHFLPFNPVEKRTAITYIDPEG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L+G+  KKAH II  FA+RGLRSLAV RQ+VPEKTKES G P
Sbjct  422  NWHRVSKGAPEQIIELCNLKGDAEKKAHAIIGKFADRGLRSLAVARQTVPEKTKESAGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  541



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/300 (86%), Positives = 282/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEIVVM+PIQHR YR+GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAMGMVIEIVVMYPIQHRRYRDGINNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS++EVFV+D  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
            +++LLGARASRVENQDAIDACIVGML DPKEAR GI+EVHFLPFNPVDKRTAIT+ID+ G
Sbjct  359  NLVLLGARASRVENQDAIDACIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITFIDNDG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHRVSKGAPEQIIELC+L  +  KKAH IID FA+RGLRSLAV RQ+VPEKTKES G P
Sbjct  419  SWHRVSKGAPEQIIELCDLREDIKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  479  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIXKETGRRLGMGTNMYPSSS  538



>ref|XP_004287218.1| PREDICTED: ATPase 8, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=948

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 282/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSI VG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTSIGNFCICSIGVGMVIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF ++  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPKNLDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR+ENQDAIDA IVGML DPKEARAGI EVHFLPFNPV+KRTAITYIDS+G
Sbjct  359  GVVLLSARASRIENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LC+L+GE  KKAHE+IDN+A+RGLRSL V RQ+V EKTKES G P
Sbjct  419  DWHRCSKGAPEQIIDLCDLKGEARKKAHEVIDNYADRGLRSLGVARQTVSEKTKESAGDP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  538



>ref|XP_009334638.1| PREDICTED: ATPase 9, plasma membrane-type [Pyrus x bretschneideri]
Length=954

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG++IE++VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIGVGIVIEVIVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++VEVFV+D  KD
Sbjct  302  MAIGSHRLSTQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++LLGARASRVENQDAID CIVGML DPKEAR GI EVHFLPFNPV+KRTAITYID  G
Sbjct  362  GLILLGARASRVENQDAIDTCIVGMLGDPKEAREGINEVHFLPFNPVEKRTAITYIDPEG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L+G+  KKAH II  FA+RGLRSLAV RQ+VPEKTKES G P
Sbjct  422  NWHRVSKGAPEQIIELCNLKGDAEKKAHAIIGKFADRGLRSLAVARQTVPEKTKESAGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  541



>ref|XP_010431653.1| PREDICTED: ATPase 9, plasma membrane-type-like [Camelina sativa]
Length=624

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G++IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  KD
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +L+  ARASRVENQDAIDACIVGML DP+EAR GI EVHF PFNPVDKRTAITYID++G
Sbjct  362  QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +  K+AH+IID FA+RGLRSLAVGRQ+V EK K S G P
Sbjct  422  NWHRVSKGAPEQIIELCNLREDAKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>ref|XP_008242930.1| PREDICTED: ATPase 8, plasma membrane-type [Prunus mume]
Length=947

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/300 (86%), Positives = 280/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+ IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTSIGNFCICSIAVGMAIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVF +D  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKDMDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA IVGML DPKEARAGI EVHFLPFNPVDKRTAITY+DS+G
Sbjct  359  TVILLSARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYVDSNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LC+L+GE  KKAH +IDN+A+RGLRSL V RQ+V EKTKES G  
Sbjct  419  DWHRCSKGAPEQIIDLCDLKGEMKKKAHAVIDNYADRGLRSLGVARQTVSEKTKESAGDA  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  538



>ref|XP_009766358.1| PREDICTED: ATPase 8, plasma membrane-type [Nicotiana sylvestris]
Length=951

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 282/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIAVGMVIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  300  MAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIV ML DPKEARAGIQEVHFLPFNPV+KRTAITYID  G
Sbjct  360  TVMLLAARASRVENQDAIDACIVNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+G+  KK+ +IID++ANRGLRSLAV RQ+VPEK+KES G P
Sbjct  420  NWHRASKGAPEQIIELCELKGDIRKKSLDIIDSYANRGLRSLAVARQTVPEKSKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A++LGVNVKMITGDQLAIGKET RRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSA  539



>gb|AAR32129.2| proton P-ATPase [Nicotiana tabacum]
Length=951

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 282/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIAVGMVIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  300  MAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIV ML DPKEARAGIQEVHFLPFNPV+KRTAITYID  G
Sbjct  360  TVMLLAARASRVENQDAIDACIVNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+G+  KK+ +IID++ANRGLRSLAV RQ+VPEK+KES G P
Sbjct  420  NWHRASKGAPEQIIELCELKGDIRKKSLDIIDSYANRGLRSLAVARQTVPEKSKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A++LGVNVKMITGDQLAIGKET RRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSA  539



>ref|XP_010047150.1| PREDICTED: ATPase 8, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW78971.1| hypothetical protein EUGRSUZ_C00401 [Eucalyptus grandis]
Length=950

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/300 (86%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+++EIVVM+ IQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241  QKVLTAIGNFCICSIAVGMVVEIVVMYVIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF  D  KD
Sbjct  301  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFTNDVDKD  360

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +LLL ARASRVENQDAIDACIVGML DP+EARAG+ EVHFLPFNPVDKRTAITYID  G
Sbjct  361  GLLLLAARASRVENQDAIDACIVGMLGDPREARAGLTEVHFLPFNPVDKRTAITYIDERG  420

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII+LC L+GE  K+AH IIDNFA RGLRSL V RQ VPEKTKES G P
Sbjct  421  NWHRSSKGAPEQIIDLCGLKGEPRKRAHAIIDNFAERGLRSLGVSRQMVPEKTKESEGTP  480

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  481  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  540



>ref|XP_006396088.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
 gb|ESQ36867.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
Length=949

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIGIGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++  KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNVDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDACIV ML DPKEARAGI EVHFLPFNPV+KRTAITYIDS+G
Sbjct  360  TVILLSARASRTENQDAIDACIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII LCEL+GET K+AH+II  FA RGLRSL VGRQ VPEK KE  GLP
Sbjct  420  EWHRCSKGAPEQIITLCELKGETEKRAHDIIGKFAERGLRSLGVGRQKVPEKDKEGAGLP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_006473964.1| PREDICTED: ATPase 8, plasma membrane-type-like [Citrus sinensis]
 gb|KDO59386.1| hypothetical protein CISIN_1g041450mg [Citrus sinensis]
Length=949

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/300 (86%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+ IEI+VM+ IQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAVGMFIEIIVMWAIQRRSYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVFV+    D
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFVKGTDSD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +LL  ARASRVENQDAIDA IVGML+DPKEARAGI EVHFLPFNPVDKRTAITYIDS+G
Sbjct  359  GLLLAAARASRVENQDAIDASIVGMLADPKEARAGITEVHFLPFNPVDKRTAITYIDSNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LC L+GE  +KAH+IIDNFA RGLR+L VGRQ+VPEKTKES G P
Sbjct  419  DWHRTSKGAPEQIIDLCGLKGEMRRKAHQIIDNFAERGLRALGVGRQTVPEKTKESEGSP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>ref|XP_008386550.1| PREDICTED: ATPase 9, plasma membrane-type-like [Malus domestica]
Length=962

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG++IE++VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  251  QKVLTAIGNFCICSIGVGIVIEVIVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  310

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++VEVFV+D  KD
Sbjct  311  MAIGSHRLSTQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKD  370

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++LLGARASRVENQDAID CIVGML DPKEAR GI EVHFLPFNPV+KRTAITYID  G
Sbjct  371  GLILLGARASRVENQDAIDTCIVGMLGDPKEARQGITEVHFLPFNPVEKRTAITYIDPEG  430

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L+G+  KKAH II  FA+RGLRSLAV RQ+VPEK KES G P
Sbjct  431  NWHRVSKGAPEQIIELCNLKGDVEKKAHAIIGKFADRGLRSLAVARQTVPEKNKESAGTP  490

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  491  WEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  550



>ref|XP_007138427.1| hypothetical protein PHAVU_009G208000g [Phaseolus vulgaris]
 gb|ESW10421.1| hypothetical protein PHAVU_009G208000g [Phaseolus vulgaris]
Length=855

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 280/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLT+IGNFCICSIAVG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QQVLTSIGNFCICSIAVGIVIEIIVMYPIQHRSYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFSRGMDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++L  ARASR ENQDAIDA IVGMLSDPKEARA I EVHFLPFNPVDKRTAIT+IDS+G
Sbjct  360  TLVLFSARASRTENQDAIDASIVGMLSDPKEARAEITEVHFLPFNPVDKRTAITFIDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DW+R SKGAPEQIIELC L+GETLKKAH++ID +A+RGLRSL V RQ+V EKTKES G P
Sbjct  420  DWYRSSKGAPEQIIELCGLKGETLKKAHKVIDEYADRGLRSLGVARQTVSEKTKESAGDP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFLGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_009587248.1| PREDICTED: ATPase 9, plasma membrane-type [Nicotiana tomentosiformis]
Length=951

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 282/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIAVGMVIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  300  MAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIV ML DPKEAR+GIQEVHFLPFNPV+KRTAITYID  G
Sbjct  360  TVMLLAARASRVENQDAIDACIVNMLGDPKEARSGIQEVHFLPFNPVEKRTAITYIDDKG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+G+  KK+ +IID++ANRGLRSLAV RQ+VPEK+KES G P
Sbjct  420  NWHRASKGAPEQIIELCELKGDIRKKSLDIIDSYANRGLRSLAVARQTVPEKSKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A++LGVNVKMITGDQLAIGKET RRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSA  539



>ref|XP_010496144.1| PREDICTED: ATPase 6, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/300 (85%), Positives = 280/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G+LIE+++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR+ENQDAID  IV ML DPKEARAGI EVHFLPFNPV+KRTAITYIDS+G
Sbjct  360  TVILLSARASRIENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC+L+GET ++AHEIID FA RGLRSL V RQ+VP+K KES G P
Sbjct  420  EWHRCSKGAPEQIIELCDLKGETKRRAHEIIDKFAERGLRSLGVARQTVPDKDKESAGTP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_010033994.1| PREDICTED: ATPase 9, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW53878.1| hypothetical protein EUGRSUZ_J03094 [Eucalyptus grandis]
Length=929

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/300 (85%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+ +EI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAVGMTVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDVDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML+DPKEARA I EVHFLPFNPVDKRTAITY+DS+G
Sbjct  359  GVILLGARASRVENQDAIDACIVGMLADPKEARADITEVHFLPFNPVDKRTAITYVDSNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQII+LC++  +  KK H+IID FA+RGLRSLAV +Q+VPEKTK+S G P
Sbjct  419  NWHRVSKGAPEQIIDLCKVRQDVKKKVHDIIDKFADRGLRSLAVAKQTVPEKTKDSAGEP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>ref|XP_010033995.1| PREDICTED: ATPase 9, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=931

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/300 (85%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+ +EI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241  QKVLTAIGNFCICSIAVGMTVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D  KD
Sbjct  301  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDVDKD  360

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML+DPKEARA I EVHFLPFNPVDKRTAITY+DS+G
Sbjct  361  GVILLGARASRVENQDAIDACIVGMLADPKEARADITEVHFLPFNPVDKRTAITYVDSNG  420

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQII+LC++  +  KK H+IID FA+RGLRSLAV +Q+VPEKTK+S G P
Sbjct  421  NWHRVSKGAPEQIIDLCKVRQDVKKKVHDIIDKFADRGLRSLAVAKQTVPEKTKDSAGEP  480

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  481  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  540



>ref|XP_003547446.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/300 (86%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEIVVM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QKVLTAIGNFCICSIAVGMIIEIVVMYPIQHRKYRSGINNLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF +DA KD
Sbjct  297  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFARDADKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML DPKEAR GI EVHFLPFNPVDKRTAITYID+ G
Sbjct  357  TVMLLGARASRVENQDAIDACIVGMLGDPKEARDGITEVHFLPFNPVDKRTAITYIDTEG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC+L  +  KKA  IID FA+RGLRSLAV +Q VPEK+KES G P
Sbjct  417  NWHRVSKGAPEQIIELCKLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESAGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMG+NMYPSSS
Sbjct  477  WTFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSS  536



>ref|XP_006343689.1| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum tuberosum]
Length=951

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/300 (85%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIAVGMVIEIIVMYPIQQRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA+KD
Sbjct  300  MAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDATKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASR+ENQDAID CIV ML DPKEARAGIQEVHFLPFNPV+KRTAITYID  G
Sbjct  360  TVMLLGARASRIENQDAIDTCIVNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+G+  KKA EIID++ANRGLRSL + RQ+VPEK+KES G P
Sbjct  420  NWHRASKGAPEQIIELCELKGDIRKKALEIIDDYANRGLRSLGLARQTVPEKSKESEGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A+ELGV VKMITGDQLAIGKET RRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALELGVAVKMITGDQLAIGKETARRLGMGTNMYPSSA  539



>ref|XP_004488894.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cicer arietinum]
Length=947

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 280/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIA+G+L+EI+VM+PIQ+R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIAIGMLVEIIVMYPIQNRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF     KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPSGMDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  ARASRVENQDAIDA IVGMLSDPKEARAGI EVHFLPFNPVDKRTAITYIDS+G
Sbjct  360  SVVLYAARASRVENQDAIDASIVGMLSDPKEARAGITEVHFLPFNPVDKRTAITYIDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELCEL+GETLK+AH+ ID +A RGLRSLAVG Q+V EK+KES G P
Sbjct  420  DWHRSSKGAPEQIIELCELKGETLKRAHKTIDGYAERGLRSLAVGFQTVSEKSKESAGEP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WVFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|NP_178762.1| H(+)-ATPase 6 [Arabidopsis thaliana]
 sp|Q9SH76.1|PMA6_ARATH RecName: Full=ATPase 6, plasma membrane-type; AltName: Full=Proton 
pump 6 [Arabidopsis thaliana]
 gb|AAD32758.1| putative plasma membrane proton ATPase [Arabidopsis thaliana]
 gb|AEC06056.1| H(+)-ATPase 6 [Arabidopsis thaliana]
Length=949

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G+LIEI++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIGIGMLIEIIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D  KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFSKDVDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAID  IV ML DPKEARAGI EVHFLPFNPV+KRTAITYID++G
Sbjct  360  YVILLSARASRVENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDTNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC+L+GET ++AHEIID FA RGLRSL V RQ VPEK KES G P
Sbjct  420  EWHRCSKGAPEQIIELCDLKGETKRRAHEIIDKFAERGLRSLGVARQRVPEKDKESAGTP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>gb|AAA98916.1| Theoretical protein with similarity to Swiss-Prot Accession Number 
P19456 plasma membrane ATPase 2 (proton pump) [Arabidopsis 
thaliana]
Length=859

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  173  QKVLTAIGNFCICSIAIGMLIEIVVMYPIQKRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  232

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  KD
Sbjct  233  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  292

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +L+  ARASRVENQDAIDACIVGML DP+EAR GI EVHF PFNPVDKRTAITYID++G
Sbjct  293  QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANG  352

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +  K+AH+IID FA+RGLRSLAVGRQ+V EK K S G P
Sbjct  353  NWHRVSKGAPEQIIELCNLREDASKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSXGEP  412

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  413  WQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  472



>ref|XP_010535850.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=881

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+E+VVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  173  QKVLTAIGNFCICSIALGMLVELVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  232

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D + D
Sbjct  233  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDLNTD  292

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASR ENQDAIDACIVGML DPKEARAGI EVHFLPFNPV+KRTA TYID +G
Sbjct  293  GVLLHAARASRTENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVEKRTANTYIDENG  352

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQII+LCEL+GE  +KAHEIID FA RGLRSL V RQ++PEKTKES G P
Sbjct  353  GWHRSSKGAPEQIIDLCELKGEMRRKAHEIIDGFAERGLRSLGVARQTIPEKTKESDGSP  412

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIG ETGRRLGMGTNMYPSSS
Sbjct  413  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSSS  472



>ref|XP_006343688.1| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum tuberosum]
Length=951

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIAVGMVIEIVVMYPIQKRNYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  300  MAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASR+ENQDAID CIV ML DPKEARAGIQEVHFLPFNPV+KRTAITYID  G
Sbjct  360  TVMLLGARASRIENQDAIDTCIVNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+G+  KKA EIID++ANRGLRSL + RQ+VPEK KES G P
Sbjct  420  NWHRASKGAPEQIIELCELKGDIKKKALEIIDDYANRGLRSLGLARQTVPEKNKESEGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A+ELGV VKMITGDQLAIGKET RRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALELGVAVKMITGDQLAIGKETARRLGMGTNMYPSSA  539



>ref|XP_006453678.1| hypothetical protein CICLE_v10007374mg [Citrus clementina]
 gb|ESR66918.1| hypothetical protein CICLE_v10007374mg [Citrus clementina]
Length=949

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+ IEI+VM+ IQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAVGMFIEIIVMWAIQRRSYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVFV+    D
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFVKGTDSD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +LL  ARASRVENQDAIDA IVGML+DPKEARAGI EVHFLPFNPVDKRTAITYIDS+G
Sbjct  359  GLLLAAARASRVENQDAIDASIVGMLADPKEARAGITEVHFLPFNPVDKRTAITYIDSNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LC L+GE  +KAH+IIDNFA RGLR+L V RQ+VPEKTKES G P
Sbjct  419  DWHRTSKGAPEQIIDLCGLKGEMRRKAHQIIDNFAERGLRALGVARQTVPEKTKESEGSP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>ref|XP_003543699.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEIVVM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QKVLTAIGNFCICSIAVGMIIEIVVMYPIQHRKYRSGINNLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  297  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFARDADKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML DPKEAR GI+EVHFLPFNPVDKRTAITYID+ G
Sbjct  357  TVMLLGARASRVENQDAIDACIVGMLGDPKEARDGIKEVHFLPFNPVDKRTAITYIDTEG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC+L  +  KKA  IID FA+RGLRSLAV +Q VPEK+KES G P
Sbjct  417  NWHRVSKGAPEQIIELCKLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESAGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMG+NMYPSSS
Sbjct  477  WTFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSS  536



>ref|XP_004251768.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X1 [Solanum 
lycopersicum]
Length=924

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG++IEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSILVGIVIEIVVMWPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF ++A  D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDQTLIEVFTKNADAD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAID CIV ML D K AR GIQEVHF PFNPVDKRTAITYID++G
Sbjct  360  TVMLLAARASRVENQDAIDTCIVNMLGDAKLAREGIQEVHFFPFNPVDKRTAITYIDNNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELC L G  LKKAHEIIDNFANRGLRSL V RQ+VPEK KES G P
Sbjct  420  DWHRASKGAPEQIIELCGLSGPVLKKAHEIIDNFANRGLRSLGVARQTVPEKDKESAGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  539



>gb|KFK27866.1| hypothetical protein AALP_AA8G439300 [Arabis alpina]
Length=949

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q VLTAIGNFCIC+I +G+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QTVLTAIGNFCICTIGIGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IV ML+DPKEARAGI EVHFLPFNPV+KRTAITYIDS G
Sbjct  360  TVMLLSARASRTENQDAIDASIVNMLADPKEARAGITEVHFLPFNPVEKRTAITYIDSKG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LCEL+GE  ++AH++ID FA RGLRSL V RQ+VP K KES G P
Sbjct  420  DWHRCSKGAPEQIIDLCELKGEPRRRAHDVIDKFAERGLRSLGVARQTVPAKDKESAGTP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG+++EI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241  QKVLTAIGNFCICSIFVGMVVEIIVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVFV+D  KD
Sbjct  301  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKDVDKD  360

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML DPKEARAGI EVHFLPFNPV+KRTAITYIDS G
Sbjct  361  TVILLGARASRVENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSDG  420

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR+SKGAPEQIIELC L+ +  KKA  IID FA+RGLRSLAVGRQ+VPEK KES G P
Sbjct  421  NWHRISKGAPEQIIELCNLKDDAKKKALAIIDKFADRGLRSLAVGRQTVPEKNKESPGSP  480

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  481  WQFVGLLPLFDPPRHDSAETIARALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  540



>ref|XP_010488815.1| PREDICTED: ATPase 6, plasma membrane-type [Camelina sativa]
Length=949

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G+LIE+++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D  KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDVDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR+ENQDAID  IV ML DPKEARAGI EVHFLPFNPV+KRTAITYIDS+G
Sbjct  360  TVILLSARASRIENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC+L+GET ++AHEIID FA RGLRSL V RQ+VP+K KES G P
Sbjct  420  EWHRCSKGAPEQIIELCDLKGETKRRAHEIIDKFAERGLRSLGVARQTVPDKDKESAGTP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_006279406.1| hypothetical protein CARUB_v10007959mg [Capsella rubella]
 gb|EOA12304.1| hypothetical protein CARUB_v10007959mg [Capsella rubella]
Length=949

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G+LIE+++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D  KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDVDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR+ENQDAID  IV ML DPKEARAGI EVHFLPFNPV+KRTAITYIDS+G
Sbjct  360  TVILLSARASRIENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC+L+GET +++HEIID FA RGLRSL V RQ VPEK KES G P
Sbjct  420  EWHRCSKGAPEQIIELCDLKGETKRRSHEIIDKFAERGLRSLGVARQKVPEKDKESAGTP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_007023380.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26002.1| H(+)-ATPase 9 [Theobroma cacao]
Length=926

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IE+VVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  201  QKVLTAIGNFCICSIAVGMIIEVVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  260

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS++EVF  +  KD
Sbjct  261  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFTNNVDKD  320

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIVGML DPKEARAGI EVHF PFNPVDKRTA+TYI+S G
Sbjct  321  MVILLAARASRVENQDAIDACIVGMLGDPKEARAGITEVHFFPFNPVDKRTAMTYIESDG  380

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHRVSKGAPEQIIELC L  E  KKAH++I NFA+RGLRSLAV +Q+VPEKTKES G  
Sbjct  381  SWHRVSKGAPEQIIELCNLRDELKKKAHDVIANFADRGLRSLAVAKQTVPEKTKESPGES  440

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  441  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  500



>ref|XP_010049873.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW82682.1| hypothetical protein EUGRSUZ_C04061 [Eucalyptus grandis]
Length=951

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+EIVVM+PIQHR YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241  QKVLTAIGNFCICSIALGMLVEIVVMYPIQHRSYRAGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVF +DA KD
Sbjct  301  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKDADKD  360

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA IVG L+DPKEARAGI EVHFLPFNPVDKRTAITY+D +G
Sbjct  361  TVMLLAARASRVENQDAIDASIVGTLADPKEARAGITEVHFLPFNPVDKRTAITYLDGNG  420

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI++LC L GE  KKAH  IDNFA RGLRSLAV RQ VPEKTKES G P
Sbjct  421  NWHRCSKGAPEQIMDLCNLRGEAKKKAHSFIDNFAARGLRSLAVARQMVPEKTKESAGGP  480

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLL LFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMG+NMYPSSS
Sbjct  481  WEFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSS  540



>ref|XP_004159431.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 8, plasma membrane-type-like, 
partial [Cucumis sativus]
Length=903

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIEI+VM+PIQ+R YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  219  QKVLTAIGNFCICSIAIGMLIEILVMYPIQNRAYREGIDNLLVLLIGGIPIAMPTVLSVT  278

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRL++QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LVEVF ++   D
Sbjct  279  MAIGSHRLAEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLVEVFSKNTDAD  338

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +LLL ARASRVENQDAIDA IVGML DPKEAR+GI EVHFLPFNPV+KRTAITYIDS+G
Sbjct  339  TLLLLAARASRVENQDAIDASIVGMLGDPKEARSGITEVHFLPFNPVEKRTAITYIDSNG  398

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII+LC+L+GE  KKAH II N+A+RGLRSLAV RQ+V EKTKES G P
Sbjct  399  NWHRSSKGAPEQIIDLCDLKGERRKKAHNIISNYADRGLRSLAVARQTVLEKTKESTGEP  458

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  459  WDFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  518



>ref|XP_006350073.1| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum tuberosum]
Length=924

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG++IEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSILVGIVIEIVVMWPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF ++A  D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDQTLIEVFPKNADAD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIV ML D K AR GIQEVHF PFNPVDKRTAITYID +G
Sbjct  360  TVMLLAARASRVENQDAIDACIVNMLGDAKLAREGIQEVHFFPFNPVDKRTAITYIDGNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELC L G  LKK+HEIIDNFANRGLRSL V RQ+VPEK KES G P
Sbjct  420  DWHRASKGAPEQIIELCGLSGSVLKKSHEIIDNFANRGLRSLGVARQTVPEKDKESAGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  539



>ref|XP_007203995.1| hypothetical protein PRUPE_ppa000965mg [Prunus persica]
 gb|EMJ05194.1| hypothetical protein PRUPE_ppa000965mg [Prunus persica]
Length=948

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+ IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIAVGMAIEIVVMYPIQHREYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVF ++  KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKNMDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA IVGML DPKEARAGI EVHFLPFNPVDKRTAITY+DS+G
Sbjct  360  TVILLSARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYVDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LC+L+GE  KKAH +IDN+A RGLRSL V RQ+V EKTKES G  
Sbjct  420  DWHRCSKGAPEQIIDLCDLKGEMKKKAHAVIDNYAERGLRSLGVARQTVSEKTKESAGDA  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  539



>gb|KEH32174.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=948

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/300 (86%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+LIEI+VM+PIQ R YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIAVGMLIEIIVMYPIQQRSYREGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF+   +KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFINGVNKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +LL  ARASRVENQDAIDA IVGML DPKEARAGI EVHFLPFNPV KRTAITYIDS G
Sbjct  360  GLLLDAARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVGKRTAITYIDSEG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+GETLKKAH+IID FA RGLRSLAV RQ+V EKTKES G  
Sbjct  420  NWHRCSKGAPEQIIELCELKGETLKKAHKIIDQFAERGLRSLAVSRQTVSEKTKESEGDS  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GL+PLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFLGLMPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_008456775.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis melo]
Length=923

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIEI+VM+PIQ+R YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAIGMLIEILVMYPIQNRAYREGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRL++QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF ++   D
Sbjct  299  MAIGSHRLAEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFSKNTDAD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +LLL ARASRVENQDAIDA IVGML DPKEAR+GI EVHFLPFNPV+KRTAITYIDS+G
Sbjct  359  TLLLLAARASRVENQDAIDASIVGMLGDPKEARSGITEVHFLPFNPVEKRTAITYIDSNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII+LC+L+GE  KKAH II N+A+RGLRSLAV RQ+V EKTKES G P
Sbjct  419  NWHRSSKGAPEQIIDLCDLKGERRKKAHNIISNYADRGLRSLAVARQTVLEKTKESSGEP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WDFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVFV+D  KD
Sbjct  299  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKDMDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAIDA IVGML+DPKEARAGIQE+HFLPFNPVDKRTAITYIDS+G
Sbjct  359  TVLLYSARASRVENQDAIDASIVGMLADPKEARAGIQEIHFLPFNPVDKRTAITYIDSNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQII+LC L+ +  KK HE+ID FA+RGLRSL V RQ +PE  KES G P
Sbjct  419  KWHRASKGAPEQIIDLCNLKDDAKKKVHEMIDKFADRGLRSLGVARQEIPEANKESAGGP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  479  WQFMGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  538



>gb|EPS57651.1| hypothetical protein M569_17165 [Genlisea aurea]
Length=955

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+LIE+VVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  246  QKVLTSIGNFCICSIAVGMLIEVVVMYPIQRRTYRDGIDNLLVLLIGGIPIAMPTVLSVT  305

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++  KD
Sbjct  306  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNMEKD  365

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA IV ML DPKEARAGI EVHFLPFNPV+KRTAITY DS+G
Sbjct  366  TVVLLAARASRVENQDAIDASIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYHDSNG  425

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII+LC+L+G  LKKAHEIIDNFANRGLRSL V  QSVPEKTKE  G P
Sbjct  426  EWHRCSKGAPEQIIDLCQLKGAVLKKAHEIIDNFANRGLRSLGVAIQSVPEKTKEGAGGP  485

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETIK+A++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  486  WEFVGLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  545



>ref|XP_004139271.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=923

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIEI+VM+PIQ+R YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAIGMLIEILVMYPIQNRAYREGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRL++QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LVEVF ++   D
Sbjct  299  MAIGSHRLAEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLVEVFSKNTDAD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +LLL ARASRVENQDAIDA IVGML DPKEAR+GI EVHFLPFNPV+KRTAITYIDS+G
Sbjct  359  TLLLLAARASRVENQDAIDASIVGMLGDPKEARSGITEVHFLPFNPVEKRTAITYIDSNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII+LC+L+GE  KKAH II N+A+RGLRSLAV RQ+V EKTKES G P
Sbjct  419  NWHRSSKGAPEQIIDLCDLKGERRKKAHNIISNYADRGLRSLAVARQTVLEKTKESTGEP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WDFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>ref|XP_004242977.2| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum lycopersicum]
Length=951

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 281/300 (94%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIAVGMVIEIIVMYPIQQRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA+KD
Sbjct  300  MAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDATKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASR+ENQDAID CIV ML DPKEARAGIQEVHFLPFNPV+KRTAITYID  G
Sbjct  360  TVMLLGARASRIENQDAIDTCIVNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC+L+G+  KKA +IID++ANRGLRSL + RQ+VPEK+KES G P
Sbjct  420  NWHRASKGAPEQIIELCDLKGDIKKKALDIIDDYANRGLRSLGLARQTVPEKSKESEGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A+ELGV VKMITGDQLAIGKET RRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALELGVAVKMITGDQLAIGKETARRLGMGTNMYPSSA  539



>ref|XP_010535849.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=948

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+E+VVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIALGMLVELVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D + D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDLNTD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASR ENQDAIDACIVGML DPKEARAGI EVHFLPFNPV+KRTA TYID +G
Sbjct  360  GVLLHAARASRTENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVEKRTANTYIDENG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQII+LCEL+GE  +KAHEIID FA RGLRSL V RQ++PEKTKES G P
Sbjct  420  GWHRSSKGAPEQIIDLCELKGEMRRKAHEIIDGFAERGLRSLGVARQTIPEKTKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIG ETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSSS  539



>ref|XP_004253510.2| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum lycopersicum]
Length=951

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 280/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIAVGMVIEIVVMYPIQKRNYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  300  MAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASR+ENQDAID CIV ML DPKEARAGIQEVHFLPFNPV+KRTAITYID  G
Sbjct  360  TVMLLGARASRIENQDAIDTCIVNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC+L+G+  KKA +IID++ANRGLRSL + RQ+VPEK+KES G P
Sbjct  420  NWHRASKGAPEQIIELCDLKGDVRKKALDIIDDYANRGLRSLGLARQTVPEKSKESEGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI++A+ELGV VKMITGDQLAIGKET RRLGMGTNMYPSS+
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRKALELGVAVKMITGDQLAIGKETARRLGMGTNMYPSSA  539



>ref|XP_004508384.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X2 [Cicer 
arietinum]
Length=865

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+LIEIVVM+PIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIAVGMLIEIVVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF  D  K+
Sbjct  300  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFPADLDKE  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +LL  ARASRVENQDAIDA IVGMLSDPKEARAGI EVHFLPFNPV KRTAITY DS G
Sbjct  360  GLLLAAARASRVENQDAIDASIVGMLSDPKEARAGITEVHFLPFNPVGKRTAITYYDSQG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +W+R SKGAPEQIIELC+L+GETLKKAH IID FA RGLRSL V RQ++ EKTKES G  
Sbjct  420  NWYRCSKGAPEQIIELCQLKGETLKKAHRIIDQFAERGLRSLGVSRQTISEKTKESEGDA  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGL+PLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLMPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_006389820.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
 gb|ESQ27106.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
Length=953

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/300 (85%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G++IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241  QKVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  KD
Sbjct  301  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  360

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +L+  ARASRVENQDAIDACIVGML DP+EAR GI EVHF PFNPVDKRTAITYIDS+G
Sbjct  361  QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDSNG  420

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +T K+AH+IID FA+RGLRSLAVGRQ+V  K K S G P
Sbjct  421  NWHRVSKGAPEQIIELCNLREDTKKRAHDIIDKFADRGLRSLAVGRQTVSAKDKNSPGEP  480

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  481  WEFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  540



>ref|XP_010425792.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
 ref|XP_010425793.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
 ref|XP_010425794.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/300 (85%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLT+IGNFCICSI +G+LIEI++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QQVLTSIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVF  +   D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPTNMDTD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L+ ARASR+ENQDAIDA IVGML DPKEARAGI EVHFLPFNPVDKRTAITYID  G
Sbjct  360  SVVLMAARASRIENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDESG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELC L+GET +KAHE+ID FA RGLRSL V +Q+VPEKTKES G P
Sbjct  420  DWHRSSKGAPEQIIELCNLQGETKRKAHEVIDGFAERGLRSLGVAQQTVPEKTKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIG ETGRRLGMGTNMYPS+S
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTS  539



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=954

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAIGMIIEIVVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++VEVFV+D  KD
Sbjct  302  MAIGSHRLSTQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++LLGARASRVENQDAID CIVGML DPKEAR  I EVHFLPFNPV+KRTAITYID+ G
Sbjct  362  GLILLGARASRVENQDAIDTCIVGMLGDPKEARESITEVHFLPFNPVEKRTAITYIDTDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQII+LCEL+ +  KKAH IID FA+RGLRSLAV RQ+VPEK KES G P
Sbjct  422  NWHRVSKGAPEQIIDLCELKDDARKKAHAIIDKFADRGLRSLAVCRQTVPEKNKESAGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  541



>ref|XP_002324564.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEF03129.1| ATPase 6 family protein [Populus trichocarpa]
Length=949

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIEI+VM+PIQ+R YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAIGMLIEIIVMYPIQNRRYREGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D  +D
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDMDRD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +LL  ARA+R+ENQDAIDA IVGML DPKEARA I EVHFLPFNPV+KRTAITY DS G
Sbjct  359  TLLLHAARAARIENQDAIDASIVGMLGDPKEARADITEVHFLPFNPVEKRTAITYYDSKG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DW+R SKGAPEQII+LC+LEGE  KKAHEIIDNFA+RGLRSL V RQ++PEK KES G P
Sbjct  419  DWYRSSKGAPEQIIDLCQLEGEMEKKAHEIIDNFADRGLRSLGVARQTIPEKNKESEGGP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>ref|XP_006279360.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
 gb|ABA18104.1| putative plasma membrane ATPase [Capsella rubella]
 gb|EOA12258.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
Length=948

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSI +G+LIEI++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVF ++   D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPRNMDTD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L+ ARASR+ENQDAIDA IVGML DPKEARAGI EVHFLPFNPVDKRTAITYID +G
Sbjct  360  SVVLMAARASRIENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDENG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELC L+GET +KAHE+ID FA RGLRSL V +Q+VPEKTKES G P
Sbjct  420  DWHRSSKGAPEQIIELCNLQGETKRKAHEVIDGFAERGLRSLGVAQQTVPEKTKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIG ETGRRLGMGTNMYPS+S
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTS  539



>gb|KDO45595.1| hypothetical protein CISIN_1g044543mg [Citrus sinensis]
Length=962

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEI+VM+PIQHR YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  250  QKVLTAIGNFCICSIAIGMVIEIIVMYPIQHRAYRNGIDNLLVLLIGGIPIAMPTVLSVT  309

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LVEVFV+D  KD
Sbjct  310  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFVKDMDKD  369

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L GARASRVENQDAIDACIVGML D KEARAGI E+HFLPFNPV+KRTAITYIDS G
Sbjct  370  TVILYGARASRVENQDAIDACIVGMLGDAKEARAGITELHFLPFNPVEKRTAITYIDSDG  429

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR+SKGAPEQIIELC L  +   KAH IID FA+RGLRSLAV  QSVPEKTKES G P
Sbjct  430  SWHRISKGAPEQIIELCNLREDVRNKAHTIIDKFADRGLRSLAVAEQSVPEKTKESPGGP  489

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  490  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSA  549



>ref|XP_010514696.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
 ref|XP_010514698.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
 ref|XP_010514699.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
 ref|XP_010514700.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
Length=948

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/300 (85%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLT+IGNFCICSI +G+LIEI++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QQVLTSIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVF  +   D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPTNMDTD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L+ ARASR+ENQDAIDA IVGML DPKEARAGI EVHFLPFNPVDKRTAITYID  G
Sbjct  360  SVVLMAARASRIENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDESG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELC L+GET +KAHE+ID FA RGLRSL V +Q+VPEKTKES G P
Sbjct  420  DWHRSSKGAPEQIIELCNLQGETKRKAHEVIDGFAERGLRSLGVAQQTVPEKTKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIG ETGRRLGMGTNMYPS+S
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTS  539



>ref|XP_006427547.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
 gb|ESR40787.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
Length=962

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEI+VM+PIQHR YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  250  QKVLTAIGNFCICSIAIGMVIEIIVMYPIQHRAYRNGIDNLLVLLIGGIPIAMPTVLSVT  309

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LVEVFV+D  KD
Sbjct  310  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFVKDMDKD  369

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L GARASRVENQDAIDACIVGML D KEARAGI E+HFLPFNPV+KRTAITYIDS G
Sbjct  370  TVILYGARASRVENQDAIDACIVGMLGDAKEARAGITELHFLPFNPVEKRTAITYIDSDG  429

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR+SKGAPEQIIELC L  +   KAH IID FA+RGLRSLAV  QSVPEKTKES G P
Sbjct  430  SWHRISKGAPEQIIELCNLREDVRNKAHTIIDKFADRGLRSLAVAEQSVPEKTKESPGGP  489

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  490  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSA  549



>ref|XP_002307856.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE91379.1| ATPase 6 family protein [Populus trichocarpa]
Length=944

 Score =   536 bits (1380),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  234  QKVLTAIGNFCICSIAIGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  293

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVFV+D  KD
Sbjct  294  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFVKDMDKD  353

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++L  ARASR ENQDAIDA IVGML DP EAR+GI EVHFLPFNPV+KRTAITY D +G
Sbjct  354  TLILHAARASRTENQDAIDASIVGMLGDPSEARSGIIEVHFLPFNPVEKRTAITYFDGNG  413

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DW+R SKGAPEQIIELCEL+G   KKAHEII+NFA+RGLRSL V R  +PEK KES G P
Sbjct  414  DWYRSSKGAPEQIIELCELKGNIRKKAHEIINNFADRGLRSLGVARHRIPEKNKESAGAP  473

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  474  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  533



>ref|NP_189850.1| H(+)-ATPase 8 [Arabidopsis thaliana]
 sp|Q9M2A0.1|PMA8_ARATH RecName: Full=ATPase 8, plasma membrane-type; AltName: Full=Proton 
pump 8 [Arabidopsis thaliana]
 emb|CAB86447.1| plasma membrane H+-ATPase-like protein [Arabidopsis thaliana]
 gb|AEE77743.1| H(+)-ATPase 8 [Arabidopsis thaliana]
Length=948

 Score =   536 bits (1380),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSI +G+LIEI++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVF ++   D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKNMDSD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L+ ARASR+ENQDAIDA IVGML DPKEARAGI EVHFLPFNPVDKRTAITYID  G
Sbjct  360  SVVLMAARASRIENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDESG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELC L+GET +KAHE+ID FA RGLRSL V +Q+VPEKTKES G P
Sbjct  420  DWHRSSKGAPEQIIELCNLQGETKRKAHEVIDGFAERGLRSLGVAQQTVPEKTKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIG ETGRRLGMGTNMYPS+S
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTS  539



>ref|XP_006465284.1| PREDICTED: ATPase 9, plasma membrane-type-like [Citrus sinensis]
Length=962

 Score =   536 bits (1381),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEI+VM+PIQHR YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  250  QKVLTAIGNFCICSIAIGMVIEIIVMYPIQHRAYRNGIDNLLVLLIGGIPIAMPTVLSVT  309

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LVEVFV+D  KD
Sbjct  310  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFVKDMDKD  369

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L GARASRVENQDAIDACIVGML D KEARAGI E+HFLPFNPV+KRTAITYIDS G
Sbjct  370  TVILYGARASRVENQDAIDACIVGMLGDAKEARAGITELHFLPFNPVEKRTAITYIDSDG  429

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR+SKGAPEQIIELC L  +   KAH IID FA+RGLRSLAV  QSVPEKTKES G P
Sbjct  430  SWHRISKGAPEQIIELCNLREDVRNKAHTIIDKFADRGLRSLAVAEQSVPEKTKESPGGP  489

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  490  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSA  549



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   536 bits (1380),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS++EVFV+D  +D
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVKDMDRD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L+ ARASRVENQDAIDA IVGML+DPKEARAGI EVHFLPFNPV+KRTAITYIDS G
Sbjct  362  TVVLIAARASRVENQDAIDASIVGMLADPKEARAGITEVHFLPFNPVEKRTAITYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQII+LC++  E   K H IID FA+RGLRSL V RQ+VPEK KES G P
Sbjct  422  HWHRASKGAPEQIIDLCKMSNEAKSKVHAIIDKFADRGLRSLGVARQTVPEKNKESAGGP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  541



>ref|XP_009106729.1| PREDICTED: ATPase 9, plasma membrane-type [Brassica rapa]
Length=954

 Score =   535 bits (1379),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +++  ARASRVENQDAIDACIVGML DP EAR GI EVHF PFNPVDKRTAITYIDS G
Sbjct  362  QLMVNAARASRVENQDAIDACIVGMLGDPSEARQGITEVHFFPFNPVDKRTAITYIDSSG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +T K+AH+IID FA+RGLRSLAVGRQ+V EK K S G P
Sbjct  422  NWHRVSKGAPEQIIELCNLREDTKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>ref|XP_006594226.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X2 [Glycine 
max]
Length=861

 Score =   533 bits (1372),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIA+G+LIEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIAIGMLIEIIVMYPIQQRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF     KD
Sbjct  300  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPTGMDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++L  ARASR ENQDAIDA IVGMLSDPKEARAGI EVHFLPFNPVDKRTAITYID  G
Sbjct  360  TLVLYAARASRTENQDAIDASIVGMLSDPKEARAGITEVHFLPFNPVDKRTAITYIDGQG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+GE LKKAH++ID +ANRGLRSL V RQ+V EK KES G  
Sbjct  420  NWHRSSKGAPEQIIELCELKGEVLKKAHKVIDEYANRGLRSLGVSRQTVSEKNKESAGES  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score =   535 bits (1379),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241  QKVLTAIGNFCICSIAIGMVIEILVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS++EVF++D  KD
Sbjct  301  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFIKDVDKD  360

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +LLL ARASRVENQDAIDAC+VGML DPKEARA I EVHF PFNPVDKRTA+TYIDS G
Sbjct  361  MLLLLAARASRVENQDAIDACVVGMLGDPKEARADITEVHFFPFNPVDKRTAMTYIDSDG  420

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHRVSKGAPEQII LC L  +  KKAH+IID FA+RGLRSL V RQ+VPEKTKES G P
Sbjct  421  SWHRVSKGAPEQIISLCNLREDVKKKAHDIIDKFADRGLRSLGVARQTVPEKTKESSGDP  480

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGL+PLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  481  WEFVGLMPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  540



>ref|XP_007012006.1| H(+)-ATPase 8 [Theobroma cacao]
 gb|EOY29625.1| H(+)-ATPase 8 [Theobroma cacao]
Length=951

 Score =   535 bits (1379),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+SL+EVF     KD
Sbjct  302  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFASGIDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++LL ARASRVENQDAIDA IVGML DPKEARAGI E+HF PFNPVDKRTAITYIDS G
Sbjct  362  TLMLLAARASRVENQDAIDASIVGMLGDPKEARAGITELHFFPFNPVDKRTAITYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII+LC L GE  KKA  +IDNFA+RGLRSLAV RQ++PEKTKES G P
Sbjct  422  EWHRCSKGAPEQIIDLCGLTGELRKKALGVIDNFADRGLRSLAVARQTIPEKTKESAGGP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  482  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  541



>ref|XP_010417679.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X2 [Camelina 
sativa]
Length=928

 Score =   535 bits (1377),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G++IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  KD
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +L+  ARASRVENQDAIDACIVGML DP+EAR GI EVHF PFNPVDKRTAITYID++G
Sbjct  362  QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +  K+AH+IID FA+RGLRSLAVGRQ+V EK K S G P
Sbjct  422  NWHRVSKGAPEQIIELCNLREDAKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>ref|XP_007014223.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
 gb|EOY31842.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
Length=886

 Score =   533 bits (1373),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  173  QKVLTAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  232

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVFV+D  K+
Sbjct  233  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKE  292

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHF PFNPVDKRTA+TYIDS+G
Sbjct  293  HVVLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNG  352

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC    +  KK H IID FA RGLRSLAVGRQ VPEKTKES G P
Sbjct  353  NWHRASKGAPEQILALCNAREDLKKKVHSIIDKFAERGLRSLAVGRQQVPEKTKESAGTP  412

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  413  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  472



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =   535 bits (1378),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q VLTAIGNFCICSIA+G+L+E+VVM+PIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QIVLTAIGNFCICSIALGMLVEVVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D  KD
Sbjct  300  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDTDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAIDACIVGML+DPKEARAGIQEVHFLPFNPV+KRTA TYIDS+G
Sbjct  360  GVLLYAARASRVENQDAIDACIVGMLADPKEARAGIQEVHFLPFNPVEKRTANTYIDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQII+LC L+ +  +K HEIID FA+RGLRSL V RQ VPE +KES G P
Sbjct  420  KWHRASKGAPEQIIDLCNLKEDVKRKVHEIIDKFADRGLRSLGVARQQVPEASKESTGGP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  480  WEFMGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  539



>ref|XP_004235922.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=954

 Score =   535 bits (1378),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 255/300 (85%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSILVGIIIEILVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDKSLVEVF +D  +D
Sbjct  303  MAIGSHKLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLEVDKSLVEVFAKDMDQD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML+D KEARAGIQEVHFLPFNPVDKRTAITYID++G
Sbjct  363  TVILLGARASRVENQDAIDACIVGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDTNG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI++LC L     +K H IID FA RGLRSLAV +Q+VPEKTKES G P
Sbjct  423  NWHRVSKGAPEQIVDLCRLSEHVKRKVHSIIDKFAERGLRSLAVAQQTVPEKTKESPGSP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  483  WVFVGLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  542



>gb|KHN01287.1| Plasma membrane ATPase 4 [Glycine soja]
Length=885

 Score =   533 bits (1372),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 255/300 (85%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEI+VM+PIQHR YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  173  QKVLTAIGNFCICSIAVGMVIEIIVMYPIQHRPYRSGIDNLLVLLIGGIPIAMPTVLSVT  232

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  233  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKDADKD  292

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIVGML DPKEAR GI+EVHFLPFNPVDKRTAITYID++G
Sbjct  293  TVILLAARASRVENQDAIDACIVGMLGDPKEARDGIKEVHFLPFNPVDKRTAITYIDNNG  352

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +W+R SKGAPEQII LC L  +  KKAH II  FA+RGLRSLAV +Q VPEKTKES G P
Sbjct  353  NWNRASKGAPEQIIHLCNLREDVKKKAHAIIGKFADRGLRSLAVAKQEVPEKTKESPGGP  412

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKET RRLGMG+NMYPSSS
Sbjct  413  WQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETARRLGMGSNMYPSSS  472



>gb|KEH39623.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=949

 Score =   535 bits (1377),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 258/300 (86%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEIVVM+PIQ R YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QKVLTAIGNFCICSIAVGMVIEIVVMYPIQRRKYRSGIDNLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LVEVF +D  KD
Sbjct  297  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFSRDTDKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGMLSDPKEAR G+ EVHFLPFNPVDKRTAITYID+ G
Sbjct  357  MVILLGARASRVENQDAIDACIVGMLSDPKEAREGLTEVHFLPFNPVDKRTAITYIDTDG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQII+LC L  +  +KA  IID FA RGLRSLAVG+Q VPEK+KES G P
Sbjct  417  NWHRVSKGAPEQIIDLCNLREDVKRKAISIIDKFAERGLRSLAVGKQEVPEKSKESSGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMG+NMYPSSS
Sbjct  477  WTFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSS  536



>ref|XP_010417678.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X1 [Camelina 
sativa]
Length=955

 Score =   535 bits (1377),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G++IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  KD
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +L+  ARASRVENQDAIDACIVGML DP+EAR GI EVHF PFNPVDKRTAITYID++G
Sbjct  362  QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +  K+AH+IID FA+RGLRSLAVGRQ+V EK K S G P
Sbjct  422  NWHRVSKGAPEQIIELCNLREDAKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>ref|XP_004508383.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X1 [Cicer 
arietinum]
Length=949

 Score =   534 bits (1376),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+LIEIVVM+PIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIAVGMLIEIVVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF  D  K+
Sbjct  300  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFPADLDKE  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +LL  ARASRVENQDAIDA IVGMLSDPKEARAGI EVHFLPFNPV KRTAITY DS G
Sbjct  360  GLLLAAARASRVENQDAIDASIVGMLSDPKEARAGITEVHFLPFNPVGKRTAITYYDSQG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +W+R SKGAPEQIIELC+L+GETLKKAH IID FA RGLRSL V RQ++ EKTKES G  
Sbjct  420  NWYRCSKGAPEQIIELCQLKGETLKKAHRIIDQFAERGLRSLGVSRQTISEKTKESEGDA  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGL+PLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFVGLMPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_010472896.1| PREDICTED: ATPase 9, plasma membrane-type isoform X3 [Camelina 
sativa]
 ref|XP_010472897.1| PREDICTED: ATPase 9, plasma membrane-type isoform X4 [Camelina 
sativa]
Length=955

 Score =   535 bits (1377),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G++IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  KD
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +L+  ARASRVENQDAIDACIVGML DP+EAR GI EVHF PFNPVDKRTAITYID++G
Sbjct  362  QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +  K+AH+IID FA+RGLRSLAVGRQ+V EK K S G P
Sbjct  422  NWHRVSKGAPEQIIELCNLREDAKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>ref|NP_178181.1| H(+)-ATPase 9 [Arabidopsis thaliana]
 sp|Q42556.2|PMA9_ARATH RecName: Full=ATPase 9, plasma membrane-type; AltName: Full=Proton 
pump 9 [Arabidopsis thaliana]
 gb|AAF14653.1|AC011713_1 Identical to gb|X73676 aha9 (ATAHA9) ATPase gene from Arabidopsis 
thaliana [Arabidopsis thaliana]
 gb|AEE36433.1| H(+)-ATPase 9 [Arabidopsis thaliana]
Length=954

 Score =   534 bits (1376),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAIGMLIEIVVMYPIQKRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  KD
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +L+  ARASRVENQDAIDACIVGML DP+EAR GI EVHF PFNPVDKRTAITYID++G
Sbjct  362  QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +  K+AH+IID FA+RGLRSLAVGRQ+V EK K S G P
Sbjct  422  NWHRVSKGAPEQIIELCNLREDASKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>ref|XP_010472895.1| PREDICTED: ATPase 9, plasma membrane-type isoform X2 [Camelina 
sativa]
Length=967

 Score =   535 bits (1377),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G++IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  281  QKVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  340

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  KD
Sbjct  341  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  400

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +L+  ARASRVENQDAIDACIVGML DP+EAR GI EVHF PFNPVDKRTAITYID++G
Sbjct  401  QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANG  460

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +  K+AH+IID FA+RGLRSLAVGRQ+V EK K S G P
Sbjct  461  NWHRVSKGAPEQIIELCNLREDAKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEP  520

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  521  WQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  580



>ref|XP_002875581.1| hypothetical protein ARALYDRAFT_323063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51840.1| hypothetical protein ARALYDRAFT_323063 [Arabidopsis lyrata subsp. 
lyrata]
Length=948

 Score =   534 bits (1375),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSI +G+LIEI++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVF ++   D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKNMDTD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L+ ARASR+ENQDAIDA IVGML DPKEAR GI EVHFLPFNPVDKRTAITYID  G
Sbjct  360  SVVLMAARASRIENQDAIDASIVGMLGDPKEARTGITEVHFLPFNPVDKRTAITYIDESG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELC L+GET +KAHE+ID FA RGLRSL V +Q+VPEKTKES G P
Sbjct  420  DWHRSSKGAPEQIIELCNLQGETKRKAHEVIDGFAERGLRSLGVAQQTVPEKTKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIG ETGRRLGMGTNMYPS+S
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTS  539



>ref|XP_006300372.1| hypothetical protein CARUB_v10022427mg [Capsella rubella]
 gb|EOA33270.1| hypothetical protein CARUB_v10022427mg [Capsella rubella]
Length=955

 Score =   534 bits (1375),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G++IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  KD
Sbjct  303  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +L+  ARASRVENQDAIDACIVGML DP+EAR GI EVHF PFNPVDKRTAITYID+ G
Sbjct  363  QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDATG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +  K+AH+IID FA+RGLRSLAVGRQ+V EK K S G P
Sbjct  423  NWHRVSKGAPEQIIELCNLREDAKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  483  WQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  542



>gb|KFK33846.1| hypothetical protein AALP_AA5G067500 [Arabis alpina]
Length=948

 Score =   533 bits (1374),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G+LIEI++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVF ++   D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPENMDSD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L+ ARASR+ENQDAIDA IVGML DPKEAR GI EVHFLPFNPV+KRTAITYID +G
Sbjct  360  GVVLMAARASRIENQDAIDASIVGMLGDPKEAREGISEVHFLPFNPVEKRTAITYIDENG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELC+L+GET +KAHE+ID FA RGLRSL V +Q+VPEKTKES G P
Sbjct  420  DWHRCSKGAPEQIIELCKLQGETKRKAHEVIDGFAERGLRSLGVAQQTVPEKTKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIG ETGRRLGMGTNMYPS+S
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTS  539



>gb|KFK42449.1| hypothetical protein AALP_AA2G258100 [Arabis alpina]
Length=953

 Score =   533 bits (1374),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G++IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241  QKVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  KD
Sbjct  301  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  360

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +L+  ARASRVENQDAIDACIVGML DP+EAR GI EVHF PFNPVDKRTAITYIDS G
Sbjct  361  QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDSSG  420

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +T K+AH+IID FA+RGLRSLAVGRQ+V  K K S G P
Sbjct  421  NWHRVSKGAPEQIIELCNLREDTKKRAHDIIDKFADRGLRSLAVGRQTVTAKDKNSPGEP  480

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  481  WQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  540



>gb|KEH37844.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=903

 Score =   532 bits (1370),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 255/300 (85%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG++IEI+VM+PIQ+R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIAVGMVIEIIVMYPIQNRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF  D +KD
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPTDMNKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  ARASRVENQDAIDA IV MLSDPKEARAGI EVHFLPFNPVDKRTAIT+ID +G
Sbjct  360  SVVLYAARASRVENQDAIDASIVNMLSDPKEARAGITEVHFLPFNPVDKRTAITFIDGNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC L+GETLK+AH+ ID +A RGLRSLAVG Q+V EKTKES G P
Sbjct  420  NWHRSSKGAPEQIIELCGLKGETLKRAHKTIDEYAERGLRSLAVGFQTVSEKTKESAGEP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WVFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>gb|ABA18112.1| putative plasma membrane ATPase [Arabidopsis arenosa]
Length=948

 Score =   533 bits (1374),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSI +G+LIEI++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVF ++   D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKNMDTD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L+ ARASR+ENQDAIDA IVGML DPKEARAGI EVHFLPFNPVDKRTAITYID  G
Sbjct  360  SVVLMAARASRIENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDESG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DW+R SKGAPEQIIELC L+GET +KAHE+ID FA RGLRSL V +Q+VPEKTKES G P
Sbjct  420  DWYRSSKGAPEQIIELCNLQGETKRKAHEVIDGFAERGLRSLGVAQQTVPEKTKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIG ETGRRLGMGTNMYPS+S
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTS  539



>ref|XP_009104474.1| PREDICTED: ATPase 9, plasma membrane-type [Brassica rapa]
Length=954

 Score =   533 bits (1374),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAIGMVIEIVVMYPIQHRSYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +L+  ARASRVENQDAIDACIVGML DP+EAR GI EVHF PFNPVDKRTAITYID+ G
Sbjct  362  QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDASG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +  K+AH+IID FA+RGLRSLAVGRQ+V EK K S G P
Sbjct  422  NWHRVSKGAPEQIIELCNLREDAKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>gb|KHN18583.1| ATPase 8, plasma membrane-type [Glycine soja]
Length=920

 Score =   532 bits (1371),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+LIEI+VMFPIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIAVGMLIEIIVMFPIQQRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF     +D
Sbjct  300  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPTGMDRD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++L  ARASR+ENQDAIDA IVGML DPKEARAGI EVHFLPFNPVDKRTAITYID  G
Sbjct  360  TLVLYAARASRIENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDGQG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+GE LKKAH++ID +ANRGLRSL V RQ+V EK KES G  
Sbjct  420  NWHRSSKGAPEQIIELCELKGEVLKKAHKVIDEYANRGLRSLGVSRQTVSEKNKESAGES  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_010472893.1| PREDICTED: ATPase 9, plasma membrane-type isoform X1 [Camelina 
sativa]
Length=994

 Score =   534 bits (1376),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G++IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  281  QKVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  340

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  KD
Sbjct  341  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  400

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +L+  ARASRVENQDAIDACIVGML DP+EAR GI EVHF PFNPVDKRTAITYID++G
Sbjct  401  QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANG  460

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +  K+AH+IID FA+RGLRSLAVGRQ+V EK K S G P
Sbjct  461  NWHRVSKGAPEQIIELCNLREDAKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEP  520

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  521  WQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  580



>ref|XP_011082157.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   533 bits (1373),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCICSIAVG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QQVLTAIGNFCICSIAVGILIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF +D  K+
Sbjct  302  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKDLDKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML+DPKEAR GI EVHFLPFNPV+KRTAITYIDS G
Sbjct  362  SVILLGARASRVENQDAIDACIVGMLADPKEARTGITEVHFLPFNPVEKRTAITYIDSSG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI+ELC L  +  ++ H IID FA+RGLRSLAV +Q VPEK KES G P
Sbjct  422  NWHRVSKGAPEQIVELCGLRDDMKRRVHSIIDKFADRGLRSLAVAQQVVPEKNKESAGGP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W FVGLLPLFDPPRHDS ETIKRA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WIFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>ref|XP_003529784.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =   533 bits (1372),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 255/300 (85%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEI+VM+PIQHR YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QKVLTAIGNFCICSIAVGMVIEIIVMYPIQHRPYRSGIDNLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  297  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKDADKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIVGML DPKEAR GI+EVHFLPFNPVDKRTAITYID++G
Sbjct  357  TVILLAARASRVENQDAIDACIVGMLGDPKEARDGIKEVHFLPFNPVDKRTAITYIDNNG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +W+R SKGAPEQII LC L  +  KKAH II  FA+RGLRSLAV +Q VPEKTKES G P
Sbjct  417  NWNRASKGAPEQIIHLCNLREDVKKKAHAIIGKFADRGLRSLAVAKQEVPEKTKESPGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKET RRLGMG+NMYPSSS
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETARRLGMGSNMYPSSS  536



>ref|XP_011017965.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=949

 Score =   533 bits (1372),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIEI+VM+PIQ+R YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAIGMLIEIIVMYPIQNRRYREGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D   D
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDMDSD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +LL  ARA+R+ENQDAIDA I GML DPKEARA I EVHFLPFNPV+KRTAITY DS G
Sbjct  359  TLLLHAARAARIENQDAIDASIFGMLVDPKEARADITEVHFLPFNPVEKRTAITYYDSKG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DW+R SKGAPEQII+LC+L+GE  KKAHEIIDNFA+RGLRSL V RQ++PEK KES G P
Sbjct  419  DWYRSSKGAPEQIIDLCQLKGEMKKKAHEIIDNFADRGLRSLGVARQTIPEKNKESEGGP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  538



>ref|XP_003549696.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform 1 [Glycine 
max]
Length=947

 Score =   533 bits (1372),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+LIEI+VMFPIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIAVGMLIEIIVMFPIQQRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF     +D
Sbjct  300  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPTGMDRD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++L  ARASR+ENQDAIDA IVGML DPKEARAGI EVHFLPFNPVDKRTAITYID  G
Sbjct  360  TLVLYAARASRIENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDGQG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+GE LKKAH++ID +ANRGLRSL V RQ+V EK KES G  
Sbjct  420  NWHRSSKGAPEQIIELCELKGEVLKKAHKVIDEYANRGLRSLGVSRQTVSEKNKESAGES  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_003542615.1| PREDICTED: ATPase 8, plasma membrane-type-like isoformX1 [Glycine 
max]
Length=947

 Score =   533 bits (1372),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIA+G+LIEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIAIGMLIEIIVMYPIQQRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF     KD
Sbjct  300  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPTGMDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++L  ARASR ENQDAIDA IVGMLSDPKEARAGI EVHFLPFNPVDKRTAITYID  G
Sbjct  360  TLVLYAARASRTENQDAIDASIVGMLSDPKEARAGITEVHFLPFNPVDKRTAITYIDGQG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+GE LKKAH++ID +ANRGLRSL V RQ+V EK KES G  
Sbjct  420  NWHRSSKGAPEQIIELCELKGEVLKKAHKVIDEYANRGLRSLGVSRQTVSEKNKESAGES  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   533 bits (1373),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVFV+D  K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHF PFNPVDKRTA+TYIDS+G
Sbjct  362  HVVLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC    +  KK H IID FA RGLRSLAVGRQ VPEKTKES G P
Sbjct  422  NWHRASKGAPEQILALCNAREDLKKKVHSIIDKFAERGLRSLAVGRQQVPEKTKESAGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  541



>ref|XP_011002373.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=944

 Score =   533 bits (1372),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  234  QKVLTAIGNFCICSIAIGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  293

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVFV+D  KD
Sbjct  294  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFVKDMDKD  353

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++L  ARASR ENQDAIDA IVG+L DP EAR+GI EVHFLPFNPV+KRTAITY D +G
Sbjct  354  TLILHAARASRTENQDAIDASIVGILGDPSEARSGIIEVHFLPFNPVEKRTAITYFDGNG  413

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DW+R SKGAPEQIIELCEL+G   KKAHEII NFA+RGLRSL V RQ +PEK KES G P
Sbjct  414  DWYRSSKGAPEQIIELCELKGNIRKKAHEIISNFADRGLRSLGVARQRIPEKNKESAGAP  473

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  474  WEFVGLLPLFDPPRHDSAETICRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  533



>ref|XP_007150788.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
 gb|ESW22782.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
Length=949

 Score =   533 bits (1372),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 257/300 (86%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEIVVM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QKVLTAIGNFCICSIAVGMIIEIVVMYPIQHRKYRSGINNLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  297  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKALIEVFSRDADKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAID CIVGML DPKEAR GIQEVHFLPFNPV+KRTAITYIDS G
Sbjct  357  TVILLGARASRVENQDAIDTCIVGMLGDPKEARDGIQEVHFLPFNPVEKRTAITYIDSDG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +W RVSKGAPEQIIELC L  +  KKA  II  FA+RGLRSLAV +Q VPEKTKES G P
Sbjct  417  NWSRVSKGAPEQIIELCNLREDVKKKALSIIGKFADRGLRSLAVAKQDVPEKTKESSGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMG+NMYPSSS
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSS  536



>gb|AAD46186.1| plasma membrane proton ATPase [Nicotiana plumbaginifolia]
Length=954

 Score =   533 bits (1372),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSILVGIVIEILVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK+LVEVF +D  +D
Sbjct  303  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLEVDKNLVEVFAKDIDQD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML+D KEARAGIQEVHFLPFNPVDKRTAITYID++G
Sbjct  363  TVILLGARASRVENQDAIDACIVGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDANG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +  ++AH +ID FA+RGLRSLAV +Q+VPE+TKES G P
Sbjct  423  NWHRVSKGAPEQIIELCGLSEDVKRRAHSVIDKFADRGLRSLAVAQQTVPERTKESPGGP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  483  WLFVGLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  542



>emb|CDP14278.1| unnamed protein product [Coffea canephora]
Length=1297

 Score =   542 bits (1396),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 279/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G++IEIVVM+P+QHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIGLGMVIEIVVMYPVQHRKYREGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK ++EVF ++  KD
Sbjct  300  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKQMIEVFPKNMDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  ARASR ENQDAIDA IV MLSDPKEARAGI E+HFLPFNPV+KRTAITYIDS+G
Sbjct  360  SVVLYAARASRTENQDAIDASIVNMLSDPKEARAGITELHFLPFNPVEKRTAITYIDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LCEL+GE  KKAH+IIDNFANRGLRSL V RQ+VPEK KES G P
Sbjct  420  DWHRSSKGAPEQIIDLCELKGEVRKKAHDIIDNFANRGLRSLGVARQAVPEKNKESAGGP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDSAETIK+A++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFIGLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539


 Score =   455 bits (1170),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 217/256 (85%), Positives = 235/256 (92%), Gaps = 0/256 (0%)
 Frame = -2

Query  768  LIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLT  589
            +I  IPIAMPTVLSVTMAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLT
Sbjct  630  VIVSIPIAMPTVLSVTMAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLT  689

Query  588  VDKSLVEVFVQDASKDDVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPF  409
            VDK ++EVF ++  KD V+L  ARASR ENQDAIDA IV MLSDPKEARAGI E+HFLPF
Sbjct  690  VDKQMIEVFPKNMDKDSVVLYAARASRTENQDAIDASIVNMLSDPKEARAGITELHFLPF  749

Query  408  NPVDKRTAITYIDSHGDWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAV  229
            NPV+KRTAITYIDS+GDWHR SKGAPEQII+LCEL+GE  KKAH+IIDNFANRGLRSL V
Sbjct  750  NPVEKRTAITYIDSNGDWHRSSKGAPEQIIDLCELKGEVRKKAHDIIDNFANRGLRSLGV  809

Query  228  GRQSVPEKTKESFGLPWEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKE  49
             RQ+VPEK KES G PWEF+GLLPLFDPPRHDSAETIK+A++LGVNVKMITGDQLAIGKE
Sbjct  810  ARQAVPEKNKESAGGPWEFIGLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKE  869

Query  48   TGRRLGMGTNMYPSSS  1
            TGRRLGMGTNMYPSSS
Sbjct  870  TGRRLGMGTNMYPSSS  885



>ref|XP_006341374.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Solanum tuberosum]
Length=992

 Score =   533 bits (1374),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSILVGIIIEILVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK LVEVF +D  +D
Sbjct  303  MAIGSHKLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLEVDKGLVEVFAKDMDQD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML+D KEARAGIQEVHFLPFNPVDKRTAITYID++G
Sbjct  363  TVILLGARASRVENQDAIDACIVGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDTNG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI++LC L     +K H IID FA+RGLRSLAV +Q+VPEKTKES G P
Sbjct  423  NWHRVSKGAPEQIVDLCRLSEHVKRKVHSIIDKFADRGLRSLAVAQQTVPEKTKESPGAP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  483  WVFVGLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  542



>ref|XP_007014222.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY31841.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=930

 Score =   531 bits (1369),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVFV+D  K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHF PFNPVDKRTA+TYIDS+G
Sbjct  362  HVVLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC    +  KK H IID FA RGLRSLAVGRQ VPEKTKES G P
Sbjct  422  NWHRASKGAPEQILALCNAREDLKKKVHSIIDKFAERGLRSLAVGRQQVPEKTKESAGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  541



>ref|XP_003531728.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =   532 bits (1371),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 255/300 (85%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEI+VM+PIQHR YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QKVLTAIGNFCICSIAVGMVIEIIVMYPIQHRPYRSGIDNLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  297  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKDADKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML DPKEAR GI+EVHFLPFNPVDKRTAITYID +G
Sbjct  357  IVILLGARASRVENQDAIDACIVGMLGDPKEARDGIKEVHFLPFNPVDKRTAITYIDING  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII LC +  +  K+AH II  FA+RGLRSLAV +Q VPEKTKES G P
Sbjct  417  NWHRASKGAPEQIIHLCNVREDVKKEAHAIIGKFADRGLRSLAVAKQEVPEKTKESPGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKET RRLGMG+NMYPSSS
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETARRLGMGSNMYPSSS  536



>ref|XP_009607951.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana tomentosiformis]
Length=954

 Score =   532 bits (1371),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSILVGIIIEILVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK+LVEVF +D  +D
Sbjct  303  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLEVDKNLVEVFAKDIDQD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML+D KEARAGIQEVHFLPFNPVDKRTAITYID++G
Sbjct  363  TVILLGARASRVENQDAIDACIVGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDANG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIELC L  +  ++ H +ID FA+RGLRSLAV +Q+VPE+TKES G P
Sbjct  423  NWHRVSKGAPEQIIELCGLSEDVKRRVHSVIDKFADRGLRSLAVAQQTVPERTKESPGGP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  483  WLFVGLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  542



>ref|XP_008776221.1| PREDICTED: ATPase 8, plasma membrane-type-like [Phoenix dactylifera]
Length=887

 Score =   530 bits (1365),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 250/300 (83%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  173  QKVLTAIGNFCICSIGVGMLVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  232

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+++E+FV+D  KD
Sbjct  233  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNMIEIFVKDIDKD  292

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  ARASRVENQDAIDA +VGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDS G
Sbjct  293  IVVLYAARASRVENQDAIDASVVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSAG  352

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR+SKGAPEQIIELC +  +  KK H IID FA+RGLRSL V +Q VPE  KES G P
Sbjct  353  KWHRISKGAPEQIIELCNMREDAKKKVHIIIDKFADRGLRSLGVAKQEVPEANKESLGRP  412

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  413  WQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  472



>gb|KDP38637.1| hypothetical protein JCGZ_03990 [Jatropha curcas]
Length=930

 Score =   531 bits (1368),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 256/300 (85%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLT+IGNFCICSIAVG++IEI++MFPIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QQVLTSIGNFCICSIAVGMIIEIIIMFPIQHRNYREGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MA+GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EV   D  KD
Sbjct  299  MAVGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVLASDLDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR+ENQDAIDA IVGML DPKEAR GI EVHFLPFNPV+KRTAITYID++G
Sbjct  359  FVVLLAARASRIENQDAIDASIVGMLGDPKEARTGITEVHFLPFNPVEKRTAITYIDNNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQII+LC L+GE  +KAHE+ID+FA RGLRSL V RQ++PEKTKES G P
Sbjct  419  DWHRCSKGAPEQIIDLCGLQGEIRRKAHEVIDSFAERGLRSLGVARQTIPEKTKESAGGP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  479  WEFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  538



>ref|XP_009419963.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   531 bits (1368),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  245  QKVLTAIGNFCICSIAVGMLIEIVVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  304

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EV+V D  KD
Sbjct  305  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVYVNDFDKD  364

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  A ASRVENQDAIDA IVGML+DPKEARAGIQEVHFLPFNPVDKRTAITYIDS+G
Sbjct  365  TVVLFAAMASRVENQDAIDAAIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNG  424

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII+LC L+ +  KK H +ID FA+RGLR+L V RQ VPE +KES G P
Sbjct  425  NWHRSSKGAPEQIIDLCNLKDDAKKKVHSMIDKFADRGLRALGVARQEVPEASKESAGGP  484

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  485  WQFIGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  544



>ref|XP_006419170.1| hypothetical protein EUTSA_v10002391mg [Eutrema salsugineum]
 gb|ESQ37606.1| hypothetical protein EUTSA_v10002391mg [Eutrema salsugineum]
Length=948

 Score =   531 bits (1367),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 252/300 (84%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G+LIEI++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVF ++   D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPRNLDTD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L+ ARASR+ENQDAIDA IVGML DPKEAR GI EVHFLPFNPVDKRTAITYID +G
Sbjct  360  AVVLMAARASRIENQDAIDASIVGMLGDPKEAREGITEVHFLPFNPVDKRTAITYIDENG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELC L+G+T +KAHE+ID FA RGLRSL V +Q+VP+KTKES G P
Sbjct  420  DWHRSSKGAPEQIIELCNLQGDTKRKAHEVIDGFAERGLRSLGVAQQTVPDKTKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIG ETGRRLGMGTNMYPS+S
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTS  539



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   531 bits (1367),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++LVEVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  362  HVLLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQI++LC+ + +  KKAH IID FA RGLRSLAVGRQ VPEK+KES G P
Sbjct  422  KWHRASKGAPEQILDLCKCKEDVKKKAHSIIDKFAERGLRSLAVGRQEVPEKSKESLGSP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  541



>gb|ABA18090.1| putative plasma membrane ATPase [Olimarabidopsis pumila]
Length=948

 Score =   531 bits (1367),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 252/300 (84%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSI +G+L+EI++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIGLGMLVEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVF  +   D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPSNMDTD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L+ ARASRVENQDAIDA IVGML DPKEARAGI EVHFLPFNPVDKRTAITY+D +G
Sbjct  360  SVVLMAARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYVDVNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQIIELC L+GET +KAHE+ID FA RGLRSL V +Q+VPEKTKES G P
Sbjct  420  DWHRSSKGAPEQIIELCNLQGETKRKAHEVIDGFAERGLRSLGVAQQTVPEKTKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLL LFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIG ETGRRLGMGTNMYPS+S
Sbjct  480  WEFVGLLALFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTS  539



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   531 bits (1367),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++LVEVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  362  HVLLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQI++LC+ + +  KKAH IID FA RGLRSLAVGRQ VPEK+KES G P
Sbjct  422  KWHRASKGAPEQILDLCKCKEDVKKKAHSIIDKFAERGLRSLAVGRQEVPEKSKESLGSP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  541



>ref|XP_010537896.1| PREDICTED: ATPase 9, plasma membrane-type [Tarenaya hassleriana]
Length=994

 Score =   532 bits (1370),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+EIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  281  QKVLTAIGNFCICSIAIGMLVEIVVMYPIQRRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  340

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS+VEVFV+D  KD
Sbjct  341  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  400

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             +++  ARASRVENQDAIDACIVGML DPKEAR GI+EVHF PFNPVDKRTAITYIDS+G
Sbjct  401  QLIVHAARASRVENQDAIDACIVGMLGDPKEARDGIEEVHFFPFNPVDKRTAITYIDSNG  460

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DW+RVSKGAPEQIIELC L  +  K++H IID FA+RGLRSLAVG+Q++P+K K   G P
Sbjct  461  DWYRVSKGAPEQIIELCNLREDAKKRSHAIIDKFADRGLRSLAVGKQAIPDKDKNGPGGP  520

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETIKRA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  521  WQFLGLLPLFDPPRHDSAETIKRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  580



>ref|XP_006597964.1| PREDICTED: ATPase 8, plasma membrane-type-like [Glycine max]
Length=862

 Score =   528 bits (1359),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+LIE+VVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241  QKVLTSIGNFCICSIAVGMLIELVVMYPIQKRSYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMD+LCSDKTGTLTLNKLTVDKSL+EVF     KD
Sbjct  301  MAIGSHRLSQQGAITKRMTAIEEMAGMDILCSDKTGTLTLNKLTVDKSLIEVFPTGMDKD  360

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++L  ARASR ENQDAIDA IVGML D KEARAGI EVHFLPFNPVDKRTAIT+ID++G
Sbjct  361  TLVLYAARASRTENQDAIDASIVGMLDDRKEARAGITEVHFLPFNPVDKRTAITFIDNNG  420

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPE+IIELC L+GETLKKAH++ID FANRGLRSL V RQ+V E+TKES G  
Sbjct  421  DWHRSSKGAPEEIIELCGLKGETLKKAHKVIDEFANRGLRSLGVSRQTVSERTKESAGDA  480

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDS+ETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  481  WEFLGLLPLFDPPRHDSSETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  540



>gb|KHN18251.1| ATPase 8, plasma membrane-type [Glycine soja]
Length=868

 Score =   528 bits (1359),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+LIE+VVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  247  QKVLTSIGNFCICSIAVGMLIELVVMYPIQKRSYRDGIDNLLVLLIGGIPIAMPTVLSVT  306

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMD+LCSDKTGTLTLNKLTVDKSL+EVF     KD
Sbjct  307  MAIGSHRLSQQGAITKRMTAIEEMAGMDILCSDKTGTLTLNKLTVDKSLIEVFPTGMDKD  366

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++L  ARASR ENQDAIDA IVGML D KEARAGI EVHFLPFNPVDKRTAIT+ID++G
Sbjct  367  TLVLYAARASRTENQDAIDASIVGMLDDRKEARAGITEVHFLPFNPVDKRTAITFIDNNG  426

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPE+IIELC L+GETLKKAH++ID FANRGLRSL V RQ+V E+TKES G  
Sbjct  427  DWHRSSKGAPEEIIELCGLKGETLKKAHKVIDEFANRGLRSLGVSRQTVSERTKESAGDA  486

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDS+ETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  487  WEFLGLLPLFDPPRHDSSETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  546



>ref|XP_004486623.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=949

 Score =   530 bits (1365),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEIVVM+PIQHR YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QKVLTAIGNFCICSIAVGMIIEIVVMYPIQHRKYRSGIDNLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D  KD
Sbjct  297  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFSRDTDKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGMLSDPKEAR G  EVHFLPFNPV+KRTA+TYID+ G
Sbjct  357  MVILLGARASRVENQDAIDACIVGMLSDPKEAREGCTEVHFLPFNPVEKRTAMTYIDTDG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC L  +  KKA  IID FA+RGLRSLAV +Q VPEK+KES G P
Sbjct  417  NWHRASKGAPEQIIELCNLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESPGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI++A+ LGVNVKMITGDQLAIGKETGRRLGMG+NMYPSSS
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSS  536



>ref|XP_009128205.1| PREDICTED: ATPase 8, plasma membrane-type [Brassica rapa]
Length=948

 Score =   530 bits (1365),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G+LIEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIGIGMLIEIVVMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKSL+EVF  +   D
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPSNLDTD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L+ ARASR+ENQDAIDA IVGML DPKEAR GI+EVHFLPFNPVDKRTAITYID +G
Sbjct  360  AVVLMAARASRIENQDAIDASIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITYIDENG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +W+R SKGAPEQIIELC L+GE  +KAHE+ID FA RGLRSL V +Q+VPEK+KES G P
Sbjct  420  EWYRSSKGAPEQIIELCNLQGEARRKAHEVIDGFAERGLRSLGVAQQTVPEKSKESDGSP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIG ETGRRLGMGTNMYPS+S
Sbjct  480  WEFIGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTS  539



>ref|XP_007135798.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
 gb|ESW07792.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
Length=949

 Score =   530 bits (1364),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 252/300 (84%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QKVLTAIGNFCICSIALGMVIEIIVMYPIQHRPYRKGIDNLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF ++A KD
Sbjct  297  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFGKNADKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML DP+EAR GI+E+HFLPFNPVDKRTAITYID +G
Sbjct  357  TVILLGARASRVENQDAIDACIVGMLGDPREARDGIREIHFLPFNPVDKRTAITYIDDNG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII+LC L  +  KK H II  FA+RGLRSLAV +Q VPEKTKES G P
Sbjct  417  NWHRASKGAPEQIIDLCNLREDVKKKVHAIIGKFADRGLRSLAVAQQEVPEKTKESKGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKET RRLGMG+NMYPSSS
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETARRLGMGSNMYPSSS  536



>ref|XP_009773901.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana sylvestris]
Length=954

 Score =   530 bits (1365),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 252/300 (84%), Positives = 278/300 (93%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSILVGIVIEILVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK+LVEVF +D  +D
Sbjct  303  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLEVDKNLVEVFAKDIDQD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML+D KEARAGIQEVHFLPFNPVDKRTAITYID++G
Sbjct  363  TVILLGARASRVENQDAIDACIVGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDANG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQIIE+C L  +  ++ H +ID FA+RGLRSLAV +Q+VPE+TKES G P
Sbjct  423  NWHRVSKGAPEQIIEICGLSEDVKRRVHSVIDKFADRGLRSLAVAQQTVPERTKESPGGP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  483  WLFVGLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  542



>emb|CAN78639.1| hypothetical protein VITISV_031738 [Vitis vinifera]
Length=958

 Score =   530 bits (1364),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+++EIVVM+PIQ R YR+GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  246  QKVLTAIGNFCICSIALGIIVEIVVMYPIQRRKYRDGINNLLVLLIGGIPIAMPTVLSVT  305

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS++E+F +D   D
Sbjct  306  MAIGSHRLSKQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEIFSKDVDSD  365

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIVGML+DP EAR+GI EVHFLPFNPV+KRTAITYIDS G
Sbjct  366  MVILLAARASRVENQDAIDACIVGMLADPSEARSGITEVHFLPFNPVEKRTAITYIDSDG  425

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC L+    KKAH IID FA+RGLRSLAV +Q+VPEK KES G P
Sbjct  426  NWHRASKGAPEQIIELCNLKDHAKKKAHAIIDKFADRGLRSLAVSQQTVPEKNKESAGGP  485

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  486  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  545



>ref|XP_007154926.1| hypothetical protein PHAVU_003G159200g [Phaseolus vulgaris]
 gb|ESW26920.1| hypothetical protein PHAVU_003G159200g [Phaseolus vulgaris]
Length=946

 Score =   529 bits (1363),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 252/300 (84%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+LIEI+VM+PIQ R YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIAVGMLIEIIVMYPIQQRAYREGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF     KD
Sbjct  300  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPTGMDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++L  ARASR+ENQDAIDA IVGML+DPKEARAGI EVHFLPFNPVDKRTAITYID   
Sbjct  360  ALVLYAARASRIENQDAIDASIVGMLADPKEARAGINEVHFLPFNPVDKRTAITYIDGQN  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC L+GE LKKAH++ID +ANRGLRSL V RQ+V EK+KES G  
Sbjct  420  NWHRSSKGAPEQIIELCGLKGEALKKAHKVIDEYANRGLRSLGVSRQTVSEKSKESVGDS  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   530 bits (1364),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 249/300 (83%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGILVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  302  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+HG
Sbjct  362  HVILLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAHG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  KK H +ID FA RGLRSL V RQ VPEKTKES G P
Sbjct  422  NWHRASKGAPEQILNLCNCKEDVRKKVHFVIDKFAERGLRSLGVARQEVPEKTKESLGSP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   529 bits (1363),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+SLVEVF +   K+
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRSLVEVFTKGVDKE  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASRVENQDAIDAC+VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS+G
Sbjct  360  YVLLLAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI++LC  + +  +K H +ID +A RGLRSLAV RQ VPEK+KES G P
Sbjct  420  NWHRASKGAPEQILDLCNCKEDVRRKVHSMIDKYAERGLRSLAVARQEVPEKSKESTGGP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  480  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  539



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   529 bits (1363),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 252/300 (84%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAVGMLIEIIVMYPIQHRNYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+E+F +D  KD
Sbjct  299  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIELFAKDTDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAIDA IVGML+DPKEARAGIQEVHFLPFNPVDKRTAITYIDS+G
Sbjct  359  TVLLYAARASRVENQDAIDASIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQI++LC L+ +  KK HE+ID FA+RGLRSLAV  Q VPE  KES G P
Sbjct  419  KWHRASKGAPEQIVDLCNLKEDAEKKVHEMIDKFADRGLRSLAVACQEVPEANKESAGGP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  479  WQFMGLLPLFDPPRHDSAETIRRALILGVNVKMITGDQLAIAKETGRRLGMGTNMYPSST  538



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =   529 bits (1363),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+++EIVVM+PIQ R YR+GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  238  QKVLTAIGNFCICSIALGIIVEIVVMYPIQRRKYRDGINNLLVLLIGGIPIAMPTVLSVT  297

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS++E+F +D   D
Sbjct  298  MAIGSHRLSKQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEIFSKDVDSD  357

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIVGML+DP EAR+GI EVHFLPFNPV+KRTAITYIDS G
Sbjct  358  MVILLAARASRVENQDAIDACIVGMLADPSEARSGITEVHFLPFNPVEKRTAITYIDSDG  417

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC L+    KKAH IID FA+RGLRSLAV +Q+VPEK KES G P
Sbjct  418  NWHRASKGAPEQIIELCNLKDHAKKKAHAIIDKFADRGLRSLAVSQQTVPEKNKESAGGP  477

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  478  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  537



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   529 bits (1363),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+SLVEVF +   K+
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRSLVEVFTKGVDKE  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASRVENQDAIDAC+VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS+G
Sbjct  360  YVLLLAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI++LC  + +  +K H +ID +A RGLRSLAV RQ VPEK+KES G P
Sbjct  420  NWHRASKGAPEQILDLCNCKEDVRRKVHSMIDKYAERGLRSLAVARQEVPEKSKESTGGP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  480  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  539



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   529 bits (1363),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 250/300 (83%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+ +EI+VMFPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGIFVEIIVMFPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  362  HVLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQI++LC    +  K+AH +ID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  422  SWHRASKGAPEQIMDLCSCREDVRKRAHSVIDKFAERGLRSLAVARQEVPEKTKESAGGP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>gb|KHN38020.1| Plasma membrane ATPase [Glycine soja]
Length=885

 Score =   527 bits (1357),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 253/300 (84%), Positives = 274/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEI+VM+PIQHR YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  173  QKVLTAIGNFCICSIAVGMVIEIIVMYPIQHRPYRSGIDNLLVLLIGGIPIAMPTVLSVT  232

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLC DKTGTLTLNKLTVDK+L+EVF +DA KD
Sbjct  233  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCRDKTGTLTLNKLTVDKTLIEVFAKDADKD  292

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML DPKEAR GI+EVHFLPFNPVDKRTAITYID +G
Sbjct  293  IVILLGARASRVENQDAIDACIVGMLGDPKEARDGIKEVHFLPFNPVDKRTAITYIDING  352

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII LC +  +  K+AH II  FA+RGLRSLAV +Q VP KTKES G P
Sbjct  353  NWHRASKGAPEQIIHLCNVREDVKKEAHAIIGKFADRGLRSLAVAKQEVPGKTKESPGGP  412

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKET RRLGMG+NMYPSSS
Sbjct  413  WQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETARRLGMGSNMYPSSS  472



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =   529 bits (1363),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 252/300 (84%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAVGMLIEIIVMYPIQHRNYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+E+F +D  KD
Sbjct  299  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIELFAKDTDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAIDA IVGML+DPKEARAGIQEVHFLPFNPVDKRTAITYIDS+G
Sbjct  359  TVLLYAARASRVENQDAIDASIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQI++LC L+ +  KK HE+ID FA+RGLRSLAV  Q VPE  KES G P
Sbjct  419  KWHRASKGAPEQIVDLCNLKEDAEKKVHEMIDKFADRGLRSLAVACQEVPEANKESAGGP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  479  WQFMGLLPLFDPPRHDSAETIRRALILGVNVKMITGDQLAIAKETGRRLGMGTNMYPSST  538



>gb|KDO67286.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=675

 Score =   519 bits (1337),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 244/300 (81%), Positives = 270/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++ EI++M+P+QHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAG++EVHFLPFNPVDKRTA+TYIDS G
Sbjct  362  HVILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC    +  KK H +ID FA RGLRSL V RQ +PEKTKES G P
Sbjct  422  NWHRASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+ VGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  482  WQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  541



>ref|XP_002437958.1| hypothetical protein SORBIDRAFT_10g005500 [Sorghum bicolor]
 gb|EER89325.1| hypothetical protein SORBIDRAFT_10g005500 [Sorghum bicolor]
Length=874

 Score =   526 bits (1354),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 249/300 (83%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCI SIA G+L+E+VVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  238  QQVLTAIGNFCIISIAAGMLVEVVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  297

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMD+LCSDKTGTLTLNKLTVDKSL+EV+ +   KD
Sbjct  298  MAIGSHRLSQQGAITKRMTAIEEMAGMDMLCSDKTGTLTLNKLTVDKSLIEVYSKGVDKD  357

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAID CIV ML+DPKEARAGIQEVHFLPFNPV+KRTAITYID +G
Sbjct  358  MVLLYAARASRVENQDAIDTCIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDGNG  417

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHRVSKGAPEQIIELC +  E  KK H +ID +A+RGLRSL V  Q VPEK+KES G P
Sbjct  418  DWHRVSKGAPEQIIELCNMGAEAEKKVHALIDGYADRGLRSLGVSYQQVPEKSKESAGEP  477

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPS++
Sbjct  478  WQFIGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSTT  537



>ref|XP_010539422.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Tarenaya hassleriana]
Length=885

 Score =   526 bits (1354),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 249/300 (83%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCICSIAVG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  173  QQVLTAIGNFCICSIAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  232

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  233  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKD  292

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
            +V+LL AR+SR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  293  EVILLAARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  352

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI++LC    +   K H +ID +A+RGLRSL V RQ VPEKTKES G P
Sbjct  353  NWHRASKGAPEQILDLCNARHDLRSKVHSVIDKYADRGLRSLGVARQVVPEKTKESPGGP  412

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPS+S
Sbjct  413  WQFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAS  472



>emb|CBI35956.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   528 bits (1359),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 250/300 (83%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+++EIVVM+PIQ R YR+GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIALGIIVEIVVMYPIQRRKYRDGINNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKS++E+F +D   D
Sbjct  300  MAIGSHRLSKQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEIFSKDVDSD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDACIVGML+DP EAR+GI EVHFLPFNPV+KRTAITYIDS G
Sbjct  360  MVILLAARASRVENQDAIDACIVGMLADPSEARSGITEVHFLPFNPVEKRTAITYIDSDG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELC L+    KKAH IID FA+RGLRSLAV +Q +PEK KES G P
Sbjct  420  NWHRASKGAPEQIIELCNLKDHAKKKAHAIIDKFADRGLRSLAVSQQVIPEKNKESAGGP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_007011593.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY29212.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=674

 Score =   518 bits (1334),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 244/300 (81%), Positives = 270/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+++EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  173  QKVLTAIGNFCICSIAVGIVVEIIVMYPIQHRKYRQGIDNLLVLLIGGIPIAMPTVLSVT  232

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF +   K+
Sbjct  233  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKE  292

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  ARASR ENQDAID  IVGML+DPKEARAGI+E+HFLPFNPVDKRTA+TYIDS G
Sbjct  293  QVILYAARASRTENQDAIDTAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDG  352

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII LC  + +  KK H +ID FA RGLRSL V RQ VPEKTKE+ G P
Sbjct  353  NWHRASKGAPEQIITLCNCKEDVKKKVHAVIDKFAERGLRSLGVARQEVPEKTKEAPGAP  412

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  413  WQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  472



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   527 bits (1357),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 249/300 (83%), Positives = 277/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVFV+   K+
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKTLVEVFVKGVDKE  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASRVENQDAIDAC+VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID++G
Sbjct  360  YVLLLPARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI++LC  + +  +K H +ID +A  GLRSLAV RQ VPEK+KES G P
Sbjct  420  NWHRASKGAPEQILDLCNCKEDVRRKVHSMIDKYAEAGLRSLAVARQEVPEKSKESAGGP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  480  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  539



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   527 bits (1357),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 274/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+++EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGIIVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVFV+   KD
Sbjct  302  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  362  HVILLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHRVSKGAPEQI+ LC  + +  K+ H +ID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  422  KWHRVSKGAPEQILNLCNCKEDVRKRVHSVIDKFAERGLRSLAVARQEVPEKTKESPGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>gb|KCW80694.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=815

 Score =   522 bits (1345),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 244/300 (81%), Positives = 271/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+ +E++VM+PIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAIGIAVELIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRTLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  362  HVILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQI+ LC  + +  +KAH +ID FA RGLRSL V RQ +PE+TK+S G P
Sbjct  422  KWHRASKGAPEQILNLCNCKEDVRRKAHAVIDKFAERGLRSLGVARQEIPERTKDSPGAP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =   526 bits (1356),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 250/300 (83%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L EI+VM+PIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSIAIGMLAEIIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LVEVF +   KD
Sbjct  303  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARA+R ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID++G
Sbjct  363  HVILLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC L  +  KK H IID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  423  NWHRASKGAPEQIMSLCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLL LFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  483  WQFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  542



>ref|XP_009381563.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=960

 Score =   527 bits (1357),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 274/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA G+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  248  QKVLTAIGNFCICSIAFGMLVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  307

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVFV+D  KD
Sbjct  308  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKDMDKD  367

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  ARASRVENQDAIDACIVGML+DPKEARAGIQE+HFLPFNPV+KRTAITY+DS G
Sbjct  368  TVVLYAARASRVENQDAIDACIVGMLADPKEARAGIQELHFLPFNPVEKRTAITYVDSKG  427

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQII+LC ++ +  KK H +I  FA+RGLR+L V RQ VPE +KES G P
Sbjct  428  KWHRASKGAPEQIIDLCNMKEDARKKVHAMIGKFADRGLRALGVARQEVPEASKESAGAP  487

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  488  WQFMGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSST  547



>gb|KHN22097.1| ATPase 8, plasma membrane-type [Glycine soja]
Length=1183

 Score =   533 bits (1373),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIA+G+LIEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIAIGMLIEIIVMYPIQQRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF     KD
Sbjct  300  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPTGMDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++L  ARASR ENQDAIDA IVGMLSDPKEARAGI EVHFLPFNPVDKRTAITYID  G
Sbjct  360  TLVLYAARASRTENQDAIDASIVGMLSDPKEARAGITEVHFLPFNPVDKRTAITYIDGQG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQIIELCEL+GE LKKAH++ID +ANRGLRSL V RQ+V EK KES G  
Sbjct  420  NWHRSSKGAPEQIIELCELKGEVLKKAHKVIDEYANRGLRSLGVSRQTVSEKNKESAGES  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEF+GLLPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  480  WEFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  539



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   526 bits (1356),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+EI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIALGMLVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVFV++  KD
Sbjct  302  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKNMDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L+ ARASRVENQDAIDA IVGML+DPKEARAGI+E+HFLPFNPV+KRTAITYIDS G
Sbjct  362  TVVLIAARASRVENQDAIDASIVGMLADPKEARAGIKEIHFLPFNPVEKRTAITYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII+LC L  E   K H +ID FA+RGLRSL V +Q VPEK+KES G P
Sbjct  422  NWHRASKGAPEQIIDLCNLNNEAKNKVHSMIDKFADRGLRSLGVAQQMVPEKSKESAGAP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>ref|XP_010227956.1| PREDICTED: ATPase 6, plasma membrane-type-like isoform X2 [Brachypodium 
distachyon]
Length=857

 Score =   523 bits (1348),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 269/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCI SIA G+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QQVLTAIGNFCIISIAAGMLVEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EV  +   KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVCSKSVDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAID CIV ML+DPKEARAGIQEVHFLPFNPVDKRTAITYID +G
Sbjct  359  MVLLYAARASRVENQDAIDTCIVNMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDGNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHRVSKGAPEQIIELC +  E  KK H  ID +A+RGLRSL V  Q VPEK KES G P
Sbjct  419  DWHRVSKGAPEQIIELCNMAPEAEKKVHASIDQYADRGLRSLGVSYQQVPEKNKESAGEP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPS++
Sbjct  479  WQFIGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSTA  538



>ref|XP_010525721.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   526 bits (1355),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 252/300 (84%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QKVLTAIGNFCICSIAVGMVIEIIVMYPIQHREYRDGIDNLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  297  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  ARASRVENQDAIDA +VGML+DPKEARAGI+EVHF PFNPVDKRTA+TYID  G
Sbjct  357  QVILFAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDGDG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHRVSKGAPEQII+LC    +  +K H IID +A RGLRSLAV RQ VPEKTKES G P
Sbjct  417  KWHRVSKGAPEQIIDLCGARDDLKRKVHAIIDKYAERGLRSLAVARQVVPEKTKESPGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  477  WEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  536



>ref|XP_008658955.1| PREDICTED: uncharacterized protein LOC100501185 isoform X1 [Zea 
mays]
 gb|AFW85572.1| hypothetical protein ZEAMMB73_839541 [Zea mays]
Length=857

 Score =   523 bits (1348),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCI SIA G+L+E++VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  238  QQVLTAIGNFCIISIAAGMLVEVIVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  297

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMD+LCSDKTGTLTLNKLTVDKSL+EV+ +   +D
Sbjct  298  MAIGSHRLSQQGAITKRMTAIEEMAGMDMLCSDKTGTLTLNKLTVDKSLIEVYSKGVDRD  357

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAID CIV ML+DPKEARAGIQEVHFLPFNPV+KRTAITYID +G
Sbjct  358  MVLLYAARASRVENQDAIDTCIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDGNG  417

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHRVSKGAPEQIIELC +  E  KK H +ID +A+RGLRSL V  Q VPEK+KES G P
Sbjct  418  DWHRVSKGAPEQIIELCNMGAEAEKKVHALIDGYADRGLRSLGVSYQQVPEKSKESAGDP  477

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPS++
Sbjct  478  WQFIGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSTT  537



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =   526 bits (1355),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 249/300 (83%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCICSIAVG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  238  QQVLTAIGNFCICSIAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  297

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  298  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKD  357

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
            +V+LL AR+SR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  358  EVILLAARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  417

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI++LC    +   K H +ID +A+RGLRSL V RQ VPEKTKES G P
Sbjct  418  NWHRASKGAPEQILDLCNARHDLRSKVHSVIDKYADRGLRSLGVARQVVPEKTKESPGGP  477

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPS+S
Sbjct  478  WQFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAS  537



>ref|XP_009341818.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Pyrus x 
bretschneideri]
Length=939

 Score =   526 bits (1354),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 254/300 (85%), Positives = 274/300 (91%), Gaps = 8/300 (3%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTSIGNFCICSIAVGMVIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EVF ++  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPKNVDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA IV ML+DPKEARAGI EVHFLPFNPVDKRTAITYID++G
Sbjct  359  GVVLLSARASRVENQDAIDASIVNMLADPKEARAGITEVHFLPFNPVDKRTAITYIDANG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQ        GE  KKAH +IDN+A RGLRSL V RQ+VPEKTKES G P
Sbjct  419  DWHRCSKGAPEQ--------GEARKKAHAVIDNYAERGLRSLGVARQTVPEKTKESAGNP  470

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  471  WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  530



>ref|XP_010539421.1| PREDICTED: ATPase 2, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=950

 Score =   526 bits (1355),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 249/300 (83%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCICSIAVG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  238  QQVLTAIGNFCICSIAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  297

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  298  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKD  357

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
            +V+LL AR+SR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  358  EVILLAARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  417

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI++LC    +   K H +ID +A+RGLRSL V RQ VPEKTKES G P
Sbjct  418  NWHRASKGAPEQILDLCNARHDLRSKVHSVIDKYADRGLRSLGVARQVVPEKTKESPGGP  477

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPS+S
Sbjct  478  WQFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAS  537



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   526 bits (1355),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCICSIAVG++IEI+VMFPIQHR YR GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QQVLTAIGNFCICSIAVGIVIEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  297  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  357  HVLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII LC    +  +K H IID +A RGLRSLAV RQ VPEKTKES G P
Sbjct  417  NWHRASKGAPEQIITLCNCREDMKRKVHSIIDKYAERGLRSLAVARQEVPEKTKESPGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI++A+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  536



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   526 bits (1354),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 276/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTSIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   K+
Sbjct  300  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKE  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASRVENQDAIDAC+VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID++G
Sbjct  360  HVLLLAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI++LC  + +  +K H +ID +A RGLRSLAV RQ VPEK+KES G  
Sbjct  420  NWHRASKGAPEQILDLCNSKEDVKRKVHAMIDKYAERGLRSLAVARQEVPEKSKESLGGR  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  480  WEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  539



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   526 bits (1354),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+++EI+VMFPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241  QKVLTAIGNFCICSIAVGIIVEIIVMFPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   +D
Sbjct  301  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDRD  360

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA +VGML+DPKEARAGI EVHFLPFNPVDKRTA+TY+D HG
Sbjct  361  HVVLLAARASRTENQDAIDAAMVGMLADPKEARAGITEVHFLPFNPVDKRTALTYVDDHG  420

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI+ +C    +  KK H +ID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  421  NWHRVSKGAPEQIMNICNCREDVRKKVHTVIDKFAERGLRSLAVARQEVPEKTKESPGGP  480

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI++A+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  481  WQFVGLLPLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  540



>ref|XP_010548606.1| PREDICTED: ATPase 2, plasma membrane-type [Tarenaya hassleriana]
Length=948

 Score =   525 bits (1353),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 250/300 (83%), Positives = 274/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q VLTAIGNFCICSIAVG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QMVLTAIGNFCICSIAVGMVIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  297  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  357  QVLLFAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI++L +   +  KK H +ID +A RGLRSLAV RQ VPEKTKES G P
Sbjct  417  NWHRVSKGAPEQILDLSKARDDLRKKVHAVIDKYAERGLRSLAVARQVVPEKTKESPGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPS++
Sbjct  477  WEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAT  536



>ref|XP_010669283.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669284.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
Length=952

 Score =   525 bits (1353),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 274/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIAVG+LIE+VVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTSIGNFCICSIAVGMLIEVVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LVEVF +   KD
Sbjct  302  MAIGSHKLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKKLVEVFAKGVEKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA +VGML+DPKEARAGI+EVHF PFNPVDKRTA+TYID++G
Sbjct  362  YVILLAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDANG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR SKGAPEQI+ LC  + +  KK H++IDN+A RGLRSLAV RQ VPEKTKES G P
Sbjct  422  DWHRASKGAPEQILALCGCKADVKKKVHDVIDNYAGRGLRSLAVARQEVPEKTKESPGGP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  482  WQFVGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSST  541



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   525 bits (1353),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 250/300 (83%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVFV+D  KD
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKDGDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASRVENQDAIDA IVG L+DP+EARA I EVHFLPFNPVDKRTAITYIDS+G
Sbjct  362  HVLLLAARASRVENQDAIDAAIVGTLADPREARASITEVHFLPFNPVDKRTAITYIDSNG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  KK H IID FA RGLRSLAV RQ VPEK+KES G P
Sbjct  422  NWHRASKGAPEQILALCNAKEDFKKKVHSIIDKFAERGLRSLAVSRQQVPEKSKESAGAP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLL LFDPPRHDSAETI++ + LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  482  WQFVGLLSLFDPPRHDSAETIRQTLHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  541



>ref|XP_006453323.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474211.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Citrus sinensis]
 gb|ESR66563.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=885

 Score =   523 bits (1347),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 271/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  173  QKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  232

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  233  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKD  292

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHF PFNPVDKRTA+TYIDS G
Sbjct  293  HVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDG  352

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQI+ LC  + +  KK H IID +A RGLRSLAV RQ VPE+TKES G P
Sbjct  353  HWHRASKGAPEQILALCNAKEDLKKKVHAIIDKYAERGLRSLAVARQEVPERTKESPGGP  412

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  413  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  472



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   525 bits (1352),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 249/300 (83%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L EI+VM+PIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSIAIGMLAEIIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LVEVF +   KD
Sbjct  303  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARA+R ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID++G
Sbjct  363  HVILLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC L  +  KK H IID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  423  NWHRASKGAPEQIMALCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLL LFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++
Sbjct  483  WQFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAT  542



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   525 bits (1352),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 249/300 (83%), Positives = 271/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  303  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAG++EVHFLPFNPVDKRTA+TYID+ G
Sbjct  363  HVILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDADG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC L  +  KK H IID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  423  NWHRASKGAPEQIMTLCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLL LFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  483  WQFVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  542



>gb|EMS46830.1| ATPase 9, plasma membrane-type [Triticum urartu]
Length=677

 Score =   516 bits (1329),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 244/300 (81%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCI SIA+G+L+EIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  121  QKVLTAIGNFCIVSIAIGMLVEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  180

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+++E FV+D  KD
Sbjct  181  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNMIESFVKDVDKD  240

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  ARASR ENQDAIDA IVGML+DPKEARAGIQEVHF+PFNPVDKRTAITY+DS G
Sbjct  241  AVVLYAARASRTENQDAIDASIVGMLADPKEARAGIQEVHFMPFNPVDKRTAITYVDSDG  300

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHRVSKGAPEQII+LC L  +  ++ H II  FA+RGLRSLAV RQSVPE+ KE+ G P
Sbjct  301  TWHRVSKGAPEQIIDLCGLREDVRRRVHGIIGKFADRGLRSLAVARQSVPERRKEAKGAP  360

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+ +LPLFDPPRHD AETI+RA++LGVN KMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  361  WQFLAVLPLFDPPRHDRAETIRRALQLGVNAKMITGDQLAIGKETGRRLGMGTNMYPSSS  420



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   525 bits (1352),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIALGILIEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+E+HFLPFNPVDKRTA+TYIDS G
Sbjct  362  HVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  K+ H +ID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  422  NWHRASKGAPEQILALCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGAP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>ref|XP_003564205.1| PREDICTED: ATPase 6, plasma membrane-type-like isoform X1 [Brachypodium 
distachyon]
Length=946

 Score =   525 bits (1351),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 269/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCI SIA G+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QQVLTAIGNFCIISIAAGMLVEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSL+EV  +   KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVCSKSVDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAID CIV ML+DPKEARAGIQEVHFLPFNPVDKRTAITYID +G
Sbjct  359  MVLLYAARASRVENQDAIDTCIVNMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDGNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHRVSKGAPEQIIELC +  E  KK H  ID +A+RGLRSL V  Q VPEK KES G P
Sbjct  419  DWHRVSKGAPEQIIELCNMAPEAEKKVHASIDQYADRGLRSLGVSYQQVPEKNKESAGEP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPS++
Sbjct  479  WQFIGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSTA  538



>ref|XP_010033996.1| PREDICTED: ATPase 9, plasma membrane-type isoform X3 [Eucalyptus 
grandis]
Length=920

 Score =   524 bits (1349),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 275/300 (92%), Gaps = 9/300 (3%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+ +EI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAVGMTVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +D  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDVDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LLGARASRVENQDAIDACIVGML+DPKEARA I EVHFLPFNPVDKRTAITY+DS+G
Sbjct  359  GVILLGARASRVENQDAIDACIVGMLADPKEARADITEVHFLPFNPVDKRTAITYVDSNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQ ++         KK H+IID FA+RGLRSLAV +Q+VPEKTK+S G P
Sbjct  419  NWHRVSKGAPEQDVK---------KKVHDIIDKFADRGLRSLAVAKQTVPEKTKDSAGEP  469

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  470  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  529



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   525 bits (1351),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 271/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIE++VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAVGILIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAG++EVHFLPFNPVDKRTA+TYIDS G
Sbjct  359  YVILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  KKAH +ID FA RGLRSL V RQ +PEK K+S G P
Sbjct  419  NWHRSSKGAPEQILNLCNCKEDVRKKAHSVIDKFAERGLRSLGVARQEIPEKNKDSPGAP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  479  WQFVGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  538



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =   525 bits (1351),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 250/300 (83%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLT+IGNFCICSIA+G+LIEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTSIGNFCICSIAIGMLIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++LVEVF +   K+
Sbjct  303  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLVEVFAKGVEKE  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  363  YVILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  KKAH +I+ FA+RGLRSLAV RQ VPEKTKES G P
Sbjct  423  NWHRASKGAPEQILTLCRCKEDVKKKAHGVIEKFADRGLRSLAVARQEVPEKTKESPGGP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETIKRA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  483  WQFVGLLPLFDPPRHDSAETIKRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  542



>dbj|BAL41366.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   524 bits (1350),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 250/300 (83%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCICSIAVG++IEI+VMFPIQHR YR GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QQVLTAIGNFCICSIAVGIVIEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  297  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  357  HVLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII LC    +  +K H IID +A RGLRSLAV RQ VPEKTKES G P
Sbjct  417  NWHRASKGAPEQIITLCNCREDMKRKVHSIIDKYAERGLRSLAVARQEVPEKTKESPGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI++A+ LGVNV+MITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRKALHLGVNVEMITGDQLAIGKETGRRLGMGTNMYPSSA  536



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   524 bits (1350),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIE++VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAIGILIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++L+EVF +   K+
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKE  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  359  YVILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSEG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQII LC  + +  KK H +ID FA RGLRSL V RQ VPEK+KES G P
Sbjct  419  KWHRASKGAPEQIINLCNCKEDVRKKVHSVIDKFAERGLRSLGVARQEVPEKSKESPGGP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  479  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  538



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   524 bits (1350),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 251/300 (84%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q VLTAIGNFCICSIAVG+LIEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QMVLTAIGNFCICSIAVGMLIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  297  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKALIEVFAKGVEKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAIDA +VGML+DPKEARAGI+E+HFLPFNPVDKRTA+TYIDS G
Sbjct  357  QVLLFAARASRVENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI++L +   +  K+ H IID +A RGLRSLAV RQ VPEKTKES G P
Sbjct  417  NWHRVSKGAPEQILDLSKARDDLRKRVHAIIDKYAERGLRSLAVARQVVPEKTKESPGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPS+S
Sbjct  477  WEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAS  536



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   524 bits (1350),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 249/300 (83%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LVEVF +   KD
Sbjct  303  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARA+R ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID++G
Sbjct  363  HVILLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC L  +  KK H IID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  423  NWHRASKGAPEQIMALCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLL LFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++
Sbjct  483  WQFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAT  542



>gb|KEH39757.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=820

 Score =   520 bits (1339),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 245/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+E++VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAIGILVELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++L+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  362  YVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQII LC  + +  KK H +ID FA RGLRSL V RQ VPE+TK+S G P
Sbjct  422  KWHRASKGAPEQIINLCNCKEDVRKKVHAVIDKFAERGLRSLGVARQEVPERTKDSPGGP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score =   524 bits (1350),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 270/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IE++VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAVGIVIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDK GTLTLNKL+VDK+LVEVF +   KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKAGTLTLNKLSVDKNLVEVFAKGVEKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  359  YVILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  K+AH  ID FA RGLRSL V RQ VPE+TKES G P
Sbjct  419  NWHRSSKGAPEQILNLCNCKEDVRKRAHATIDKFAERGLRSLGVARQEVPERTKESLGAP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  479  WQFVGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  538



>ref|XP_009410182.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   522 bits (1344),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  173  QKVLTAIGNFCICSIVVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  232

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVFV+D  KD
Sbjct  233  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFVRDLDKD  292

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++L  ARASRVENQDAIDACIVGML+DP+EARAGIQE+HFLPFNPV+KRTAITYI+S G
Sbjct  293  AIVLYAARASRVENQDAIDACIVGMLADPREARAGIQEIHFLPFNPVEKRTAITYIESDG  352

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQIIELC + G+   K H +I  FA+RGLR+L V RQ VPE +KES G P
Sbjct  353  KWHRSSKGAPEQIIELCNMRGDARTKVHGMITKFADRGLRALGVARQEVPEASKESAGGP  412

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  413  WQFLGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSST  472



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   524 bits (1350),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 271/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  303  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAG++EVHFLPFNPVDKRTA+TYID+ G
Sbjct  363  HVILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDADG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC L  +  +K H IID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  423  NWHRASKGAPEQIMTLCNLRDDAKRKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLL LFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  483  WQFVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  542



>ref|XP_009368031.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=948

 Score =   524 bits (1349),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  236  QKVLTAIGNFCICSIALGILIEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVT  295

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF +   K+
Sbjct  296  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKE  355

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+E+HFLPFNPVDKRTA+TYIDS G
Sbjct  356  HVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDG  415

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  K+ H +ID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  416  NWHRASKGAPEQILALCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGAP  475

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  476  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  535



>ref|XP_009410181.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   522 bits (1344),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI VG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  173  QKVLTAIGNFCICSIVVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  232

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVFV+D  KD
Sbjct  233  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFVRDLDKD  292

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             ++L  ARASRVENQDAIDACIVGML+DP+EARAGIQE+HFLPFNPV+KRTAITYI+S G
Sbjct  293  AIVLYAARASRVENQDAIDACIVGMLADPREARAGIQEIHFLPFNPVEKRTAITYIESDG  352

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQIIELC + G+   K H +I  FA+RGLR+L V RQ VPE +KES G P
Sbjct  353  KWHRSSKGAPEQIIELCNMRGDARTKVHGMITKFADRGLRALGVARQEVPEASKESAGGP  412

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  413  WQFLGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSST  472



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   524 bits (1349),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 244/300 (81%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA G++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIATGIVIEIIVMYPIQHRSYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  302  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA +VGML+DPKEARAGIQEVHFLPFNPVDKRTA+TY+D++G
Sbjct  362  HVVLLAARASRTENQDAIDAAMVGMLADPKEARAGIQEVHFLPFNPVDKRTALTYVDANG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  K+ H +ID FA RGLRSLAV RQ VPE+TKES G P
Sbjct  422  NWHRASKGAPEQIMSLCSCKEDVRKRVHAVIDKFAERGLRSLAVARQEVPERTKESAGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI++A+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>ref|XP_010932230.1| PREDICTED: plasma membrane ATPase 4 [Elaeis guineensis]
Length=953

 Score =   524 bits (1349),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSI +G+L+EIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIGLGMLVEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+++E+FV+D  KD
Sbjct  299  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNMIEIFVKDIDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  ARASRVENQDAIDA +VGML+DPKEARAGIQEVHFLPFNPVDKRTAITY DS G
Sbjct  359  TVVLYSARASRVENQDAIDASVVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYTDSAG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR+SKGAPEQIIELC +  ++ K+ H IID FA+RGLRSL V +Q VPE  KES G P
Sbjct  419  KWHRISKGAPEQIIELCNMREDSKKRIHAIIDKFADRGLRSLGVAKQEVPEANKESPGGP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  479  WQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  538



>gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   523 bits (1348),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL++DK+L+EVF +   KD
Sbjct  300  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSIDKALIEVFAKGVEKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID++G
Sbjct  360  HVILLAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC    +  KK H +ID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  420  NWHRASKGAPEQILSLCNCRDDIKKKVHAVIDKFAERGLRSLAVARQQVPEKTKESPGGP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLL LFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  480  WEFVGLLNLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  539



>gb|KDO67285.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=847

 Score =   520 bits (1339),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 244/300 (81%), Positives = 270/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++ EI++M+P+QHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAG++EVHFLPFNPVDKRTA+TYIDS G
Sbjct  362  HVILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC    +  KK H +ID FA RGLRSL V RQ +PEKTKES G P
Sbjct  422  NWHRASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+ VGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  482  WQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  541



>ref|XP_006648053.1| PREDICTED: ATPase 8, plasma membrane-type-like [Oryza brachyantha]
Length=950

 Score =   523 bits (1348),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q VLTAIGNFCI SIAVG+++EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QLVLTAIGNFCIISIAVGMIVEIIVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EV+ +   KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVYGRGLDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAID CIVGML+DPKEARAGI+EVHFLPFNPV+KRTAITYID +G
Sbjct  359  SVLLYAARASRVENQDAIDTCIVGMLADPKEARAGIKEVHFLPFNPVEKRTAITYIDGNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHR+SKGAPEQIIELC++  +  KK H +ID +A+RGLRSL V  Q VPEK+KES G P
Sbjct  419  DWHRISKGAPEQIIELCQMSKDAEKKVHTLIDQYADRGLRSLGVSYQKVPEKSKESAGEP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKET RRLGMGTNMYPS++
Sbjct  479  WQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETARRLGMGTNMYPSTT  538



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   523 bits (1348),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++L+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  362  HVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  KK H +ID FA RGLRSL V RQ VPEKTKES G P
Sbjct  422  NWHRASKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   523 bits (1347),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 270/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  303  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARA ++EVHFLPFNPVDKRTA+TYID+ G
Sbjct  363  HVILLAARASRTENQDAIDAAIVGMLADPKEARAAVREVHFLPFNPVDKRTALTYIDADG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC L  +  KK H IID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  423  NWHRASKGAPEQIMTLCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLL LFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  483  WQFVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  542



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =   523 bits (1347),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 271/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHF PFNPVDKRTA+TYIDS G
Sbjct  362  HVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQI+ LC  + +  KK H IID +A RGLRSLAV RQ VPE+TKES G P
Sbjct  422  HWHRASKGAPEQILALCNAKEDLKKKVHAIIDKYAERGLRSLAVARQEVPERTKESPGGP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  541



>ref|XP_004960134.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=951

 Score =   523 bits (1347),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 274/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEI+VMFPIQHR YR GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QKVLTAIGNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  297  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  357  HVLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI++LC    +  +K H IID +A RGLRSLAV RQ VPEK+K++ G P
Sbjct  417  NWHRVSKGAPEQILDLCNCREDMRRKVHSIIDKYAERGLRSLAVARQEVPEKSKDASGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI++A+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  536



>dbj|BAG94605.1| unnamed protein product [Oryza sativa Japonica Group]
Length=908

 Score =   521 bits (1343),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q VLTAIGNFCICSIAVG++IEI+VMFPIQHR YR GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  194  QTVLTAIGNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVT  253

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  254  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKD  313

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  314  HVLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  373

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  +K H +ID +A RGLRSLAV RQ VPEK+KES G P
Sbjct  374  NWHRASKGAPEQILTLCNCKEDVKRKVHAVIDKYAERGLRSLAVARQEVPEKSKESAGGP  433

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI++A+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  434  WQFVGLLPLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  493



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   523 bits (1347),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++L+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  362  HVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  KK H +ID FA RGLRSL V RQ VPEKTKES G P
Sbjct  422  NWHRASKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =   523 bits (1347),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 271/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241  QKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  301  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKD  360

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHF PFNPVDKRTA+TYIDS G
Sbjct  361  HVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDG  420

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQI+ LC  + +  KK H IID +A RGLRSLAV RQ VPE+TKES G P
Sbjct  421  HWHRASKGAPEQILALCNAKEDLKKKVHAIIDKYAERGLRSLAVARQEVPERTKESPGGP  480

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  481  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  540



>gb|KEH39753.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   523 bits (1346),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 249/300 (83%), Positives = 270/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCICSIAVG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QQVLTAIGNFCICSIAVGILIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD +L+EVF +   KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDTNLIEVFSRGMDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAID  IVGML DP EARAGI EVHFLPFNPVDKRTA+TYIDS G
Sbjct  359  FVILLAARASRVENQDAIDTAIVGMLPDPLEARAGINEVHFLPFNPVDKRTALTYIDSDG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ELC  +    K+AH +ID FA RGLRSL V  Q VPE+TK+S G P
Sbjct  419  NWHRSSKGAPEQILELCNCKENVSKRAHAVIDRFAERGLRSLGVAYQEVPERTKDSPGAP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  479  WQFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  538



>ref|XP_009390572.1| PREDICTED: ATPase 9, plasma membrane-type [Musa acuminata subsp. 
malaccensis]
Length=949

 Score =   523 bits (1346),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIE++VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  238  QKVLTAIGNFCICSIAVGMLIEVIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  297

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVFV    KD
Sbjct  298  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFVSGLDKD  357

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  A ASRVENQDAIDA IVGML+DPKEARAGIQEVHFLPFNPVDKRTAITYIDS+G
Sbjct  358  SVVLYAAMASRVENQDAIDASIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNG  417

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQII+LC ++ +  KK H +ID FA RGLR+L V RQ VPE  KES G P
Sbjct  418  KWHRSSKGAPEQIIDLCNMKDDAKKKVHAMIDKFAERGLRALGVARQEVPEANKESAGDP  477

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI++A+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  478  WQFIGLLPLFDPPRHDSAETIRQALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSST  537



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =   521 bits (1341),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 244/300 (81%), Positives = 270/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++ EI++M+P+QHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  173  QKVLTAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  232

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF +   K+
Sbjct  233  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKE  292

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAG++EVHFLPFNPVDKRTA+TYIDS G
Sbjct  293  HVILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDG  352

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC    +  KK H +ID FA RGLRSL V RQ +PEKTKES G P
Sbjct  353  NWHRASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAP  412

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+ VGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  413  WQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  472



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =   523 bits (1346),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 245/300 (82%), Positives = 271/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIE+VVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIALGILIELVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF ++  KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKNVEKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML++PKEARAG++E+HF PFNPVDKRTA+TYIDS G
Sbjct  359  YVILLAARASRTENQDAIDAAIVGMLANPKEARAGVREIHFFPFNPVDKRTALTYIDSDG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  KKAH +ID FA RGLRSL V RQ VPEK K+S G P
Sbjct  419  NWHRSSKGAPEQILNLCNCKEDVRKKAHSVIDKFAERGLRSLGVARQEVPEKNKDSPGAP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  479  WQFVGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  538



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =   523 bits (1346),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+ IEIVVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSIAVGIAIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF +   K+
Sbjct  303  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFPKGVEKE  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IV ML+DPKEARAG++E+HFLPFNPVDKRTA+TYIDS G
Sbjct  363  HVILLAARASRTENQDAIDAAIVNMLADPKEARAGVREIHFLPFNPVDKRTALTYIDSDG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ELC  + +  +K H +ID FA RGLRSL V RQ +PEKTKES G P
Sbjct  423  NWHRASKGAPEQILELCNCKEDFKRKVHAVIDKFAERGLRSLGVARQQIPEKTKESPGAP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  483  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  542



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   523 bits (1346),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+LIEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIALGILIEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VD++L+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLXVDRNLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+E+HFLPFNPVDKRTA+TYIDS G
Sbjct  362  HVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  K+ H +ID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  422  NWHRASKGAPEQILTLCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =   522 bits (1345),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 244/300 (81%), Positives = 271/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+ +E++VM+PIQHR YREGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAIGIAVELIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRTLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  362  HVILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQI+ LC  + +  +KAH +ID FA RGLRSL V RQ +PE+TK+S G P
Sbjct  422  KWHRASKGAPEQILNLCNCKEDVRRKAHAVIDKFAERGLRSLGVARQEIPERTKDSPGAP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   522 bits (1345),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+++EI+VMFPIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGIIVEIIVMFPIQDRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+E+F +   +D
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEIFTKGVDRD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  362  HVVLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI+ LC    +  KK H +ID FA RGLRSLAV RQ VPE+TKES G P
Sbjct  422  NWHRVSKGAPEQIMSLCNCREDVRKKVHNVIDKFAERGLRSLAVARQEVPERTKESAGGP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>ref|XP_008668762.1| PREDICTED: plasma membrane ATPase [Zea mays]
 tpg|DAA35606.1| TPA: plasma-membrane H+ATPase2 isoform 1 [Zea mays]
 tpg|DAA35607.1| TPA: plasma-membrane H+ATPase2 isoform 2 [Zea mays]
Length=951

 Score =   522 bits (1344),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCICSI VG+L+EI+VMFPIQHR YR GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QQVLTAIGNFCICSIGVGILVEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  297  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA +VGML+DPKEARAGI+E+HFLPFNPVDKRTA+TYID+ G
Sbjct  357  HVLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI++LC  + +  +K H IID +A RGLRSLAV RQ VPEK KES G P
Sbjct  417  NWHRVSKGAPEQILDLCHCKEDLRRKVHSIIDKYAERGLRSLAVARQEVPEKNKESPGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI++A+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  536



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   522 bits (1344),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 245/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+++EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  238  QKVLTAIGNFCICSIALGIVVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  297

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  298  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDKD  357

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA +VGML+DPKEARAGI+E+HFLPFNPVDKRTA+TYIDS+ 
Sbjct  358  HVVLLAARASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSNE  417

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI+ LC    +   K H +ID FA RGLRSLAV RQ VPEK+KES G P
Sbjct  418  NWHRVSKGAPEQILNLCNCREDVRNKVHNVIDKFAERGLRSLAVARQEVPEKSKESPGAP  477

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  478  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  537



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   522 bits (1344),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++L+EVF +   K+
Sbjct  302  MAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  362  HVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  KK H +ID FA RGLRSL V RQ VPEKTKES G P
Sbjct  422  NWHRASKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   522 bits (1344),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++L+EVF +   K+
Sbjct  302  MAIGSHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  362  HVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  KK H +ID FA RGLRSL V RQ VPEKTKES G P
Sbjct  422  NWHRASKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>gb|ACL54575.1| unknown [Zea mays]
Length=951

 Score =   522 bits (1344),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCICSI VG+L+EI+VMFPIQHR YR GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QQVLTAIGNFCICSIGVGILVEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  297  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA +VGML+DPKEARAGI+E+HFLPFNPVDKRTA+TYID+ G
Sbjct  357  HVLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI++LC  + +  +K H IID +A RGLRSLAV RQ VPEK KES G P
Sbjct  417  NWHRVSKGAPEQILDLCHCKEDLRRKVHSIIDKYAERGLRSLAVARQEVPEKNKESPGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI++A+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  536



>ref|NP_001054118.1| Os04g0656100 [Oryza sativa Japonica Group]
 sp|Q7XPY2.1|PMA1_ORYSJ RecName: Full=Plasma membrane ATPase; AltName: Full=Proton pump 
[Oryza sativa Japonica Group]
 emb|CAE03410.3| OSJNBa0071I13.11 [Oryza sativa Japonica Group]
 dbj|BAF16032.1| Os04g0656100 [Oryza sativa Japonica Group]
 emb|CAH66693.1| OSIGBa0158D24.1 [Oryza sativa Indica Group]
 gb|EAY95868.1| hypothetical protein OsI_17734 [Oryza sativa Indica Group]
Length=951

 Score =   521 bits (1343),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q VLTAIGNFCICSIAVG++IEI+VMFPIQHR YR GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QTVLTAIGNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  297  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  357  HVLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  +K H +ID +A RGLRSLAV RQ VPEK+KES G P
Sbjct  417  NWHRASKGAPEQILTLCNCKEDVKRKVHAVIDKYAERGLRSLAVARQEVPEKSKESAGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI++A+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  536



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   521 bits (1343),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 245/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+E++VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAIGILVELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++L+EVF +   K+
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKE  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  359  YVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQII LC  + +  KK H +ID FA RGLRSL V RQ VPE+TK+S G P
Sbjct  419  KWHRASKGAPEQIINLCNCKEDVRKKVHAVIDKFAERGLRSLGVARQEVPERTKDSPGGP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  479  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  538



>gb|EAZ32257.1| hypothetical protein OsJ_16461 [Oryza sativa Japonica Group]
Length=951

 Score =   521 bits (1343),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q VLTAIGNFCICSIAVG++IEI+VMFPIQHR YR GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QTVLTAIGNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  297  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  357  HVLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  +K H +ID +A RGLRSLAV RQ VPEK+KES G P
Sbjct  417  NWHRASKGAPEQILTLCNCKEDVKRKVHAVIDKYAERGLRSLAVARQEVPEKSKESAGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI++A+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  536



>gb|KDO67283.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
 gb|KDO67284.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=883

 Score =   520 bits (1338),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 244/300 (81%), Positives = 270/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++ EI++M+P+QHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAG++EVHFLPFNPVDKRTA+TYIDS G
Sbjct  362  HVILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC    +  KK H +ID FA RGLRSL V RQ +PEKTKES G P
Sbjct  422  NWHRASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+ VGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  482  WQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  541



>ref|XP_004966679.1| PREDICTED: ATPase 6, plasma membrane-type-like [Setaria italica]
Length=919

 Score =   520 bits (1340),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 245/300 (82%), Positives = 271/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCI SIA G+L+E+VVM+ +QHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QQVLTAIGNFCIISIAAGMLVEVVVMYSVQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMD+LCSDKTGTLTLNKLTVDKSL+EV+ +   KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDILCSDKTGTLTLNKLTVDKSLIEVYSKGVDKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  ARASRVENQDAID CIV ML+DPKEARAGIQEVHFLPFNPV+KRTAITY+D +G
Sbjct  359  MVLLYAARASRVENQDAIDTCIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYVDGNG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            DWHRVSKGAPEQIIELC +  +  KK H +ID +A+RGLRSL V  Q VPEK+KES G P
Sbjct  419  DWHRVSKGAPEQIIELCNMGADAEKKVHALIDGYADRGLRSLGVSYQQVPEKSKESAGEP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPS++
Sbjct  479  WQFIGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSTT  538



>ref|XP_010914190.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=957

 Score =   521 bits (1343),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+++EI+VMFPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGIVVEIIVMFPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   +D
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDRD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TY+D  G
Sbjct  362  YVLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYVDGDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI++LC    +  K+AH +ID FA RGLRSLAV RQ VPEK+KES G P
Sbjct  422  NWHRASKGAPEQIMDLCGCREDVRKRAHSVIDKFAERGLRSLAVARQEVPEKSKESAGGP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   521 bits (1343),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 269/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIE+VVM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  239  QKVLTAIGNFCICSIAVGILIELVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  298

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  299  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKD  358

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAG++EVHF PFNPVDKRTA+TYID+ G
Sbjct  359  YVILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFFPFNPVDKRTALTYIDADG  418

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  KKAH  ID FA RGLRSL V RQ +PEK K+S G P
Sbjct  419  NWHRSSKGAPEQILNLCNCKEDVRKKAHSTIDKFAERGLRSLGVARQEIPEKDKDSPGAP  478

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  479  WQFVGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  538



>gb|KDO67282.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=923

 Score =   520 bits (1340),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 244/300 (81%), Positives = 270/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++ EI++M+P+QHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAG++EVHFLPFNPVDKRTA+TYIDS G
Sbjct  362  HVILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC    +  KK H +ID FA RGLRSL V RQ +PEKTKES G P
Sbjct  422  NWHRASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+ VGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  482  WQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  541



>ref|NP_200545.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 ref|NP_001190559.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 sp|P20431.2|PMA3_ARATH RecName: Full=ATPase 3, plasma membrane-type; AltName: Full=Proton 
pump 3 [Arabidopsis thaliana]
 gb|AAA32750.1| ATPase [Arabidopsis thaliana]
 dbj|BAB09963.1| plasma membrane ATPase 3 [Arabidopsis thaliana]
 gb|AAL59975.1| putative plasma membrane proton pump ATPase 3 [Arabidopsis thaliana]
 gb|AED96889.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 gb|AED96890.1| H(+)-ATPase 3 [Arabidopsis thaliana]
Length=949

 Score =   521 bits (1342),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 245/300 (82%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+ IEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  238  QKVLTAIGNFCICSIAVGIAIEIVVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVT  297

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EV+ +   KD
Sbjct  298  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVYCKGVEKD  357

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
            +VLL  ARASRVENQDAIDA +VGML+DPKEARAGI+E+HFLPFNPVDKRTA+T+IDS+G
Sbjct  358  EVLLFAARASRVENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTFIDSNG  417

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI++LC    +  K+ H  ID +A RGLRSLAV RQ+VPEKTKES G P
Sbjct  418  NWHRVSKGAPEQILDLCNARADLRKRVHSTIDKYAERGLRSLAVSRQTVPEKTKESSGSP  477

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVG+LPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAI KETGRRLGMG+NMYPSSS
Sbjct  478  WEFVGVLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIAKETGRRLGMGSNMYPSSS  537



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =   521 bits (1343),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+++E++VM+PIQ+R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGIIVELIVMYPIQNRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+SL+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFAKGVDKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHF PFNPVDKRTA+TYIDS G
Sbjct  362  YVILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  +K H +ID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  422  NWHRASKGAPEQILTLCNCKEDVKRKVHSVIDKFAERGLRSLAVARQEVPEKTKESPGGP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =   521 bits (1342),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 271/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L E++VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LVEVF +   KD
Sbjct  303  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKD  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARA+R ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  363  HVILLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDASG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC L  +  KK H IID FA RGLRSLAV RQ VPEK+KES G P
Sbjct  423  NWHRASKGAPEQIMSLCNLRDDAKKKVHAIIDKFAERGLRSLAVSRQEVPEKSKESAGAP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLL LFDPPRHDSAETI++A+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  483  WQFVGLLSLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  542



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   521 bits (1342),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 244/300 (81%), Positives = 270/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+++EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGIVVEIIVMYPIQHRKYRQGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  ARASR ENQDAID  IVGML+DPKEARAGI+E+HFLPFNPVDKRTA+TYIDS G
Sbjct  362  QVILYAARASRTENQDAIDTAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQII LC  + +  KK H +ID FA RGLRSL V RQ VPEKTKE+ G P
Sbjct  422  NWHRASKGAPEQIITLCNCKEDVKKKVHAVIDKFAERGLRSLGVARQEVPEKTKEAPGAP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+GLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WQFIGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>ref|XP_002447249.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
 gb|EES11577.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
Length=951

 Score =   521 bits (1342),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            QQVLTAIGNFCICSIAVG+++EI+VMFPIQHR YR GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QQVLTAIGNFCICSIAVGIIVEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  297  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID  G
Sbjct  357  HVLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGDG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI++LC  + +  +K H IID +A RGLRSLAV RQ VPEK KES G P
Sbjct  417  NWHRVSKGAPEQILDLCHCKEDLRRKVHGIIDKYAERGLRSLAVARQEVPEKNKESPGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI++A+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  536



>gb|AAL09726.1| AT5g57350/MJB24_16 [Arabidopsis thaliana]
Length=949

 Score =   521 bits (1342),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 245/300 (82%), Positives = 275/300 (92%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+ IEIVVM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  238  QKVLTAIGNFCICSIAVGIAIEIVVMYPIQRRHYRDGIDNLLVLLIGGIPIAMPTVLSVT  297

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EV+ +   KD
Sbjct  298  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVYCKGVEKD  357

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
            +VLL  ARASRVENQDAIDA +VGML+DPKEARAGI+E+HFLPFNPVDKRTA+T+IDS+G
Sbjct  358  EVLLFAARASRVENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTFIDSNG  417

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI++LC    +  K+ H  ID +A RGLRSLAV RQ+VPEKTKES G P
Sbjct  418  NWHRVSKGAPEQILDLCNARADLRKRVHSTIDKYAERGLRSLAVSRQTVPEKTKESSGSP  477

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVG+LPLFDPPRHDSAETI+RA++LGVNVKMITGDQLAI KETGRRLGMG+NMYPSSS
Sbjct  478  WEFVGVLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIAKETGRRLGMGSNMYPSSS  537



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   521 bits (1342),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q VLTAIGNFCICSIAVG++IE+VVM+PIQHRGYR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  240  QMVLTAIGNFCICSIAVGMVIELVVMYPIQHRGYRDGIDNLLVLLIGGIPIAMPTVLSVT  299

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  300  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKD  359

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  360  HVILLAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  419

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ELC    +  KKAH  +D FA RGLRSLAV RQ VPEK+KES G P
Sbjct  420  NWHRASKGAPEQILELCNAREDVKKKAHSCMDKFAERGLRSLAVARQQVPEKSKESPGGP  479

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W FVGLL LFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  480  WXFVGLLNLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  539



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =   521 bits (1342),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 270/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+L+EI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIALGMLVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +   +D
Sbjct  302  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDRD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASRVENQDAID  IV ML+DP+EARAGIQEVHFLPFNPVDKRTAITYI+S G
Sbjct  362  KVVLLAARASRVENQDAIDTAIVNMLADPQEARAGIQEVHFLPFNPVDKRTAITYIESDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR SKGAPEQI++LC L  +  KK H IID +A+RGLRSLAV RQ VPE TKES G P
Sbjct  422  SWHRASKGAPEQIVDLCNLREDARKKVHSIIDKYADRGLRSLAVARQVVPEATKESAGRP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFV +LPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WEFVAVLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>ref|XP_010545412.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=957

 Score =   521 bits (1342),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 247/300 (82%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG++IEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  245  QKVLTAIGNFCICSIAVGMVIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  304

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  305  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKD  364

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
            +V+LL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHF PFNPVDKRTA+TYID+  
Sbjct  365  EVILLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDADV  424

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI++LC    +   + H +ID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  425  NWHRVSKGAPEQILDLCNARQDIRNRVHSVIDKFAERGLRSLAVARQVVPEKTKESSGGP  484

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSA+TIKRA+ELGVNVKMITGDQLAI KETGRRLGMG+NMYPS+S
Sbjct  485  WEFVGLLPLFDPPRHDSADTIKRALELGVNVKMITGDQLAIAKETGRRLGMGSNMYPSAS  544



>ref|XP_006652940.1| PREDICTED: plasma membrane ATPase-like [Oryza brachyantha]
Length=951

 Score =   521 bits (1342),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 245/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q VLTAIGNFCICSIAVG++IEI+VMFPIQHR YR GI+NLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QSVLTAIGNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  297  MAIGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLLL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID+ G
Sbjct  357  HVLLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  +K H +ID +A RGLRSLAV RQ VPEK+K+S G P
Sbjct  417  NWHRASKGAPEQILTLCNCKEDVKRKVHNVIDKYAERGLRSLAVARQEVPEKSKDSAGGP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI++A+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  477  WQFVGLLPLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  536



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   521 bits (1341),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 271/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIE++VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  243  QKVLTAIGNFCICSIAVGILIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  302

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+SL+EVFV+   K+
Sbjct  303  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFVKGVEKE  362

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYIDS+G
Sbjct  363  YVILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNG  422

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHRVSKGAPEQI+ LC    +  +K H +ID FA RGLRSL V RQ VPEKTK+S G P
Sbjct  423  TWHRVSKGAPEQILNLCNSREDVRRKVHAVIDKFAERGLRSLGVARQEVPEKTKDSPGGP  482

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+ VGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  483  WQLVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  542



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   521 bits (1342),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 245/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+L+EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   KD
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKTLIEVFAKGVEKD  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEARAGI+EVHF PFNPVDKRTA+TYIDS+G
Sbjct  362  HVILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  +K   +ID FA RGLRSLAV RQ VPEK+K+S G P
Sbjct  422  NWHRASKGAPEQILTLCNCKEDVKRKVFGVIDKFAERGLRSLAVARQEVPEKSKDSPGAP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+S
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  541



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   521 bits (1341),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 273/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+++EI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGMIVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF +   K+
Sbjct  302  MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID++G
Sbjct  362  YVVLLAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHRVSKGAPEQI+ LC  + +  KK H IID FA RGLRSLAV RQ VPE+ KES G P
Sbjct  422  SWHRVSKGAPEQIVTLCNCKEDVRKKVHAIIDKFAERGLRSLAVARQEVPERHKESPGAP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  541



>dbj|BAH56991.1| AT4G30190 [Arabidopsis thaliana]
Length=816

 Score =   516 bits (1330),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 248/300 (83%), Positives = 270/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  113  QKVLTAIGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  172

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  173  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKD  232

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  A ASRVENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID  G
Sbjct  233  QVLLFAAMASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGSG  292

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI+EL +   +  KK   IID +A RGLRSLAV RQ VPEKTKES G P
Sbjct  293  NWHRVSKGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGAP  352

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSA TI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  353  WEFVGLLPLFDPPRHDSAGTIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  412



>ref|XP_002438748.1| hypothetical protein SORBIDRAFT_10g025470 [Sorghum bicolor]
 gb|EER90115.1| hypothetical protein SORBIDRAFT_10g025470 [Sorghum bicolor]
Length=956

 Score =   521 bits (1341),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIEI+VM+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  245  QKVLTAIGNFCICSIAVGMLIEIIVMYPIQHRQYRDGIDNLLVLLIGGIPIAMPTVLSVT  304

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+++E FV+D  KD
Sbjct  305  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNMIEPFVKDLDKD  364

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+L  ARASR ENQDAIDA IVGML+DP+EARAGIQEVHF+PFNPVDKRTAITYIDS G
Sbjct  365  AVVLYAARASRTENQDAIDASIVGMLADPREARAGIQEVHFMPFNPVDKRTAITYIDSDG  424

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
             WHR+SKGAPEQIIELC L  +  ++ H II  FA+RGLRSLAV RQ +PE  K++ G P
Sbjct  425  SWHRISKGAPEQIIELCRLREDLSRRVHAIIAKFADRGLRSLAVARQRIPECNKDAPGTP  484

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+F+ +LPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS
Sbjct  485  WQFLAVLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  544



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   521 bits (1341),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 246/300 (82%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIAVG+LIE++VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  242  QKVLTAIGNFCICSIAVGILIELIVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  301

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++L+EVF +   K+
Sbjct  302  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKE  361

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAIDA IVGML+DPKEAR GI+EVHFLPFNPVDKRTA+TYIDS G
Sbjct  362  HVMLLAARASRTENQDAIDAAIVGMLADPKEARVGIREVHFLPFNPVDKRTALTYIDSDG  421

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +  K+ H +ID FA RGLRSLAV RQ VPEKTKES G P
Sbjct  422  NWHRASKGAPEQILALCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESPGTP  481

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  482  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  541



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   521 bits (1341),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 243/300 (81%), Positives = 272/300 (91%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G+++EI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  238  QKVLTAIGNFCICSIAIGMIVEIIVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  297

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF++   K+
Sbjct  298  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKTLIEVFIKGVDKE  357

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             V+LL ARASR ENQDAID  IVGML+DPKEARAGI+E+HFLPFNPVDKRTA+TYIDS+G
Sbjct  358  HVILLAARASRTENQDAIDTAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSNG  417

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHR SKGAPEQI+ LC  + +   K H +ID FA RGLRSLAV RQ VPE+TKES G P
Sbjct  418  NWHRASKGAPEQILSLCNCKEDVRNKVHSVIDKFAERGLRSLAVARQEVPEQTKESPGAP  477

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            W+FVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  478  WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  537



>pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump
 pdb|3B8C|B Chain B, Crystal Structure Of A Plasma Membrane Proton Pump
Length=885

 Score =   518 bits (1335),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 249/300 (83%), Positives = 271/300 (90%), Gaps = 0/300 (0%)
 Frame = -2

Query  900  QQVLTAIGNFCICSIAVGVLIEIVVMFPIQHRGYREGIDNLLVLLIGGIPIAMPTVLSVT  721
            Q+VLTAIGNFCICSIA+G++IEI+VM+PIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  237  QKVLTAIGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  296

Query  720  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFVQDASKD  541
            MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LVEVF +   KD
Sbjct  297  MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKD  356

Query  540  DVLLLGARASRVENQDAIDACIVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSHG  361
             VLL  A ASRVENQDAIDA +VGML+DPKEARAGI+EVHFLPFNPVDKRTA+TYID  G
Sbjct  357  QVLLFAAMASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGSG  416

Query  360  DWHRVSKGAPEQIIELCELEGETLKKAHEIIDNFANRGLRSLAVGRQSVPEKTKESFGLP  181
            +WHRVSKGAPEQI+EL +   +  KK   IID +A RGLRSLAV RQ VPEKTKES G P
Sbjct  417  NWHRVSKGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGAP  476

Query  180  WEFVGLLPLFDPPRHDSAETIKRAIELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  1
            WEFVGLLPLFDPPRHDSAETI+RA+ LGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS+
Sbjct  477  WEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  536



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1894744851408