BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19426_g4_i1 len=1146 path=[3061:0-1145]

Length=1146
                                                                      Score     E

gb|AFK46374.1|  unknown                                                 185   1e-51   
gb|KHN35778.1|  Plasma membrane ATPase 4                                183   4e-50   
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                189   2e-49   
emb|CDP14275.1|  unnamed protein product                                186   2e-49   
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                189   2e-49   
ref|XP_010429928.1|  PREDICTED: ATPase 9, plasma membrane-type-like     179   3e-49   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    186   3e-48   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     184   8e-48   
ref|XP_002307856.1|  ATPase 6 family protein                            184   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                184   1e-47   
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                184   1e-47   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     184   1e-47   
gb|AAB17186.1|  plasma membrane H+-ATPase                               184   1e-47   Solanum lycopersicum
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                184   1e-47   
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      183   2e-47   
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like     183   2e-47   
emb|CDP14278.1|  unnamed protein product                                184   2e-47   
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     182   5e-47   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     182   6e-47   
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type-like     182   8e-47   
gb|ABA18112.1|  putative plasma membrane ATPase                         181   9e-47   Arabidopsis arenosa
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    181   9e-47   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             181   1e-46   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     181   1e-46   
ref|NP_189850.1|  H(+)-ATPase 8                                         181   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          181   1e-46   
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             181   1e-46   
emb|CAC29436.1|  P-type H+-ATPase                                       181   1e-46   Vicia faba [broad bean]
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             181   1e-46   
ref|XP_002309321.1|  ATPase 6 family protein                            181   1e-46   Populus trichocarpa [western balsam poplar]
emb|CAA59799.1|  H(+)-transporting ATPase                               181   2e-46   Phaseolus vulgaris [French bean]
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     181   2e-46   
gb|ABA18090.1|  putative plasma membrane ATPase                         181   2e-46   Olimarabidopsis pumila
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           181   2e-46   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          181   2e-46   
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     180   2e-46   
gb|KEH39758.1|  plasma membrane H+-ATPase                               180   3e-46   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     180   3e-46   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             180   3e-46   
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           180   3e-46   
gb|KHN15309.1|  Plasma membrane ATPase 4                                179   4e-46   
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    179   4e-46   
gb|KEH35952.1|  plasma membrane H+-ATPase                               179   5e-46   
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          179   5e-46   
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    179   6e-46   
gb|AAO22672.1|  putative plasma membrane proton ATPase                  171   7e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AAF27113.1|AC018849_1  aha9, 5' partial; 1-2403                      176   7e-46   
emb|CAG28305.1|  proton-exporting ATPase                                171   7e-46   Cucumis sativus [cucumbers]
emb|CDY39956.1|  BnaC06g40340D                                          178   7e-46   
emb|CDX87330.1|  BnaA07g35430D                                          178   7e-46   
ref|XP_002324564.1|  ATPase 6 family protein                            179   8e-46   Populus trichocarpa [western balsam poplar]
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             179   8e-46   
ref|XP_010467151.1|  PREDICTED: ATPase 6, plasma membrane-type-like     170   8e-46   
emb|CAD62443.1|  proton-exporting ATPase                                170   9e-46   Zea mays [maize]
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          179   9e-46   
dbj|BAD16684.1|  plasma membrane H+-ATPase                              179   9e-46   Daucus carota [Queen Anne's lace]
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             179   1e-45   
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          178   1e-45   
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    178   1e-45   
ref|XP_002523524.1|  H(\+)-transporting atpase plant/fungi plasma...    176   1e-45   Ricinus communis
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    178   1e-45   
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      178   1e-45   
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like     178   1e-45   
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           178   2e-45   
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...    178   2e-45   
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...    178   2e-45   
gb|AAY42949.1|  plasma membrane H+ ATPase                               177   2e-45   Lupinus albus
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          177   2e-45   
ref|XP_003594954.1|  Plasma membrane ATPase                             177   2e-45   
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like     177   2e-45   
emb|CAD29579.1|  proton-exporting ATPase                                169   2e-45   Zea mays [maize]
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type          177   2e-45   
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     177   2e-45   
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    177   2e-45   
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             177   2e-45   
ref|NP_001169998.1|  uncharacterized protein LOC100383904               171   3e-45   Zea mays [maize]
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     177   3e-45   
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    177   3e-45   
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4                177   3e-45   
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    177   3e-45   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                177   4e-45   
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    177   4e-45   
gb|KHG19606.1|  ATPase 5, plasma membrane-type -like protein            175   4e-45   
gb|KHN16462.1|  Plasma membrane ATPase 4                                177   4e-45   
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          177   4e-45   
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          177   4e-45   
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     177   5e-45   
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          176   5e-45   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             176   5e-45   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   176   6e-45   
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             176   6e-45   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             176   6e-45   
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          176   6e-45   
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                176   6e-45   
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                176   6e-45   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     176   7e-45   
dbj|BAD16685.1|  plasma membrane H+-ATPase                              176   7e-45   Daucus carota [Queen Anne's lace]
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             176   9e-45   
gb|AAK31799.2|  plasma membrane H+ ATPase                               176   9e-45   Lilium longiflorum [Easter lily]
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     176   1e-44   
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           176   1e-44   
dbj|BAO02511.1|  predicted H+ ATPase ortholog                           173   1e-44   
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    176   1e-44   
ref|NP_001185450.1|  H(+)-ATPase 9                                      175   1e-44   
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             175   1e-44   
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    175   1e-44   
ref|NP_178181.1|  H(+)-ATPase 9                                         175   1e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAY42948.1|  plasma membrane H+ ATPase                               175   1e-44   Lupinus albus
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             175   2e-44   
dbj|BAC77531.1|  plasma membrane H+-ATPase                              175   2e-44   Sesbania rostrata
ref|XP_006293643.1|  hypothetical protein CARUB_v10022598mg             175   2e-44   
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    175   2e-44   
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     175   2e-44   
ref|XP_007023380.1|  H(+)-ATPase 9                                      174   2e-44   
ref|XP_007023381.1|  H(+)-ATPase 9                                      174   2e-44   
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           174   2e-44   
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                174   2e-44   
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        174   3e-44   Lilium longiflorum [Easter lily]
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                174   3e-44   
dbj|BAM20992.1|  plasma membrane H+-ATPase                              170   3e-44   
ref|XP_002515334.1|  H(\+)-transporting atpase plant/fungi plasma...    172   3e-44   Ricinus communis
gb|EPS59184.1|  hypothetical protein M569_15622                         171   3e-44   
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...    174   3e-44   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           174   3e-44   
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           174   3e-44   
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     174   3e-44   
dbj|BAC77530.1|  plasma membrane H+-ATPase                              174   3e-44   Sesbania rostrata
emb|CAB69823.1|  plasma membrane H+ ATPase                              174   3e-44   Prunus persica
ref|XP_011078615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    174   4e-44   
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       174   4e-44   
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             174   4e-44   
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       174   4e-44   
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       174   4e-44   
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1       174   4e-44   
gb|AAB84202.2|  plasma membrane proton ATPase                           174   4e-44   Kosteletzkya virginica [seashore mallow]
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    174   4e-44   
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    174   5e-44   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             174   5e-44   
emb|CBI35956.3|  unnamed protein product                                174   5e-44   
dbj|BAD16688.1|  plasma membrane H+-ATPase                              174   5e-44   Daucus carota [Queen Anne's lace]
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like           174   5e-44   
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           173   6e-44   
emb|CAN78639.1|  hypothetical protein VITISV_031738                     173   6e-44   Vitis vinifera
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             173   6e-44   Vitis vinifera
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          173   6e-44   
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          172   6e-44   
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...    172   8e-44   
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          173   8e-44   
ref|XP_007012006.1|  H(+)-ATPase 8                                      173   8e-44   
gb|AFM52333.1|  plasma membrane H+-ATPase                               173   9e-44   
emb|CDX67957.1|  BnaA07g19970D                                          172   9e-44   
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          173   9e-44   
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          173   9e-44   
gb|AAR32129.2|  proton P-ATPase                                         173   9e-44   Nicotiana tabacum [American tobacco]
gb|AAQ19039.1|  P-type H+-ATPase                                        166   9e-44   Vicia faba [broad bean]
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                   172   1e-43   
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           173   1e-43   
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             172   1e-43   
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             172   1e-43   
gb|EPS57651.1|  hypothetical protein M569_17165                         172   1e-43   
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    172   1e-43   
gb|AAQ19041.1|  P-type H+-ATPase                                        166   1e-43   Phaseolus acutifolius
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     172   1e-43   
gb|AEO22063.1|  plasma membrane H+-ATPase                               172   1e-43   
gb|KEH39623.1|  plasma membrane H+-ATPase                               172   1e-43   
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                172   1e-43   Vitis vinifera
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          172   1e-43   
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             172   1e-43   
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             172   1e-43   
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       172   2e-43   
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     172   2e-43   
gb|KHG28536.1|  Plasma membrane ATPase 4                                170   2e-43   
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 172   2e-43   
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          172   2e-43   
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          172   2e-43   
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  172   2e-43   
ref|XP_006350073.1|  PREDICTED: ATPase 8, plasma membrane-type-like     172   2e-43   
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           172   2e-43   
dbj|BAD19091.1|  putative H+-exporting ATPase                           172   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048395.2|  Os02g0797300                                       171   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          172   3e-43   
gb|KHN22411.1|  ATPase 9, plasma membrane-type                          171   3e-43   
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     171   3e-43   
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...    171   3e-43   
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     171   3e-43   
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    171   3e-43   
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          171   3e-43   Vitis vinifera
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    171   3e-43   
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     171   3e-43   
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           171   4e-43   
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             171   4e-43   
ref|XP_004287218.1|  PREDICTED: ATPase 8, plasma membrane-type-like     171   4e-43   
dbj|BAA08134.1|  putative plasma membrane H+-ATPase                     171   4e-43   Zostera marina
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...    169   4e-43   Ricinus communis
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   171   4e-43   Vicia faba [broad bean]
gb|KFK32649.1|  hypothetical protein AALP_AA6G270500                    170   4e-43   
gb|AAY42950.1|  plasma membrane H+ ATPase                               171   4e-43   Lupinus albus
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             171   5e-43   
ref|XP_008776221.1|  PREDICTED: ATPase 8, plasma membrane-type-like     171   5e-43   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     171   5e-43   
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...    171   5e-43   
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like           171   5e-43   
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          171   5e-43   
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           171   5e-43   
emb|CDY50939.1|  BnaC03g74390D                                          171   6e-43   
emb|CAN61424.1|  hypothetical protein VITISV_027272                     171   6e-43   Vitis vinifera
emb|CDX93092.1|  BnaA03g38140D                                          171   6e-43   
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                 170   7e-43   
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                170   8e-43   
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           170   8e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006382164.1|  H+-ATPase family protein                           170   9e-43   
emb|CAG28306.1|  proton-exporting ATPase                                162   9e-43   Cucumis sativus [cucumbers]
ref|NP_180028.1|  H(+)-ATPase 5                                         170   9e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                170   1e-42   
gb|AAB41898.1|  H+-transporting ATPase                                  170   1e-42   Mesembryanthemum crystallinum
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 170   1e-42   
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4-like           170   1e-42   
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    169   1e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CAN64375.1|  hypothetical protein VITISV_014422                     169   1e-42   Vitis vinifera
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...    169   1e-42   
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         169   1e-42   
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           169   1e-42   
ref|XP_002452983.1|  hypothetical protein SORBIDRAFT_04g036040          169   1e-42   Sorghum bicolor [broomcorn]
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                169   1e-42   
gb|AAO72564.1|  plasma membrane H+-ATPase-like protein                  166   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       169   2e-42   
gb|EYU24620.1|  hypothetical protein MIMGU_mgv1a001404mg                168   2e-42   
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                169   2e-42   
dbj|BAD16687.1|  plasma membrane H+-ATPase                              169   2e-42   Daucus carota [Queen Anne's lace]
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           169   2e-42   
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           169   2e-42   
gb|KHN18583.1|  ATPase 8, plasma membrane-type                          169   2e-42   
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    169   2e-42   
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     169   3e-42   
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    169   3e-42   
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     169   3e-42   
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g             168   3e-42   
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like             169   3e-42   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                168   4e-42   
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    168   5e-42   
gb|EPS65442.1|  hypothetical protein M569_09334                         168   5e-42   
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    167   5e-42   
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    167   6e-42   
gb|KGN65469.1|  hypothetical protein Csa_1G423270                       167   6e-42   
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           167   6e-42   
gb|KHG26452.1|  Plasma membrane ATPase 4                                165   7e-42   
gb|KHN01287.1|  Plasma membrane ATPase 4                                167   8e-42   
gb|KHN38020.1|  Plasma membrane ATPase                                  167   8e-42   
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like             167   8e-42   
ref|XP_006848753.1|  hypothetical protein AMTR_s00026p00031590          162   8e-42   
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         167   8e-42   
ref|NP_178762.1|  H(+)-ATPase 6                                         167   8e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     167   9e-42   
dbj|BAD94367.1|  plasma membrane proton ATPase                          158   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  167   1e-41   
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           167   1e-41   
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg             167   1e-41   
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    166   1e-41   
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             166   1e-41   
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           166   1e-41   
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like     166   1e-41   
dbj|BAM20989.1|  plasma membrane H+-ATPase                              166   2e-41   
gb|ABW25091.1|  plasma membrane proton pump                             166   2e-41   Cucumis sativus [cucumbers]
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    166   2e-41   
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           166   2e-41   
ref|XP_010094202.1|  Plasma membrane ATPase 4                           166   2e-41   
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like           166   2e-41   
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          166   2e-41   
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             166   2e-41   
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     166   3e-41   
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           166   3e-41   
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          166   3e-41   
dbj|BAO45902.1|  plasma membrane H+-ATPase                              166   3e-41   
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    166   3e-41   
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     166   3e-41   
gb|KGN60742.1|  hypothetical protein Csa_2G009310                       165   3e-41   
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       166   3e-41   
dbj|BAL41366.1|  plasma membrane H+-ATPase                              166   3e-41   
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    166   3e-41   
ref|XP_010097155.1|  ATPase 9, plasma membrane-type                     165   3e-41   
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     165   4e-41   
emb|CAD29312.1|  plasma membrane H+-ATPase                              165   4e-41   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  165   4e-41   
emb|CAC50884.1|  plasma membrane H+-ATPase                              163   4e-41   
gb|EMT26270.1|  Plasma membrane ATPase                                  165   5e-41   
gb|KEH32174.1|  plasma membrane H+-ATPase                               165   5e-41   
ref|XP_004159431.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 8, pl...    165   5e-41   
gb|AEQ27822.1|  PM H+-ATPase R                                          165   5e-41   
ref|XP_004139271.1|  PREDICTED: ATPase 8, plasma membrane-type-like     165   5e-41   
gb|KGN60167.1|  hypothetical protein Csa_3G881800                       162   6e-41   
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         165   6e-41   
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           165   6e-41   
gb|ACR38028.1|  unknown                                                 159   6e-41   
emb|CBI20766.3|  unnamed protein product                                164   6e-41   
gb|KHN22686.1|  Plasma membrane ATPase 4                                164   7e-41   
dbj|BAM20990.1|  plasma membrane H+-ATPase                              164   7e-41   
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    164   9e-41   
emb|CDP02997.1|  unnamed protein product                                164   9e-41   
emb|CAC10554.1|  plasma membrane proton ATPase                          158   9e-41   
dbj|BAF01699.1|  plasma membrane ATPase 3                               159   9e-41   
gb|AFW04239.1|  plasma membrane H+-ATPase                               164   1e-40   
gb|EPS63245.1|  hypothetical protein M569_11541                         164   1e-40   
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like           164   1e-40   
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                164   1e-40   
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           164   1e-40   
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                164   1e-40   
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4                164   1e-40   
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             163   1e-40   
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           164   1e-40   
ref|XP_008658955.1|  PREDICTED: uncharacterized protein LOC100501...    163   1e-40   
ref|XP_010417679.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    164   1e-40   
ref|XP_009773901.1|  PREDICTED: plasma membrane ATPase 4-like           164   1e-40   
gb|AAD46186.1|  plasma membrane proton ATPase                           164   1e-40   
gb|KGN65225.1|  hypothetical protein Csa_1G267210                       162   1e-40   
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  164   1e-40   
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             164   1e-40   
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             164   1e-40   
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          164   2e-40   
dbj|BAJ33915.1|  unnamed protein product                                164   2e-40   
dbj|BAG94605.1|  unnamed protein product                                163   2e-40   
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   163   2e-40   
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                163   2e-40   
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  163   2e-40   
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                163   2e-40   
ref|NP_179486.1|  H(+)-ATPase 1                                         163   2e-40   
emb|CAD29313.1|  plasma membrane H+-ATPase                              163   2e-40   
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           163   2e-40   
emb|CDO98206.1|  unnamed protein product                                163   2e-40   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             163   2e-40   
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           163   2e-40   
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  163   2e-40   
ref|NP_001054118.1|  Os04g0656100                                       163   3e-40   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          163   3e-40   
ref|XP_006341374.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    163   3e-40   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          163   3e-40   
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4                162   3e-40   
ref|XP_010472895.1|  PREDICTED: ATPase 9, plasma membrane-type is...    163   3e-40   
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             163   3e-40   
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          163   3e-40   
ref|XP_002324397.1|  H+-ATPase family protein                           163   3e-40   
gb|AHK23067.1|  plasma membrane ATPase 4                                163   3e-40   
gb|AAN15220.1|  plasma membrane P-type proton pump ATPase               162   4e-40   
tpg|DAA59899.1|  TPA: membrane H(+)-ATPase1                             158   4e-40   
gb|AAV49159.1|  plasma membrane proton ATPase 5                         162   4e-40   
ref|XP_006654259.1|  PREDICTED: plasma membrane ATPase 4-like           162   4e-40   
ref|NP_001136587.1|  uncharacterized protein LOC100216710               157   4e-40   
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like     162   4e-40   
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     162   5e-40   
dbj|BAG55917.1|  H+-ATPase                                              156   5e-40   
gb|AAA98916.1|  Theoretical protein with similarity to Swiss-Prot...    162   5e-40   
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     162   5e-40   
gb|KHN17608.1|  Plasma membrane ATPase 4                                162   5e-40   
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    162   5e-40   
gb|KDO36416.1|  hypothetical protein CISIN_1g037174mg                   154   5e-40   
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                    162   6e-40   
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          162   6e-40   
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    162   6e-40   
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    162   6e-40   
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             162   6e-40   
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             162   6e-40   
ref|NP_001183637.1|  uncharacterized protein LOC100502231               154   6e-40   
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           162   7e-40   
tpg|DAA59901.1|  TPA: membrane H(+)-ATPase1                             157   7e-40   
gb|ACL54575.1|  unknown                                                 162   7e-40   
ref|XP_004168485.1|  PREDICTED: plasma membrane ATPase 4-like           162   8e-40   
ref|XP_004136313.1|  PREDICTED: plasma membrane ATPase 4-like           161   8e-40   
emb|CDX76810.1|  BnaC08g33960D                                          161   8e-40   
gb|KEH37844.1|  plasma membrane H+-ATPase                               161   8e-40   
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like     161   9e-40   
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           161   9e-40   
emb|CAD29297.1|  plasma membrane H+ ATPase                              161   9e-40   
ref|XP_002438748.1|  hypothetical protein SORBIDRAFT_10g025470          161   1e-39   
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             161   1e-39   
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     161   1e-39   
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    161   1e-39   
gb|EYU35892.1|  hypothetical protein MIMGU_mgv1a0008592mg               152   1e-39   
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             161   1e-39   
gb|ABR18001.1|  unknown                                                 160   1e-39   
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type          160   1e-39   
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    160   1e-39   
gb|AFW76177.1|  hypothetical protein ZEAMMB73_418989                    160   1e-39   
gb|KHF98166.1|  Plasma membrane ATPase 4                                159   2e-39   
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    160   2e-39   
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    160   2e-39   
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                   160   2e-39   
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          160   2e-39   
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    160   2e-39   
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     160   2e-39   
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    160   2e-39   
ref|XP_008649034.1|  PREDICTED: ATPase 2, plasma membrane-type-like     160   2e-39   
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     160   2e-39   
emb|CDX82608.1|  BnaC07g02580D                                          160   2e-39   
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    160   2e-39   
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             160   2e-39   
ref|XP_002437958.1|  hypothetical protein SORBIDRAFT_10g005500          160   2e-39   
emb|CDY34767.1|  BnaA09g41340D                                          160   2e-39   
ref|XP_009117122.1|  PREDICTED: ATPase 5, plasma membrane-type          160   2e-39   
emb|CBW30173.1|  Plasma membrane ATPase 4                               160   2e-39   
dbj|BAA37150.1|  p-type H+-ATPase                                       160   2e-39   
emb|CDY64741.1|  BnaCnng44750D                                          160   3e-39   
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             160   3e-39   
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4                160   3e-39   
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                   160   3e-39   
emb|CDY03545.1|  BnaC03g68040D                                          158   3e-39   
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   160   3e-39   
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          160   3e-39   
ref|XP_010313836.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    159   3e-39   
ref|XP_004251768.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    159   3e-39   
ref|XP_002297804.2|  H+-ATPase family protein                           159   3e-39   
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like     159   4e-39   
gb|EEE65209.1|  hypothetical protein OsJ_20350                          159   4e-39   
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             159   4e-39   
ref|XP_002304716.2|  H+-ATPase family protein                           159   4e-39   
ref|XP_008650289.1|  PREDICTED: ATPase 8, plasma membrane-type-like     152   4e-39   
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like           159   5e-39   
ref|NP_001169535.1|  uncharacterized protein LOC100383411               152   5e-39   
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     159   5e-39   
dbj|BAK05828.1|  predicted protein                                      159   5e-39   
ref|XP_003564205.1|  PREDICTED: ATPase 6, plasma membrane-type-li...    159   7e-39   
ref|XP_011034499.1|  PREDICTED: plasma membrane ATPase 4-like           159   7e-39   
dbj|BAD72314.1|  plasma membrane H+-ATPase                              158   7e-39   
ref|XP_006838797.1|  hypothetical protein AMTR_s00002p00260210          159   7e-39   
emb|CAD29316.1|  plasma membrane H+-ATPase                              158   8e-39   
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             159   8e-39   
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    159   9e-39   
emb|CBW30211.1|  Plasma membrane ATPase                                 158   1e-38   
gb|EMS60594.1|  Plasma membrane ATPase                                  158   1e-38   
ref|XP_009150710.1|  PREDICTED: ATPase 1, plasma membrane-type-like     158   1e-38   
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    158   1e-38   
dbj|BAF03589.1|  P-type H+-ATPase                                       158   1e-38   
gb|ACE77057.1|  plasma membrane proton pump                             158   1e-38   
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    158   1e-38   
ref|XP_010691624.1|  PREDICTED: ATPase 9, plasma membrane-type is...    158   1e-38   
dbj|BAM20991.1|  plasma membrane H+-ATPase                              158   1e-38   
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    158   1e-38   
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          158   1e-38   
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     158   1e-38   
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          158   1e-38   
dbj|BAH56991.1|  AT4G30190                                              157   2e-38   
ref|NP_001190870.1|  H(+)-ATPase 2                                      157   2e-38   
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like     157   2e-38   
ref|NP_001056980.1|  Os06g0181500                                       157   2e-38   
gb|ACN34067.1|  unknown                                                 155   2e-38   
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...    157   2e-38   
ref|XP_010111939.1|  Plasma membrane ATPase 4                           157   3e-38   
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             157   3e-38   
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             157   3e-38   
gb|ABC59935.1|  P-type ATPase                                           157   3e-38   
ref|NP_194748.1|  H(+)-ATPase 2                                         157   3e-38   
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like     157   3e-38   
dbj|BAD16686.1|  plasma membrane H+-ATPase                              157   3e-38   
gb|KEH39753.1|  plasma membrane H+-ATPase                               157   3e-38   
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             157   4e-38   
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          157   4e-38   
emb|CDY14186.1|  BnaA08g13170D                                          156   4e-38   
gb|KFK27283.1|  h(+)-atpase 3                                           156   5e-38   
ref|XP_006597964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     156   5e-38   
gb|KHN18251.1|  ATPase 8, plasma membrane-type                          155   6e-38   
ref|XP_010273791.1|  PREDICTED: plasma membrane ATPase-like isofo...    155   6e-38   
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                    156   7e-38   
ref|XP_010539792.1|  PREDICTED: ATPase 3, plasma membrane-type-like     155   7e-38   
dbj|BAM20988.1|  plasma membrane H+-ATPase                              152   9e-38   
emb|CDY30730.1|  BnaA02g33520D                                          154   1e-37   
gb|AAL09726.1|  AT5g57350/MJB24_16                                      155   1e-37   
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     155   1e-37   
gb|AAV71150.1|  plasma membrane H+-ATPase                               155   1e-37   
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like             155   1e-37   
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             155   1e-37   
gb|KHG12451.1|  ATPase 4, plasma membrane-type -like protein            153   1e-37   
dbj|BAJ34124.1|  unnamed protein product                                155   1e-37   
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          155   1e-37   
ref|XP_010273789.1|  PREDICTED: ATPase 10, plasma membrane-type-l...    155   1e-37   
ref|NP_200545.1|  H(+)-ATPase 3                                         155   1e-37   
gb|AAD46188.1|  plasma membrane proton ATPase                           155   2e-37   
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          155   2e-37   
gb|KDP38637.1|  hypothetical protein JCGZ_03990                         155   2e-37   
gb|KEH19962.1|  plasma membrane H+-ATPase                               155   2e-37   
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     155   2e-37   
ref|XP_004955721.1|  PREDICTED: plasma membrane ATPase 1-like           155   2e-37   
dbj|BAD16689.1|  plasma membrane H+-ATPase                              154   2e-37   
ref|XP_008650970.1|  PREDICTED: uncharacterized protein LOC100216...    154   2e-37   
gb|KFK29576.1|  h(+)-atpase 2                                           154   2e-37   
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 154   3e-37   
ref|XP_002459489.1|  hypothetical protein SORBIDRAFT_02g005440          154   3e-37   
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         154   3e-37   
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         154   4e-37   
ref|XP_009782785.1|  PREDICTED: ATPase 10, plasma membrane-type i...    154   4e-37   
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             153   6e-37   
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    153   6e-37   
ref|XP_007138427.1|  hypothetical protein PHAVU_009G208000g             152   6e-37   
ref|XP_011082991.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    153   7e-37   
emb|CAB41144.1|  H+-transporting ATPase-like protein                    153   7e-37   
ref|NP_190378.2|  H(+)-ATPase 4                                         153   7e-37   
emb|CDY45757.1|  BnaC02g42250D                                          153   7e-37   
ref|XP_009608472.1|  PREDICTED: ATPase 10, plasma membrane-type i...    153   8e-37   
ref|NP_201073.1|  H(+)-ATPase 11                                        153   8e-37   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             153   8e-37   
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    153   8e-37   
ref|XP_006426822.1|  hypothetical protein CICLE_v100248072mg            150   8e-37   
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             152   9e-37   



>gb|AFK46374.1| unknown [Lotus japonicus]
Length=289

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 177/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA G+ LG+Y ALMT +FF+L+ DTDFF D F V
Sbjct  24   DGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGSYMALMTVVFFWLIKDTDFFPDKFGV  83

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP E+ AA+YLQ+SIISQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT + V
Sbjct  84   RSIRNSPGEMMAALYLQVSIISQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATFLAV  143

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANWSFARI G+GWGWAGVIW+Y+I+TY PLD++KF  R AL+        +N+T+    
Sbjct  144  YANWSFARINGMGWGWAGVIWLYTIVTYIPLDLLKFAIRYALSGKAWDNLLENKTAFTTK  203

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  NEKNS    SE+ +      E  RLRE  
Sbjct  204  KDYGKEEREAQWAAAQRTLHGLQPPETSNVFNEKNSYRELSEIAEQAKRRAEVARLRELH  263

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  264  TLKGHV---ESVVKLKGLDIDTIQQHYTV  289



>gb|KHN35778.1| Plasma membrane ATPase 4 [Glycine soja]
Length=365

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 178/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LG Y ALMT +FF+ + +T FF D F V
Sbjct  100  DGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGGYLALMTVIFFWAIKETTFFPDKFGV  159

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +H +P E+TAA+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+ AQ +AT I V
Sbjct  160  RPIHDNPDEMTAALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFVIAQLIATVIAV  219

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQGIGWGWAGVIW+YSI+ YFPLDI+KF  R  L+        +N+T+    
Sbjct  220  YANWGFARIQGIGWGWAGVIWLYSIVFYFPLDIMKFAIRYILSGKAWNNLLENKTAFTTK  279

Query  506  -------------------------KAPNQCNEKNS-SEMTDL-ECAPE--EATRLREDD  598
                                     +  N  NEK+S  E+T++ E A    E  RLRE  
Sbjct  280  KDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEIAEQAKRRAEVARLRELH  339

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  340  TLKGHV---ESVVKLKGLDIDTIQQHYTV  365



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score =   189 bits (480),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 179/268 (67%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA GI LGTY ALMT +FF+L SDTDFF+D F V
Sbjct  685  DGTIMTISKDRVKPSPVPDSWKLNEIFATGIVLGTYMALMTVIFFYLASDTDFFSDTFNV  744

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KS+ G+P+ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG LLL AFL AQ +AT I V
Sbjct  745  KSMRGNPNELTAALYLQVSIISQALIFVTRSRSWSFVERPGFLLLGAFLIAQLLATVIAV  804

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAAL----------------TD  493
            YA W FARI GIGWGWAGVIWI+SI+TYFPLD++KFI R AL                T 
Sbjct  805  YAKWEFARISGIGWGWAGVIWIFSIVTYFPLDVLKFIIRFALSGKAWDSMIQNKTAFTTK  864

Query  494  NETSKAPNQC---------------------NEKNSSEMTDL-ECAPE--EATRLREDDA  601
             +  K   +                      N+KN  E++++ E A    E  RLRE   
Sbjct  865  KDYGKGEREAQWAVAQRTLHGLSTTENAALYNDKNYRELSEIAEQAKRRAEVARLRELHT  924

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI+TIQQH TV
Sbjct  925  LKGHVE---SVVKLKGLDIDTIQQHYTV  949



>emb|CDP14275.1| unnamed protein product [Coffea canephora]
Length=635

 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 147/268 (55%), Positives = 178/268 (66%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+L +DTDFF++ FKV
Sbjct  371  DGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYLAIMTVVFFYLAADTDFFSNIFKV  430

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+   P ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AF  AQ VAT I V
Sbjct  431  RSIRDHPDELTAALYLQVSIISQALIFVTRSRSWSFVERPGLMLVTAFFIAQLVATLIAV  490

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YANWSFARIQGIGWGW GVIWI+SI+TYFPLDI+KFI R AL+                 
Sbjct  491  YANWSFARIQGIGWGWGGVIWIFSIVTYFPLDILKFIIRYALSGKAWDSMIQNKTAFTTK  550

Query  497  ----------------------ETSKAPNQCNEKNSSEMTDL-ECAPE--EATRLREDDA  601
                                  +T ++    N+K+  E++++ E A    E  RLRE   
Sbjct  551  KDYGREEREAQWALAQRTLHGLQTPESAGLFNDKHYRELSEIAEQAKRRAEVARLRELHT  610

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  611  LKGHVE---SVVKLKGLDIETIQQHYTV  635



>gb|EYU31795.1| hypothetical protein MIMGU_mgv1a000883mg [Erythranthe guttata]
Length=951

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 177/268 (66%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y ALMT +FF+L +DTDFF++ FKV
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGSYMALMTVVFFYLAADTDFFSEKFKV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  SP ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG LL+ AFL AQ VAT I V
Sbjct  747  RSLRNSPDELTAALYLQVSIISQALIFVTRSRSWSFVERPGFLLMSAFLIAQLVATIIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YANW FARIQGIGWGWAG+IWIYSI+TYFPLD++KFI R ALT                 
Sbjct  807  YANWGFARIQGIGWGWAGIIWIYSIVTYFPLDVLKFIIRYALTGKAWDSMIQNRVAFTTK  866

Query  497  ----------------------ETSKAPNQCNEKNSSEMTDL-ECAPE--EATRLREDDA  601
                                     + P   ++KN  E++++ E A    E  RLRE   
Sbjct  867  KDYGRGEREAQWAVAQRTLHGLSAGETPALLHDKNYGELSEIAEQAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  927  LKGHVE---SVVKLKGLDIETIQQHYTV  951



>ref|XP_010429928.1| PREDICTED: ATPase 9, plasma membrane-type-like [Camelina sativa]
Length=276

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 173/270 (64%), Gaps = 45/270 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTI+KDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    TDFF+  F V
Sbjct  10   DGTIMTIAKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGV  69

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+P ELT+A+YLQ+SIISQALIFVTRS+SWS+ E PG  L+ AFL AQ +AT I V
Sbjct  70   RSISGNPHELTSAIYLQVSIISQALIFVTRSRSWSYVERPGFWLIFAFLIAQLIATLIAV  129

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G GWGWAGVIW+Y+I+TY PLDI+KFI R +L+        +N+T+    
Sbjct  130  YANWDFARIRGTGWGWAGVIWLYTIVTYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  189

Query  506  --------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLRED  595
                                      ++ +  N+K++    SE+ D      E  RLRE 
Sbjct  190  KDYGKGEREAQWAQAQRTLHGLQPAHQSSDMFNDKSTYRELSEIADQAKRRAEVARLRER  249

Query  596  DAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
              + G +    SV K K LDI  IQQH T+
Sbjct  250  HTLKGHV---ESVVKQKGLDIEAIQQHYTL  276



>ref|XP_011078614.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X1 [Sesamum 
indicum]
Length=952

 Score =   186 bits (471),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 178/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIF  GI LGTY A+MT +FF+L SDTDFF++ F V
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLQEIFCTGIVLGTYMAIMTVVFFYLASDTDFFSNTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL G P ELTAA+YLQ+SIISQALIFV RS+SWSF E PG LL+ AFL AQ +AT I V
Sbjct  747  RSLRGKPDELTAALYLQVSIISQALIFVIRSRSWSFVERPGCLLITAFLLAQLLATIIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARIQGIGWGW GVIW+YSIITYFPLDI+KFI R AL+        +N+T+    
Sbjct  807  YAHWGFARIQGIGWGWGGVIWVYSIITYFPLDILKFIIRFALSGKAWDSMIENKTAFTTK  866

Query  506  ----KAPNQC----------------------NEKNSSEMTDL-ECAPE--EATRLREDD  598
                K   +                       ++KN  E++++ E A    E  RLRE  
Sbjct  867  KDYGKGEREAQWAVAQRTLHGLSTPDASTALLHDKNYRELSEIAEQARRRAEVARLRELH  926

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  927  TLKGHVE---SVVKLKGLDIETIQQHYTV  952



>ref|XP_006343689.1| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum tuberosum]
Length=951

 Score =   184 bits (468),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 178/268 (66%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LGTYQA+MT +FF+L +DTDFFT+ F V
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGTYQAIMTVVFFYLAADTDFFTENFHV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP+ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AF AAQ VAT + V
Sbjct  747  RSIRNSPNELTAALYLQVSIISQALIFVTRSRSWSFVECPGLMLVGAFFAAQLVATVLAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YA+W FARI+G+GWGWA VIW+Y+IITY P D++KFI R  L+                 
Sbjct  807  YADWEFARIKGVGWGWAAVIWVYTIITYLPQDVLKFIIRFGLSGRAWDTMIQNKTAFTTK  866

Query  497  ----------------------ETSKAPNQCNEKNSSEMTDL-ECAPE--EATRLREDDA  601
                                  +T +A    N+KN  E++++ E A    E  RLRE   
Sbjct  867  KDYGRGEREAQWALAQRTLHGLQTPEASGLFNDKNYRELSEIAEQAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  927  LKGHVE---SVVKLKGLDIETIQQHYTV  951



>ref|XP_002307856.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE91379.1| ATPase 6 family protein [Populus trichocarpa]
Length=944

 Score =   184 bits (467),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 153/267 (57%), Positives = 179/267 (67%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA+G+ LGTY A++T LFF+L   TDFF+D F V
Sbjct  681  DGTIMTISKDRVKPSPVPDSWKLKEIFAMGVVLGTYLAIITVLFFWLAHGTDFFSDKFGV  740

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G P ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AFLAAQ VAT I V
Sbjct  741  RSIRGKPDELTAALYLQVSIISQALIFVTRSRSWSFTERPGLLLVGAFLAAQLVATVIAV  800

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQGIGWGWAG+IWI+SIITY PLDI+KFITR ALT        +N+T+    
Sbjct  801  YANWGFARIQGIGWGWAGIIWIFSIITYIPLDILKFITRYALTGKAWDNLLENKTAFTTK  860

Query  506  ----KAPNQC-------------------NEKNS----SEMTDLECAPEEATRLREDDAV  604
                K   +                    N+K S    SE+ +      E  RLRE   +
Sbjct  861  KDYGKGEREAQWATAQRTLHGLQSPETMKNDKASYRELSELAEQAKRRAEVARLREIHTL  920

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI TIQQH TV
Sbjct  921  KGHVE---SVVKMKGLDIETIQQHYTV  944



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   184 bits (467),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 176/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA G+ LG YQALMT +FF+ + DTDFF+D F V
Sbjct  687  DGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGGYQALMTVVFFWAMHDTDFFSDKFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KSL  S  E+ +A+YLQ+SIISQALIFVTRS+SWSF E PG+LL+IAF+ AQ VAT I V
Sbjct  747  KSLRNSDEEMMSALYLQVSIISQALIFVTRSRSWSFVERPGMLLVIAFMIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW+FAR++G GWGWAGVIW+YSI+ YFPLDI+KF  R  L+        DN+T+    
Sbjct  807  YANWAFARVKGCGWGWAGVIWLYSIVFYFPLDIMKFAIRYILSGKAWNNLLDNKTAFTTK  866

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  NEKNS    SE+ +      E  RLRE  
Sbjct  867  KDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEIAEQAKRRAEMARLRELH  926

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  927  TLKGHVE---SVVKLKGLDIETIQQHYTV  952



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 176/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA G+ LG YQALMT +FF+ + DTDFF+D F V
Sbjct  687  DGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGGYQALMTVVFFWAMHDTDFFSDKFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KSL  S  E+ +A+YLQ+SIISQALIFVTRS+SWSF E PG+LL+IAF+ AQ VAT I V
Sbjct  747  KSLRNSDEEMMSALYLQVSIISQALIFVTRSRSWSFLERPGMLLVIAFMIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW+FAR++G GWGWAGVIW+YSII YFPLDI+KF  R  L+        DN+T+    
Sbjct  807  YANWAFARVKGCGWGWAGVIWLYSIIFYFPLDIMKFAIRYILSGKAWNNLLDNKTAFTTK  866

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  NEKNS    SE+ +      E  RLRE  
Sbjct  867  KDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEIAEQAKRRAEMARLRELH  926

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  927  TLKGHVE---SVVKLKGLDIETIQQHYTV  952



>ref|XP_011002373.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=944

 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 149/267 (56%), Positives = 179/267 (67%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA+G+ LGTY A++T LFF+L   TDFF+D F  
Sbjct  681  DGTIMTISKDRVKPSPVPDSWKLKEIFAMGVVLGTYLAIITVLFFWLAHGTDFFSDKFGA  740

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G P ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AFLAAQ VAT I V
Sbjct  741  RSIRGKPDELTAALYLQVSIISQALIFVTRSRSWSFTERPGLLLVGAFLAAQLVATVIAV  800

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQGIGWGWAG+IWI+SIITY PLDI+KFITR ALT        +N+T+    
Sbjct  801  YANWGFARIQGIGWGWAGIIWIFSIITYIPLDILKFITRYALTGKAWDNLLENKTAFTTK  860

Query  506  ----------------------KAP-----NQCNEKNSSEMTDLECAPEEATRLREDDAV  604
                                  ++P     ++ + +  SE+ +      E  RLRE   +
Sbjct  861  KDYGKGEREAQWATAQRTLHGLQSPETMKNDKVSYRELSELAEQAKRRAEVARLREIHTL  920

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI TIQQH TV
Sbjct  921  KGHVE---SVVKMKGLDIETIQQHYTV  944



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 175/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKLNEIFA G+ LG YQALMT +FF+ + DT FFTD F V
Sbjct  687  DGTIMTISKDRVKPSPMPDSWKLNEIFATGVVLGGYQALMTVIFFWAMHDTSFFTDKFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            K +  S  E+ +A+YLQ+SIISQALIFVTRS+SWSF E PG LL+IAFL AQ VAT I V
Sbjct  747  KDIRESDEEMMSALYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W+FAR++G GWGWAGVIWI+SI+TYFPLDI+KF  R  L+        DN+T+    
Sbjct  807  YADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFAIRYILSGKAWNNLLDNKTAFTTK  866

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  NEKNS    SE+ +      E  RLRE  
Sbjct  867  KDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSYRELSEIAEQAKRRAEMARLRELH  926

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  927  TLKGHVE---SVVKLKGLDIETIQQHYTV  952



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 175/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKLNEIFA G+ LG YQALMT +FF+ + DT FFTD F V
Sbjct  687  DGTIMTISKDRVKPSPMPDSWKLNEIFATGVVLGGYQALMTVIFFWAMHDTSFFTDKFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            K +  S  E+ +A+YLQ+SIISQALIFVTRS+SWSF E PG LL+IAFL AQ VAT I V
Sbjct  747  KDIRESDEEMMSALYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W+FAR++G GWGWAGVIWI+SI+TYFPLDI+KF  R  L+        DN+T+    
Sbjct  807  YADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFAIRYILSGKAWNNLLDNKTAFTTK  866

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  NEKNS    SE+ +      E  RLRE  
Sbjct  867  KDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSYRELSEIAEQAKRRAEMARLRELH  926

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  927  TLKGHVE---SVVKLKGLDIETIQQHYTV  952



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   183 bits (465),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 175/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKLNEIFA G+ LG YQALMT LFF+ + DT FF+D F V
Sbjct  687  DGTIMTISKDRVKPSPMPDSWKLNEIFATGVVLGGYQALMTVLFFWAMHDTKFFSDKFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            K +  S  E+ +A+YLQ+SIISQALIFVTRS+SWSF E PG LL+IAFL AQ VAT I V
Sbjct  747  KDIRESDEEMMSALYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W+FAR++G GWGWAGVIWI+SI+TYFPLDI+KF  R  L+        DN+T+    
Sbjct  807  YADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFAIRYILSGKAWNNLLDNKTAFTTK  866

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  NEKNS    SE+ +      E  RLRE  
Sbjct  867  KDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSYRELSEIAEQAKRRAEMARLRELH  926

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  927  TLKGHVE---SVVKLKGLDIETIQQHYTV  952



>ref|XP_011084028.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   183 bits (465),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 175/268 (65%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LGTY A+MT +FF+L SDTDFF+D FKV
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYMAIMTVIFFYLASDTDFFSDTFKV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +P ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AFL AQ +AT I V
Sbjct  747  RSIRNNPEELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVGAFLIAQLLATIIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YA+W FARI+GIGWGW G+IWIYSI+TY PLDI+KF+ R AL+                 
Sbjct  807  YAHWEFARIKGIGWGWGGIIWIYSIVTYIPLDILKFLIRFALSGKAWDSMIQKRTAFTTK  866

Query  497  -------------------------ETSKAPNQCNEKNSSEMTDLECAPEEATRLREDDA  601
                                     E+S+  N  + +  SE+ D+     E  RLRE   
Sbjct  867  KDYGKGEREAQWAVAQRTLHGLSTTESSELLNDKSYRELSEIADMAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDIN IQQ+ TV
Sbjct  927  LKGHVE---SVVKLKGLDINAIQQNYTV  951



>emb|CDP14278.1| unnamed protein product [Coffea canephora]
Length=1297

 Score =   184 bits (468),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 147/268 (55%), Positives = 178/268 (66%), Gaps = 43/268 (16%)
 Frame = +2

Query  2     DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
             DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+L +DTDFF++ FKV
Sbjct  1033  DGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYLAVMTVVFFYLAADTDFFSNIFKV  1092

Query  182   ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
             +S+   P ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AF  AQ VAT I V
Sbjct  1093  RSIRDHPDELTAALYLQVSIISQALIFVTRSRSWSFVERPGLMLVTAFFIAQLVATLIAV  1152

Query  362   YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
             YANWSFARIQGIGWGW GVIWI+SI+TYFPLDI+KFI R AL+                 
Sbjct  1153  YANWSFARIQGIGWGWGGVIWIFSIVTYFPLDILKFIIRYALSGKAWDSMIQNKTAFTTK  1212

Query  497   ----------------------ETSKAPNQCNEKNSSEMTDL-ECAPE--EATRLREDDA  601
                                   +T ++    N+K+  E++++ E A    E  RLRE   
Sbjct  1213  KDYGREEREAQWALAQRTLHGLQTPESAGLFNDKHYRELSEIAEQAKRRAEVARLRELHT  1272

Query  602   V*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  1273  LKGHVE---SVVKLKGLDIETIQQHYTV  1297



>ref|XP_011017965.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=949

 Score =   182 bits (462),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 177/267 (66%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY ++MT +FF+LV DTDFF++ F V
Sbjct  686  DGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYMSIMTVVFFWLVHDTDFFSEKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G P ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AF+ AQ +AT I V
Sbjct  746  RSIRGKPDELTAALYLQVSIISQALIFVTRSRSWSFVECPGLLLVSAFVVAQLMATIIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YANWSFARIQG+GWGWAG+IWIYSIITY PLDI+KFI R ALT    DN           
Sbjct  806  YANWSFARIQGVGWGWAGIIWIYSIITYIPLDILKFIIRYALTGKAWDNLLQNKTAFTNK  865

Query  497  -ETSKAPNQC-------------------NEKNS----SEMTDLECAPEEATRLREDDAV  604
             +  K   +                    N+K +    +E+ +      E  RLRE   +
Sbjct  866  KDYGKGEREAQWATAQRTLHGLQPPETMFNDKTTYRELNELAEQAKKRAEVARLRELHTL  925

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI TIQQH TV
Sbjct  926  KGHVD---SVVKMKGLDIETIQQHYTV  949



>ref|XP_006343688.1| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum tuberosum]
Length=951

 Score =   182 bits (461),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 177/268 (66%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRV PSP+PDSWKLNEIFA G+ LGTYQA+MT +FF+L +DTDFFT+ F V
Sbjct  687  DGTIMTISKDRVVPSPLPDSWKLNEIFATGVVLGTYQAIMTVVFFYLAADTDFFTENFHV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP+ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AF AAQ VAT + V
Sbjct  747  RSIRNSPNELTAALYLQVSIISQALIFVTRSRSWSFVERPGLMLVGAFFAAQLVATVLAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YA+W FARI+G+GWGWA VIW+Y+IITY P D++KFI R  L+                 
Sbjct  807  YADWEFARIKGVGWGWAAVIWVYTIITYLPQDVLKFIIRFGLSGRAWDTMIQNKTAFTTK  866

Query  497  ----------------------ETSKAPNQCNEKNSSEMTDL-ECAPE--EATRLREDDA  601
                                  +T +A    N+KN  E++++ E A    E  RLRE   
Sbjct  867  KDYGRGEREAQWALAQRTLHGLQTPEAAGLFNDKNYRELSEIAEQAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  927  LKGHVE---SVVKLKGLDIETIQQHYTV  951



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=954

 Score =   182 bits (461),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 180/269 (67%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+  +D++FF+D F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYMAVMTVVFFWAANDSNFFSDKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ GS  ELTAAVYLQ+SIISQALIFVTRS+SWSF E PG++L+IAFL AQ +AT + V
Sbjct  749  RSIRGSDRELTAAVYLQVSIISQALIFVTRSRSWSFVERPGVMLMIAFLIAQLLATILAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGVIW+YSI+TY PLDI+KF+ R AL+        +N+T+    
Sbjct  809  YANWGFARIKGMGWGWAGVIWLYSIVTYIPLDILKFMIRYALSGKAWDNVLENKTAFTTK  868

Query  506  ----KAPNQC---------------------NEKNS----SEMTDLECAPEEATRLREDD  598
                K   +                      N+KN+    SE+ +      E  RLRE  
Sbjct  869  KDYGKGEREAQWATAQRTLHGLQPPETSDIFNDKNNYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>gb|ABA18112.1| putative plasma membrane ATPase [Arabidopsis arenosa]
Length=948

 Score =   181 bits (460),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 167/265 (63%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LGTY AL T LFF+L  DT+FF+  F V
Sbjct  687  DGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTNFFSKTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  EL AA+YLQ+SIISQALIFVTRS+SWSF E PG LLLIAF+ AQ VAT I V
Sbjct  747  RSIQGNEEELMAALYLQVSIISQALIFVTRSRSWSFVERPGFLLLIAFVIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDNETSKAPNQC------  523
            YANW FARI G GWGWAGVIW+YSIITY PLDI+KFI R ALT        NQ       
Sbjct  807  YANWGFARIVGCGWGWAGVIWVYSIITYIPLDILKFIIRYALTGKAWDNMINQKTAFTTK  866

Query  524  -------------------------------NEKNSSEMTDLECAPEEATRLREDDAV*G  610
                                           N+   SE+ +      E  RLRE   + G
Sbjct  867  KDYGKGEREAQWALAQRTLHGLPPPEAMFHDNKNELSEIAEQAKRRAEVARLRELHTLKG  926

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  927  HVE---SVVKLKGLDIDTIQQHYTV  948



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   181 bits (460),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 149/269 (55%), Positives = 175/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA G+ LG YQALMT +FF+ + DTDFF+D F V
Sbjct  687  DGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGGYQALMTVVFFWAMHDTDFFSDKFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KSL  S  E+ +A+YLQ+SIISQALIFVTRS+SWSF E PG+LL+IAF+ AQ VAT I V
Sbjct  747  KSLRNSDEEMMSALYLQVSIISQALIFVTRSRSWSFLERPGMLLVIAFMIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW+FAR++G GWGWAGVIW+YSII Y PLDI+KF  R  L+        DN+T+    
Sbjct  807  YANWAFARVKGCGWGWAGVIWLYSIIFYLPLDIMKFAIRYILSGKAWNNLLDNKTAFTTK  866

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  NEKNS    SE+ +      E  RLRE  
Sbjct  867  KDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEIAEQAKRRAEMARLRELH  926

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  927  TLKGHVE---SVVKLKGLDIETIQQHYTV  952



>ref|XP_002875581.1| hypothetical protein ARALYDRAFT_323063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51840.1| hypothetical protein ARALYDRAFT_323063 [Arabidopsis lyrata subsp. 
lyrata]
Length=948

 Score =   181 bits (460),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 173/265 (65%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LGTY AL T LFF+L  DT+FF+  F V
Sbjct  687  DGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTNFFSKTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  EL AA+YLQ+SIISQALIFVTRS+SWSF E PG LLLIAF+ AQ VAT I V
Sbjct  747  RSIQGNEEELMAALYLQVSIISQALIFVTRSRSWSFVERPGFLLLIAFVIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNETSKA------  511
            YANW FARI G GWGWAGVIW+YSIITY PLDI+KFI R ALT    DN  ++       
Sbjct  807  YANWGFARIVGCGWGWAGVIWVYSIITYIPLDILKFIIRYALTGKAWDNMINQKTAFTTK  866

Query  512  ------------------------PNQCNEKNSSEMTDL-ECAPE--EATRLREDDAV*G  610
                                    P      N +E++++ E A    E  RLRE   + G
Sbjct  867  KDYGKGEREAQWALAQRTLHGLPPPEAMFHDNKNELSEIAEQAKRRAEVARLRELHTLKG  926

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  927  HVE---SVVKLKGLDIDTIQQHYTV  948



>ref|XP_004242977.2| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum lycopersicum]
Length=951

 Score =   181 bits (460),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 176/268 (66%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRV PSP+PDSWKLNEIFA GI LGTYQA+MT +FF+L +DTDFFT+ F V
Sbjct  687  DGTIMTISKDRVVPSPLPDSWKLNEIFATGIVLGTYQAVMTVVFFYLAADTDFFTENFHV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AF AAQ VAT + V
Sbjct  747  RSIRNSPYELTAALYLQVSIISQALIFVTRSRSWSFVERPGLMLVGAFFAAQLVATVLAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YA+W FARI+G+GWGWA VIW+Y+IITY P D++KFI R  L+                 
Sbjct  807  YADWEFARIKGVGWGWAAVIWVYTIITYLPQDVLKFIIRFGLSGRAWDTMIQNKTAFTTK  866

Query  497  ----------------------ETSKAPNQCNEKNSSEMTDL-ECAPE--EATRLREDDA  601
                                  +T +A    N+KN  E++++ E A    E  RLRE   
Sbjct  867  KDYGRGEREAQWALAQRTLHGLQTPEAAGLFNDKNYRELSEIAEQAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  927  LKGHVE---SVVKLKGLDIETIQQHYTV  951



>ref|NP_189850.1| H(+)-ATPase 8 [Arabidopsis thaliana]
 sp|Q9M2A0.1|PMA8_ARATH RecName: Full=ATPase 8, plasma membrane-type; AltName: Full=Proton 
pump 8 [Arabidopsis thaliana]
 emb|CAB86447.1| plasma membrane H+-ATPase-like protein [Arabidopsis thaliana]
 gb|AEE77743.1| H(+)-ATPase 8 [Arabidopsis thaliana]
Length=948

 Score =   181 bits (459),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 166/265 (63%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LGTY AL T LFF+L  DTDFF+  F V
Sbjct  687  DGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTDFFSKTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  EL AA+YLQ+SIISQALIFVTRS+SWSF E PG LLLIAF+ AQ VAT I V
Sbjct  747  RSIQGNEEELMAALYLQVSIISQALIFVTRSRSWSFVERPGFLLLIAFVIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDNETSKAPNQC------  523
            YANW FARI G GWGWAG IW+YSIITY PLDI+KFI R ALT        NQ       
Sbjct  807  YANWGFARIVGCGWGWAGGIWVYSIITYIPLDILKFIIRYALTGKAWDNMINQKTAFTTK  866

Query  524  -------------------------------NEKNSSEMTDLECAPEEATRLREDDAV*G  610
                                           N+   SE+ +      E  RLRE   + G
Sbjct  867  KDYGKGEREAQWALAQRTLHGLPPPEAMFNDNKNELSEIAEQAKRRAEVARLRELHTLKG  926

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  927  HVE---SVVKLKGLDIDTIQQHYTV  948



>ref|XP_011033475.1| PREDICTED: ATPase 8, plasma membrane-type [Populus euphratica]
Length=949

 Score =   181 bits (459),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 173/267 (65%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT LFF+L  DTDFF + F V
Sbjct  686  DGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYMAIMTVLFFWLAHDTDFFPEKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +++ G P ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AF+AAQ VAT I V
Sbjct  746  RTIRGKPDELTAALYLQVSIISQALIFVTRSRSWSFVECPGLLLVSAFIAAQLVATLIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNETSKAPNQCNE  529
            YA+WSFARI+GIGWGWAG+IW++SIITY PLDIIKFI R ALT    DN         N+
Sbjct  806  YASWSFARIEGIGWGWAGIIWLFSIITYIPLDIIKFIIRYALTGKAWDNMLQNKTAFTNK  865

Query  530  KNS-----------------------------------SEMTDLECAPEEATRLREDDAV  604
            K+                                    SE+ +      E  RLRE   +
Sbjct  866  KDYGKGEREAQWATAQRTLHGLQPPETMFNDKTTYRELSELAEQAKKRAEVARLRELHTL  925

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI TIQQH TV
Sbjct  926  KGHVD---SVVKMKGLDIETIQQHYTV  949



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =   181 bits (459),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 176/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+ + +T FF D F V
Sbjct  690  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMKETKFFPDKFGV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  SP E+TAA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ +AT I V
Sbjct  750  RHIGDSPDEMTAALYLQVSIVSQALIFVTRSRSWSFIERPGLLLLGAFVIAQLIATLIAV  809

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANWSFARI+G+GWGWAGVIW+YSI+ YFPLDI+KF TR  L+        +N+T+    
Sbjct  810  YANWSFARIKGVGWGWAGVIWLYSIVFYFPLDIMKFATRYILSGKAWLNLLENKTAFTTK  869

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  NEK+S    SE+ +      E  RLRE  
Sbjct  870  KDYGKEEREAQWALAQRTLHGLQPPEASNIFNEKSSYRELSEIAEQAKRRAEVARLRELH  929

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  930  TLKGHVE---SVVKLKGLDIDTIQQHYTV  955



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =   181 bits (459),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 179/269 (67%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y ALMT +FF+L+ DTDFF+D F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +P E+ AA+YLQ+SIISQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  746  RSIRKNPDEMMAALYLQVSIISQALIFVTRSRSWSFLERPGLLLLGAFMIAQLVATFIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGVIW+YS++TYFPLDI+KF+ R  L+        +N+T+    
Sbjct  806  YANWGFARIKGMGWGWAGVIWVYSLVTYFPLDILKFVIRYVLSGKAWDNLLENKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQSPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+T+QQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTMQQHYTV  951



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =   181 bits (459),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 177/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y ALMT +FF+ + DT+FF++ F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYMALMTVIFFWAMKDTNFFSNKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  SP E+ AA+YLQ+SIISQALIFVTRS+SWSFAE PG+LLL AFL AQ VAT I V
Sbjct  746  RSLRLSPEEMMAALYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLVATFIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGVIW+YS++TY PLDI+KF  R  L+        +N+T+    
Sbjct  806  YANWGFARIKGMGWGWAGVIWLYSVVTYIPLDILKFAIRYILSGKAWDNLLENKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>ref|XP_002309321.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE92844.1| ATPase 6 family protein [Populus trichocarpa]
Length=949

 Score =   181 bits (459),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 173/267 (65%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT LFF+L  DTDFF + F V
Sbjct  686  DGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYMAIMTVLFFWLAHDTDFFPEKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +++ G P ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AF+AAQ VAT I V
Sbjct  746  RTIRGKPDELTAALYLQVSIISQALIFVTRSRSWSFVECPGLLLVSAFIAAQLVATLIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNETSKAPNQCNE  529
            YA+WSFARI+GIGWGWAG+IW++SIITY PLDIIKFI R ALT    DN         N+
Sbjct  806  YASWSFARIEGIGWGWAGIIWLFSIITYIPLDIIKFIIRYALTGKAWDNMLQNKTAFTNK  865

Query  530  KNS-----------------------------------SEMTDLECAPEEATRLREDDAV  604
            K+                                    SE+ +      E  RLRE   +
Sbjct  866  KDYGKGEREAQWATAQRTLHGLQPPETMFNDKTTYRELSELAEQAKKRAEVARLRELHTL  925

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI TIQQH TV
Sbjct  926  KGHVD---SVVKMKGLDIETIQQHYTV  949



>emb|CAA59799.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=951

 Score =   181 bits (458),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 177/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y ALMT +FF+ + DT+FF++ F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYMALMTVIFFWAMKDTNFFSNKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  SP E+ AA+YLQ+SIISQALIFVTRS+SWSFAE PG+LLL AFL AQ VAT I V
Sbjct  746  RSLRLSPEEMMAALYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLVATFIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGVIW+YS++TY PLDI+KF  R  L+        +N+T+    
Sbjct  806  YANWGFARIKGMGWGWAGVIWLYSVVTYIPLDILKFAIRYILSGKAWDNLLENKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>ref|XP_004253510.2| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum lycopersicum]
Length=951

 Score =   181 bits (458),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 176/268 (66%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRV PSP+PDSWKLNEIFA G+ LGTYQA+MT +FF+L +DTDFFT+ F V
Sbjct  687  DGTIMTISKDRVVPSPLPDSWKLNEIFATGVVLGTYQAVMTVVFFYLAADTDFFTENFHV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AF AAQ VAT + V
Sbjct  747  RSIRNSPYELTAALYLQVSIISQALIFVTRSRSWSFVERPGLMLVGAFFAAQLVATVLAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YA+W FARI+G+GWGWA VIW+Y+IITY P D++KFI R  L+                 
Sbjct  807  YADWEFARIKGVGWGWAAVIWVYTIITYLPQDVLKFIIRFGLSGRAWDTMIQNKTAFTTK  866

Query  497  ----------------------ETSKAPNQCNEKNSSEMTDL-ECAPE--EATRLREDDA  601
                                  +T +A    N+KN  E++++ E A    E  RLRE   
Sbjct  867  KDYGRGEREAQWALAQRTLHGLQTPEAAGLFNDKNYRELSEIAEQAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  927  LKGHVE---SVVKLKGLDIETIQQHYTV  951



>gb|ABA18090.1| putative plasma membrane ATPase [Olimarabidopsis pumila]
Length=948

 Score =   181 bits (458),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 172/265 (65%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LGTY AL T LFF+L  DTDFF+  F V
Sbjct  687  DGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTDFFSKTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  EL AA+YLQ+SIISQALIFVTRS+SWSF E PG LL+IAF+ AQ VAT I V
Sbjct  747  RSIQGNEEELMAALYLQVSIISQALIFVTRSRSWSFVERPGFLLMIAFVIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YANW FARI G GWGWAGVIW+YSIITY PLDI+KFI R ALT    DN           
Sbjct  807  YANWGFARIIGCGWGWAGVIWVYSIITYIPLDILKFIIRYALTGKAWDNMIQQKTAFTTK  866

Query  497  -ETSKAPNQC-------------------NEKNS--SEMTDLECAPEEATRLREDDAV*G  610
             +  K   +                    ++KN   SE+ +      E  RLRE   + G
Sbjct  867  KDYGKGEREAQWALAQRTLHGLPPPEAMFHDKNHELSEIAEQAKRRAEVARLRELHTLKG  926

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  927  HVE---SVVKLKGLDIDTIQQHYTV  948



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =   181 bits (458),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 178/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LG Y ALMT +FF+ + +T FF D F V
Sbjct  690  DGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGGYLALMTVIFFWAIKETTFFPDKFGV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +H +P E+TAA+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+ AQ +AT I V
Sbjct  750  RPIHDNPDEMTAALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFVIAQLIATVIAV  809

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQGIGWGWAGVIW+YSI+ YFPLDI+KF  R  L+        +N+T+    
Sbjct  810  YANWGFARIQGIGWGWAGVIWLYSIVFYFPLDIMKFAIRYILSGKAWNNLLENKTAFTTK  869

Query  506  -------------------------KAPNQCNEKNS-SEMTDL-ECAPE--EATRLREDD  598
                                     +  N  NEK+S  E+T++ E A    E  RLRE  
Sbjct  870  KDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEIAEQAKRRAEVARLRELH  929

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  930  TLKGHVE---SVVKLKGLDIDTIQQHYTV  955



>ref|XP_010514696.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
 ref|XP_010514698.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
 ref|XP_010514699.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
 ref|XP_010514700.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
Length=948

 Score =   181 bits (458),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 172/265 (65%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LGTY AL T LFF+L  DTDFF+  F V
Sbjct  687  DGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTDFFSRTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  EL AA+YLQ+SIISQALIFVTRS+SWSF E PG LL+IAF+ AQ VAT I V
Sbjct  747  RSIQGNEEELMAALYLQVSIISQALIFVTRSRSWSFVERPGFLLIIAFIIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNETSKA------  511
            YANW FARI G GWGWAGVIW+YSIITY PLDI+KFI R ALT    DN   +       
Sbjct  807  YANWGFARIIGCGWGWAGVIWVYSIITYIPLDILKFIIRYALTGKAWDNMIQQKTAFTTK  866

Query  512  ------------------------PNQCNEKNSSEMTDL-ECAPE--EATRLREDDAV*G  610
                                    P      N+ E++++ E A    E  RLRE   + G
Sbjct  867  KDYGKGEREAQWALAQRTLHGLPPPEAMFHDNNHELSEIAEQAKRRAEVARLRELHTLKG  926

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  927  HVE---SVVKLKGLDIDTIQQHYTV  948



>ref|XP_011084027.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 149/268 (56%), Positives = 172/268 (64%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LGTY A+MT +FF+L SDTDFF+D FKV
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYMAIMTVVFFYLASDTDFFSDTFKV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AFL AQ +AT I V
Sbjct  747  RSIRNNFEELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVGAFLIAQLLATIIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YA+W FARI+GIGWGW GVIWIYSI+TY PLDIIKF  R AL+                 
Sbjct  807  YAHWEFARIRGIGWGWGGVIWIYSIVTYIPLDIIKFGIRFALSGKAWDSMIQNRTAFTTK  866

Query  497  -------------------------ETSKAPNQCNEKNSSEMTDLECAPEEATRLREDDA  601
                                     ETS A N  + K  SE+ +      E  RLRE   
Sbjct  867  KDYGKGEREAQWAMAQRTLHGLSTTETSGAYNDNSYKELSEIAEQAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  927  LKGHVE---SVVKLKGLDIETIQQHYTV  951



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   180 bits (457),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 177/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y ALMT +FF+ + DT+FF++ F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  +P E+ AA+YLQ+SIISQALIFVTRS+SWSFAE PG+LLL AFL AQ +AT I V
Sbjct  746  RPIRHNPDEMMAALYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLIATFIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGVIW+YS++TY PLD++KF  R  L+        +N+T+    
Sbjct  806  YANWGFARIKGMGWGWAGVIWLYSLVTYIPLDLLKFAIRYFLSGKAWDNLLENKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  NEKNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWAAAQRTLHGLQPPEASNVFNEKNSYRELSEIAEQAKRRAEVARLREVH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>ref|XP_010425792.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
 ref|XP_010425793.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
 ref|XP_010425794.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   180 bits (456),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 172/265 (65%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LGTY AL T LFF+L  DTDFF+  F V
Sbjct  687  DGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTDFFSRTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  EL AA+YLQ+SIISQALIFVTRS+SWSF E PG LL+IAF+ AQ VAT I V
Sbjct  747  RSIQGNEEELMAALYLQVSIISQALIFVTRSRSWSFVERPGFLLIIAFIIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YANW FARI G GWGWAGVIW+YSIITY PLDI+KFI R ALT    DN           
Sbjct  807  YANWGFARIIGCGWGWAGVIWVYSIITYIPLDILKFIIRYALTGKAWDNMIQQKTAFTTK  866

Query  497  -ETSKAPNQC-------------------NEKNS--SEMTDLECAPEEATRLREDDAV*G  610
             +  K   +                    ++KN   SE+ +      E  RLRE   + G
Sbjct  867  KDYGKGEREAQWALAQRTLHGLPPPEAMFHDKNHELSEIAEQAKRRAEVARLRELHTLKG  926

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  927  HVE---SVVKLKGLDIDTIQQHYTV  948



>ref|XP_006279360.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
 gb|ABA18104.1| putative plasma membrane ATPase [Capsella rubella]
 gb|EOA12258.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
Length=948

 Score =   180 bits (456),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 172/265 (65%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LGTY AL T LFF+L  DT+FF+  F V
Sbjct  687  DGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTNFFSKTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  EL AA+YLQ+SIISQALIFVTRS+SWSF E PG LL+IAF+ AQ VAT I V
Sbjct  747  RSIQGNEEELMAALYLQVSIISQALIFVTRSRSWSFVERPGFLLIIAFIIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YANW FARI G GWGWAGVIWIYSIITY PLDI+KFI R ALT    DN           
Sbjct  807  YANWGFARIIGCGWGWAGVIWIYSIITYIPLDILKFIIRYALTGKAWDNMIQQKTAFTTK  866

Query  497  -ETSKAPNQC-------------------NEKNS--SEMTDLECAPEEATRLREDDAV*G  610
             +  K   +                    ++KN   SE+ +      E  RLRE   + G
Sbjct  867  KDYGKGEREAQWALAQRTLHGLPPPEAMFHDKNHELSEIAEQAKRRAEVARLRELHTLKG  926

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  927  HVE---SVVKLKGLDIDTIQQHYTV  948



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   180 bits (456),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 176/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y ALMT +FF+ + DT+FF++ F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  +  E+ AA+YLQ+SIISQALIFVTRS+SWSFAE PG+LLL AF  AQ VAT I V
Sbjct  746  RSLRHNSEEMMAALYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFFIAQLVATFIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGVIW+YS++TY PLD++KF  R  L+        +N+T+    
Sbjct  806  YANWGFARIKGMGWGWAGVIWLYSLVTYIPLDLLKFAIRYVLSGKAWDNLLENKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  NEKNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWAAAQRTLHGLQPPEASNLFNEKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   179 bits (455),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 178/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LG Y ALMT +FF+ + +T FF D F V
Sbjct  690  DGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGGYLALMTVIFFWAMKETTFFPDKFGV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +H +P E+TAA+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+ AQ +AT I V
Sbjct  750  RPIHDNPDEMTAALYLQVSIVSQALIFVTRSRSWSFIERPGLLLMTAFIIAQLIATVIAV  809

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQGIGWGWAGVIW+YSI+ YFPLD++KF  R  L+        +N+T+    
Sbjct  810  YANWGFARIQGIGWGWAGVIWLYSIVFYFPLDLMKFAIRYILSGKAWNNLLENKTAFTTK  869

Query  506  -------------------------KAPNQCNEKNS-SEMTDL-ECAPE--EATRLREDD  598
                                     +  N  NEK+S  E+T++ E A    E  RLRE  
Sbjct  870  KDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEIAEQAKRRAEVARLRELH  929

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  930  TLKGHVE---SVVKLKGLDIDTIQQHYTV  955



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   179 bits (455),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 178/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LG Y ALMT +FF+ + +T FF D F V
Sbjct  690  DGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGGYLALMTVIFFWAMKETTFFPDKFGV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +H +P E+TAA+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+ AQ +AT I V
Sbjct  750  RPIHDNPDEMTAALYLQVSIVSQALIFVTRSRSWSFIERPGLLLMTAFIIAQLIATVIAV  809

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQGIGWGWAGVIW+YSI+ YFPLD++KF  R  L+        +N+T+    
Sbjct  810  YANWGFARIQGIGWGWAGVIWLYSIVFYFPLDLMKFAIRYILSGKAWNNLLENKTAFTTK  869

Query  506  -------------------------KAPNQCNEKNS-SEMTDL-ECAPE--EATRLREDD  598
                                     +  N  NEK+S  E+T++ E A    E  RLRE  
Sbjct  870  KDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEIAEQAKRRAEVARLRELH  929

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  930  TLKGHVE---SVVKLKGLDIDTIQQHYTV  955



>gb|KEH35952.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   179 bits (455),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 180/269 (67%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA G+ LG+Y ALMT +FF+L+ DTDFF+D F V
Sbjct  685  DGTIMTISKDRVKPSPMPDSWKLREIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGV  744

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +P E+ AA+YLQ+SIISQALIFVTRS+SWS  E PG+LLL AF+ AQ +AT I V
Sbjct  745  RSIRNNPDEMMAALYLQVSIISQALIFVTRSRSWSVVERPGLLLLGAFMIAQLLATFIAV  804

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANWSFARI+G+GWGWAGVIW+YSI+TY PLDI+KF+ R  L+        +N+T+    
Sbjct  805  YANWSFARIKGMGWGWAGVIWMYSIVTYIPLDILKFVIRYVLSGKAWDNLLENKTAFTTK  864

Query  506  ----------------------KAP---NQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                  ++P   N  N+KNS    SE+ +      E  RLRE  
Sbjct  865  KDYGKEEREAQWATAQRTLHGLQSPDTTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  924

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+T+QQH TV
Sbjct  925  TLKGHVE---SVVKLKGLDIDTMQQHYTV  950



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   179 bits (455),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 180/269 (67%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA G+ LG+Y ALMT +FF+L+ DTDFF+D F V
Sbjct  686  DGTIMTISKDRVKPSPMPDSWKLREIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +P E+ AA+YLQ+SIISQALIFVTRS+SWS  E PG+LLL AF+ AQ +AT I V
Sbjct  746  RSIRNNPDEMMAALYLQVSIISQALIFVTRSRSWSVVERPGLLLLGAFMIAQLLATFIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANWSFARI+G+GWGWAGVIW+YSI+TY PLDI+KF+ R  L+        +N+T+    
Sbjct  806  YANWSFARIKGMGWGWAGVIWMYSIVTYIPLDILKFVIRYVLSGKAWDNLLENKTAFTTK  865

Query  506  ----------------------KAP---NQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                  ++P   N  N+KNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQSPDTTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+T+QQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTMQQHYTV  951



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   179 bits (454),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 177/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA GI LG+Y ALMT +FF+++ DTDFF+D F V
Sbjct  686  DGTIMTISKDRVKPSPMPDSWKLREIFATGIVLGSYMALMTVVFFWIMKDTDFFSDKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP E+ AA+YLQ+SIISQALIFVTRS+SWS+ E PG+LLL AF+ AQ VAT + V
Sbjct  746  RSIRNSPGEMMAALYLQVSIISQALIFVTRSRSWSYVERPGLLLLSAFMIAQLVATFLAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQG+GWGWAGVIW+YS++TY PLDI+KF  R  L+        +N+T+    
Sbjct  806  YANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>gb|AAO22672.1| putative plasma membrane proton ATPase [Arabidopsis thaliana]
Length=334

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 140/267 (52%), Positives = 166/267 (62%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY AL+T +FF+L  DT FF+D F V
Sbjct  71   DGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYMALVTVVFFWLAHDTTFFSDKFGV  130

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL G   EL A +YLQ+SIISQALIFVTRS+SWSF E PG+LLLIAF  AQ +AT I  
Sbjct  131  RSLQGKDEELIAVLYLQVSIISQALIFVTRSRSWSFVERPGLLLLIAFFVAQLIATLIAT  190

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARI+G GWGW GVIWIYSI+TY PLDI+KFITR  L+        +N T+    
Sbjct  191  YAHWEFARIKGCGWGWCGVIWIYSIVTYIPLDILKFITRYTLSGKAWNNMIENRTAFTTK  250

Query  506  ----------------------KAPNQCNEKNS-----SEMTDLECAPEEATRLREDDAV  604
                                  K P    E  +     SE+ +      E  RLRE   +
Sbjct  251  KDYGRGEREAQWALAQRTLHGLKPPESMFEDTATYTELSEIAEQAKKRAEVARLREVHTL  310

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI+ + QH TV
Sbjct  311  KGHV---ESVVKLKGLDIDNLNQHYTV  334



>gb|AAF27113.1|AC018849_1 aha9, 5' partial; 1-2403 [Arabidopsis thaliana]
Length=612

 Score =   176 bits (447),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 138/269 (51%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    TDFF+  F V
Sbjct  347  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGV  406

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+P ELTAAVYLQ+SI+SQALIFVTRS+SWS+ E PG  L+ AF  AQ +AT I V
Sbjct  407  RSISGNPHELTAAVYLQVSIVSQALIFVTRSRSWSYVERPGFWLISAFFMAQLIATLIAV  466

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNET-----  502
            YANW+FARI+GIGWGWAGVIW+YSI+ Y PLDI+KFI R +L+        +N+T     
Sbjct  467  YANWNFARIRGIGWGWAGVIWLYSIVFYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  526

Query  503  ------------------------SKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                    ++  +  N+K++    SE+ D      E  RLRE  
Sbjct  527  KDYGKGEREAQWAQAQRTLHGLQPAQTSDMFNDKSTYRELSEIADQAKRRAEVARLRERH  586

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI  IQQH T+
Sbjct  587  TLKGHVE---SVVKQKGLDIEAIQQHYTL  612



>emb|CAG28305.1| proton-exporting ATPase [Cucumis sativus]
Length=311

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 139/270 (51%), Positives = 173/270 (64%), Gaps = 45/270 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+++ +TDFF + F V
Sbjct  45   DGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGYLALMTVIFFWIMRETDFFPEKFNV  104

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  SP E+ AA+YLQ+SI+SQALIFVTRS+SWS+ E PG+LL+ AF+ AQ VAT I V
Sbjct  105  RPIKDSPKEMMAALYLQVSIVSQALIFVTRSRSWSYFERPGLLLMGAFVIAQLVATLIAV  164

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FA+I+G GWGWAGV+WIYS+I Y PLD IKF  R  L+        +N+T+    
Sbjct  165  YANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFAIRYILSGKAWLNLLENKTAFTTK  224

Query  506  -----------------------KAPNQCN---EKNS----SEMTDLECAPEEATRLRED  595
                                    AP + +   EKNS    SE+ +      E  RLRE 
Sbjct  225  KDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSEIAEQAKRRAEIARLREL  284

Query  596  DAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + + G +    SV K K LDI+TIQQH TV
Sbjct  285  NTLKGHV---ESVVKLKGLDIDTIQQHYTV  311



>emb|CDY39956.1| BnaC06g40340D [Brassica napus]
Length=861

 Score =   178 bits (452),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 171/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+ V  TDFF+  F V
Sbjct  596  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAVESTDFFSAKFGV  655

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+P ELT+A+YLQ+SIISQALIFVTRS+SWS+AE PG  L+ AF  AQ VAT I V
Sbjct  656  RSISGNPHELTSAIYLQVSIISQALIFVTRSRSWSYAERPGFWLIAAFFLAQLVATLIAV  715

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNE-------TSK  508
            YANW FARI+G GWGWAGVIW+YSI+TY PLDI+KFI R +L+    DN        TSK
Sbjct  716  YANWDFARIRGTGWGWAGVIWLYSIVTYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  775

Query  509  A----------------------PNQCNE--------KNSSEMTDLECAPEEATRLREDD  598
                                   P Q +E        +  SE+ D      E  RLRE  
Sbjct  776  KDYGKGEREAQWAQAQRTLHGLQPAQPSEMFNDKSTYRELSEIADQAKRRAEVARLREHH  835

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI  IQQH T+
Sbjct  836  TLKGHVE---SVVKQKGLDIEAIQQHYTL  861



>emb|CDX87330.1| BnaA07g35430D [Brassica napus]
Length=861

 Score =   178 bits (452),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 171/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+ V  TDFF+  F V
Sbjct  596  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAVESTDFFSAKFGV  655

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+P ELT+A+YLQ+SIISQALIFVTRS+SWS+AE PG  L+ AF  AQ +AT I V
Sbjct  656  RSISGNPHELTSAIYLQVSIISQALIFVTRSRSWSYAERPGFWLIAAFFLAQLIATVIAV  715

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNE-------TSK  508
            YANW FARI+G GWGWAGVIW+YSI+TY PLDI+KFI R +L+    DN        TSK
Sbjct  716  YANWDFARIRGTGWGWAGVIWLYSIVTYVPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  775

Query  509  A----------------------PNQCNE--------KNSSEMTDLECAPEEATRLREDD  598
                                   P Q +E        +  SE+ D      E  RLRE  
Sbjct  776  KDYGKGEREAQWAQAQRTLHGLQPAQPSEMFNDKSTYRELSEIADQAKRRAEVARLREHH  835

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI  IQQH T+
Sbjct  836  TLKGHVE---SVVKQKGLDIEAIQQHYTL  861



>ref|XP_002324564.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEF03129.1| ATPase 6 family protein [Populus trichocarpa]
Length=949

 Score =   179 bits (453),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 177/267 (66%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY ++MT +FF+LV DTDFF++ F V
Sbjct  686  DGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYMSIMTVVFFWLVHDTDFFSEKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G P ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AF+AAQ +AT I V
Sbjct  746  RSIRGKPDELTAALYLQVSIISQALIFVTRSRSWSFVECPGLLLVGAFIAAQLMATIIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YA WSFARIQG+GWGWAG+IWIYSIITY PLDI+KFI R ALT    DN           
Sbjct  806  YATWSFARIQGVGWGWAGIIWIYSIITYIPLDILKFIIRYALTGKAWDNLLQNKTAFTTK  865

Query  497  -ETSKAPNQC-------------------NEKNS----SEMTDLECAPEEATRLREDDAV  604
             +  K   +                    N+K +    +E+ +      E  RLRE   +
Sbjct  866  KDYGKGEREAQWATAQRTLHGLQPPETMFNDKTTYRELNELAEQAKKRAEVARLRELHTL  925

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI TIQQH TV
Sbjct  926  KGHVD---SVVKMKGLDIETIQQHYTV  949



>ref|XP_006419170.1| hypothetical protein EUTSA_v10002391mg [Eutrema salsugineum]
 gb|ESQ37606.1| hypothetical protein EUTSA_v10002391mg [Eutrema salsugineum]
Length=948

 Score =   179 bits (453),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 172/265 (65%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LGTY AL T LFF+L  DT+FF+  F V
Sbjct  687  DGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTNFFSKTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  EL AA+YLQ+SIISQALIFVTRS+SWSF E PGILL+IAF+ AQ  AT I V
Sbjct  747  RSIQGNEEELMAALYLQVSIISQALIFVTRSRSWSFVERPGILLVIAFIIAQLAATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YANW FARI G GWGWAGVIW+YSIITY PLDI+KFI R +LT    DN           
Sbjct  807  YANWEFARILGCGWGWAGVIWLYSIITYMPLDILKFIIRYSLTGKAWDNMIQQKTAFTTK  866

Query  497  -ETSKAPNQC-------------------NEKNS--SEMTDLECAPEEATRLREDDAV*G  610
             +  K   +                    ++KN   SE+ +      E  RLRE   + G
Sbjct  867  KDYGKGEREAQWALAQRTLHGLPPPEAMFHDKNHELSEIAEQAKRRAEVARLRELHTLKG  926

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  927  HVE---SVVKLKGLDIDTIQQHYTV  948



>ref|XP_010467151.1| PREDICTED: ATPase 6, plasma membrane-type-like [Camelina sativa]
Length=287

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 140/267 (52%), Positives = 165/267 (62%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY AL+T +FF+L  DT FF D F V
Sbjct  24   DGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYMALVTVVFFWLAHDTTFFPDKFGV  83

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL G   EL A +YLQ+SIISQALIFVTRS+SWSF E PG+LLLIAF  AQ +AT I  
Sbjct  84   RSLQGKNEELIAVLYLQVSIISQALIFVTRSRSWSFVERPGLLLLIAFFVAQLIATLIAT  143

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARI+G GWGW GVIWIYSI+TY PLDI+KFITR  L+        +N T+    
Sbjct  144  YAHWEFARIKGCGWGWCGVIWIYSIVTYIPLDILKFITRYTLSGKAWNNMIENRTAFTTK  203

Query  506  ----------------------KAPNQCNEKNS-----SEMTDLECAPEEATRLREDDAV  604
                                  K P    E  +     SE+ +      E  RLRE   +
Sbjct  204  KDYGRGEREAQWALAQRTLHGLKPPESMFEDTATYTELSEIAEQAKKRAEVARLREVHTL  263

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI+ + QH TV
Sbjct  264  KGHV---ESVVKLKGLDIDNLNQHYTV  287



>emb|CAD62443.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 138/271 (51%), Positives = 174/271 (64%), Gaps = 46/271 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG+Y ALMT +FF+ +  TDFF+D F V
Sbjct  45   DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGV  104

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  S  E+ +A+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AFL AQ VAT + V
Sbjct  105  RSIRDSEHEMMSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAV  164

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETSKAPN  517
            YANW FARI+GIGWGWAGV+W+YSI+ YFPLD+IKF  R  L+        +N+T+    
Sbjct  165  YANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENKTAFTTK  224

Query  518  Q-------------------------------CNEKNS----SEMTDLECAPEEATRLRE  592
            +                                ++KNS    SE+ +      E  RLRE
Sbjct  225  KDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELSEIAEQAKRRAEIARLRE  284

Query  593  DDAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + + G +    SV K K LDI+TIQQ+ TV
Sbjct  285  LNTLKGHV---ESVVKLKGLDIDTIQQNYTV  312



>ref|XP_009104474.1| PREDICTED: ATPase 9, plasma membrane-type [Brassica rapa]
Length=954

 Score =   179 bits (453),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    TDFF+  F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+P ELT+A+YLQ+SIISQALIFVTRS+SWS+AE PG  L+ AF  AQ VAT I V
Sbjct  749  RSISGNPHELTSAIYLQVSIISQALIFVTRSRSWSYAERPGFWLIAAFFIAQLVATIIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNE-------TSK  508
            YANW FARI+G GWGWAGVIW+YSI+TY PLDI+KFI R AL+    DN        TSK
Sbjct  809  YANWDFARIRGTGWGWAGVIWLYSIVTYIPLDILKFIIRYALSGRAWDNVIENKTAFTSK  868

Query  509  A----------------------PNQCNE--------KNSSEMTDLECAPEEATRLREDD  598
                                   P Q +E        +  SE+ D      E  RLRE  
Sbjct  869  KDYGKGEREAQWAQAQRTLHGLQPAQPSEMFNDKSTYRELSEIADQAKRRAEVARLRERH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI  IQQH T+
Sbjct  929  TLKGHVE---SVVKQKGLDIEAIQQHYTL  954



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   179 bits (453),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y AL+T +FF+L+ DTD+  + F V
Sbjct  685  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALLTVIFFWLMKDTDWLPNTFGV  744

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+   P E+ AA+YLQ+SI+SQALIFVTRS+SWSF E PG LLL AFL AQ +AT I V
Sbjct  745  RSIRNKPDEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGFLLLGAFLIAQLIATLIAV  804

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQG GWGWAGVIW+YSI+ YFPLDI+KF TR AL+        DN T+    
Sbjct  805  YANWGFARIQGCGWGWAGVIWLYSIVFYFPLDIMKFATRYALSNKAWQSMIDNRTAFTTK  864

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  NEK+S    SE+ +      E  RLRE  
Sbjct  865  KDYGKEEREAQWALAQRTLHGLQPPEASNIFNEKSSYRELSEIAEQAKRRAEVARLRELH  924

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  925  TLKGHVE---SVVKLKGLDIDTIQQHYTV  950



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score =   179 bits (453),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 177/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY ALMT +FF+++ DTDFF+D F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGTYMALMTVVFFWIMKDTDFFSDKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP E+ AA+YLQ+SIISQALIFVTRS+SWS+ E PG+LLL AF+ AQ VAT + V
Sbjct  746  RSIRNSPGEMMAALYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFMIAQLVATFLAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGVIW+YS++TY PLDI+KF  R  L+        +N+T+    
Sbjct  806  YANWEFARIKGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>gb|KHM99449.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=940

 Score =   178 bits (452),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y ALMT +FF+ + DT+FF++ F V
Sbjct  675  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGV  734

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L  SP E+ AA+YLQ+SIISQALIFVTRS+SWSF E PG+LLL AF  AQ VAT I V
Sbjct  735  RPLRDSPDEMMAALYLQVSIISQALIFVTRSRSWSFVERPGLLLLGAFFIAQLVATFIAV  794

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGVIW+YS++TY PLD++KF  R  L+        +N+T+    
Sbjct  795  YANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  854

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  855  KDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  914

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  915  TLKGHVE---SVVKLKGLDIDTIQQHYTV  940



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score =   178 bits (452),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y ALMT +FF+ + DT+FF++ F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L  SP E+ AA+YLQ+SIISQALIFVTRS+SWSF E PG+LLL AF  AQ VAT I V
Sbjct  746  RPLRDSPDEMMAALYLQVSIISQALIFVTRSRSWSFVERPGLLLLGAFFIAQLVATFIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGVIW+YS++TY PLD++KF  R  L+        +N+T+    
Sbjct  806  YANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>ref|XP_002523524.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF38863.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=747

 Score =   176 bits (447),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 179/267 (67%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA G+ LGTY A+MT +FF+L  DTDFF + F V
Sbjct  484  DGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGTYMAIMTVIFFWLAHDTDFFPEKFGV  543

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +++    +ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AF+AAQ +AT I V
Sbjct  544  RTIRDEHAELTAALYLQVSIISQALIFVTRSRSWSFLERPGLLLVGAFIAAQLLATVIAV  603

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FA+IQGIGWGWAGVIW+YSIITY PLDI+KF+ R AL+         N+T+    
Sbjct  604  YANWGFAKIQGIGWGWAGVIWVYSIITYIPLDILKFMIRYALSGKAWDNLLQNKTAFTTK  663

Query  506  -----------------------KAPNQCNEKNS-SEMTDL-ECAPE--EATRLREDDAV  604
                                    A    ++K+S  E+T+L E A    E  RLRE   +
Sbjct  664  KDYGKGEREAQWAMAQRTLHGLQSADGVTHDKSSYKELTELAEQAKRRAEVARLRELHTL  723

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI+TIQQH TV
Sbjct  724  KGHVE---SVVKLKGLDIDTIQQHYTV  747



>gb|KFK33846.1| hypothetical protein AALP_AA5G067500 [Arabis alpina]
Length=948

 Score =   178 bits (452),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 171/265 (65%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LGTY AL T LFF+L  DT FF++ F V
Sbjct  687  DGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTTFFSETFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G   EL AA+YLQ+SIISQALIFVTRS+SWSF E PG LL+IAF+ AQ VAT I V
Sbjct  747  RSIQGKEEELMAALYLQVSIISQALIFVTRSRSWSFVERPGFLLIIAFILAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YANW FARIQG GWGWAGVIW+YSIITY PLDI+KF  R ALT    DN           
Sbjct  807  YANWGFARIQGCGWGWAGVIWLYSIITYIPLDILKFAIRYALTGKAWDNMIQQKTAFTTK  866

Query  497  -ETSKAPNQC-------------------NEKNS--SEMTDLECAPEEATRLREDDAV*G  610
             +  K   +                    ++KN   SEM +      E  RLRE   + G
Sbjct  867  KDYGKGEREAQWALAQRTLHGLPPPEAMFHDKNHELSEMAEQAKRRAEVARLRELHTLKG  926

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH T+
Sbjct  927  HVE---SVVKLKGLDIDTIQQHYTL  948



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =   178 bits (451),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 176/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA G+ LG Y ALMT +FF+L+ DTDFF+D F V
Sbjct  686  DGTIMTISKDRVKPSPMPDSWKLREIFATGVVLGAYMALMTVVFFWLMKDTDFFSDKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP E+ AA+YLQ+SIISQALIFVTRS+SWS+ E PG+LLL AF+ AQ VAT + V
Sbjct  746  RSIRNSPGEMMAALYLQVSIISQALIFVTRSRSWSYVERPGLLLLSAFMIAQLVATFLAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQG+GWGWAGVIW+YS++TY PLDI+KF  R  L+        +N+T+    
Sbjct  806  YANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>ref|XP_009366133.1| PREDICTED: ATPase 8, plasma membrane-type-like [Pyrus x bretschneideri]
Length=947

 Score =   178 bits (451),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 138/265 (52%), Positives = 170/265 (64%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+L + T+FF   F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYMAVMTVVFFWLANSTNFFGKHFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
             ++  +P +L +A+YLQ+SIISQALIFVTRS+SWSF E PG++L++AFLAAQ VAT I V
Sbjct  746  HNISDNPKQLNSAIYLQVSIISQALIFVTRSRSWSFVERPGLMLMVAFLAAQLVATLIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----------------D  493
            Y +W FARI+G+GWGWAGVIWIYSI+TYFPLDI KFI R ALT                +
Sbjct  806  YCSWGFARIEGVGWGWAGVIWIYSIVTYFPLDIFKFIIRYALTGKAWDNIVQNKTAFTSN  865

Query  494  NETSKAPNQC---------------------NEKNSSEMTDLECAPEEATRLREDDAV*G  610
            N+  K   +                      N    +E+ +      E  RLRE   + G
Sbjct  866  NDYGKGAREAQWASAQRSLSGLQPPEALFHGNHGEQAELAEQAKRRAEVARLRELHTLKG  925

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  926  HVE---SVVKLKGLDIDTIQQHYTV  947



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   178 bits (451),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 177/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y ALMT +FF+L+ DTDFF+D F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  SP E+ AA+YLQ+SIISQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT + V
Sbjct  746  RSLRKSPEEMMAALYLQVSIISQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATFLAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGVIW+YS++TY PLDI+KF  R  L+        +N+T+    
Sbjct  806  YANWGFARIKGMGWGWAGVIWVYSLVTYIPLDILKFTIRYVLSGKAWDNLLENKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQPPETTNIFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+T+QQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTMQQHYTV  951



>ref|XP_009341818.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Pyrus x 
bretschneideri]
Length=939

 Score =   178 bits (451),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 138/265 (52%), Positives = 170/265 (64%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+L + T+FF   F V
Sbjct  678  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYMAVMTVVFFWLANSTNFFGKHFGV  737

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
             ++  +P +L +A+YLQ+SIISQALIFVTRS+SWSF E PG++L++AFLAAQ VAT I V
Sbjct  738  HNISDNPKQLNSAIYLQVSIISQALIFVTRSRSWSFVERPGLMLMVAFLAAQLVATLIAV  797

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----------------D  493
            Y +W FARI+G+GWGWAGVIWIYSI+TYFPLDI KFI R ALT                +
Sbjct  798  YCSWGFARIEGVGWGWAGVIWIYSIVTYFPLDIFKFIIRYALTGKAWDNIVQNKTAFTSN  857

Query  494  NETSKAPNQC---------------------NEKNSSEMTDLECAPEEATRLREDDAV*G  610
            N+  K   +                      N    +E+ +      E  RLRE   + G
Sbjct  858  NDYGKGAREAQWASAQRSLSGLQPPEALFHGNHGEQAELAEQAKRRAEVARLRELHTLKG  917

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  918  HVE---SVVKLKGLDIDTIQQHYTV  939



>ref|XP_009341817.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009341823.1| PREDICTED: ATPase 8, plasma membrane-type [Pyrus x bretschneideri]
Length=947

 Score =   178 bits (451),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 138/265 (52%), Positives = 170/265 (64%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+L + T+FF   F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYMAVMTVVFFWLANSTNFFGKHFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
             ++  +P +L +A+YLQ+SIISQALIFVTRS+SWSF E PG++L++AFLAAQ VAT I V
Sbjct  746  HNISDNPKQLNSAIYLQVSIISQALIFVTRSRSWSFVERPGLMLMVAFLAAQLVATLIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----------------D  493
            Y +W FARI+G+GWGWAGVIWIYSI+TYFPLDI KFI R ALT                +
Sbjct  806  YCSWGFARIEGVGWGWAGVIWIYSIVTYFPLDIFKFIIRYALTGKAWDNIVQNKTAFTSN  865

Query  494  NETSKAPNQC---------------------NEKNSSEMTDLECAPEEATRLREDDAV*G  610
            N+  K   +                      N    +E+ +      E  RLRE   + G
Sbjct  866  NDYGKGAREAQWASAQRSLSGLQPPEALFHGNHGEQAELAEQAKRRAEVARLRELHTLKG  925

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  926  HVE---SVVKLKGLDIDTIQQHYTV  947



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score =   177 bits (450),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 178/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA G+ LG+Y ALMT +FF+L+ DTDFF+D F V
Sbjct  686  DGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGSYMALMTVIFFWLIKDTDFFSDKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  +P+E+ AA+YLQ+SIISQALIFVTRS+SWS+ E PG LL+ AFL AQ VAT + V
Sbjct  746  RSLRNNPAEMMAALYLQVSIISQALIFVTRSRSWSYVERPGFLLMGAFLIAQLVATFLAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANWSFARI+G+GWGWAGVIW+YS++TY PLDI+KF    AL+        +N+T+    
Sbjct  806  YANWSFARIKGMGWGWAGVIWLYSLVTYVPLDILKFAIAYALSGKAWNTLLENKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>ref|XP_009106729.1| PREDICTED: ATPase 9, plasma membrane-type [Brassica rapa]
Length=954

 Score =   177 bits (450),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 171/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+ V  TDFF+  F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAVESTDFFSAKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+P ELT+A+YLQ+SIISQALIFVTRS+SWS+AE PG  L+ AF  AQ +AT I V
Sbjct  749  RSISGNPHELTSAIYLQVSIISQALIFVTRSRSWSYAERPGFWLIAAFFLAQLIATVIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNE-------TSK  508
            YANW FARI+G GWGWAGVIW+YSI+TY PLDI+KFI R +L+    DN        TSK
Sbjct  809  YANWDFARIRGTGWGWAGVIWLYSIVTYVPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  868

Query  509  A----------------------PNQCNE--------KNSSEMTDLECAPEEATRLREDD  598
                                   P Q +E        +  SE+ D      E  RLRE  
Sbjct  869  KDYGKGEREAQWAQAQRTLHGLQPAQPSEMFNDKSTYRELSEIADQAKRRAEVARLREHH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI  IQQH T+
Sbjct  929  TLKGHVE---SVVKQKGLDIEAIQQHYTL  954



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   177 bits (450),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 174/270 (64%), Gaps = 45/270 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA G+ LG Y A+MT +FF++V DT FF + F V
Sbjct  692  DGTIMTISKDRVKPSPMPDSWKLREIFATGVMLGGYLAMMTVIFFWVVKDTKFFPERFGV  751

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +H SP ELTAA+YLQ+SI+SQALIFVTRS+SWS+ E PG+LL+ AF+ AQ +AT I V
Sbjct  752  RHIHDSPDELTAALYLQVSIVSQALIFVTRSRSWSYVERPGMLLMGAFVIAQLIATLIAV  811

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQGIGWGWAGVIW+YSII Y PLDIIKF  R  L+        +N+T+    
Sbjct  812  YANWGFARIQGIGWGWAGVIWLYSIIFYIPLDIIKFAIRYGLSGKAWTNLLENKTAFTNK  871

Query  506  ----------------------KAPNQC----NEKNS----SEMTDLECAPEEATRLRED  595
                                   AP +     N+KN+    SE+ +      E  RLRE 
Sbjct  872  KDYGKEEREAQWAHAQRTLHGLSAPEETSSLFNDKNTYRELSEIAEQAKRRAEVARLREL  931

Query  596  DAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
              + G +    SV K K LDI T+QQH TV
Sbjct  932  HTLKGHVE---SVVKLKGLDIETMQQHYTV  958



>ref|XP_008386550.1| PREDICTED: ATPase 9, plasma membrane-type-like [Malus domestica]
Length=962

 Score =   177 bits (450),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 141/268 (53%), Positives = 172/268 (64%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    +DFFT+ F V
Sbjct  698  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYMAVMTVVFFWAAHGSDFFTERFGV  757

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  ELT A+YLQ+SIISQALIFVTRS+SWS+ E PG+LLL AF  AQ +AT I V
Sbjct  758  RSIRGNFPELTGAIYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFFIAQLIATIIAV  817

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YANW FARI+GIGWGWAGVIW+YSI+TY PLDI+KFI R  L+    DN           
Sbjct  818  YANWGFARIRGIGWGWAGVIWLYSIVTYIPLDILKFIIRYILSGKAWDNVLENKTAFTTK  877

Query  497  -------------------------ETSKAPNQCNEKNSSEMTDLECAPEEATRLREDDA  601
                                     ET++  +  N +  SE+ +      E  RLRE + 
Sbjct  878  KDYGKGDREAQWATAQRTLHGLQPPETAELFHDKNYRELSEIAEQAKKRAEVARLRELNT  937

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI+TIQQH TV
Sbjct  938  LKGHVE---SVVKLKGLDIDTIQQHYTV  962



>emb|CAD29579.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 137/271 (51%), Positives = 174/271 (64%), Gaps = 46/271 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG+Y ALMT +FF+ +  TDFF+D F V
Sbjct  45   DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGV  104

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  S  E+ +A+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AFL AQ VAT + V
Sbjct  105  RSIRDSEHEMMSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAV  164

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETSKAPN  517
            YANW FARI+GIGWGWAGV+W+YSI+ YFPLD++KF  R  L+        +N+T+    
Sbjct  165  YANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLLKFFIRFVLSGRAWDNLLENKTAFTTK  224

Query  518  Q-------------------------------CNEKNS----SEMTDLECAPEEATRLRE  592
            +                                N+K+S    SE+ +      E  RLRE
Sbjct  225  KDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKSSYRELSEIAEQAKRRAEIARLRE  284

Query  593  DDAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + + G +    SV K K LDI+TIQQ+ TV
Sbjct  285  LNTLKGHV---ESVVKLKGLDIDTIQQNYTV  312



>ref|XP_008384624.1| PREDICTED: ATPase 8, plasma membrane-type [Malus domestica]
Length=947

 Score =   177 bits (450),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 138/265 (52%), Positives = 169/265 (64%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+L + T+FF   F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYMAVMTVVFFWLANSTBFFGKHFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
             ++  +P +L +A+YLQ+SIISQALIFVTRS+SWSF E PG++L +AFLAAQ VAT I V
Sbjct  746  HNISDNPKQLNSAIYLQVSIISQALIFVTRSRSWSFLERPGLMLXVAFLAAQLVATLIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----------------D  493
            Y +W FARI+G+GWGWAGVIWIYSI+TYFPLDI KFI R ALT                +
Sbjct  806  YCSWGFARIEGVGWGWAGVIWIYSIVTYFPLDIFKFIIRYALTGKAWDTIVQNKTAFTSN  865

Query  494  NETSKAPNQC---------------------NEKNSSEMTDLECAPEEATRLREDDAV*G  610
            N+  K   +                      N    +E+ +      E  RLRE   + G
Sbjct  866  NDYGKGAREAQWASAQRSLNGLQPPEALFHGNHGEQAELAEQAKRRAEVARLRELHTLKG  925

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  926  HVE---SVVKLKGLDIDTIQQHYTV  947



>ref|XP_011084023.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   177 bits (450),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 149/268 (56%), Positives = 173/268 (65%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LGTY A+MT +FFFL SDTDFF+D FKV
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYMAIMTVIFFFLASDTDFFSDTFKV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+   P ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AFL AQ +AT I V
Sbjct  747  RSIRNHPEELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVGAFLIAQLLATIIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YA+W FARI+GIGWGWAG+IWIYSIITY PLDIIKF  R AL+                 
Sbjct  807  YAHWEFARIKGIGWGWAGIIWIYSIITYIPLDIIKFGIRFALSGKAWDSMIQKRIAFTTK  866

Query  497  -------------------------ETSKAPNQCNEKNSSEMTDLECAPEEATRLREDDA  601
                                     E+S+  N  + +  SE+ +      E  RLRE   
Sbjct  867  KDYGKGEREAQWAIAQRTLHGLSTTESSELFNDKSYRELSEIAEQAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  927  LKGHVE---SVVKLKGLDIETIQQHYTV  951



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score =   177 bits (450),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 175/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y ALMT +FF+ + DT+FF++ F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L  SP ++ AA+YLQ+SIISQALIFVTRS+SWSF E PG+LLL AF  AQ VAT I V
Sbjct  746  RPLSDSPDKMMAALYLQVSIISQALIFVTRSRSWSFVERPGLLLLGAFFIAQLVATFIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANWSFARI+G+GWGWAGVIW+YS++TY PLD++KF  R  L+        +N+T+    
Sbjct  806  YANWSFARIKGMGWGWAGVIWLYSVVTYIPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>ref|XP_007203995.1| hypothetical protein PRUPE_ppa000965mg [Prunus persica]
 gb|EMJ05194.1| hypothetical protein PRUPE_ppa000965mg [Prunus persica]
Length=948

 Score =   177 bits (450),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 138/265 (52%), Positives = 166/265 (63%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRV+PSP+PDSWKL EIFA G+ LGTY A+MT +FF+L   TDFF   F V
Sbjct  687  DGTIMTISKDRVRPSPLPDSWKLKEIFATGVVLGTYMAIMTVVFFWLAYSTDFFAKTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
              +  +P +L +A+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AFLAAQ VAT I V
Sbjct  747  HHIGENPKQLNSAIYLQVSIISQALIFVTRSRSWSFLERPGVMLVGAFLAAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----------------D  493
            Y +W FARI+GIGW WAGVIW+YSIITYFPLDI KFI R ALT                 
Sbjct  807  YCSWGFARIEGIGWRWAGVIWVYSIITYFPLDIFKFIIRYALTGRAWDNIVQNKTAFTSK  866

Query  494  NETSKAPNQC---------------------NEKNSSEMTDLECAPEEATRLREDDAV*G  610
            N+  K   +                      N +  SE+ +      E  RLRE   + G
Sbjct  867  NDYGKGEREAQWASAQRSLHGLQPPEALFPGNHREQSELAEQAKRRAEVARLRELHTLKG  926

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV + K LDI+TIQQH TV
Sbjct  927  HVE---SVVQLKGLDIDTIQQHYTV  948



>ref|NP_001169998.1| uncharacterized protein LOC100383904 [Zea mays]
 gb|ACN35480.1| unknown [Zea mays]
Length=404

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 166/273 (61%), Gaps = 52/273 (19%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LGTY AL TALFF+L  DTDFFT+ F V
Sbjct  139  DGTIMTISKDRVKPSPTPDSWKLKEIFATGIVLGTYMALATALFFYLAHDTDFFTNAFGV  198

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  EL AA+YLQ+SIISQALIFVTRS+SWSF E PG LL+IAFLAAQ VAT I V
Sbjct  199  RSIKENDKELMAALYLQVSIISQALIFVTRSRSWSFVERPGALLVIAFLAAQLVATCIAV  258

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDNETSKAPNQCNEKNS-  538
            YANW F ++QGIGWGW G IW +S++TYFPLD++KF  R AL    + KA N  N K + 
Sbjct  259  YANWEFCKMQGIGWGWGGAIWAFSVVTYFPLDVLKFAIRYAL----SGKAWNNINNKTAF  314

Query  539  --------------------------------------------SEMTDLECAPEEATRL  586
                                                        SE+ +      E  RL
Sbjct  315  TNRTDYGKGEREAQWATAQRTLHGLNQATATSDLFGDNQGYRELSELAEQAAKRAEVARL  374

Query  587  REDDAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
            RE   + G +    SV K K LDI+TIQQ  TV
Sbjct  375  RELHTLKGHVE---SVVKLKGLDIDTIQQSYTV  404



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   177 bits (449),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LG Y ALMT +FF+L++DTDFF++ F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLREIFATGIVLGGYLALMTVVFFWLMNDTDFFSEKFHV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL   P ++ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  749  RSLRDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMVAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITR--------AALTDNETS----  505
            YANW FARI+G GWGWAGVIW+YSI+TYFPLD +KF  R          L +N+T+    
Sbjct  809  YANWGFARIKGAGWGWAGVIWLYSIVTYFPLDFLKFAIRYIQSGKAWNNLLENKTAFTTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  NEKNS    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_010049874.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=942

 Score =   177 bits (449),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 152/267 (57%), Positives = 176/267 (66%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LGTY ALMT LFF+L  DTDFF + F V
Sbjct  679  DGTIMTISKDRVKPSPVPDSWKLKEIFATGIVLGTYLALMTVLFFWLAHDTDFFPNTFGV  738

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + + GS  ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AFLAAQ VAT I V
Sbjct  739  RPIKGSEDELTAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVGAFLAAQLVATLIAV  798

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNE-------TSK  508
            YA W FAR+QGIGWGWAG+IWI+SIITYFPLD++KF+ R ALT    DN        T+K
Sbjct  799  YATWGFARVQGIGWGWAGLIWIFSIITYFPLDVLKFLIRYALTGKAWDNMFQSKTAFTTK  858

Query  509  A------------------------PNQCNEKNS----SEMTDLECAPEEATRLREDDAV  604
                                     P+  N+K+S    SE+ +      E  RL E   +
Sbjct  859  TDYGKGEREAQWALAERTLHGLQTPPSLFNDKSSYRELSEIAEQARRRAEVARLTELHTL  918

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI TIQQH TV
Sbjct  919  KGHVD---SVVKLKGLDIETIQQHYTV  942



>ref|XP_008367709.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=956

 Score =   177 bits (449),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+L+ DTDFF+D F V
Sbjct  691  DGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGGYMALMTVVFFWLMRDTDFFSDKFHV  750

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL   P ++ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  751  RSLRNRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAV  810

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITR--------AALTDNETS----  505
            YANW FARI+G GWGWAGVIW YSI+TY PLD++KF  R          L +N+T+    
Sbjct  811  YANWGFARIEGAGWGWAGVIWXYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTAFTTK  870

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  NEKNS    SE+ +      E  RLRE  
Sbjct  871  KDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELH  930

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  931  TLKGHVE---SVVKLKGLDIDTIQQHYTV  956



>ref|XP_010049873.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW82682.1| hypothetical protein EUGRSUZ_C04061 [Eucalyptus grandis]
Length=951

 Score =   177 bits (449),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 152/267 (57%), Positives = 176/267 (66%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LGTY ALMT LFF+L  DTDFF + F V
Sbjct  688  DGTIMTISKDRVKPSPVPDSWKLKEIFATGIVLGTYLALMTVLFFWLAHDTDFFPNTFGV  747

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + + GS  ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AFLAAQ VAT I V
Sbjct  748  RPIKGSEDELTAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVGAFLAAQLVATLIAV  807

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNE-------TSK  508
            YA W FAR+QGIGWGWAG+IWI+SIITYFPLD++KF+ R ALT    DN        T+K
Sbjct  808  YATWGFARVQGIGWGWAGLIWIFSIITYFPLDVLKFLIRYALTGKAWDNMFQSKTAFTTK  867

Query  509  A------------------------PNQCNEKNS----SEMTDLECAPEEATRLREDDAV  604
                                     P+  N+K+S    SE+ +      E  RL E   +
Sbjct  868  TDYGKGEREAQWALAERTLHGLQTPPSLFNDKSSYRELSEIAEQARRRAEVARLTELHTL  927

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI TIQQH TV
Sbjct  928  KGHVD---SVVKLKGLDIETIQQHYTV  951



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   177 bits (448),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+L+ DTDFF+D F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGGYMALMTVVFFWLMRDTDFFSDKFXV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL   P ++ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  749  RSLRNRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITR--------AALTDNETS----  505
            YANW FARI+G GWGWAGVIW YSI+TY PLD++KF  R          L +N+T+    
Sbjct  809  YANWGFARIEGAGWGWAGVIWXYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTAFTTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  NEKNS    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_008219933.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Prunus 
mume]
Length=935

 Score =   177 bits (448),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LG Y ALMT +FF+L+ +T FF++ F V
Sbjct  670  DGTIMTISKDRVKPSPQPDSWKLREIFATGIVLGGYMALMTVVFFWLMRETKFFSNAFGV  729

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L   P ++ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  730  RHLGNRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAV  789

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW+FARI+G GWGWAGVIW++S++TYFPLD++KF  R  L+        +N+T+    
Sbjct  790  YANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  849

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  NEKNS    SE+ +      E  RLRE  
Sbjct  850  KDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELH  909

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  910  TLKGHVE---SVVKLKGLDIDTIQQHYTV  935



>gb|KHG19606.1| ATPase 5, plasma membrane-type -like protein [Gossypium arboreum]
Length=659

 Score =   175 bits (443),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 175/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIF+ GI LG Y ALMT +FF+++ DTDFF + F V
Sbjct  394  DGTIMTISKDRVKPSPQPDSWKLKEIFSTGIVLGGYLALMTVVFFWVMKDTDFFPNMFNV  453

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  SP E+ AA+YLQ+SI+SQALIFVTRS+SWS+ E PG+LLL AF+ AQ VAT I V
Sbjct  454  RSLADSPEEMMAALYLQVSIVSQALIFVTRSRSWSYVERPGLLLLTAFVIAQLVATLIAV  513

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGVIW+YS++TY PLD+IKF  R  L+        +N+T+    
Sbjct  514  YANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLIKFAIRYVLSGKAWDNLLENKTAFTTK  573

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  NEK+S    SE+ +      E  RLRE +
Sbjct  574  KDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKSSYRELSEIAEQAKRRAEVARLRELN  633

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  634  TLKGHVE---SVVKLKGLDIDTIQQHYTV  659



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   177 bits (448),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 176/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG Y ALMT +FF+L+ DTDFF+D F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGAYMALMTVVFFWLMKDTDFFSDKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP E+ AA+YLQ+SIISQALIFVTRS+SWS+ E PG+LLL AF+ AQ VAT + V
Sbjct  746  RSIRNSPGEMMAALYLQVSIISQALIFVTRSRSWSYVERPGLLLLSAFMIAQLVATFLAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQG+GWGWAGVIW+YS++TY PLDI+KF  R  L+        +N+T+    
Sbjct  806  YANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>ref|XP_008242930.1| PREDICTED: ATPase 8, plasma membrane-type [Prunus mume]
Length=947

 Score =   177 bits (448),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 166/265 (63%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRV+PSP+PDSWKL EIFA G+ LGTY A+MT +FF+L   TDFF   F V
Sbjct  686  DGTIMTISKDRVRPSPLPDSWKLKEIFATGVVLGTYMAIMTVVFFWLAYSTDFFAKTFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
              +  +P +L +A+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AFLAAQ VAT I V
Sbjct  746  HHIAENPKQLNSAIYLQVSIISQALIFVTRSRSWSFLERPGLMLVGAFLAAQLVATLIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----------------D  493
            Y +W FARI+GIGW WAGVIW+YSIITYFPLDI KFI R ALT                 
Sbjct  806  YCSWGFARIEGIGWRWAGVIWVYSIITYFPLDIFKFIIRYALTGRAWDNIVRNKTAFTSK  865

Query  494  NETSKAPNQC---------------------NEKNSSEMTDLECAPEEATRLREDDAV*G  610
            N+  KA  +                      N    SE+ +      E  RLRE   + G
Sbjct  866  NDYGKAEREAQWASAQRSLHGLQPPGALFPGNHGEQSELAEQAKRRAEVARLRELHTLKG  925

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV + K LDI+TIQQH TV
Sbjct  926  HVE---SVVQLKGLDIDTIQQHYTV  947



>ref|XP_008381054.1| PREDICTED: ATPase 9, plasma membrane-type [Malus domestica]
Length=954

 Score =   177 bits (448),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    +DFFT+ F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYMAVMTVVFFWAAHGSDFFTEKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  ELTAA+YLQ+SIISQALIFVTRS+SWS+ E PG  LL AF+ AQ +AT I V
Sbjct  749  RSIRGNFPELTAAIYLQVSIISQALIFVTRSRSWSYVERPGFFLLGAFVIAQLIATIIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YANW FARI GIGWGWAGVIW+YS+ITY PLDI+KFI R  L+    DN           
Sbjct  809  YANWGFARIHGIGWGWAGVIWLYSLITYVPLDILKFIIRYVLSGKAWDNVLERKTAFTTK  868

Query  497  -------------------------ETSKAPNQCNE-KNSSEMTDLECAPEEATRLREDD  598
                                     ETS+  N  N  +  SE+ +      E  RLRE  
Sbjct  869  KDYGKGEREAQWATAQRTLHGLQPPETSELFNDKNNYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_010103366.1| ATPase 8, plasma membrane-type [Morus notabilis]
 gb|EXB95573.1| ATPase 8, plasma membrane-type [Morus notabilis]
Length=948

 Score =   177 bits (448),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 175/266 (66%), Gaps = 41/266 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y A+MT +FF+L  D+D F+  F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGAYMAIMTVVFFWLAHDSDSFSQTFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            K + G+ +EL +A+YLQ+SIISQ+LIFVTRS+SWSF E PG LL+ AF+AAQ VAT I V
Sbjct  746  KPIKGNLAELNSALYLQVSIISQSLIFVTRSRSWSFVERPGFLLVFAFIAAQLVATVIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI GIGWGWAGVIWIYS+ITY PLD +KFI R AL+         N+T+    
Sbjct  806  YANWEFARIHGIGWGWAGVIWIYSLITYIPLDALKFIIRYALSGKAWDTLLQNKTAFTTK  865

Query  506  ----------------------KAPNQC-NEKNSSEMTDL-ECAPE--EATRLREDDAV*  607
                                  ++P    N+KN+ E TD+ E A    E  RLRE   + 
Sbjct  866  KDYGRGEREAQWAMAQRTLHGLQSPRALFNDKNNHESTDIAEQAKRRAEVARLRELHTLK  925

Query  608  GGMWNH*SVAKAKALDINTIQQHSTV  685
            G +    SV K K LDI+TIQQH TV
Sbjct  926  GHVE---SVVKLKGLDIDTIQQHYTV  948



>ref|XP_011084025.1| PREDICTED: ATPase 8, plasma membrane-type [Sesamum indicum]
Length=949

 Score =   176 bits (447),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 173/266 (65%), Gaps = 41/266 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LGTY A+MT +FF+L SDTDFF+D FKV
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYMAIMTVVFFYLASDTDFFSDTFKV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AFL AQ +AT I V
Sbjct  747  RSIRNNFEELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVGAFLIAQLLATIIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YA+W FARI+GIGWGW GVIWIYSI+TY PLD+IKF  R AL+                 
Sbjct  807  YAHWEFARIRGIGWGWGGVIWIYSIVTYIPLDVIKFGIRFALSGKAWDSMIQNRTAFTTK  866

Query  497  ----------------------ETSKAP-NQCNEKNSSEMTDLECAPEEATRLREDDAV*  607
                                   T++ P N+ + K  SE+ +      E  RLRE   + 
Sbjct  867  KDYGKGEREAQWAMAQRTLHGLSTTETPGNENSYKELSEIAEQAKRRAEVARLRELHTLK  926

Query  608  GGMWNH*SVAKAKALDINTIQQHSTV  685
            G +    SV K K LDI TIQQH TV
Sbjct  927  GHVE---SVVKLKGLDIETIQQHYTV  949



>ref|XP_006389820.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
 gb|ESQ27106.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
Length=953

 Score =   176 bits (447),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    TDFF+  F V
Sbjct  688  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAEFGV  747

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + + G+P ELTAA+YLQ+SI+SQALIFVTRS+SWS+ E PG  L+ AF  AQ +AT I V
Sbjct  748  RPISGNPHELTAAIYLQVSIVSQALIFVTRSRSWSYVERPGFWLVSAFFIAQLIATLIAV  807

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW+FARI+GIGWGWAGVIW+YSI+TY PLDI+KFI R +L+        +N+T+    
Sbjct  808  YANWNFARIRGIGWGWAGVIWLYSIVTYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  867

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  +  N+K++    SE+ D      E  RLRE  
Sbjct  868  KDYGKGEREAQWAQAQRTLHGLQSPQTSDMFNDKSTYRELSEIADQAKRRAEVARLRERH  927

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI  IQQH T+
Sbjct  928  TLKGHVE---SVVKQKGLDIEAIQQHYTL  953



>gb|KDO45595.1| hypothetical protein CISIN_1g044543mg [Citrus sinensis]
Length=962

 Score =   176 bits (447),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PD+WKL EIFA GI LGTY A+MT LFF+ +  + FF++ F V
Sbjct  697  DGTIMTISKDRVKPSPVPDTWKLKEIFATGIVLGTYLAVMTVLFFWAIHSSTFFSEKFGV  756

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP ELTAAVYLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+ AQ VAT I V
Sbjct  757  RSIRDSPHELTAAVYLQVSIVSQALIFVTRSRSWSFLERPGLLLIAAFIIAQLVATLIAV  816

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YAN+ FARI GIGWGW GVIW+YSI+ Y PLD++KFI R ALT    DN           
Sbjct  817  YANFGFARIHGIGWGWVGVIWLYSIVFYIPLDVLKFIVRYALTGKAWDNLLENKTAFTTK  876

Query  497  -------------------------ETSKAPNQCNE-KNSSEMTDLECAPEEATRLREDD  598
                                     ETS+  N  N  +  SE+ +      E  RLRE  
Sbjct  877  KDYGRGEREAQWALAQRTLHGLHPPETSELLNDKNNYRELSEIAEQAKRRAEVARLRELH  936

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  937  TLKGHVE---SVVKLKGLDIETIQQHYTV  962



>ref|XP_006453678.1| hypothetical protein CICLE_v10007374mg [Citrus clementina]
 gb|ESR66918.1| hypothetical protein CICLE_v10007374mg [Citrus clementina]
Length=949

 Score =   176 bits (447),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 146/267 (55%), Positives = 174/267 (65%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIF  G+ LGTY AL+TA FF+L+ DT FFT+ F +
Sbjct  686  DGTIMTISKDRVKPSPMPDSWKLKEIFGTGVVLGTYMALVTAFFFWLIHDTRFFTNTFNL  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            K +H  P  L+AA+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AFL AQ +AT I V
Sbjct  746  KEIHEKPDMLSAALYLQVSIISQALIFVTRSRSWSFVERPGVMLVGAFLVAQLLATIIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAA--------LTDNETS----  505
            YA W FARI+GIGWGWAG IWI+SIITY PLD +KF+ R A        L  N+T+    
Sbjct  806  YAKWEFARIEGIGWGWAGAIWIFSIITYLPLDPLKFVIRYAQSGKAWDNLLQNKTAFTTK  865

Query  506  -----------------------KAPNQCNEKNSS-EMTDL-ECAPE--EATRLREDDAV  604
                                    + +  NEKNS+ E+T+L E A    E  RLRE   +
Sbjct  866  KDYGKGEREAQWAMAQRTMHGLQTSESTVNEKNSNRELTELAEQAKRRAEVARLRELHTL  925

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI TIQQH TV
Sbjct  926  KGHVE---SVVKLKGLDIETIQQHYTV  949



>ref|XP_006427547.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
 gb|ESR40787.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
Length=962

 Score =   176 bits (447),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PD+WKL EIFA GI LGTY A+MT LFF+ +  + FF++ F V
Sbjct  697  DGTIMTISKDRVKPSPVPDTWKLKEIFATGIVLGTYLAVMTVLFFWAIHSSTFFSEKFGV  756

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP ELTAAVYLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+ AQ VAT I V
Sbjct  757  RSIRDSPHELTAAVYLQVSIVSQALIFVTRSRSWSFLERPGLLLIAAFIIAQLVATLIAV  816

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YAN+ FARI GIGWGW GVIW+YSI+ Y PLD++KFI R ALT    DN           
Sbjct  817  YANFGFARIHGIGWGWVGVIWLYSIVFYIPLDVLKFIVRYALTGKAWDNLLENKTAFTTK  876

Query  497  -------------------------ETSKAPNQCNE-KNSSEMTDLECAPEEATRLREDD  598
                                     ETS+  N  N  +  SE+ +      E  RLRE  
Sbjct  877  KDYGRGEREAQWALAQRTLHGLHPPETSELLNDKNNYRELSEIAEQAKRRAEVARLRELH  936

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  937  TLKGHVE---SVVKLKGLDIETIQQHYTV  962



>ref|XP_009334638.1| PREDICTED: ATPase 9, plasma membrane-type [Pyrus x bretschneideri]
Length=954

 Score =   176 bits (447),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 169/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    +DFFT+ F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYMAVMTVVFFWAAHGSDFFTEKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  ELTAA+YLQ+SIISQALIFVTRS+SWS+ E PG  LL AF+ AQ +AT I V
Sbjct  749  RSIRGNFPELTAAIYLQVSIISQALIFVTRSRSWSYVERPGFFLLGAFVIAQLIATIIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAAL----------------TD  493
            YANW FARI GIGWGWAGVIW+YS+ITY PLDI+KFI R  L                T 
Sbjct  809  YANWGFARIHGIGWGWAGVIWLYSLITYVPLDILKFIIRYVLSGKAWDNVLERKTAFTTK  868

Query  494  NETSKAPNQC---------------------NEKNS----SEMTDLECAPEEATRLREDD  598
             +  K   +                      N+KN+    SE+ +      E  RLRE  
Sbjct  869  KDYGKGEREAQWATAQRTLHGLQPPETSELFNDKNNYGELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   176 bits (447),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 176/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LG Y AL T LFF+++ DTDFF++ F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGGYLALGTVLFFWVMKDTDFFSEKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  SP E+ AA+YLQ+SI+SQALIFVTRS+SWSFAE PG+ LL AFL AQ VAT I V
Sbjct  749  RSLRDSPEEIMAALYLQVSIVSQALIFVTRSRSWSFAERPGMFLLGAFLIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+WSFA+I+G GWGWAGVIW+YSI+TYFPLDI+KF  R  L+        +N T+    
Sbjct  809  YADWSFAKIKGCGWGWAGVIWLYSIVTYFPLDILKFCIRYVLSGKAWDNLLENRTAFTTK  868

Query  506  ----------------------KAPNQCN---EKNS----SEMTDLECAPEEATRLREDD  598
                                  + P   N   EK+S    SE+ +      E  RLRE  
Sbjct  869  SNYGKEEREAQWAASQRTLHGLQPPETANLFAEKSSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =   176 bits (447),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 177/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+L+ +TDFF+D F V
Sbjct  690  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDKFGV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP EL AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  750  RSIRESPEELMAALYLQVSIVSQALIFVTRSRSWSFLERPGLLLLSAFMIAQLVATLIAV  809

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQG+GWGWAGVIWIYSI+ YFPLD++KF  R  L+        +N+T+    
Sbjct  810  YANWGFARIQGVGWGWAGVIWIYSIVFYFPLDVMKFAIRYILSGKAWLNLLENKTAFTTK  869

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  N+K+S    SE+ +      E  RLRE  
Sbjct  870  KDYGKEEREAQWALAQRTLHGLQAPEAANLFNDKSSYRELSEIAEQAKRRAEVARLRELH  929

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  930  TLKGHVE---SVVKLKGLDIDTIQQHYTV  955



>ref|XP_006465284.1| PREDICTED: ATPase 9, plasma membrane-type-like [Citrus sinensis]
Length=962

 Score =   176 bits (447),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 171/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PD+WKL EIFA GI LGTY A+MT LFF+ +  + FF++ F V
Sbjct  697  DGTIMTISKDRVKPSPVPDTWKLKEIFATGIVLGTYLAVMTVLFFWAIHSSTFFSEKFGV  756

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP ELTAAVYLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+ AQ VAT I V
Sbjct  757  RSIRDSPHELTAAVYLQVSIVSQALIFVTRSRSWSFLERPGLLLIAAFIIAQLVATLIAV  816

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YAN+ FARI GIGWGWAGVIW+YSI+ Y PLD++KFI R ALT    DN           
Sbjct  817  YANFGFARIHGIGWGWAGVIWLYSIVFYIPLDVLKFIVRYALTGKAWDNLLENKTAFTTK  876

Query  497  -------------------------ETSKAPNQCNE-KNSSEMTDLECAPEEATRLREDD  598
                                     ETS+  N  N  +  SE+ +      E  RLRE  
Sbjct  877  KDYGRGEREAQWALAQRTLHGLHPPETSELLNDKNNYRELSEIAEQAKRRAEVARLRELH  936

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  937  TLKGHVE---SVVKLKGLDIETIQQHYTV  962



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score =   176 bits (446),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 171/270 (63%), Gaps = 45/270 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y AL+T +FF+L+ DTDFF + F V
Sbjct  685  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALLTVIFFWLMKDTDFFPNKFGV  744

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  SP E+ AA+YLQ+SI+SQALIFVTRS+SWSF E PG LLL AFL AQ +AT I V
Sbjct  745  RPIRDSPDEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGFLLLGAFLIAQLIATLIAV  804

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YANW FARI+G GWGWAGVIWIYS++ YFPLDI+KF TR AL+                 
Sbjct  805  YANWGFARIEGCGWGWAGVIWIYSVVFYFPLDIMKFGTRYALSGKAWNNMIEQRVAFTTK  864

Query  497  ----------------------ETSKAPNQCNEKNS-----SEMTDLECAPEEATRLRED  595
                                  +  +A N  N+KNS     SE+ +      E  RLRE 
Sbjct  865  KDYGKEEREAQWAHVQRTLHGLQPPEATNIFNDKNSNYRELSEIAEQAKRRAEVARLREL  924

Query  596  DAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
              + G +    SV K K LDI+TIQQH TV
Sbjct  925  HTLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =   176 bits (446),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 176/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+L+ +TDFF+D F V
Sbjct  690  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDKFGV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP EL AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ +AT + V
Sbjct  750  RSIRESPGELMAALYLQVSIVSQALIFVTRSRSWSFLERPGLLLLGAFMIAQLIATLVAV  809

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI G+GWGWAGVIW+YSI+ YFPLD++KF  R  L+        +N+T+    
Sbjct  810  YANWGFARIHGVGWGWAGVIWVYSIVFYFPLDVMKFAIRYILSGKAWLNLLENKTAFTTK  869

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  N+K+S    SE+ +      E  RLRE  
Sbjct  870  KDYGKEEREAQWALAQRTLHGLQAPEAANLFNDKSSYRELSEIAEQAKRRAEVARLRELH  929

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  930  TLKGHVE---SVVKLKGLDIDTIQQHYTV  955



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =   176 bits (446),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA G+ LG Y ALMT +FF++  DTD FT  F V
Sbjct  686  DGTIMTISKDRVKPSPMPDSWKLKEIFATGVILGAYLALMTVIFFWIAHDTDHFTKAFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +    ++LT+A+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AFLAAQ VAT I V
Sbjct  746  RPIGDDINQLTSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVATLIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YA+W FARI GIGWGWAGVIWI+SI+TYFPLDI+KFI R AL+    DN           
Sbjct  806  YASWGFARIDGIGWGWAGVIWIFSIVTYFPLDILKFIIRYALSGRAWDNLIQNKTAFTSK  865

Query  497  ----------------------ETSKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                  +T+   N  N+KN+    SE+ +      E  RLRE  
Sbjct  866  KDYGKGEREAQWATAQRTLHGLQTADTSNLFNDKNNYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>ref|XP_011084026.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   176 bits (445),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 173/268 (65%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LGTY A+MT +FF+L SDTDFF+D FKV
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYMAIMTVVFFYLASDTDFFSDTFKV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+   P ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AFL AQ +AT I V
Sbjct  747  RSIRNHPEELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVGAFLIAQLLATIIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YA+W FARI+GIGWGWAG+IWIYSI+TY PLDIIKF  R AL+                 
Sbjct  807  YAHWDFARIKGIGWGWAGIIWIYSIVTYIPLDIIKFGIRFALSGKAWDSMIQKRTAFTTK  866

Query  497  -------------------------ETSKAPNQCNEKNSSEMTDLECAPEEATRLREDDA  601
                                     ET++  N  + +  SE+ +      E  RLRE   
Sbjct  867  KDYGRGEREAQWAVAQRTLHGLSTPETAELFNDKSYRELSEIAEQAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K L+I TIQQH TV
Sbjct  927  LKGHVE---SVVKLKGLEIETIQQHYTV  951



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   176 bits (445),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 175/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG Y A+MT +FF++  DTD  T+ F +
Sbjct  685  DGTIMTISKDRVKPSPVPDSWKLKEIFAAGVVLGAYMAVMTVVFFWIAHDTDIATEKFGL  744

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KS+  +  ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AF+AAQ VAT I V
Sbjct  745  KSIKDNTDELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVTAFIAAQLVATVIAV  804

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+WSFARIQGIGWGWA  IW+YS+ITY PLDI+KFITR  L+         N+T+    
Sbjct  805  YASWSFARIQGIGWGWAAFIWVYSVITYIPLDILKFITRYVLSGKAWDNLLQNKTAFTSK  864

Query  506  ----------------------KAPNQC---NEKNS----SEMTDLECAPEEATRLREDD  598
                                  ++P+     N+KNS    SE+ +      E  RLRE  
Sbjct  865  KDYGRGEREAQWAMAQRTLHGLQSPDTSALFNDKNSYRELSEIAEQAKRRAEVARLRELH  924

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  925  TLKGHVE---SVVKLKGLDIETIQQHYTV  950



>dbj|BAO02511.1| predicted H+ ATPase ortholog [Nicotiana alata]
Length=652

 Score =   173 bits (439),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 178/268 (66%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTYQA+MT +FF+L +DTDFF++ F V
Sbjct  388  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYQAIMTVVFFYLAADTDFFSENFHV  447

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP+ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AF AAQ VAT + V
Sbjct  448  RSIRNSPTELTAALYLQVSIISQALIFVTRSRSWSFVERPGLMLVGAFFAAQLVATVLAV  507

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YANW FARI+G+GWGWA VIWIY+IITY PLDI+KFI R AL+                 
Sbjct  508  YANWEFARIKGVGWGWAAVIWIYTIITYIPLDILKFIIRFALSGRAWDSMIQNKTAFTTK  567

Query  497  ----------------------ETSKAPNQCNEKNSSEMTDL-ECAPE--EATRLREDDA  601
                                  +T +     N+KN  E++++ E A    E  RLRE   
Sbjct  568  KDYGRGEREAQWALAQRTLHGLQTPENTGLFNDKNYRELSEIAEQAKRRAEVARLRELHT  627

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  628  LKGHVE---SVVKLKGLDIETIQQHYTV  652



>gb|KFK42449.1| hypothetical protein AALP_AA2G258100 [Arabis alpina]
Length=953

 Score =   176 bits (445),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 138/269 (51%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    TDFF+  F V
Sbjct  688  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGV  747

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + + G+P ELTAA+YLQ+SIISQALIFVTRS+SWS+ E PG+ L+ AF  AQ VA+ I V
Sbjct  748  RPISGNPHELTAAIYLQVSIISQALIFVTRSRSWSYVERPGLWLVAAFFVAQLVASLIAV  807

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW+FARI+GIGWGWAGVIW+YSI+TY PLDI+KFI R +L+        +N+T+    
Sbjct  808  YANWNFARIRGIGWGWAGVIWLYSIVTYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  867

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  +  N+K++    SE+ D      E  RLRE  
Sbjct  868  KDYGKGEREAQWAQAQRTLHGLQPPQTSDMFNDKSTYRELSEIADQAKRRAEVARLRECH  927

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI  IQQH T+
Sbjct  928  TLKGHVE---SVVKQKGLDIEAIQQHYTL  953



>ref|NP_001185450.1| H(+)-ATPase 9 [Arabidopsis thaliana]
 gb|AEE36434.1| H(+)-ATPase 9 [Arabidopsis thaliana]
Length=945

 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 138/269 (51%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    TDFF+  F V
Sbjct  680  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGV  739

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+P ELTAAVYLQ+SI+SQALIFVTRS+SWS+ E PG  L+ AF  AQ +AT I V
Sbjct  740  RSISGNPHELTAAVYLQVSIVSQALIFVTRSRSWSYVERPGFWLISAFFMAQLIATLIAV  799

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNET-----  502
            YANW+FARI+GIGWGWAGVIW+YSI+ Y PLDI+KFI R +L+        +N+T     
Sbjct  800  YANWNFARIRGIGWGWAGVIWLYSIVFYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  859

Query  503  ------------------------SKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                    ++  +  N+K++    SE+ D      E  RLRE  
Sbjct  860  KDYGKGEREAQWAQAQRTLHGLQPAQTSDMFNDKSTYRELSEIADQAKRRAEVARLRERH  919

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI  IQQH T+
Sbjct  920  TLKGHVE---SVVKQKGLDIEAIQQHYTL  945



>ref|XP_007135798.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
 gb|ESW07792.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
Length=949

 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA GI LGTY A+MT +FF+    +DFFT+ F V
Sbjct  684  DGTIMTISKDRVKPSPLPDSWKLNEIFATGIVLGTYLAIMTVVFFWAAHASDFFTEKFGV  743

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +P ELTAAVYLQ+SI+SQALIFVTRS+SWS+ E PG+LL+ AF+ AQ +AT I V
Sbjct  744  RSIRSNPGELTAAVYLQVSIVSQALIFVTRSRSWSYFERPGLLLVSAFIVAQLIATVIAV  803

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAAL--------TDNETS----  505
            YANW FAR+QGIGWGWAGVIW+YSI+ Y PLD++KF  R  L        T+N+T+    
Sbjct  804  YANWEFARMQGIGWGWAGVIWLYSIVFYLPLDVLKFGIRYFLSGKAWNNITENKTAFTTK  863

Query  506  ----------------KAPNQCN---------EKNS----SEMTDLECAPEEATRLREDD  598
                            +  +  N         E+N+    SE+ +      E  RLRE  
Sbjct  864  KDYGKEEREAQWATAQRTLHGLNPPETEPTFSERNNYRELSEIAEQARKRAEVARLRELH  923

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G M    SV K K LDI+TIQ H TV
Sbjct  924  TLKGHME---SVVKLKGLDIDTIQHHYTV  949



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRV+PSP+PDSWKL EIFA G+ LG Y A+MT +FF++  DTD  T+ F +
Sbjct  685  DGTIMTISKDRVRPSPVPDSWKLREIFATGVVLGAYMAVMTVVFFWIAHDTDIVTEKFGL  744

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KS+ G+  ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AF+AAQ VAT I V
Sbjct  745  KSISGNTDELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVTAFIAAQLVATVIAV  804

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARI+GIGWGWA  IW+YS+ITY PLDI+KFITR AL+         N+T+    
Sbjct  805  YASWGFARIEGIGWGWAAFIWVYSVITYIPLDILKFITRYALSGKAWDNLLQNKTAFTSK  864

Query  506  ----------------------KAPNQC---NEKNS----SEMTDLECAPEEATRLREDD  598
                                  + P+     N+KN     SE+ +      E  RLRE  
Sbjct  865  KDYGRGEREAQWVMAQRTLHGLQPPDTSGLFNDKNGYTELSEIAEQAKRRAEVARLRELH  924

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  925  TLKGHVE---SVVKLKGLDIETIQQHYTV  950



>ref|NP_178181.1| H(+)-ATPase 9 [Arabidopsis thaliana]
 sp|Q42556.2|PMA9_ARATH RecName: Full=ATPase 9, plasma membrane-type; AltName: Full=Proton 
pump 9 [Arabidopsis thaliana]
 gb|AAF14653.1|AC011713_1 Identical to gb|X73676 aha9 (ATAHA9) ATPase gene from Arabidopsis 
thaliana [Arabidopsis thaliana]
 gb|AEE36433.1| H(+)-ATPase 9 [Arabidopsis thaliana]
Length=954

 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 138/269 (51%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    TDFF+  F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+P ELTAAVYLQ+SI+SQALIFVTRS+SWS+ E PG  L+ AF  AQ +AT I V
Sbjct  749  RSISGNPHELTAAVYLQVSIVSQALIFVTRSRSWSYVERPGFWLISAFFMAQLIATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNET-----  502
            YANW+FARI+GIGWGWAGVIW+YSI+ Y PLDI+KFI R +L+        +N+T     
Sbjct  809  YANWNFARIRGIGWGWAGVIWLYSIVFYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  868

Query  503  ------------------------SKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                    ++  +  N+K++    SE+ D      E  RLRE  
Sbjct  869  KDYGKGEREAQWAQAQRTLHGLQPAQTSDMFNDKSTYRELSEIADQAKRRAEVARLRERH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI  IQQH T+
Sbjct  929  TLKGHVE---SVVKQKGLDIEAIQQHYTL  954



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 138/268 (51%), Positives = 171/268 (64%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+ + DT FF   F V
Sbjct  692  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYMALMTVIFFWAMKDTTFFPRKFGV  751

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +H SP E+TAA+YLQ+S +SQALIFVTRS+SWSF E PG+LL+ AF+ AQ +AT I V
Sbjct  752  RPIHDSPYEMTAALYLQVSTVSQALIFVTRSRSWSFVERPGMLLMGAFVIAQLIATIIAV  811

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT-------DNETS-----  505
            YANW FA+IQG+GWGWAGVIW+YS++ YFPLD++KF  R  L+       +N+T+     
Sbjct  812  YANWGFAKIQGVGWGWAGVIWLYSVVFYFPLDLLKFAIRYVLSGKAWVNIENKTAFTTKK  871

Query  506  ------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDDA  601
                                    +  N  NE N+    SE+ +      E  RLRE   
Sbjct  872  DYGKEEREAQWAHAQRTLHGLQPPETSNIFNESNNYRELSEIAEQAKRRAEVARLRELHT  931

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI+TIQQH TV
Sbjct  932  LKGHVE---SVVKLKGLDIDTIQQHYTV  956



>ref|XP_006300372.1| hypothetical protein CARUB_v10022427mg [Capsella rubella]
 gb|EOA33270.1| hypothetical protein CARUB_v10022427mg [Capsella rubella]
Length=955

 Score =   175 bits (444),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTI+KDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    TDFF+  F V
Sbjct  690  DGTIMTIAKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+P ELT+A+YLQ+SIISQALIFVTRS+SWS+ E PG  L+ AF  AQ +AT I V
Sbjct  750  RSISGNPHELTSAIYLQVSIISQALIFVTRSRSWSYVERPGFWLIFAFFIAQLIATLIAV  809

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNET-----  502
            YANW FARI+G GWGWAGVIW+YSI+TY PLDI+KFI R +L+        +N+T     
Sbjct  810  YANWDFARIRGTGWGWAGVIWLYSIVTYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  869

Query  503  ------------------------SKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                    +++ +  N+K++    SE+ D      E  RLRE  
Sbjct  870  KDYGKGEREAQWAQAQRTLHGLQPAQSSDMFNDKSTYRELSEIADQAKRRAEVARLRERH  929

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI  IQQH T+
Sbjct  930  TLKGHVE---SVVKQKGLDIEAIQQHYTL  955



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =   175 bits (444),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA G+ LG Y ALMT +FF+ + +T FF+D F V
Sbjct  689  DGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGGYLALMTVIFFWAMKETTFFSDKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SLH SP E+ AA+YLQ+SI+SQALIFVTRS+SWS+ E PG+LL+ AF+ AQ +AT I V
Sbjct  749  RSLHDSPDEMIAALYLQVSIVSQALIFVTRSRSWSYVERPGLLLMSAFVIAQLIATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+GIGWGWAGVIW+YSI+ Y PLDI+KF  R  L+        +N+T+    
Sbjct  809  YANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIMKFAIRYILSGKAWLNLLENKTAFTTK  868

Query  506  ----KAPNQC---------------------NEKNS----SEMTDLECAPEEATRLREDD  598
                K   +                      NEK+S    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWALAQRTLHGLQPPETSGIFNEKSSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_006293643.1| hypothetical protein CARUB_v10022598mg [Capsella rubella]
 gb|EOA26541.1| hypothetical protein CARUB_v10022598mg [Capsella rubella]
Length=931

 Score =   175 bits (443),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIF+ G+ LG YQALMT +FF+++ DTD F++   V
Sbjct  666  DGTIMTISKDRVKPSPQPDSWKLREIFSTGVVLGGYQALMTVVFFWVMKDTDIFSNMLGV  725

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L   P ++ AA+YLQ+SIISQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  726  RPLSQRPEQMMAALYLQVSIISQALIFVTRSRSWSFVERPGLLLLGAFVIAQLVATFIAV  785

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNET-----  502
            YANWSFARI+G GWGWAGVIW+YS+ITY PLD++KF  R  L+        +N+T     
Sbjct  786  YANWSFARIEGAGWGWAGVIWLYSLITYIPLDLLKFGIRYVLSGKAWLNLLENKTAFTTK  845

Query  503  ------------------------SKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                    ++  N  NEKNS    S++ +      E  RLRE +
Sbjct  846  KDYGKEEREAQWAAAQRTLHGLQPAETNNIFNEKNSYHDLSQIAEQAKRRAEVVRLREIN  905

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  906  TLKGHVE---SVVKLKGLDIDTIQQHYTV  931



>ref|XP_010417678.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X1 [Camelina 
sativa]
Length=955

 Score =   175 bits (443),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 137/270 (51%), Positives = 173/270 (64%), Gaps = 45/270 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTI+KDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    TDFF+  F V
Sbjct  689  DGTIMTIAKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+P ELT+A+YLQ+SIISQALIFVTRS+SWS+ E PG  L+ AFL AQ +AT I V
Sbjct  749  RSISGNPHELTSAIYLQVSIISQALIFVTRSRSWSYVERPGFWLMFAFLIAQLIATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G GWGWAGVIW+Y+IITY PLDI+KFI R +L+        +N+T+    
Sbjct  809  YANWDFARIRGTGWGWAGVIWLYTIITYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  868

Query  506  --------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLRED  595
                                      ++ +  N+K++    SE+ D      E  RLRE 
Sbjct  869  KDYGKGEREAQWAQAQRTLHGLQPAHQSSDMFNDKSTYRELSEIADQAKRRAEVARLRER  928

Query  596  DAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
              + G +    SV K K LDI  IQQH T+
Sbjct  929  HTLKGHVE---SVVKQKGLDIEAIQQHYTL  955



>ref|XP_006473964.1| PREDICTED: ATPase 8, plasma membrane-type-like [Citrus sinensis]
 gb|KDO59386.1| hypothetical protein CISIN_1g041450mg [Citrus sinensis]
Length=949

 Score =   175 bits (443),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 170/267 (64%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIF  G+ LGTY AL+TA FF+L+ DT FFT+ F +
Sbjct  686  DGTIMTISKDRVKPSPMPDSWKLKEIFGTGVVLGTYMALVTAFFFWLIHDTRFFTNTFNL  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            K +H  P  L+AA+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AFL AQ +AT I V
Sbjct  746  KEIHEKPDMLSAALYLQVSIISQALIFVTRSRSWSFVERPGVMLVGAFLVAQLLATIIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAA--------LTDNETS----  505
            YA W FARI+GIGWGWAG IWI+SIITY PLD +KF+ R A        L  N+T+    
Sbjct  806  YAKWEFARIEGIGWGWAGAIWIFSIITYLPLDPLKFVIRYAQSGKAWDNLLQNKTAFTTK  865

Query  506  -----------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDDAV  604
                                    + +  NEKNS    +E+ +      E  RLRE   +
Sbjct  866  KDYGKGEREAQWAMAQRTMHGLQTSESTVNEKNSNRELNELAEQAKRRAEVARLRELHTL  925

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI TIQQH TV
Sbjct  926  KGHVE---SVVKLKGLDIETIQQHYTV  949



>ref|XP_007023380.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26002.1| H(+)-ATPase 9 [Theobroma cacao]
Length=926

 Score =   174 bits (442),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA GI LG Y A MT +FF+   ++DFF+D F V
Sbjct  661  DGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGAYLACMTVVFFWAAQESDFFSDKFGV  720

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  S  ELTAAVYLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+ AQ VAT + V
Sbjct  721  RSIRNSHEELTAAVYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFIIAQLVATILAV  780

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YANW FARI+GIGWGWAGVIWIYS++ YFPLD++KF+ R +L+    DN           
Sbjct  781  YANWGFARIKGIGWGWAGVIWIYSVVFYFPLDVLKFLIRYSLSGKAWDNLLQNKTAFTTK  840

Query  497  -------------------------ETSKAPNQ-CNEKNSSEMTDLECAPEEATRLREDD  598
                                     ET+   N+  N +  SE+ +      E  RLRE  
Sbjct  841  KDYGRGEREAQWAMAQRTLHGLQPPETTDLFNEKTNYRELSEIAEQARKRAEVARLRELH  900

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  901  TLKGHVE---SVVKLKGLDIDTIQQHYTV  926



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score =   174 bits (442),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA GI LG Y A MT +FF+   ++DFF+D F V
Sbjct  688  DGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGAYLACMTVVFFWAAQESDFFSDKFGV  747

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  S  ELTAAVYLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+ AQ VAT + V
Sbjct  748  RSIRNSHEELTAAVYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFIIAQLVATILAV  807

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YANW FAR++GIGWGWAGVIWIYSI+ Y PLDI+KF  R +L+    DN           
Sbjct  808  YANWGFARMKGIGWGWAGVIWIYSIVFYIPLDILKFFIRYSLSGKAWDNLLQNKTAFTTK  867

Query  497  ----------------------ETSKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                  +T  + +  N+KNS    SE+ +      E  RLRE  
Sbjct  868  KDYGREEREAQWATAQRTLHGLQTPGSVDILNDKNSHEELSEIAEQAKKRAEVARLREFH  927

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  928  TLKGHVE---SVVKLKGLDIDTIQQHYTV  953



>ref|XP_004486623.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=949

 Score =   174 bits (442),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA+GI LG Y A+MT +FF+    ++FF+D F V
Sbjct  684  DGTIMTISKDRVKPSPLPDSWKLKEIFAMGIVLGAYLAVMTVVFFWAAHASNFFSDKFGV  743

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  + +ELTAAVYLQ+SI+SQALIFVTRS+SWSF E PG+LL++AFL AQ +AT I V
Sbjct  744  RSIRDNHNELTAAVYLQVSIVSQALIFVTRSRSWSFIERPGLLLVVAFLIAQLIATLIAV  803

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAAL--------TDN-------  496
            YANW FA ++ IGWGWAGVIW+YSI+ Y PLDI+KFI + AL        TDN       
Sbjct  804  YANWEFAHMKAIGWGWAGVIWLYSIVFYIPLDILKFIIKYALSGKAWNNITDNRTAFTTK  863

Query  497  -------------------------ETSKAPNQCNE-KNSSEMTDLECAPEEATRLREDD  598
                                     ET +  N+ N  ++ SE+ +      E  RLRE  
Sbjct  864  KDYGRGEREAQWAAAQRTLHGLNPPETEQVLNESNNYRDLSELAEQAKKRAEIARLRELH  923

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  924  TLKGHVE---SVVKLKGLDIETIQQHYTV  949



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   174 bits (442),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LG Y ALMT +FF+ + DTDFF+D F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYLALMTVVFFWAMHDTDFFSDKFNV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  SP E  AA+YLQ+SIISQALIFVTRS+SWSFAE PG+LL+ AF+ AQ VAT I V
Sbjct  749  RSLRNSPHEQMAALYLQVSIISQALIFVTRSRSWSFAERPGLLLVSAFIIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW F+RI+GIGWGWAGVIW+Y+I++Y PLDIIKF  R  L+        +N+T+    
Sbjct  809  YANWGFSRIKGIGWGWAGVIWLYTIVSYVPLDIIKFFIRYVLSGKAWDNLLENKTAFTTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+K+S    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKSSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>gb|ABO15469.2| plasma membrane H+-ATPase LilHA2 [Lilium longiflorum]
Length=954

 Score =   174 bits (442),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 175/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA GI LG Y A+MT +FF++V DTD+FT  F V
Sbjct  689  DGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGAYLAIMTVIFFWIVHDTDYFTKAFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
              +  + ++LT+A+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AFLAAQ VAT I+V
Sbjct  749  SPIGDNINQLTSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVATVISV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YA+W FARI GIGW WAGVIWI+SI+TYFPLDI+KFI R AL+    DN           
Sbjct  809  YASWGFARIDGIGWRWAGVIWIFSIVTYFPLDILKFIIRYALSGKAWDNLIQNKTAFTSK  868

Query  497  ----------------------ETSKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                  +T+   +  N+KNS    SE+ +      E  RLRE  
Sbjct  869  KDYGKGEREAQWATAQRTLHGLQTADTSSLFNDKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIETIQQHYTV  954



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   174 bits (442),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 168/269 (62%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA G+ LGTY ALMT +FF+ +  TDFF+D F+V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGTYLALMTVIFFWAMHKTDFFSDTFRV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL G   E+ AA+YLQ+SI+SQALIFVTRS+SW F E PG+LL+ AF+ AQ VAT I V
Sbjct  749  RSLRGHDEEMMAALYLQVSIVSQALIFVTRSRSWCFVERPGLLLVTAFVIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNETSKA------  511
            YANW FARI+GIGWGWA VIW+YSI+ +FPLD+ KF  R  L+    DN   K       
Sbjct  809  YANWGFARIKGIGWGWAAVIWLYSIVFFFPLDLFKFSIRYILSGKAWDNLLEKKTAFTTK  868

Query  512  ---------------------------PNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                        N  NEKNS    SE+ +      E  RLRE  
Sbjct  869  KDYGREEREAQWAMAQRTLHGLQPPETTNLFNEKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>dbj|BAM20992.1| plasma membrane H+-ATPase, partial [Marchantia polymorpha]
Length=460

 Score =   170 bits (430),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIF  G+ +GTY A+MT +FF+    TDFF   F V
Sbjct  196  DGTIMTISKDRVKPSPLPDSWKLAEIFTQGVVIGTYLAVMTVIFFWAADRTDFFERTFGV  255

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL GSP+ELTAAVYLQ+SIISQALIFVTRS+SWSF E PG+LLL AF  AQ VAT I V
Sbjct  256  RSLRGSPNELTAAVYLQVSIISQALIFVTRSRSWSFTERPGLLLLAAFWIAQLVATFIAV  315

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN  496
            YANW FARI GIGWGWAGVIW+YSIITYFPLDIIKF  R  L++ 
Sbjct  316  YANWGFARITGIGWGWAGVIWLYSIITYFPLDIIKFAVRYILSNK  360



>ref|XP_002515334.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF46783.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=734

 Score =   172 bits (437),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIF+ G+ LG Y ALMT +FF+ + +TDFF+D F V
Sbjct  469  DGTIMTISKDRVKPSPQPDSWKLKEIFSTGVVLGGYLALMTVIFFWAMEETDFFSDKFGV  528

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SLH S  E+ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+AAQ +AT I V
Sbjct  529  RSLHNSEGEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLIGAFIAAQLIATVIAV  588

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G GWGWAGVIW+YS++TY PLD++KF  R  L+        +N+T+    
Sbjct  589  YANWGFARIEGCGWGWAGVIWLYSVVTYVPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  648

Query  506  ----------------------KAPNQCN---EKNS----SEMTDLECAPEEATRLREDD  598
                                  + P   N   +KNS    SE+ +      E  RLRE  
Sbjct  649  KDYGKEEREAQWATAQRTLHGLQPPETTNFFADKNSYRELSEIAEQAKRRAEVARLRELH  708

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  709  TLKGHVE---SVVKLKGLDIDTIQQHYTV  734



>gb|EPS59184.1| hypothetical protein M569_15622, partial [Genlisea aurea]
Length=522

 Score =   171 bits (432),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKD+VKPSPMPDSWKL EIFA GI  GTY A+MT +FF+   ++DFFT+ F V
Sbjct  257  DGTIMTISKDKVKPSPMPDSWKLKEIFATGIVFGTYLAVMTVVFFWAAQESDFFTEKFGV  316

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G   EL + VYLQ+SIISQALIFVTRS++WS+ E PG+LL+ AFLAAQ +AT I V
Sbjct  317  RSIRGKHRELNSVVYLQVSIISQALIFVTRSRTWSYIERPGLLLVFAFLAAQLIATLIAV  376

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDNE-----------TSK  508
            YANW FA+IQGIGWGWAGVIW+Y+II Y PLD+ KFI R AL+              TSK
Sbjct  377  YANWGFAKIQGIGWGWAGVIWLYNIIFYIPLDVFKFIIRYALSGKAWNHMLENKIAFTSK  436

Query  509  -----------------------APN-------QCNEKNSSEMTDLECAPEEATRLREDD  598
                                   APN       + N +  SE+ +      E  RLRE  
Sbjct  437  KDYGRGEREAQWAMAQRTLHGLQAPNTSELFHDKSNYRELSEIAEQAMKRAEVARLRELH  496

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  497  TLKGHVE---SVVKRKGLDIDTIQQHYTV  522



>ref|XP_010472893.1| PREDICTED: ATPase 9, plasma membrane-type isoform X1 [Camelina 
sativa]
Length=994

 Score =   174 bits (442),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 172/270 (64%), Gaps = 45/270 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTI+KDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    TDFF+  F V
Sbjct  728  DGTIMTIAKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGV  787

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + + G+P ELT+A+YLQ+SIISQALIFVTRS+SWS+ E PG  L+ AFL AQ +AT I V
Sbjct  788  RPISGNPHELTSAIYLQVSIISQALIFVTRSRSWSYVERPGFWLIFAFLIAQLIATLIAV  847

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G GWGWAGVIW+Y+IITY PLDI+KFI R +L+        +N+T+    
Sbjct  848  YANWDFARIRGTGWGWAGVIWLYTIITYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  907

Query  506  --------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLRED  595
                                      ++ +  N+K++    SE+ D      E  RLRE 
Sbjct  908  KDYGKGEREAQWAQAQRTLHGLQPAHQSSDMFNDKSTYRELSEIADQAKRRAEVARLRER  967

Query  596  DAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
              + G +    SV K K LDI  IQQH T+
Sbjct  968  HTLKGHVE---SVVKQKGLDIEAIQQHYTL  994



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   174 bits (441),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 171/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LG Y ALMT +FF+L+ DTDFF++ F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYMALMTVVFFWLMRDTDFFSNKFHV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L   P ++ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  749  RPLSDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITR--------AALTDNETS----  505
            YANW FARIQG GWGWAGVIW+YSI+TY PLD++KF  R          L +N+T+    
Sbjct  809  YANWGFARIQGAGWGWAGVIWLYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTAFTTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  NEKNS    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_009368031.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=948

 Score =   174 bits (441),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 171/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LG Y ALMT +FF+L+ DTDFF++ F V
Sbjct  683  DGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYMALMTVVFFWLMRDTDFFSNKFHV  742

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L   P ++ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  743  RPLSDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAV  802

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITR--------AALTDNETS----  505
            YANW FARIQG GWGWAGVIW+YSI+TY PLD++KF  R          L +N+T+    
Sbjct  803  YANWGFARIQGAGWGWAGVIWLYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTAFTTK  862

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  NEKNS    SE+ +      E  RLRE  
Sbjct  863  KDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELH  922

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  923  TLKGHVE---SVVKLKGLDIDTIQQHYTV  948



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   174 bits (441),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 172/268 (64%), Gaps = 44/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LG Y ALMT +FF+L++DTDFF++ F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLREIFATGIVLGGYLALMTVVFFWLMNDTDFFSEKFHV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL   P ++ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  749  RSLRDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMVAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITR--------AALTDNETS----  505
            YANW FARI+G GWGWAGVIW+YSI+TYFPLD +KF  R          L +N+T+    
Sbjct  809  YANWGFARIKGAGWGWAGVIWLYSIVTYFPLDFLKFAIRYIQSGKAWNNLLENKTAFTTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  NEKNS    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHST  682
             + G +    SV K K LDI++IQQH T
Sbjct  929  TLKGHVE---SVVKLKGLDIDSIQQHYT  953



>dbj|BAC77530.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=951

 Score =   174 bits (441),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA G+ LG+Y ALMT +FF+L+ DTDFF+D F V
Sbjct  686  DGTIMTISKDRVKPSPQPDSWKLREIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  SP E+ AA+YLQ+SIISQALIFVTRS+SWS+ E PG+LLL AF  AQ VAT + V
Sbjct  746  RSLRNSPEEMMAALYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFFIAQLVATFLAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETSKAPN  517
            YANW FARI+G+GWGWA VIW+YS++TY PLDI+KF  R  L+        +N+T+    
Sbjct  806  YANWGFARIKGMGWGWAAVIWLYSLVTYVPLDILKFTIRYVLSGKAWDNLLENKTAFTTK  865

Query  518  Q-----------------------------CNEKNS----SEMTDLECAPEEATRLREDD  598
            +                              N+KNS    SE+ +      E  RLRE  
Sbjct  866  KDYGKEEREAQWATAQRTLHGLQPPETTSIFNDKNSYRELSEIAEQAKRRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIDTIQQHYTV  951



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   174 bits (441),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LG Y ALMT +FF+L+ DT FF++ F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYMALMTVVFFWLMKDTKFFSNTFNV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L   P ++ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  749  RHLGDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMVAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW+FARI+G GWGWAGVIW++S++TYFPLD++KF  R  L+        +N+T+    
Sbjct  809  YANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  +EKNS    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETNNLFSEKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_011078615.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X2 [Sesamum 
indicum]
Length=932

 Score =   174 bits (441),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIF  GI LGTY A+MT +FF+L SDTDFF++ F V
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLQEIFCTGIVLGTYMAIMTVVFFYLASDTDFFSNTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL G P ELTAA+YLQ+SIISQALIFV RS+SWSF E PG LL+ AFL AQ +AT I V
Sbjct  747  RSLRGKPDELTAALYLQVSIISQALIFVIRSRSWSFVERPGCLLITAFLLAQLLATIIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT  490
            YA+W FARIQGIGWGW GVIW+YSIITYFPLDI+KFI R AL+
Sbjct  807  YAHWGFARIQGIGWGWGGVIWVYSIITYFPLDILKFIIRFALS  849



>ref|XP_009399554.1| PREDICTED: plasma membrane ATPase isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=955

 Score =   174 bits (441),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 179/269 (67%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y A++T +FF+LV DTDFF + F V
Sbjct  690  DGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGAYLAIITVVFFWLVHDTDFFPEKFGV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KS+  + +ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AFLAAQ VAT I V
Sbjct  750  KSIRDNNNELTAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVATVIAV  809

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARI+GIGWGWA +IWI+S++TYFPLD++KFI R AL+         N+T+    
Sbjct  810  YASWGFARIEGIGWGWAAIIWIFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTK  869

Query  506  ----------------------KAPNQC---NEKNS----SEMTDLECAPEEATRLREDD  598
                                  + P+     N+ NS    SE+ D      E  RLRE +
Sbjct  870  KDYGREEREAQWALAQRTLHGLQVPDTSALFNDNNSYRELSEIADQAMRRAEVARLRELN  929

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  930  TLKGHVE---SVVKLKGLDIDTIQQHYTV  955



>ref|XP_007225350.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
 gb|EMJ26549.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
Length=943

 Score =   174 bits (441),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LG Y ALMT +FF+L+ DT FF++ F V
Sbjct  678  DGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYMALMTVVFFWLMKDTKFFSNTFNV  737

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L   P ++ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  738  RHLGDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMVAQLVATLIAV  797

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW+FARI+G GWGWAGVIW++S++TYFPLD++KF  R  L+        +N+T+    
Sbjct  798  YANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  857

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  +EKNS    SE+ +      E  RLRE  
Sbjct  858  KDYGKEEREAQWAAAQRTLHGLQPPETNNLFSEKNSYRELSEIAEQAKRRAEVARLRELH  917

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  918  TLKGHVE---SVVKLKGLDIDTIQQHYTV  943



>ref|XP_009399553.1| PREDICTED: plasma membrane ATPase isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=981

 Score =   174 bits (441),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 179/269 (67%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y A++T +FF+LV DTDFF + F V
Sbjct  716  DGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGAYLAIITVVFFWLVHDTDFFPEKFGV  775

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KS+  + +ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AFLAAQ VAT I V
Sbjct  776  KSIRDNNNELTAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVATVIAV  835

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARI+GIGWGWA +IWI+S++TYFPLD++KFI R AL+         N+T+    
Sbjct  836  YASWGFARIEGIGWGWAAIIWIFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTK  895

Query  506  ----------------------KAPNQC---NEKNS----SEMTDLECAPEEATRLREDD  598
                                  + P+     N+ NS    SE+ D      E  RLRE +
Sbjct  896  KDYGREEREAQWALAQRTLHGLQVPDTSALFNDNNSYRELSEIADQAMRRAEVARLRELN  955

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  956  TLKGHVE---SVVKLKGLDIDTIQQHYTV  981



>ref|XP_009399552.1| PREDICTED: plasma membrane ATPase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=982

 Score =   174 bits (441),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 179/269 (67%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y A++T +FF+LV DTDFF + F V
Sbjct  717  DGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGAYLAIITVVFFWLVHDTDFFPEKFGV  776

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KS+  + +ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AFLAAQ VAT I V
Sbjct  777  KSIRDNNNELTAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVATVIAV  836

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARI+GIGWGWA +IWI+S++TYFPLD++KFI R AL+         N+T+    
Sbjct  837  YASWGFARIEGIGWGWAAIIWIFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTK  896

Query  506  ----------------------KAPNQC---NEKNS----SEMTDLECAPEEATRLREDD  598
                                  + P+     N+ NS    SE+ D      E  RLRE +
Sbjct  897  KDYGREEREAQWALAQRTLHGLQVPDTSALFNDNNSYRELSEIADQAMRRAEVARLRELN  956

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  957  TLKGHVE---SVVKLKGLDIDTIQQHYTV  982



>ref|XP_009399551.1| PREDICTED: plasma membrane ATPase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1008

 Score =   174 bits (441),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 179/269 (67%), Gaps = 44/269 (16%)
 Frame = +2

Query  2     DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
             DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y A++T +FF+LV DTDFF + F V
Sbjct  743   DGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGAYLAIITVVFFWLVHDTDFFPEKFGV  802

Query  182   ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
             KS+  + +ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AFLAAQ VAT I V
Sbjct  803   KSIRDNNNELTAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVATVIAV  862

Query  362   YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
             YA+W FARI+GIGWGWA +IWI+S++TYFPLD++KFI R AL+         N+T+    
Sbjct  863   YASWGFARIEGIGWGWAAIIWIFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTK  922

Query  506   ----------------------KAPNQC---NEKNS----SEMTDLECAPEEATRLREDD  598
                                   + P+     N+ NS    SE+ D      E  RLRE +
Sbjct  923   KDYGREEREAQWALAQRTLHGLQVPDTSALFNDNNSYRELSEIADQAMRRAEVARLRELN  982

Query  599   AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
              + G +    SV K K LDI+TIQQH TV
Sbjct  983   TLKGHVE---SVVKLKGLDIDTIQQHYTV  1008



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   174 bits (440),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+ + DTDFF++ F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMHDTDFFSEKFSV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL GS +E+  A+YLQ+SI+SQALIFVTRS+SWS+AE PG+LLL AF+ AQ VAT I V
Sbjct  749  RSLRGSENEMMGALYLQVSIVSQALIFVTRSRSWSYAERPGLLLLSAFIIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+GIGWGWAGVIW+YSI+ Y PLD IKF  R  L+        +N+T+    
Sbjct  809  YANWGFARIKGIGWGWAGVIWLYSIVFYVPLDFIKFAIRYILSGKAWLTLFENKTAFTTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  +EKNS    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWALAQRTLHGLQPPETSNLFHEKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_010472896.1| PREDICTED: ATPase 9, plasma membrane-type isoform X3 [Camelina 
sativa]
 ref|XP_010472897.1| PREDICTED: ATPase 9, plasma membrane-type isoform X4 [Camelina 
sativa]
Length=955

 Score =   174 bits (440),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 136/270 (50%), Positives = 172/270 (64%), Gaps = 45/270 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTI+KDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    TDFF+  F V
Sbjct  689  DGTIMTIAKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + + G+P ELT+A+YLQ+SIISQALIFVTRS+SWS+ E PG  L+ AFL AQ +AT I V
Sbjct  749  RPISGNPHELTSAIYLQVSIISQALIFVTRSRSWSYVERPGFWLIFAFLIAQLIATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G GWGWAGVIW+Y+IITY PLDI+KFI R +L+        +N+T+    
Sbjct  809  YANWDFARIRGTGWGWAGVIWLYTIITYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  868

Query  506  --------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLRED  595
                                      ++ +  N+K++    SE+ D      E  RLRE 
Sbjct  869  KDYGKGEREAQWAQAQRTLHGLQPAHQSSDMFNDKSTYRELSEIADQAKRRAEVARLRER  928

Query  596  DAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
              + G +    SV K K LDI  IQQH T+
Sbjct  929  HTLKGHVE---SVVKQKGLDIEAIQQHYTL  955



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =   174 bits (440),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIF  GI LG Y ALMT LFF+ V DT+FF++ F V
Sbjct  690  DGTIMTISKDRVKPSPQPDSWKLKEIFGTGIVLGGYLALMTVLFFWAVKDTNFFSEKFNV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KSL  SP EL AA+YLQ+SIISQALIFVTRS+SWS+ E PG+LL+ AF+ AQ VAT I V
Sbjct  750  KSLKDSPEELMAALYLQVSIISQALIFVTRSRSWSYMERPGLLLVGAFIIAQLVATVIAV  809

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAA--------LTDNETS----  505
            YANW FARI+G+GWGWAGVIW+YS++TY PLDI+KF  R A        L +N+T+    
Sbjct  810  YANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKTAFTTK  869

Query  506  ----------------------KAPNQCN---EKNS----SEMTDLECAPEEATRLREDD  598
                                  + P   N   EK+S    SE+ +      E  RLRE  
Sbjct  870  KDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRAEVARLRELH  929

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  930  TLKGHVE---SVVKLKGLDIDTIQQHYTV  955



>ref|XP_007150788.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
 gb|ESW22782.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
Length=949

 Score =   174 bits (440),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 138/269 (51%), Positives = 168/269 (62%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIF  GI LG Y A+MT +FF+    ++FF+D F V
Sbjct  684  DGTIMTISKDRVKPSPMPDSWKLREIFITGIVLGAYLAVMTVVFFWAAHASNFFSDKFGV  743

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  + SELTAAVYLQ+SI+SQALIFVTRS+SWS+ E PG+ LL+AF  AQ +AT I V
Sbjct  744  RSIRDNHSELTAAVYLQVSIVSQALIFVTRSRSWSYVERPGLFLLVAFFIAQLIATIIAV  803

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----------------D  493
            YANW FA+++GIGWGWAGVIW+YSI+ Y P+DI+KFI R  LT                 
Sbjct  804  YANWGFAKMKGIGWGWAGVIWLYSIVFYVPMDILKFIIRYGLTGKAWNNITENRVAFTSK  863

Query  494  NETSKAPNQC---------------------NEKNS----SEMTDLECAPEEATRLREDD  598
            N+  K   +                      NEKN+    SE+ +      E  RLRE  
Sbjct  864  NDYGKGEREAQWAAAQRTLHGLNPPETDEMLNEKNNYRELSELAEQAKKRAEVARLRELH  923

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  924  TLKGHVE---SVVKLKGLDIETIQQHYTV  949



>emb|CBI35956.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   174 bits (440),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 169/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTI+KDRVKPSP+PDSWKL EIFA GI LGTY A+MT +FF+   D++FF+D F V
Sbjct  687  DGTIMTIAKDRVKPSPLPDSWKLREIFATGIVLGTYLAVMTVVFFWAAHDSNFFSDKFSV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  ELTA VYLQ+SI+SQALIFVTRSQ WSF E PG+LL+ AFL AQ VAT I V
Sbjct  747  RSIRGNKHELTAVVYLQVSIVSQALIFVTRSQGWSFIERPGLLLVSAFLIAQLVATFIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FA+I+G GWGWAGVIW+YSI+ YFPLDI+KF  R ALT         N+T+    
Sbjct  807  YANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFFIRYALTGKAWDTLLQNKTAFTTK  866

Query  506  ---------------------KAPNQCNE--------KNSSEMTDLECAPEEATRLREDD  598
                                   P Q +E        +  SEM +      E  RLRE  
Sbjct  867  KDYGRGEREAQWALAQRTLHGLQPPQTSELFTEKGNYRELSEMAEQAKRRAEVARLRELH  926

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI  IQQH TV
Sbjct  927  TLKGHVE---SVVKLKGLDIEGIQQHYTV  952



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   174 bits (440),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG Y AL+T +FF+L+ DTDFF D F V
Sbjct  685  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGGYLALLTVIFFWLIKDTDFFPDKFGV  744

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +P E+ A +YLQ+SI+SQALIFVTRS+SWSF E PG LLL AF+ AQ +AT I V
Sbjct  745  RSIRHNPEEMMAVLYLQVSIVSQALIFVTRSRSWSFVERPGFLLLGAFMIAQLLATVIAV  804

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI G GWGWAGV+W+YSI+ YFPLDI+KF TR AL+        DN T+    
Sbjct  805  YANWGFARIHGCGWGWAGVVWLYSIVFYFPLDIMKFATRYALSGKAWQNMIDNRTAFSTK  864

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A    N+K+S    SE+ +      E  RLRE  
Sbjct  865  KDYGKEEREAQWALAQRTLHGLQPPEASTIFNDKSSYRELSEIAEQAKRRAEVARLRELH  924

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  925  TLKGHVE---SVVKLKGLDIDTIQQHYTV  950



>ref|XP_004138879.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=1038

 Score =   174 bits (441),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2     DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
             DGTIMTISKDRVKPSP PDSWKL EIF  GI LG Y ALMT LFF+ V DT+FF++ F V
Sbjct  773   DGTIMTISKDRVKPSPQPDSWKLKEIFGTGIVLGGYLALMTVLFFWAVKDTNFFSEKFNV  832

Query  182   ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
             KSL  SP EL AA+YLQ+SIISQALIFVTRS+SWS+ E PG+LL+ AF+ AQ VAT I V
Sbjct  833   KSLKDSPEELMAALYLQVSIISQALIFVTRSRSWSYMERPGLLLVGAFIIAQLVATVIAV  892

Query  362   YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAA--------LTDNETS----  505
             YANW FARI+G+GWGWAGVIW+YS++TY PLDI+KF  R A        L +N+T+    
Sbjct  893   YANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKTAFTTK  952

Query  506   ----------------------KAPNQCN---EKNS----SEMTDLECAPEEATRLREDD  598
                                   + P   N   EK+S    SE+ +      E  RLRE  
Sbjct  953   KDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRAEVARLRELH  1012

Query  599   AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
              + G +    SV K K LDI+TIQQH TV
Sbjct  1013  TLKGHVE---SVVKLKGLDIDTIQQHYTV  1038



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   173 bits (439),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIF  GI LG Y ALMT LFF+ V DT+FF++ F V
Sbjct  690  DGTIMTISKDRVKPSPQPDSWKLKEIFGTGIVLGGYLALMTVLFFWAVKDTNFFSEKFNV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KSL  SP EL AA+YLQ+SIISQALIFVTRS+SWS+ E PG+LL+ AF+ AQ VAT I V
Sbjct  750  KSLKDSPEELMAALYLQVSIISQALIFVTRSRSWSYMERPGLLLVGAFIIAQLVATVIAV  809

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAA--------LTDNETS----  505
            YANW FARI+G+GWGWAGVIW+YS++TY PLDI+KF  R A        L +N+T+    
Sbjct  810  YANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKTAFTTK  869

Query  506  ----------------------KAPNQCN---EKNS----SEMTDLECAPEEATRLREDD  598
                                  + P   N   EK+S    SE+ +      E  RLRE  
Sbjct  870  KDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRAEVARLRELH  929

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  930  TLKGHVE---SVVKLKGLDIDTIQQHYTV  955



>emb|CAN78639.1| hypothetical protein VITISV_031738 [Vitis vinifera]
Length=958

 Score =   173 bits (439),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 169/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTI+KDRVKPSP+PDSWKL EIFA GI LGTY A+MT +FF+   D++FF+D F V
Sbjct  693  DGTIMTIAKDRVKPSPLPDSWKLREIFATGIVLGTYLAVMTVVFFWAAHDSNFFSDKFSV  752

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  ELTA VYLQ+SI+SQALIFVTRSQ WSF E PG+LL+ AFL AQ VAT I V
Sbjct  753  RSIRGNKHELTAVVYLQVSIVSQALIFVTRSQGWSFIERPGLLLVSAFLIAQLVATFIAV  812

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FA+I+G GWGWAGVIW+YSI+ YFPLDI+KF  R ALT         N+T+    
Sbjct  813  YANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFFIRYALTGKAWDTLLQNKTAFTTK  872

Query  506  ---------------------KAPNQCNE--------KNSSEMTDLECAPEEATRLREDD  598
                                   P Q +E        +  SEM +      E  RLRE  
Sbjct  873  KDYGRGEREAQWALAQRTLHGLQPPQTSELFTEKGNYRELSEMAEQAKRRAEVARLRELH  932

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI  IQQH TV
Sbjct  933  TLKGHVE---SVVKLKGLDIEGIQQHYTV  958



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =   173 bits (439),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 169/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTI+KDRVKPSP+PDSWKL EIFA GI LGTY A+MT +FF+   D++FF+D F V
Sbjct  685  DGTIMTIAKDRVKPSPLPDSWKLREIFATGIVLGTYLAVMTVVFFWAAHDSNFFSDKFSV  744

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  ELTA VYLQ+SI+SQALIFVTRSQ WSF E PG+LL+ AFL AQ VAT I V
Sbjct  745  RSIRGNKHELTAVVYLQVSIVSQALIFVTRSQGWSFIERPGLLLVSAFLIAQLVATFIAV  804

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FA+I+G GWGWAGVIW+YSI+ YFPLDI+KF  R ALT         N+T+    
Sbjct  805  YANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFFIRYALTGKAWDTLLQNKTAFTTK  864

Query  506  ---------------------KAPNQCNE--------KNSSEMTDLECAPEEATRLREDD  598
                                   P Q +E        +  SEM +      E  RLRE  
Sbjct  865  KDYGRGEREAQWALAQRTLHGLQPPQTSELFTEKGNYRELSEMAEQAKRRAEVARLRELH  924

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI  IQQH TV
Sbjct  925  TLKGHVE---SVVKLKGLDIEGIQQHYTV  950



>ref|XP_009128205.1| PREDICTED: ATPase 8, plasma membrane-type [Brassica rapa]
Length=948

 Score =   173 bits (439),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 170/265 (64%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LGTY AL T LFF+L  DT+FF+  F V
Sbjct  687  DGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTNFFSKTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  EL AA+YLQ+SIISQALIFVTRS+SWSF E PG LLLIAF+ AQ VAT I V
Sbjct  747  RSIQENEEELMAALYLQVSIISQALIFVTRSRSWSFVERPGFLLLIAFVIAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YANW FARI G GWGWAGVIW+YSIITY PLDI+KF  R +LT    DN           
Sbjct  807  YANWGFARILGCGWGWAGVIWLYSIITYIPLDILKFTIRYSLTGKAWDNMIQQKTAFTTK  866

Query  497  -ETSKAPNQC-------------------NEKNS--SEMTDLECAPEEATRLREDDAV*G  610
             +  K   +                    ++KN   SE+ +      E  RLRE   + G
Sbjct  867  KDYGKGEREAQWALAQRTLHGLPPPEAMFHDKNHELSEIAEQAKRRAEVARLRELHTLKG  926

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  927  HVE---SVVKLKGLDIDTIQQHYTV  948



>gb|KHN31888.1| ATPase 9, plasma membrane-type [Glycine soja]
Length=841

 Score =   172 bits (437),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIF  GI LGTY A+MT +FF+    +DFF+D F V
Sbjct  576  DGTIMTISKDRVKPSPVPDSWKLREIFVTGIVLGTYLAVMTVVFFWAAHASDFFSDKFGV  635

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  + SELTAAVYLQ+SI+SQALIFVTRS+SWS+ E PG+ LL+AF  AQ +AT I V
Sbjct  636  RSIRENYSELTAAVYLQVSIVSQALIFVTRSRSWSYVERPGMFLLVAFFIAQLIATVIAV  695

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT-----------------  490
            YANW FA+++GIGWGWAGVIW+YSII Y P+DI+KFI R ALT                 
Sbjct  696  YANWEFAKMKGIGWGWAGVIWLYSIIFYIPMDILKFIIRYALTGKAWNNITENRVAFTTK  755

Query  491  ------DNETSKAPNQ--------------CNEKNS----SEMTDLECAPEEATRLREDD  598
                  + E   A  Q               NEKN+    SE+ +      E  RLRE  
Sbjct  756  KDYGKGEREAQWAAAQRTLHGLNPPETEEMLNEKNNYRELSELAEQAKKRAEVARLRELH  815

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI T+QQH TV
Sbjct  816  TLKGHVE---SVVKLKGLDIETMQQHYTV  841



>ref|XP_010535850.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=881

 Score =   172 bits (437),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 173/265 (65%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY AL T LFF+L  DTDFF+  F V
Sbjct  620  DGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYMALATVLFFWLAHDTDFFSATFGV  679

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  EL AA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+IAF+ AQ +AT I V
Sbjct  680  RSIRGNEEELMAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVIAFILAQLLATLIAV  739

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA W FARI G GWGWAGVIW+YSI+TY PLDI+KFI R +L+        +N+T+    
Sbjct  740  YAQWEFARIAGCGWGWAGVIWLYSIVTYVPLDILKFIIRYSLSGKAWDNMIENKTAFTTK  799

Query  506  ----KAPNQC-------------------NEKNS--SEMTDLECAPEEATRLREDDAV*G  610
                K   +                    ++KN   SE+ +      E  RLRE   + G
Sbjct  800  KDYGKGEREAQWALAQRTLHGLPPPDAMFHDKNHELSEIAEQAKRRAEVARLRELHTLKG  859

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  860  HVE---SVVKLKGLDIDTIQQHYTV  881



>ref|XP_009587248.1| PREDICTED: ATPase 9, plasma membrane-type [Nicotiana tomentosiformis]
Length=951

 Score =   173 bits (438),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 178/268 (66%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTYQA+MT +FF+L +DTDFF++ F V
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYQAIMTVVFFYLAADTDFFSENFHV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP+ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AF AAQ VAT + V
Sbjct  747  RSIRNSPTELTAALYLQVSIISQALIFVTRSRSWSFVERPGLMLVAAFFAAQLVATVLAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YANW FARI+G+GWGWA VIWIY+IITY PLDI+KFI R AL+                 
Sbjct  807  YANWEFARIKGVGWGWAAVIWIYTIITYIPLDILKFIIRFALSGRAWDSMIQNKTAFTTK  866

Query  497  ----------------------ETSKAPNQCNEKNSSEMTDL-ECAPE--EATRLREDDA  601
                                  +T +     N+KN  E++++ E A    E  RLRE   
Sbjct  867  KDYGRGEREAQWALAQRTLHGLQTPENTGLFNDKNYRELSEIAEQAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  927  LKGHVE---SVVKLKGLDIETIQQHYTV  951



>ref|XP_007012006.1| H(+)-ATPase 8 [Theobroma cacao]
 gb|EOY29625.1| H(+)-ATPase 8 [Theobroma cacao]
Length=951

 Score =   173 bits (438),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 178/266 (67%), Gaps = 41/266 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKLNEIFA GI LG Y A+++ LFF+L  DTDFFT+ F V
Sbjct  689  DGTIMTISKDRVKPSPMPDSWKLNEIFATGIVLGAYMAIISVLFFWLAHDTDFFTEKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +H +  ELT+A+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AF+AAQ VAT I V
Sbjct  749  RPIHDNIDELTSALYLQVSIISQALIFVTRSRSWSFVERPGLLLIGAFIAAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAAL----------------TD  493
            YA+W FARIQGIGWGWAGVIW++S+ITY PLDI+KFI R +L                T 
Sbjct  809  YASWGFARIQGIGWGWAGVIWLFSLITYIPLDILKFIIRYSLSGKAWDNLLQNKTAFTTK  868

Query  494  NETSKAPNQC-------------------NEKNSSEMTDL-ECAPE--EATRLREDDAV*  607
             +  K   +                    N+K+  E++++ E A +  E  RLRE   + 
Sbjct  869  KDYGKGEREAQWAAAQRTLHGLSPPETILNDKSYHELSEIAEQAKKRAEVARLRELHTLK  928

Query  608  GGMWNH*SVAKAKALDINTIQQHSTV  685
            G +    SV K K LDI+TIQQH TV
Sbjct  929  GHVE---SVVKLKGLDIDTIQQHYTV  951



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   173 bits (438),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LG Y ALMT +FF+L++DTDFF++ F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYLALMTVVFFWLMNDTDFFSEKFHV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL   P ++ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  749  RSLRDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITR--------AALTDNETS----  505
            YANW FARI+G GWGWAGVIW+YSI+TY PLD +KF  R          L +N+T+    
Sbjct  809  YANWGFARIKGAGWGWAGVIWLYSIVTYVPLDFLKFAIRYIQSGKAWNNLLENKTAFTTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  NE+NS    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETSNLFNERNSYRELSEIAEQAKRRAEVARLRELT  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>emb|CDX67957.1| BnaA07g19970D [Brassica napus]
Length=895

 Score =   172 bits (437),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 140/267 (52%), Positives = 168/267 (63%), Gaps = 39/267 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+    TDFF+  F V
Sbjct  629  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGV  688

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+P ELT+A+YLQ+SIISQALIFVTRS+SWS+AE PG  L+ AF  AQ VAT I V
Sbjct  689  RSISGNPHELTSAIYLQVSIISQALIFVTRSRSWSYAERPGFWLIAAFFIAQLVATIIAV  748

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNE-------TSK  508
            YANW FARI+G GWGWAGVIW+YSI+TY PLDI+KFI R AL+    DN        TSK
Sbjct  749  YANWDFARIRGTGWGWAGVIWLYSIVTYIPLDILKFIIRYALSGRAWDNVIENKTAFTSK  808

Query  509  APNQCNEKNS-----------------SEMTDLECAPEEATRL-----REDDAV*GGMWN  622
                  E+ +                 SEM + +    E + +     R  +    G   
Sbjct  809  KDYGKGEREAQWAQAQRTLHGLQPAQPSEMFNDKSTYRELSEIADQAKRRAEVARQGSKR  868

Query  623  H------*SVAKAKALDINTIQQHSTV  685
            H       SV K K LDI  IQQH T+
Sbjct  869  HTLKGHVESVVKQKGLDIEAIQQHYTL  895



>ref|XP_008228760.1| PREDICTED: ATPase 9, plasma membrane-type [Prunus mume]
Length=954

 Score =   173 bits (438),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+  +D+DFFTD F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAANDSDFFTDKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  ELTAAVYLQ+SI+SQALIFVTRSQ WS+ E PG++L+ AFL AQ +AT I V
Sbjct  749  RSIRGNDPELTAAVYLQVSIVSQALIFVTRSQGWSYIERPGLMLVGAFLIAQLIATIIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YA+W FARI GIGWGWAGVIW+YSI+ Y PLDI+KFI R AL+    DN           
Sbjct  809  YAHWGFARIHGIGWGWAGVIWLYSIVFYIPLDILKFIIRYALSGKAWDNVLERKTAFTTK  868

Query  497  -------------------------ETSKA-PNQCNEKNSSEMTDLECAPEEATRLREDD  598
                                     ET++   ++ N +  SE+ +      E  RLRE  
Sbjct  869  KDYGRGEREAQWATAQRTLHGLQSAETAELFSDKNNYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_009766358.1| PREDICTED: ATPase 8, plasma membrane-type [Nicotiana sylvestris]
Length=951

 Score =   173 bits (438),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 178/268 (66%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTYQA+MT +FF+L +DTDFF++ F V
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYQAIMTVVFFYLAADTDFFSENFHV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP+ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AF AAQ VAT + V
Sbjct  747  RSIRNSPTELTAALYLQVSIISQALIFVTRSRSWSFVERPGLMLVGAFFAAQLVATVLAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YANW FARI+G+GWGWA VIWIY+IITY PLDI+KFI R AL+                 
Sbjct  807  YANWEFARIKGVGWGWAAVIWIYTIITYIPLDILKFIIRFALSGRAWDSMIQNKTAFTTK  866

Query  497  ----------------------ETSKAPNQCNEKNSSEMTDL-ECAPE--EATRLREDDA  601
                                  +T +     N+KN  E++++ E A    E  RLRE   
Sbjct  867  KDYGRGEREAQWALAQRTLHGLQTPENTGLFNDKNYRELSEIAEQAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  927  LKGHVE---SVVKLKGLDIETIQQHYTV  951



>gb|AAR32129.2| proton P-ATPase [Nicotiana tabacum]
Length=951

 Score =   173 bits (438),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 178/268 (66%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTYQA+MT +FF+L +DTDFF++ F V
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYQAIMTVVFFYLAADTDFFSENFHV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP+ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AF AAQ VAT + V
Sbjct  747  RSIRNSPTELTAALYLQVSIISQALIFVTRSRSWSFVERPGLMLVGAFFAAQLVATVLAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YANW FARI+G+GWGWA VIWIY+IITY PLDI+KFI R AL+                 
Sbjct  807  YANWEFARIKGVGWGWAAVIWIYTIITYIPLDILKFIIRFALSGRAWDSMIQNKTAFTTK  866

Query  497  ----------------------ETSKAPNQCNEKNSSEMTDL-ECAPE--EATRLREDDA  601
                                  +T +     N+KN  E++++ E A    E  RLRE   
Sbjct  867  KDYGRGEREAQWALAQRTLHGLQTPENTGLFNDKNYRELSEIAEQAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  927  LKGHVE---SVVKLKGLDIETIQQHYTV  951



>gb|AAQ19039.1| P-type H+-ATPase [Vicia faba]
Length=370

 Score =   166 bits (421),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 149/191 (78%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+  G+Y ALMT +FF+L+ DTDFF+D F V
Sbjct  119  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVQGSYMALMTVVFFWLMKDTDFFSDKFGV  178

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +P E+ AA+YLQ+SIISQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  179  RSIRKNPDEMMAALYLQVSIISQALIFVTRSRSWSFLERPGLLLLGAFMIAQLVATFIAV  238

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDNETSKAPNQCNEKNSS  541
            YANW FARI+G+GWGWAGVIW+YS++TYFPLDI+KF+ R  L    + KA +   E  ++
Sbjct  239  YANWGFARIKGMGWGWAGVIWVYSLVTYFPLDILKFVIRYVL----SGKAWDNLLENKTA  294

Query  542  EMTDLECAPEE  574
              T  +   EE
Sbjct  295  FTTKKDYGKEE  305



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA G+ LG+Y A+MT +FF+L+  TDFF+D F V
Sbjct  620  DGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGSYLAIMTVVFFWLMRKTDFFSDAFGV  679

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL   P E+ AA+YLQ+SIISQALIFVTRS+SWSF E PG+LL  AF+ AQ VAT I V
Sbjct  680  RSLRTRPDEMMAALYLQVSIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVATFIAV  739

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANWSFARI+G GWGWAGVIW+YS++TYFPLDI+KF  R  L+        +N+T+    
Sbjct  740  YANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKTAFTTK  799

Query  506  ---------------------KAPNQCN----EKNS----SEMTDLECAPEEATRLREDD  598
                                   P + N    +KNS    SE+ +      E  RLRE  
Sbjct  800  KDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEIAEQAKRRAEVARLRELH  859

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  860  TLKGHVE---SVVKLKGLDIDTIQQHYTV  885



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   173 bits (438),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LG Y ALMT +FF+L++DTDFF++ F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYLALMTVVFFWLMNDTDFFSEKFHV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL   P ++ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  749  RSLRDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITR--------AALTDNETS----  505
            YANW FARI+G GWGWAGVIW+YSI+TY PLD +KF  R          L +N+T+    
Sbjct  809  YANWGFARIKGAGWGWAGVIWLYSIVTYVPLDFLKFAIRYIQSGKAWNNLLENKTAFTTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  NE+NS    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETXNLFNERNSYRELSEIAEQAKRRAEVARLRELT  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_007217150.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
 gb|EMJ18349.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
Length=954

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+  +D+DFFT+ F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVILGTYLAVMTVVFFWAANDSDFFTEKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  ELTAAVYLQ+SI+SQALIFVTRSQ WS+ E PG+LL+ AFL AQ +AT I V
Sbjct  749  RSIRGNEPELTAAVYLQVSIVSQALIFVTRSQGWSYIERPGLLLVGAFLIAQLIATIIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YA+W FARI GIGWGWAGVIW+YSI+ Y PLDI+KFI R AL+    DN           
Sbjct  809  YAHWGFARIHGIGWGWAGVIWLYSIVFYIPLDILKFIIRYALSGKAWDNVLERKTAFTTK  868

Query  497  -------------------------ETSKA-PNQCNEKNSSEMTDLECAPEEATRLREDD  598
                                     ET++   ++ N +  SE+ +      E  RLRE  
Sbjct  869  KDYGKGEREAQWATAQRTLHGLQSAETAELFSDKNNYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_009417440.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 175/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LGTY ALMT +FF+L  DTDFF + F V
Sbjct  691  DGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGTYLALMTVVFFWLAHDTDFFPEKFGV  750

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            K +  + +ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AF+AAQ VAT I  
Sbjct  751  KPIRDNLNELTAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVTAFIAAQLVATVIAA  810

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNET-----  502
            YA+W FARIQGIGWGWAG+IW++S++TYFPLD++KFI R  L+        +N+T     
Sbjct  811  YASWGFARIQGIGWGWAGIIWLFSLVTYFPLDVLKFIIRYTLSGKAWDNLLENKTAFTTK  870

Query  503  ------------------------SKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                    +  P   N+K+S    SE+ +      E  RLRE  
Sbjct  871  KDYGRGEREAQWALAQRTLHGLQPADTPGLFNDKSSYRELSEIAEQAKKRAEVARLRELH  930

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  931  TLKGHVE---SVVKLKGLDIETIQQHYTV  956



>gb|EPS57651.1| hypothetical protein M569_17165 [Genlisea aurea]
Length=955

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 176/266 (66%), Gaps = 41/266 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LGTY A++T +FF+L S T+FF+D FKV
Sbjct  693  DGTIMTISKDRVKPSPVPDSWKLKEIFATGIVLGTYMAVITVVFFYLASSTEFFSDIFKV  752

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KS+  SP +L++A+YLQ+SIISQALIFVTRS+SWSF E PG++L+ AFL AQ VAT I V
Sbjct  753  KSIRSSPGQLSSALYLQVSIISQALIFVTRSRSWSFVERPGLMLVFAFLTAQLVATVIAV  812

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDNE-----------TSK  508
            YA+W F RI+GIGW WAGVIWI+S++TY PLD++KFI R  L+              T+K
Sbjct  813  YADWRFTRIEGIGWEWAGVIWIFSVVTYVPLDVLKFIIRFGLSGKAWDSMIQNKTAFTTK  872

Query  509  APNQCNE------------------------KNSSEMTDL-ECAPEEA--TRLREDDAV*  607
                 NE                        KN  E+++L E A + A   RLRE   + 
Sbjct  873  KDYGRNEREAKWAMAQRTLHGLSNQKFDNDKKNGKELSELAEQAKKRAEIARLREIHTLK  932

Query  608  GGMWNH*SVAKAKALDINTIQQHSTV  685
            G +    SV K K LDI+TIQQH TV
Sbjct  933  GHVE---SVVKLKGLDIDTIQQHYTV  955



>ref|XP_010535849.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=948

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 173/265 (65%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY AL T LFF+L  DTDFF+  F V
Sbjct  687  DGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYMALATVLFFWLAHDTDFFSATFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  EL AA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+IAF+ AQ +AT I V
Sbjct  747  RSIRGNEEELMAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVIAFILAQLLATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA W FARI G GWGWAGVIW+YSI+TY PLDI+KFI R +L+        +N+T+    
Sbjct  807  YAQWEFARIAGCGWGWAGVIWLYSIVTYVPLDILKFIIRYSLSGKAWDNMIENKTAFTTK  866

Query  506  ----KAPNQC-------------------NEKNS--SEMTDLECAPEEATRLREDDAV*G  610
                K   +                    ++KN   SE+ +      E  RLRE   + G
Sbjct  867  KDYGKGEREAQWALAQRTLHGLPPPDAMFHDKNHELSEIAEQAKRRAEVARLRELHTLKG  926

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  927  HVE---SVVKLKGLDIDTIQQHYTV  948



>gb|AAQ19041.1| P-type H+-ATPase [Phaseolus acutifolius]
Length=370

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 147/191 (77%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y ALMT +FF+ + DT+FF++ F V
Sbjct  119  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYMALMTVIFFWAMKDTNFFSNKFGV  178

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  SP E+ AA+YLQ+SIISQALIFVTRS+SWSFAE PG+LLL AFL AQ VAT I V
Sbjct  179  RSLRFSPEEMMAALYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLVATFIAV  238

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDNETSKAPNQCNEKNSS  541
            YANW FARI+G+GWGWAGVIW+YS++TY PLD +KF  R  L    + KA +   E  ++
Sbjct  239  YANWGFARIKGMGWGWAGVIWLYSVVTYIPLDFLKFAIRYIL----SGKAWDNLLENKTA  294

Query  542  EMTDLECAPEE  574
              T  +   EE
Sbjct  295  FTTKKDYGKEE  305



>ref|XP_003543699.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIF  GI LGTY A+MT +FF+    +DFF+D F V
Sbjct  684  DGTIMTISKDRVKPSPVPDSWKLREIFVTGIVLGTYLAVMTVVFFWAAHASDFFSDKFGV  743

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  + SELTAAVYLQ+SI+SQALIFVTRS+SWS+ E PG+ LL+AF  AQ +AT I V
Sbjct  744  RSIRENYSELTAAVYLQVSIVSQALIFVTRSRSWSYVERPGMFLLVAFFIAQLIATVIAV  803

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT-----------------  490
            YANW FA+++GIGWGWAGVIW+YSII Y P+DI+KFI R ALT                 
Sbjct  804  YANWEFAKMKGIGWGWAGVIWLYSIIFYIPMDILKFIIRYALTGKAWNNITENRVAFTTK  863

Query  491  ------DNETSKAPNQ--------------CNEKNS----SEMTDLECAPEEATRLREDD  598
                  + E   A  Q               NEKN+    SE+ +      E  RLRE  
Sbjct  864  KDYGKGEREAQWAAAQRTLHGLNPPETEEMLNEKNNYRELSELAEQAKKRAEVARLRELH  923

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI T+QQH TV
Sbjct  924  TLKGHVE---SVVKLKGLDIETMQQHYTV  949



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 141/271 (52%), Positives = 176/271 (65%), Gaps = 46/271 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA GI LGTY A+MT +FF+ +  TDFFT+ F V
Sbjct  684  DGTIMTISKDRVKPSPLPDSWKLNEIFATGIVLGTYLAIMTVVFFWAIHKTDFFTEKFGV  743

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  S  E+ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AFL AQ VAT I V
Sbjct  744  RSIRDSEHEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGVLLVTAFLLAQLVATLIAV  803

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETSKAPN  517
            YANW FARI+GIGWGWAGV+W+YS++ YFPLD+ KF+ R AL+        +N+T+    
Sbjct  804  YANWGFARIKGIGWGWAGVVWLYSVVLYFPLDVFKFLIRFALSGRAWDNLLENKTAFTTK  863

Query  518  Q-------------------------------CNEKNS----SEMTDLECAPEEATRLRE  592
            +                                NEK+S    SE+ +      E  RLRE
Sbjct  864  KDYGREEREAQWAAAQRTLHGLQPPEVASNTLFNEKSSYRELSEIAEQAKRRAEIARLRE  923

Query  593  DDAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + + G +    SV K K LDI+TIQQ+ TV
Sbjct  924  LNTLKGHVE---SVVKLKGLDIDTIQQNYTV  951



>gb|KEH39623.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=949

 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 168/269 (62%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA GI LG Y A+MT +FF+    +DFFT+ F V
Sbjct  684  DGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGAYLAVMTVVFFWAAHASDFFTEKFGV  743

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
             S+  +  ELTAAVYLQ+S +SQALIFVTRS+SWSF E PGILL++AFL AQ +AT I V
Sbjct  744  HSIRENHEELTAAVYLQVSTVSQALIFVTRSRSWSFVERPGILLMVAFLIAQLIATLIAV  803

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAAL--------TDN-------  496
            YANW FA ++GIGWGWAGVIW+YSII Y PLD++KF+ R AL        T+N       
Sbjct  804  YANWEFASMKGIGWGWAGVIWLYSIIFYIPLDVLKFVIRYALSGKAWNNITENRTAFTSK  863

Query  497  -------------------------ETSKAPNQCNE-KNSSEMTDLECAPEEATRLREDD  598
                                     ET +  N+ N  +  SE+ D      E  RLRE  
Sbjct  864  KDYGKGEREAQWAAAQRTLHGLNPPETDQVLNESNNYRELSELADQAKKRAEIARLRELH  923

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  924  TLKGHVE---SVVKLKGLDIETIQQHYTV  949



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG Y ALMT +FF+++ DTDFF D F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGGYLALMTVIFFWVMKDTDFFPDKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KS+  SP E+ AA+YLQ+S++SQALIFVTRS+SWSF E PG+LL+ AF+ AQ VAT I V
Sbjct  749  KSIRDSPHEMMAALYLQVSVVSQALIFVTRSRSWSFVERPGLLLVTAFIIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGV+WIYS++ Y PLD IKF  R  L+        +N+T+    
Sbjct  809  YANWGFARIKGMGWGWAGVVWIYSVVFYVPLDFIKFFIRYILSGKAWLNLLENKTAFTTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_009390572.1| PREDICTED: ATPase 9, plasma membrane-type [Musa acuminata subsp. 
malaccensis]
Length=949

 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG Y A+MT +FF+L   TDFF + F V
Sbjct  684  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGAYLAIMTVVFFWLAHATDFFPEKFGV  743

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  +  ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG LL+ AF+AAQ VAT I V
Sbjct  744  RPIKDNQEELTAALYLQVSIISQALIFVTRSRSWSFVERPGFLLVAAFVAAQLVATVIAV  803

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YA+WSFARIQGIGWGWAG+IW++S+ITYFPLDI+KFI R AL+    DN           
Sbjct  804  YASWSFARIQGIGWGWAGIIWLFSLITYFPLDILKFIIRYALSGKAWDNLLQNKTAFTTK  863

Query  497  ----------------------ETSKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                  + +   +  N+K+S    SE+ +      E  RLRE  
Sbjct  864  KDYGRGEREAQWALAQRTLHGLQPADTSDLFNDKSSYRELSEIAEQAKRRAEVARLRELH  923

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  924  TLKGHVE---SVVKLKGLDIETIQQHYTV  949



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA G+ LG+Y A+MT +FF+L+  TDFF+D F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGSYLAIMTVVFFWLMRKTDFFSDAFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL   P E+ AA+YLQ+SIISQALIFVTRS+SWSF E PG+LL  AF+ AQ VAT I V
Sbjct  749  RSLRTRPDEMMAALYLQVSIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVATFIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANWSFARI+G GWGWAGVIW+YS++TYFPLDI+KF  R  L+        +N+T+    
Sbjct  809  YANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKTAFTTK  868

Query  506  ---------------------KAPNQCN----EKNS----SEMTDLECAPEEATRLREDD  598
                                   P + N    +KNS    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA G+ LG+Y A+MT +FF+L+  TDFF+D F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGSYLAIMTVVFFWLMRKTDFFSDAFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL   P E+ AA+YLQ+SIISQALIFVTRS+SWSF E PG+LL  AF+ AQ VAT I V
Sbjct  749  RSLRTRPDEMMAALYLQVSIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVATFIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANWSFARI+G GWGWAGVIW+YS++TYFPLDI+KF  R  L+        +N+T+    
Sbjct  809  YANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKTAFTTK  868

Query  506  ---------------------KAPNQCN----EKNS----SEMTDLECAPEEATRLREDD  598
                                   P + N    +KNS    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>gb|KGN52915.1| hypothetical protein Csa_4G006220 [Cucumis sativus]
Length=890

 Score =   172 bits (435),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 169/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y A+MT +FF++ + TDFF+D F V
Sbjct  625  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYLAVMTVVFFWIANATDFFSDKFGV  684

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
             S+ G+  ELTAAVYLQ+S +SQALIFVTRS+SWSF E PG+LL+ AF  AQ VAT I V
Sbjct  685  HSIRGNDGELTAAVYLQVSTVSQALIFVTRSRSWSFVERPGLLLVFAFFVAQLVATLIAV  744

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YANW FA ++GIGWGWAGVIWIYS+I Y PLD++KF TR AL+                 
Sbjct  745  YANWGFAEMKGIGWGWAGVIWIYSVIFYIPLDVLKFATRYALSGKAWNNMIQNRTAFTSK  804

Query  497  -------------------------ETSKAPN-QCNEKNSSEMTDLECAPEEATRLREDD  598
                                     ETS+  N + N +  SE+ +      E  RLRE  
Sbjct  805  KDYGIGEREAQWAAAQRTLHGLQPPETSELFNDKTNYRELSEIAEQAKKRAEVARLRELH  864

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  865  TLKGHVE---SVVKLKGLDIETIQQHYTV  890



>ref|XP_010520558.1| PREDICTED: ATPase 8, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   172 bits (436),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 169/265 (64%), Gaps = 40/265 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY AL T LFF+L   TDFF++ F V
Sbjct  687  DGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYMALTTVLFFWLAQSTDFFSNKFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G   EL AA+YLQ+SIISQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  747  RSIQGKEEELMAALYLQVSIISQALIFVTRSRSWSFVERPGLLLLGAFIIAQLVATVIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARI+G GWGWAGVIW YSI+TY PLDI+KFI R +L+        +N+T+    
Sbjct  807  YAHWEFARIEGCGWGWAGVIWAYSIVTYIPLDILKFIIRYSLSGKAWDNMIENKTAFTTK  866

Query  506  -------------------------KAPNQCNEKNSSEMTDLECAPEEATRLREDDAV*G  610
                                     +A    +    SE+ +      E  RLRE   + G
Sbjct  867  KDYGKGQREAQWALAQRTLHGLPPPEAMFHDHNHELSEIAEQAKRRAEVARLRELHTLKG  926

Query  611  GMWNH*SVAKAKALDINTIQQHSTV  685
             +    SV K K LDI+TIQQH TV
Sbjct  927  HVE---SVVKLKGLDIDTIQQHYTV  948



>gb|KHG28536.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   170 bits (430),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+ + DTDFF+D F V
Sbjct  391  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMHDTDFFSDKFGV  450

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL     E+  A+YLQ+SI+SQALIFVTRS+SWS+AE PG+LL+ AF+ AQ VAT I V
Sbjct  451  RSLREREHEMMGALYLQVSIVSQALIFVTRSRSWSYAERPGLLLVTAFIIAQLVATLIAV  510

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+GIGWGWAGVIW+YSI+ Y PLDI+KF  R  L+        +N+T+    
Sbjct  511  YANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIMKFAIRYILSGKAWLNLLENKTAFTTK  570

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+KNS    SE+ +      E  RLRE  
Sbjct  571  KDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  630

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  631  TLKGHVE---SVVKLKGLDIDTIQQHYTV  656



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   172 bits (436),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 175/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIF  GI LG Y ALMT LFF+ + DTDFFTD F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLKEIFCTGIVLGGYLALMTVLFFWAMHDTDFFTDKFSV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL GS  E+ AA+YLQ+SI+SQALIFVTRS+SWS+ E PG+LL+ AF+ AQ VAT I V
Sbjct  749  RSLRGSDKEMMAALYLQVSIVSQALIFVTRSRSWSYVERPGLLLVSAFVIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGVIW+YS++T+ PLD+IKF TR  L+        +N+T+    
Sbjct  809  YANWGFARIKGMGWGWAGVIWLYSVVTFVPLDLIKFATRYVLSGKAWDNLLENKTAFTTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  +E++S    SE+ +      E  RLRE +
Sbjct  869  KDYGKEEREAQWAAAQRTLHGLQPPETSNIFSERSSYRELSEIAEQAKRRAEVARLRELN  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =   172 bits (436),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 148/269 (55%), Positives = 171/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA+G+ LGTY A+MT +FF++V  TDFF+D F V
Sbjct  689  DGTIMTISKDRVKPSPMPDSWKLKEIFAMGVVLGTYLAVMTVVFFWVVHKTDFFSDVFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  S +ELT A+YLQ+SI+SQALIFVTRS+S SF E PG+LLL AF  AQ +AT I V
Sbjct  749  RSIKDSQTELTTALYLQVSIVSQALIFVTRSRSLSFTERPGLLLLFAFAVAQLIATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDNE-----------TSK  508
            YANW FARI GIGWGWAGVIW+YSIITY PLDI KFI R AL+              TSK
Sbjct  809  YANWGFARISGIGWGWAGVIWLYSIITYSPLDIFKFIVRYALSGKAWDTLLQNKTAFTSK  868

Query  509  APNQCNEK---------------------------NSSEMTDL-ECAPE--EATRLREDD  598
                  E+                           N  E+T+L E A    E  RLRE  
Sbjct  869  KDYGKGEREAQWALAQRTLHGLQPPESSQIFNDKTNYRELTELAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIETIQQHYTV  954



>ref|XP_010472461.1| PREDICTED: ATPase 5, plasma membrane-type [Camelina sativa]
Length=957

 Score =   172 bits (436),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 176/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIF+ G+ LG YQA MT +FF+++ DT+ F++   V
Sbjct  692  DGTIMTISKDRVKPSPQPDSWKLREIFSTGVVLGGYQAFMTVVFFWVMKDTNIFSNMLGV  751

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L   P ++ AA+YLQ+SIISQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  752  RPLSQRPEQMMAALYLQVSIISQALIFVTRSRSWSFVERPGLLLLGAFVIAQLVATFIAV  811

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNET-----  502
            YA+WSFARI+G GWGWAGVIW+YS+ITY PLD++KF  R  L+        +N+T     
Sbjct  812  YADWSFARIEGAGWGWAGVIWLYSLITYIPLDLLKFGIRYVLSGKAWLNLLENKTAFTTK  871

Query  503  ------------------------SKAPNQCNEKNS-SEMTDL-ECAPE--EATRLREDD  598
                                    ++  N  NEKNS SE++ + E A    E  RLRE +
Sbjct  872  KDYGKEEREAQWAAAQRTLHGLQPAETNNIFNEKNSYSELSQIAEQAKRRAEVVRLREIN  931

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
            ++ G +    SV K K LDI+TIQQH TV
Sbjct  932  SLKGHVE---SVVKLKGLDIDTIQQHYTV  957



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   172 bits (435),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 177/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF++  DTDFF+D F V
Sbjct  689  DGTIMTISKDRVKPSPVPDSWKLQEIFATGVVLGTYLAMMTVIFFYIAHDTDFFSDHFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  ELTAAVYLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AFLAAQ +AT I V
Sbjct  749  RSIRNNEDELTAAVYLQVSIVSQALIFVTRSRSWSFVERPGLLLVSAFLAAQLLATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETSKAPN  517
            YA W FARIQGIGWGWAGVIW+YSII YFPLD +KFI R AL+        +N+T+    
Sbjct  809  YAKWGFARIQGIGWGWAGVIWVYSIIFYFPLDPLKFIIRFALSGKAWDNLLENKTAFTTK  868

Query  518  Q-----------------------------CNEKNS----SEMTDLECAPEEATRLREDD  598
            +                              N+KNS    SE+ +      E  RLRE +
Sbjct  869  KDYGREEREAQWALAQRTLHGLQPPDLSGLLNDKNSYRELSEIAEQAKRRAEIARLRELN  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQ+ TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQNYTV  954



>ref|XP_006350073.1| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum tuberosum]
Length=924

 Score =   172 bits (435),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 142/165 (86%), Gaps = 0/165 (0%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA GI LGTYQALMT LFF+L + TDFFT+ F V
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLNEIFATGIILGTYQALMTVLFFYLAASTDFFTEKFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +   LTAAVYLQ+SIISQALIFVTRS+SWSF E PG LL++AF  AQFVAT ITV
Sbjct  747  RSIRENEHGLTAAVYLQVSIISQALIFVTRSRSWSFVERPGFLLVVAFFLAQFVATLITV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN  496
            YANW+FARI GIGWGWA +IW+Y+IITY PLD++KFI+R AL+ +
Sbjct  807  YANWNFARIHGIGWGWAAIIWVYTIITYLPLDVLKFISRYALSGD  851



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score =   172 bits (435),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIF  GI LG Y A+MT +FF++  DT FF + F V
Sbjct  691  DGTIMTISKDRVKPSPMPDSWKLREIFVTGIVLGGYLAMMTVIFFWVAKDTKFFPNKFGV  750

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +H +  ELTAA+YLQ+SI+SQALIFVTRS+SWS+ E PG+LL+ AFL AQ +AT I V
Sbjct  751  RDIHDNHDELTAALYLQVSIVSQALIFVTRSRSWSYVERPGMLLMGAFLTAQLIATLIAV  810

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI GIGWGWAGVIW+YSII Y PLD+IKF  R  L+        +N+T+    
Sbjct  811  YANWGFARIHGIGWGWAGVIWLYSIIFYLPLDVIKFFIRYLLSGKAWQNLLENKTAFTTK  870

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  +  NEK+S    SE+ +      E  RLRE  
Sbjct  871  KDYGKEEREAQWALAQRTLHGLQPPETSSVFNEKSSYRELSEIAEQAKRRAEVARLRELH  930

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  931  TLKGHVE---SVVKLKGLDIDTIQQHYTV  956



>dbj|BAD19091.1| putative H+-exporting ATPase [Oryza sativa Japonica Group]
 gb|EAY87868.1| hypothetical protein OsI_09289 [Oryza sativa Indica Group]
 gb|EAZ24947.1| hypothetical protein OsJ_08728 [Oryza sativa Japonica Group]
Length=950

 Score =   172 bits (435),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LGTY AL+TALFF+L  DTDFFT+ F V
Sbjct  685  DGTIMTISKDRVKPSPTPDSWKLKEIFATGIVLGTYMALITALFFYLAHDTDFFTETFGV  744

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  E+ AA+YLQ+SIISQALIFVTRS+SWSF E PG LL+IAFLAAQ VAT I V
Sbjct  745  RSIKTNEKEMMAALYLQVSIISQALIFVTRSRSWSFVERPGALLVIAFLAAQLVATCIAV  804

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTD----------------  493
            YA W F ++QGIGWGW G IW +S++TYFPLD++KFI R AL+                 
Sbjct  805  YAEWEFCKMQGIGWGWGGAIWAFSVVTYFPLDVLKFIIRYALSGRAWNNINNKTAFVNKN  864

Query  494  ---------------------NETSKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                 N++S + +  N+K      SE+ +      E  RLRE  
Sbjct  865  DYGKGEREAQWATAQRTLHGLNQSSTSSDLFNDKTGYRELSEIAEQAAKRAEVARLRELH  924

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQ  TV
Sbjct  925  TLKGHVE---SVVKLKGLDIDTIQQSYTV  950



>ref|NP_001048395.2| Os02g0797300 [Oryza sativa Japonica Group]
 dbj|BAF10309.2| Os02g0797300, partial [Oryza sativa Japonica Group]
Length=943

 Score =   171 bits (434),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LGTY AL+TALFF+L  DTDFFT+ F V
Sbjct  678  DGTIMTISKDRVKPSPTPDSWKLKEIFATGIVLGTYMALITALFFYLAHDTDFFTETFGV  737

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  E+ AA+YLQ+SIISQALIFVTRS+SWSF E PG LL+IAFLAAQ VAT I V
Sbjct  738  RSIKTNEKEMMAALYLQVSIISQALIFVTRSRSWSFVERPGALLVIAFLAAQLVATCIAV  797

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTD----------------  493
            YA W F ++QGIGWGW G IW +S++TYFPLD++KFI R AL+                 
Sbjct  798  YAEWEFCKMQGIGWGWGGAIWAFSVVTYFPLDVLKFIIRYALSGRAWNNINNKTAFVNKN  857

Query  494  ---------------------NETSKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                 N++S + +  N+K      SE+ +      E  RLRE  
Sbjct  858  DYGKGEREAQWATAQRTLHGLNQSSTSSDLFNDKTGYRELSEIAEQAAKRAEVARLRELH  917

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQ  TV
Sbjct  918  TLKGHVE---SVVKLKGLDIDTIQQSYTV  943



>ref|XP_010537896.1| PREDICTED: ATPase 9, plasma membrane-type [Tarenaya hassleriana]
Length=994

 Score =   172 bits (435),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 176/270 (65%), Gaps = 45/270 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+L   TDFF++ F V
Sbjct  728  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGTYLAVMTVVFFWLADSTDFFSEKFGV  787

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KS+     ELTAA+YLQ+SI+SQALIFVTRS+SWS+ E PG+LL+IAFL AQ +AT I V
Sbjct  788  KSISKKEHELTAAIYLQVSIVSQALIFVTRSRSWSYIERPGLLLVIAFLIAQLIATIIAV  847

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+GIGWGWAGVIW+YS++ Y PLDI+KFI R +L+        +N+T+    
Sbjct  848  YANWDFARIKGIGWGWAGVIWLYSLVFYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSK  907

Query  506  ----KAPNQC----------------------NEKNS----SEMTDLECAPEEATRLRED  595
                K   +                       NEK+S    SE+ D      E  RLRE 
Sbjct  908  KDYGKGEREAQWAQAQRTLHGLQTAQNSESIFNEKSSYRELSELADQAKRRAEVARLREL  967

Query  596  DAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
              + G +    SV K K LDI+TIQQH TV
Sbjct  968  HTLKGHVE---SVVKNKGLDIDTIQQHYTV  994



>gb|KHN22411.1| ATPase 9, plasma membrane-type [Glycine soja]
Length=916

 Score =   171 bits (434),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIF  GI LGTY A+MT +FF+    +DFF+D F V
Sbjct  651  DGTIMTISKDRVKPSPVPDSWKLREIFVTGIVLGTYLAVMTVIFFWAAHASDFFSDKFGV  710

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  + SELTAAVYLQ+SI+SQALIFVTRS+SWS+ E PG+ LL+AF  AQ +AT I V
Sbjct  711  RSIRENYSELTAAVYLQVSIVSQALIFVTRSRSWSYVERPGMFLLVAFFIAQLIATLIAV  770

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT-----------------  490
            YANW FA+++GIGWGWAGVIW+YSI+ Y P+DI+KFI R ALT                 
Sbjct  771  YANWGFAKMKGIGWGWAGVIWLYSIVFYIPMDILKFIIRYALTGKAWNTITENRVAFTTK  830

Query  491  ------DNETSKAPNQ--------------CNEKNS----SEMTDLECAPEEATRLREDD  598
                  + E   A  Q               NEKN+    SE+ +      E  RLRE  
Sbjct  831  KDYGKGEREAQWAAAQRTLHGLNPPETEEMLNEKNNYRELSELAEQAKKRAEVARLRELH  890

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI T+QQH TV
Sbjct  891  TLKGHVE---SVVKLKGLDIETMQQHYTV  916



>ref|XP_010047150.1| PREDICTED: ATPase 8, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW78971.1| hypothetical protein EUGRSUZ_C00401 [Eucalyptus grandis]
Length=950

 Score =   171 bits (434),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 171/266 (64%), Gaps = 41/266 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG Y A+MT +FF+LV DTDFFT  F V
Sbjct  688  DGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGAYMAIMTVVFFWLVHDTDFFTKSFGV  747

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  +  ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL IAF+AAQ VAT I+V
Sbjct  748  RPIKNNVDELTAALYLQVSIISQALIFVTRSRSWSFVERPGLLLGIAFIAAQLVATLISV  807

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARI G GWGWAGVIWIYSI+TYFPLDI+KFI R +L+         N+T+    
Sbjct  808  YASWDFARIHGTGWGWAGVIWIYSIVTYFPLDILKFIIRYSLSGKAWDTMLQNKTAFTTK  867

Query  506  ----------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDDAV*  607
                                    P      NS    SE+ +      E  RLRE   + 
Sbjct  868  KDYGKGEREAQWAIAQRTLHGLNPPETLFHDNSTEELSEIAEQAKRRAEVARLRELHTLK  927

Query  608  GGMWNH*SVAKAKALDINTIQQHSTV  685
            G +    SV K K LDI TIQQH TV
Sbjct  928  GHVE---SVVKLKGLDIETIQQHYTV  950



>ref|XP_010526269.1| PREDICTED: ATPase 5, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=931

 Score =   171 bits (434),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIF+ GI LG Y ALMT +FF+ + DTDFF++ F V
Sbjct  666  DGTIMTISKDRVKPSPQPDSWKLREIFSTGIVLGGYLALMTVVFFWAMKDTDFFSEKFGV  725

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L   P ++ AA+YLQ+SIISQALIFVTRS+SWS+ E PG+LLL AF+ AQ +AT I V
Sbjct  726  RPLKEHPEQMNAALYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFVVAQLIATFIAV  785

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNET-----  502
            YANWSFARIQG GWGWAGVIW+YS++TY PLD++KF  R  L+        +N+T     
Sbjct  786  YANWSFARIQGTGWGWAGVIWVYSVVTYIPLDLLKFAIRYVLSGRAWNNLLENKTAFTTK  845

Query  503  ------------------------SKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                    + A N  ++KNS    SE+ +      E  RLRE  
Sbjct  846  KDYGKEEREAQWATAQRTLHGLQPADAANVFSDKNSYRELSEIAEQAKRRAEVARLRELH  905

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  906  TLKGHVE---SVVKLKGLDIDTIQQHYTV  931



>ref|XP_003547446.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   171 bits (434),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIF  GI LGTY A+MT +FF+    +DFF+D F V
Sbjct  684  DGTIMTISKDRVKPSPVPDSWKLREIFVTGIVLGTYLAVMTVIFFWAAHASDFFSDKFGV  743

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  + SELTAAVYLQ+SI+SQALIFVTRS+SWS+ E PG+ LL+AF  AQ +AT I V
Sbjct  744  RSIRENYSELTAAVYLQVSIVSQALIFVTRSRSWSYVERPGMFLLVAFFIAQLIATLIAV  803

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT-----------------  490
            YANW FA+++GIGWGWAGVIW+YSI+ Y P+DI+KFI R ALT                 
Sbjct  804  YANWGFAKMKGIGWGWAGVIWLYSIVFYIPMDILKFIIRYALTGKAWNTITENRVAFTTK  863

Query  491  ------DNETSKAPNQ--------------CNEKNS----SEMTDLECAPEEATRLREDD  598
                  + E   A  Q               NEKN+    SE+ +      E  RLRE  
Sbjct  864  KDYGKGEREAQWAAAQRTLHGLNPPETEEMLNEKNNYRELSELAEQAKKRAEVARLRELH  923

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI T+QQH TV
Sbjct  924  TLKGHVE---SVVKLKGLDIETMQQHYTV  949



>ref|XP_010526268.1| PREDICTED: ATPase 5, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=956

 Score =   171 bits (434),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIF+ GI LG Y ALMT +FF+ + DTDFF++ F V
Sbjct  691  DGTIMTISKDRVKPSPQPDSWKLREIFSTGIVLGGYLALMTVVFFWAMKDTDFFSEKFGV  750

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L   P ++ AA+YLQ+SIISQALIFVTRS+SWS+ E PG+LLL AF+ AQ +AT I V
Sbjct  751  RPLKEHPEQMNAALYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFVVAQLIATFIAV  810

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNET-----  502
            YANWSFARIQG GWGWAGVIW+YS++TY PLD++KF  R  L+        +N+T     
Sbjct  811  YANWSFARIQGTGWGWAGVIWVYSVVTYIPLDLLKFAIRYVLSGRAWNNLLENKTAFTTK  870

Query  503  ------------------------SKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                    + A N  ++KNS    SE+ +      E  RLRE  
Sbjct  871  KDYGKEEREAQWATAQRTLHGLQPADAANVFSDKNSYRELSEIAEQAKRRAEVARLRELH  930

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  931  TLKGHVE---SVVKLKGLDIDTIQQHYTV  956



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   171 bits (434),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 175/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA GI LGTY AL+T LFF+L+ DTDFF+D F V
Sbjct  687  DGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGTYLALITVLFFWLIHDTDFFSDKFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  E+TAA+YLQ+SI+SQALIFVTRSQSWSF E PG+LL+ AF+AAQ VAT I V
Sbjct  747  RSIRHNRDEVTAALYLQVSIVSQALIFVTRSQSWSFVERPGLLLVGAFIAAQLVATCIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            Y +W FARI+GIGWGWAG IW++SIITYFPLDI+KFI R  L+         N+T+    
Sbjct  807  YPSWGFARIEGIGWGWAGAIWLFSIITYFPLDILKFIIRYGLSGKAWDNLLQNKTAFTTK  866

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+ +S    SE+ +      E  RLRE  
Sbjct  867  KDYGRGEREAQWALAQRTLHGLQPPETSNLFNDNSSYRELSEIAEQAKRRAEVARLRELH  926

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  927  TLKGHVE---SVVKLKGLDIETIQQHYTV  952



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =   171 bits (434),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 169/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y A+MT +FF++ + TDFF+D F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYLAVMTVVFFWIANATDFFSDKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
             S+ G+  ELTAAVYLQ+S +SQALIFVTRS+SWSF E PG+LL+ AF  AQ VAT I V
Sbjct  746  HSIRGNDGELTAAVYLQVSTVSQALIFVTRSRSWSFVERPGLLLVFAFFVAQLVATLIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YANW FA ++GIGWGWAGVIWIYS+I Y PLD++KF TR AL+                 
Sbjct  806  YANWGFAEMKGIGWGWAGVIWIYSVIFYIPLDVLKFATRYALSGKAWNNMIQNRTAFTSK  865

Query  497  -------------------------ETSKAPN-QCNEKNSSEMTDLECAPEEATRLREDD  598
                                     ETS+  N + N +  SE+ +      E  RLRE  
Sbjct  866  KDYGIGEREAQWAAAQRTLHGLQPPETSELFNDKTNYRELSEIAEQAKKRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIETIQQHYTV  951



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =   171 bits (434),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 169/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y A+MT +FF++ + TDFF+D F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYLAVMTVVFFWIANATDFFSDKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
             S+ G+  ELTAAVYLQ+S +SQALIFVTRS+SWSF E PG+LL+ AF  AQ VAT I V
Sbjct  746  HSIRGNDGELTAAVYLQVSTVSQALIFVTRSRSWSFVERPGLLLVFAFFVAQLVATLIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YANW FA ++GIGWGWAGVIWIYS+I Y PLD++KF TR AL+                 
Sbjct  806  YANWGFAEMKGIGWGWAGVIWIYSVIFYIPLDVLKFATRYALSGKAWNNMIQNRTAFTSK  865

Query  497  -------------------------ETSKAPN-QCNEKNSSEMTDLECAPEEATRLREDD  598
                                     ETS+  N + N +  SE+ +      E  RLRE  
Sbjct  866  KDYGIGEREAQWAAAQRTLHGLQPPETSELFNDKTNYRELSEIAEQAKKRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIETIQQHYTV  951



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   171 bits (434),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G  LG Y A+MT +FF++  D D     F +
Sbjct  685  DGTIMTISKDRVKPSPVPDSWKLKEIFATGAVLGAYMAVMTVVFFWIAHDYDIVPQTFGL  744

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KS+  +  ELTAA+YLQ+SIISQALIFVTRS+SWSF E PG+LL+IAF+AAQ VAT I V
Sbjct  745  KSIRDNSDELTAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVIAFIAAQLVATVIAV  804

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARIQGIGWGWA  IW+YS+ITY PLDI+KFITR AL+         N+T+    
Sbjct  805  YASWGFARIQGIGWGWAAFIWVYSVITYIPLDILKFITRYALSGKAWDNVIQNKTAFTSK  864

Query  506  ----------------------KAPNQC---NEKNS----SEMTDLECAPEEATRLREDD  598
                                  ++P+     N+K+S    SE+ +      E  RLRE  
Sbjct  865  KDYGKGEREAQWAMAQRTLHGLQSPDTSGFFNDKSSYKELSEIAEQAKRRAEVARLRELH  924

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  925  TLKGHVD---SVVKLKGLDIETIQQHYTV  950



>ref|XP_009419963.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   171 bits (434),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG Y A+MT +FF+LV DTD F + F V
Sbjct  691  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGAYLAIMTVVFFYLVHDTDVFPEIFGV  750

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  S  ELTAA+YLQ+SIISQALIFVTRS+ WSF E PG+LL++AF+AAQ VAT I  
Sbjct  751  REIKDSNDELTAALYLQVSIISQALIFVTRSRGWSFVERPGVLLVVAFIAAQLVATAIAA  810

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            +A+W FARIQGIGWGWAG+IW++S+ITYFPLDI+KFITR AL+    DN           
Sbjct  811  HASWGFARIQGIGWGWAGIIWLFSLITYFPLDILKFITRYALSGKAWDNLLQNKTAFTSK  870

Query  497  ----------------------ETSKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                  +T+      N+K+S    SE+ +      E  RLRE  
Sbjct  871  KDYGRGEREAQWALAQRTLHGLQTADTSVLFNDKSSYRELSEVAEQAKRRAEVARLRELH  930

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  931  TLKGHVE---SVVKLKGLDIETIQQHYTV  956



>ref|XP_004287218.1| PREDICTED: ATPase 8, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=948

 Score =   171 bits (433),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 138/266 (52%), Positives = 167/266 (63%), Gaps = 41/266 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LGTY A+MT +FF++   T FF+  F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYMAVMTVVFFWIAHSTQFFSRVFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +    ++LT+AVYLQ+SI+SQALIFVTRS+S+SF E PG +L+ AFLAAQ VAT I V
Sbjct  746  RHIGDDAAQLTSAVYLQVSILSQALIFVTRSRSFSFLERPGTMLMGAFLAAQLVATLIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAAL----------------TD  493
            Y +W FARI G+GWGWAGVIWIYSI+TYFPLDI KFI R AL                T+
Sbjct  806  YCSWGFARIDGVGWGWAGVIWIYSIVTYFPLDIFKFIIRYALSGHAWDSVVQHKTAFSTN  865

Query  494  NETSKAPNQCN-EKNSSEMTDLECAPE---------------------EATRLREDDAV*  607
            N+  KA  +         ++ L+  PE                     E  RLRE   + 
Sbjct  866  NDYGKAEREAQWAATQRTLSGLQSPPELFHGNHHGDEQSIAEQAKRRAEVARLRELHTLK  925

Query  608  GGMWNH*SVAKAKALDINTIQQHSTV  685
            G +    SV K K LDI TIQQ+ TV
Sbjct  926  GHVQ---SVVKLKGLDIETIQQNYTV  948



>dbj|BAA08134.1| putative plasma membrane H+-ATPase [Zostera marina]
Length=952

 Score =   171 bits (433),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 134/270 (50%), Positives = 172/270 (64%), Gaps = 45/270 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG+Y A+MT +FF+++ DT FF+D F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGSYMAVMTVVFFWIMKDTSFFSDKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  S  E+  A+YLQ+SIISQALIFVTRS+SWSF E PG+LL+ AF  AQ  AT I V
Sbjct  746  RSISNSEDEMMGALYLQVSIISQALIFVTRSRSWSFMERPGLLLVTAFFIAQMCATFIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAAL--------TDNE---TSK  508
            YA+W FAR++G+GWGW G+IW+YS++T+FPLDI+KFITR  L        T+N+   TSK
Sbjct  806  YADWGFARVKGVGWGWGGIIWLYSMVTFFPLDILKFITRYVLSGRGWENITENKTAFTSK  865

Query  509  A-------------------------------PNQCNEKNSSEMTDLECAPEEATRLRED  595
                                            P++   +  SE+ +      E  RLRE 
Sbjct  866  KDYGREEREAQWATAQRTLHGLQTAESTTNIFPDKGGYRELSEIAEQAKRRAEVARLREL  925

Query  596  DAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + + G +    SV K K LDI TIQQ+ TV
Sbjct  926  NTLKGHVE---SVVKLKGLDIETIQQNYTV  952



>ref|XP_002527322.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF35074.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=733

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 135/268 (50%), Positives = 171/268 (64%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MT +FF+  + +DFF+D F V
Sbjct  469  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYLAIMTVVFFWAANSSDFFSDHFGV  528

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  + +ELTAA+YLQ+SI+SQALIFVTRS+SWS+ E PG+LL+ AF+ AQ +AT + V
Sbjct  529  RSIRENHNELTAAIYLQVSIVSQALIFVTRSRSWSYVERPGLLLVAAFIIAQLIATLLAV  588

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YANW+FA+I GIGWGWAGVIW+YSI+ Y PLD++KF  R AL+    DN           
Sbjct  589  YANWAFAKIHGIGWGWAGVIWLYSIVFYIPLDVLKFAIRYALSGKAWDNLVQNKTAFTTK  648

Query  497  -------------------------ETSKAPNQCNEKNSSEMTDLECAPEEATRLREDDA  601
                                     ET++     N +  SE+ +      E  RLRE   
Sbjct  649  KDYGRGEREAQWAAAQRTLHGLQPPETAEIFQDKNYRELSEIAEQAKRRAEVARLRELHT  708

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  709  LKGHVE---SVVKLKGLDIETIQQHYTV  733



>gb|AAB35314.2| plasma membrane H(+)-ATPase precursor [Vicia faba]
Length=956

 Score =   171 bits (433),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 168/268 (63%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG YQALMT +FF++V  T FF D F V
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVMLGGYQALMTVIFFWIVQGTKFFPDRFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +H +P ELTAA+YLQ+SI+SQALIFVTRS+S      PG+LLL AFL AQ +AT I V
Sbjct  747  RHIHDNPDELTAALYLQVSIVSQALIFVTRSRSGLMLNAPGLLLLGAFLIAQLIATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDNETSKAPNQC------  523
            YANW+FARIQGIGWGWAGVIW+YSII Y PLDIIKF TR  L+    S   N+       
Sbjct  807  YANWAFARIQGIGWGWAGVIWLYSIIFYIPLDIIKFATRYFLSGKAWSNLENKTAFTTKK  866

Query  524  ------------------------------NEKNS----SEMTDLECAPEEATRLREDDA  601
                                          +EKNS    SE+ +      E  RLRE   
Sbjct  867  DYGKGEREAQWAHAQRTLHGLEPPESSGIFHEKNSYRELSEIAEQAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI+TIQQH TV
Sbjct  927  LKGHVE---SVVKLKGLDIDTIQQHYTV  951



>gb|KFK32649.1| hypothetical protein AALP_AA6G270500 [Arabis alpina]
Length=838

 Score =   170 bits (431),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRV+PSP PDSWKL EIF+ GI LG YQALMT +FF+ + DT+ F++ F V
Sbjct  573  DGTIMTISKDRVQPSPQPDSWKLREIFSAGIVLGGYQALMTVVFFWAMKDTNIFSNKFGV  632

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L   P ++ AA+YLQ+SIISQALIFVTRS+SWS+ E PG+LLL AF  AQ VAT I V
Sbjct  633  RPLSQRPEQMMAALYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFFIAQLVATFIAV  692

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNET-----  502
            YANWSFARI+G GWGWAGVIW+YS+ITY PLD++KF  R  L+        +N+T     
Sbjct  693  YANWSFARIEGAGWGWAGVIWLYSLITYIPLDLLKFAIRYILSGKAWLNLLENKTAFTMK  752

Query  503  ------------------------SKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                    ++  N  NEKNS    SE+ +      E  RLRE +
Sbjct  753  KDYGKEEREAQWAAAQRTLHGLQPAERNNIFNEKNSFSELSEIAEQAKRRAEVVRLRELN  812

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             +        SV K K LDI+TIQQH TV
Sbjct  813  TL---KRQVESVVKLKGLDIDTIQQHYTV  838



>gb|AAY42950.1| plasma membrane H+ ATPase [Lupinus albus]
Length=953

 Score =   171 bits (433),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 135/268 (50%), Positives = 169/268 (63%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+ + DT+F +  F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYMALMTVIFFWAMKDTNFLSRKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
                 +P E+TAA+YLQ+S +SQALIFVTRS+SWSF E PG+LL+ AF+ AQ +AT I V
Sbjct  749  DPYMTAPDEMTAALYLQVSTVSQALIFVTRSRSWSFVERPGMLLMGAFVIAQLIATIIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT-------DNETS-----  505
            YANW FA+IQG+GWGWAGVIW+YS++ YFPLD++KF  R  L+       +N+T+     
Sbjct  809  YANWGFAKIQGVGWGWAGVIWLYSVVFYFPLDLLKFAIRYVLSGKAWVNIENKTAFTTKK  868

Query  506  ------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDDA  601
                                    +  N  NE N+    SE+ +      E  RLRE   
Sbjct  869  DCGKEEREAQWAHAQRTLHGLQPPETSNIFNESNNYRELSEIAEQAKRRAEVARLRELHT  928

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI+TIQQH TV
Sbjct  929  LKGHVE---SVVKLKGLDIDTIQQHYTV  953



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   171 bits (433),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LGTY ALMT +FF+ V +TDFF+D F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLREIFATGIVLGTYLALMTVIFFWAVKETDFFSDKFHV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  S  E+ AA+YLQ+SI+SQALIFVTRS+SW F E PG+LL+IAF+ AQ VAT I V
Sbjct  749  RSLRNSEDEMMAALYLQVSIVSQALIFVTRSRSWCFVERPGLLLVIAFVVAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNETSKA------  511
            YA+W FARI+GIGWGWAGVIW+YSI+ +FPLD+ KF  R  L+    DN   K       
Sbjct  809  YADWGFARIKGIGWGWAGVIWLYSIVFFFPLDLFKFAIRYILSGKAWDNLLEKKTAFTSK  868

Query  512  ---------------------------PNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                        N  N+KNS    SE+ +      E  RLRE  
Sbjct  869  KDYGREEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_008776221.1| PREDICTED: ATPase 8, plasma membrane-type-like [Phoenix dactylifera]
Length=887

 Score =   171 bits (432),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 174/271 (64%), Gaps = 46/271 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LGTY ALMT LFF++  +TD F++ FKV
Sbjct  620  DGTIMTISKDRVKPSPVPDSWKLREIFATGIILGTYMALMTVLFFWIAQETDLFSNAFKV  679

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  +LTAA+YLQ+SIISQALIFVTR++SW F E PG+LL+ AF  AQ VAT + V
Sbjct  680  RSIRDNIGQLTAALYLQVSIISQALIFVTRARSWCFVERPGLLLVGAFAVAQLVATVVAV  739

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YANW+FA+I+GIGWGWAGVIW+YSIIT+ PLDI+KFI R +L+    DN           
Sbjct  740  YANWAFAQIRGIGWGWAGVIWLYSIITFVPLDILKFIIRYSLSGQAWDNLFQNKTAFTNK  799

Query  497  -ETSKAPNQC----------------------NEKNS-----SEMTDLECAPEEATRLRE  592
             +  K   +                       NEKN+     SE+ +      E  RLRE
Sbjct  800  PDYGKGEREAQWALAQRTLHGLHPPENSGSLFNEKNNNYRELSEIAEQAKRRAEVARLRE  859

Query  593  DDAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
               + G +    SV K K LDI TIQQH TV
Sbjct  860  LHTLKGHVE---SVVKLKGLDIETIQQHYTV  887



>ref|XP_004488894.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cicer arietinum]
Length=947

 Score =   171 bits (433),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 142/264 (54%), Positives = 173/264 (66%), Gaps = 39/264 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY A+MTA+FF++V DTDFF+  F V
Sbjct  687  DGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYMAIMTAVFFYIVHDTDFFSQTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
              +  S  +L +A+YLQ+SIISQALIFVTRS+SWSF E PG++LL AF+AAQ VAT I V
Sbjct  747  LPISDSEEQLNSALYLQVSIISQALIFVTRSRSWSFLERPGMMLLGAFVAAQLVATAIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNE-------TSK  508
            YA+W FARI GIGW WAGVIWI+S++TY PLDI+KF  R  LT    DN        T+K
Sbjct  807  YAHWDFARINGIGWKWAGVIWIFSVVTYIPLDILKFFIRMGLTGSAWDNMLQNKTAFTTK  866

Query  509  A----------------------PNQCNEKNSSEMTDL-ECAPE--EATRLREDDAV*GG  613
                                   P++ ++    E +++ E A    EA RLRE   + G 
Sbjct  867  KDYGRGEREAQWAVAQRTLHGLQPHEAHKNTHHEHSEIAEQAKRRAEAARLRELHTLKGH  926

Query  614  MWNH*SVAKAKALDINTIQQHSTV  685
            +    SV K K LDI TIQQH TV
Sbjct  927  VE---SVVKLKGLDIETIQQHYTV  947



>ref|XP_009136182.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 6, plasma membrane-type 
[Brassica rapa]
Length=980

 Score =   171 bits (433),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 165/267 (62%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY AL+T LFF+L  DTDFF   F V
Sbjct  717  DGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYMALITVLFFWLAHDTDFFPQKFGV  776

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL G P EL A +YLQ+SIISQALIFVTRS+SWSF E PG LLLIAFL AQ  AT I  
Sbjct  777  RSLKGQPEELIAVLYLQVSIISQALIFVTRSRSWSFVERPGFLLLIAFLIAQLAATLIAA  836

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARI+G GWGW GVIWIYSIITY PLD++KFITR  LT        +N T+    
Sbjct  837  YAHWEFARIKGCGWGWCGVIWIYSIITYIPLDVLKFITRYILTGKAWNNMIENRTAFTTK  896

Query  506  ----------------------KAPNQCNEKNS-----SEMTDLECAPEEATRLREDDAV  604
                                  K P    E  +     SE+ +      E  RLRE   +
Sbjct  897  KDYGRGEREAQWALAQRTLHGLKPPESMFEDKATFTELSEIAEQAKKRAEVARLREVHTL  956

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI+ + QH TV
Sbjct  957  KGHVE---SVVKLKGLDIDNLNQHYTV  980



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =   171 bits (432),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 178/269 (66%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+L+ DTDFF++ F+V
Sbjct  690  DGTIMTISKDRVKPSPVPDSWKLKEIFATGIVLGGYMALMTVVFFWLMQDTDFFSEKFQV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  +PSE+ AA+YLQ+SIISQALIFVTRS+S+SF E PG+LLL AF+ AQ VAT I V
Sbjct  750  RSLRNNPSEMMAALYLQVSIISQALIFVTRSRSFSFLERPGLLLLGAFIVAQLVATLIAV  809

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI G GWGWAGV+W++S++TYFPLD++KF  R  L+        +N+T+    
Sbjct  810  YANWEFARIHGCGWGWAGVVWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKTAFTTK  869

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     ++ N  ++K+S    SE+ +      E  RLRE +
Sbjct  870  KDYGKEEREAQWATAQRTLHGLQPPESSNIFSDKSSYRELSEIAEQAKRRAEVARLRELN  929

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+ IQQH TV
Sbjct  930  TLKGHVE---SVVKLKGLDIDNIQQHYTV  955



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =   171 bits (432),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 168/269 (62%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG+Y A+MT +FF++ + TDFFTD F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGSYLAVMTVVFFWIANATDFFTDKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
             S+ GS  ELTAAVYLQ+S +SQALIFVTRS+SWSF E PG+LL+ AF  AQ VAT I V
Sbjct  746  HSIRGSGGELTAAVYLQVSTVSQALIFVTRSRSWSFIERPGLLLVFAFFVAQLVATLIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN---------------  496
            YANW FA ++GIGWGWAGVIWIYS++ Y PLD++KF TR AL+                 
Sbjct  806  YANWGFADMKGIGWGWAGVIWIYSVVFYIPLDVLKFATRYALSGKAWNNMIQNRTAFTSK  865

Query  497  -------------------------ETSKAPN-QCNEKNSSEMTDLECAPEEATRLREDD  598
                                     ETS   N + N +  SE+ +      E  RLRE  
Sbjct  866  KDYGIGEREAQWAAAQRTLHGLQPPETSDLFNDKTNYRELSEIAEQAKKRAEVARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIETIQQHYTV  951



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score =   171 bits (432),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 176/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+L+ +TDFF+D F V
Sbjct  690  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDQFGV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  +P EL AA+YLQ+SI+SQALIFVTRS+S+SF E PG+LLL AFL AQ +AT I V
Sbjct  750  RSLRETPEELMAALYLQVSIVSQALIFVTRSRSFSFMERPGMLLLGAFLIAQLIATLIAV  809

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANWSFARI G GWGWAGVIWIYSI+ YFPLD++KF  R  L+        +N+T+    
Sbjct  810  YANWSFARIHGCGWGWAGVIWIYSIVFYFPLDLMKFAIRYILSGKAWLNLLENKTAFTTK  869

Query  506  ----------------------KAPNQC---NEKNS----SEMTDLECAPEEATRLREDD  598
                                  +AP      N+K+S    SE+ +      E  RLRE  
Sbjct  870  KDYGKEEREAQWAHAQRTLHGLEAPESSSIFNDKSSYRELSEIAEQAKRRAEVARLRELH  929

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  930  TLKGHVE---SVVKLKGLDIDTIQQHYTV  955



>emb|CDY50939.1| BnaC03g74390D [Brassica napus]
Length=949

 Score =   171 bits (432),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 165/267 (62%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY AL+T LFF+L  DTDFF   F V
Sbjct  686  DGTIMTISKDRVKPSPIPDSWKLREIFATGVVLGTYMALITVLFFWLAHDTDFFPQKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL G P EL A +YLQ+SIISQALIFVTRS+SWSF E PG LLLIAFL AQ  AT I  
Sbjct  746  RSLKGQPEELIAVLYLQVSIISQALIFVTRSRSWSFVERPGFLLLIAFLIAQLAATLIAA  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARI+G GWGW GVIWIYSIITY PLD++KFITR  LT        +N T+    
Sbjct  806  YAHWEFARIKGCGWGWCGVIWIYSIITYIPLDVLKFITRYILTGKAWNNMIENRTAFTTK  865

Query  506  ----------------------KAPNQCNEKNS-----SEMTDLECAPEEATRLREDDAV  604
                                  K P    E  +     SE+ +      E  RLRE   +
Sbjct  866  KDYGRGEREAQWALAQRTLHGLKPPESMFEDKATFTELSEIAEQAKKRAEVARLREVHTL  925

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI+ + QH TV
Sbjct  926  KGHVE---SVVKLKGLDIDNLNQHYTV  949



>emb|CAN61424.1| hypothetical protein VITISV_027272 [Vitis vinifera]
Length=967

 Score =   171 bits (432),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA GI LGTY AL+T LFF+L+ DTDFF+D F V
Sbjct  702  DGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGTYLALITVLFFWLIHDTDFFSDKFGV  761

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  E TAA+YLQ+SI+SQALIFVTRSQSWSF E PG+LL+ AF+AAQ VAT I V
Sbjct  762  RSIRHNRDEXTAALYLQVSIVSQALIFVTRSQSWSFVERPGLLLVGAFIAAQLVATCIAV  821

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            Y +W FARI+GIGWGWAG IW++SIITYFPLDI+KFI R  L+         N+T+    
Sbjct  822  YPSWGFARIEGIGWGWAGAIWLFSIITYFPLDILKFIIRYGLSGKAWDNLLQNKTAFTTK  881

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N  N+ +S    SE+ +      E  RLRE  
Sbjct  882  KDYGRGEREAQWALAQRTLHGLQPPETSNLFNDNSSYRELSEIAEQAKRRAEVARLRELH  941

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  942  TLKGHVE---SVVKLKGLDIETIQQHYTV  967



>emb|CDX93092.1| BnaA03g38140D [Brassica napus]
Length=949

 Score =   171 bits (432),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 165/267 (62%), Gaps = 42/267 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY AL+T LFF+L  DTDFF   F V
Sbjct  686  DGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYMALITVLFFWLAHDTDFFPQKFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL G P EL A +YLQ+SIISQALIFVTRS+SWSF E PG LLLIAFL AQ  AT I  
Sbjct  746  RSLKGQPEELIAVLYLQVSIISQALIFVTRSRSWSFVERPGFLLLIAFLIAQLAATLIAA  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARI+G GWGW GVIWIYSIITY PLD++KFITR  LT        +N T+    
Sbjct  806  YAHWEFARIKGCGWGWCGVIWIYSIITYIPLDVLKFITRYILTGKAWNNMIENRTAFTTK  865

Query  506  ----------------------KAPNQCNEKNS-----SEMTDLECAPEEATRLREDDAV  604
                                  K P    E  +     SE+ +      E  RLRE   +
Sbjct  866  KDYGRGEREAQWALAQRTLHGLKPPESMFEDKATFTELSEIAEQAKKRAEVARLREVHTL  925

Query  605  *GGMWNH*SVAKAKALDINTIQQHSTV  685
             G +    SV K K LDI+ + QH TV
Sbjct  926  KGHVE---SVVKLKGLDIDNLNQHYTV  949



>ref|XP_007014223.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
 gb|EOY31842.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
Length=886

 Score =   170 bits (430),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+L+ DT FF D F V
Sbjct  621  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGYLALMTVIFFWLMHDTKFFPDKFGV  680

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL GS  E+ AA+YLQ+SI+SQALIFVTRS+SWS+ E PG+LL+ AF  AQ VAT I V
Sbjct  681  RSLRGSDHEMMAALYLQVSIVSQALIFVTRSRSWSYVERPGLLLVTAFFIAQLVATLIAV  740

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FA+I+GIGWGWAGVIW+YSI+ Y PLD++KF  R  L+        +N+T+    
Sbjct  741  YANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDLMKFAIRYILSGKAWLNLLENKTAFTTK  800

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  N+K+S    SE+ +      E  RLRE  
Sbjct  801  KDYGKEEREAQWALAQRTLHGLQPPEATNLFNDKSSYRELSEIAEQAKRRAEVARLRELH  860

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  861  TLKGHVE---SVVKLKGLDIDTIQQHYTV  886



>gb|EYU37313.1| hypothetical protein MIMGU_mgv1a000870mg [Erythranthe guttata]
Length=954

 Score =   170 bits (431),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ LG Y ALMT +FF+++ +TDFF D F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGGYLALMTVIFFWMMHETDFFPDKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  E+ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL+AF  AQ +AT I V
Sbjct  749  RSIRDNEDEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLVAFCIAQLIATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQG GWGWAGVIW+YSI+ Y PLD++KF  R  L+        DN+ +    
Sbjct  809  YANWGFARIQGCGWGWAGVIWLYSIVFYVPLDLMKFAIRYILSGKAWQNLYDNKIAFSTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  NEK+S    SE+ +      E  RLRE  
Sbjct  869  QDYGKGEREAQWAHAQRTLHGLQNPEAGNLFNEKSSYRELSEIAEQAKRRAEIARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   170 bits (431),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+ V DTDFF++ F V
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAVHDTDFFSNKFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL     E+  A+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF+ AQ VAT I V
Sbjct  747  RSLRHHDEEMMGALYLQVSIVSQALIFVTRSRSWSFIERPGLLLLSAFMLAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+GIGWGWAGVIWIYSI+ YFPLDI+KF  R  L+        DN+T+    
Sbjct  807  YANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFAIRYILSGKAWLNLLDNKTAFTTK  866

Query  506  ----KAPNQC---------------------NEKNS----SEMTDLECAPEEATRLREDD  598
                K   +                      NEK+S    SE+ +      E  RLRE  
Sbjct  867  KDYGKEEREAQWAHAQRTLHGLQPPETAGIFNEKSSYRELSEIAEQAKRRAEVARLRELH  926

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  927  TLKGHVE---SVVKLKGLDIDTIQQHYTV  952



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score =   170 bits (431),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 174/270 (64%), Gaps = 45/270 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIF+ GI LG Y ALMT LFF+++ DTDFF+D F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLKEIFSTGIVLGGYMALMTVLFFWIMKDTDFFSDKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  +  E+ AA+YLQ+SI+SQALIFVTRS+SWSF E PG LLL AF+AAQ VAT I V
Sbjct  749  RSLRNNDEEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGFLLLGAFVAAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G GWGWAGVIW++S++TY PLDI+KF  R  L+        +N+T+    
Sbjct  809  YANWGFARIEGCGWGWAGVIWLFSVVTYVPLDILKFAIRYILSGKAWDNLLENKTAFTTK  868

Query  506  --------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLRED  595
                                       + N  +EKNS    SE+ +      E  RLRE 
Sbjct  869  KDYGKEEREAQWATAQRTLHGLQPPETSHNMFSEKNSYRELSEIAEQAKRRAEMARLREL  928

Query  596  DAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + + G +    SV K K LDI+TIQQH TV
Sbjct  929  NTLKGHVE---SVVKLKGLDIDTIQQHYTV  955



>emb|CAG28306.1| proton-exporting ATPase [Cucumis sativus]
Length=310

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+L+  T+FF+D F V
Sbjct  45   DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLMDGTNFFSDKFGV  104

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  E+ AA+YLQ+SI+SQALIFVTRS+  S+AE PG+LL+ AF  AQ VAT I V
Sbjct  105  RSIRHNEDEMMAALYLQVSIVSQALIFVTRSRGRSYAERPGLLLVGAFFIAQLVATLIAV  164

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FA+I+GIGWGWAGVIW+YSI+ Y PLD++KF  R  L+        +N+T+    
Sbjct  165  YANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDVMKFAIRYILSGKAWLNLLENKTAFTTK  224

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     ++ N  +EK+S    SE+ +      E  RLRE +
Sbjct  225  KDYGKEEREAQWALAQRTLHGLQPPESTNIFSEKSSYRELSEIAEQAKRRAEIARLRELN  284

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  285  TLKGHV---ESVVKLKGLDIDTIQQHYTV  310



>ref|NP_180028.1| H(+)-ATPase 5 [Arabidopsis thaliana]
 gb|AAD23893.1| putative plasma membrane proton ATPase [Arabidopsis thaliana]
 gb|AEC07588.1| H(+)-ATPase 5 [Arabidopsis thaliana]
Length=931

 Score =   170 bits (430),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 179/269 (67%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDR+KPSP PDSWKL +IF+ G+ LG YQALMT +FF+++ D+DFF+++F V
Sbjct  666  DGTIMTISKDRMKPSPQPDSWKLRDIFSTGVVLGGYQALMTVVFFWVMKDSDFFSNYFGV  725

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L   P ++ AA+YLQ+SIISQALIFVTRS+SWS+AE PG+LLL AF+ AQ VAT I V
Sbjct  726  RPLSQRPEQMMAALYLQVSIISQALIFVTRSRSWSYAECPGLLLLGAFVIAQLVATFIAV  785

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNET-----  502
            YANWSFARI+G GWGWAGVIW+YS +TY PLD++KF  R  L+        +N+T     
Sbjct  786  YANWSFARIEGAGWGWAGVIWLYSFLTYIPLDLLKFGIRYVLSGKAWLNLLENKTAFTTK  845

Query  503  ------------------------SKAPNQCNEKNS-SEMTDL-ECAPE--EATRLREDD  598
                                    ++  N  NEKNS SE++ + E A    E  RLRE +
Sbjct  846  KDYGKEEREAQWAAAQRTLHGLQPAEKNNIFNEKNSYSELSQIAEQAKRRAEVVRLREIN  905

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  906  TLKGHVE---SVVKLKGLDIDTIQQHYTV  931



>ref|XP_011069930.1| PREDICTED: plasma membrane ATPase 4 [Sesamum indicum]
Length=951

 Score =   170 bits (430),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 171/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+L+  TDFF D F V
Sbjct  686  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLMHKTDFFADNFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +++  +  E+ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+ AQ VAT I V
Sbjct  746  RNIRDNEDEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFIIAQLVATLIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G GWGWAGVIW+YSI+ Y PLD++KF  R  L+        DN+T+    
Sbjct  806  YANWGFARIKGCGWGWAGVIWLYSIVFYVPLDLMKFAIRYILSGKAWQNLYDNKTAFTTK  865

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  NEK+S    SE+ +      E  RLRE  
Sbjct  866  KDYGKGEREAQWALAQRTLHGLQTPEATNIFNEKSSYRELSEIAEQAKRRAEIARLRELH  925

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  926  TLKGHVE---SVVKLKGLDIETIQQHYTV  951



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =   170 bits (430),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 138/269 (51%), Positives = 170/269 (63%), Gaps = 46/269 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG YQA+MT +FF+LV DT FF D F V
Sbjct  690  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYQAIMTVVFFWLVRDTTFFVDKFHV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            K L  +  ++ AA+YLQ+S ISQALIFVTRS+SWSFAE PG++LL AF+ AQ +AT I V
Sbjct  750  KPL--TDGQMMAALYLQVSAISQALIFVTRSRSWSFAERPGLMLLGAFVVAQLIATLIAV  807

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETSKA--  511
            YANWSFA+I+G+GWGWA  +WIY+++TY PLDI+KF  R AL+        DN+T+    
Sbjct  808  YANWSFAKIEGMGWGWALAVWIYTLVTYIPLDILKFTIRYALSGRAWNNLLDNKTAFTTK  867

Query  512  -------------------------------PNQCNEKNSSEMTDLECAPEEATRLREDD  598
                                           P + N +  SE+ +      E  RLRE  
Sbjct  868  KDYGKEEREAQWAAAQRTMHGLQPPETTNLFPEKSNYRELSEIAEQAKRRAEVARLRELH  927

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  928  TLKGHVE---SVVKLKGLDIDTIQQHYTV  953



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   170 bits (430),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+L+ DT FF D F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGYLALMTVIFFWLMHDTKFFPDKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL GS  E+ AA+YLQ+SI+SQALIFVTRS+SWS+ E PG+LL+ AF  AQ VAT I V
Sbjct  749  RSLRGSDHEMMAALYLQVSIVSQALIFVTRSRSWSYVERPGLLLVTAFFIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FA+I+GIGWGWAGVIW+YSI+ Y PLD++KF  R  L+        +N+T+    
Sbjct  809  YANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDLMKFAIRYILSGKAWLNLLENKTAFTTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  N+K+S    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWALAQRTLHGLQPPEATNLFNDKSSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_004296457.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =   170 bits (430),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRV PSP+PDSWKL EIFA GI LG Y ALMT +FF+L+ +TDFF+D F V
Sbjct  690  DGTIMTISKDRVVPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDKFGV  749

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  SP +L AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LLL AF  AQ +AT + V
Sbjct  750  RSIRESPEDLMAALYLQVSIVSQALIFVTRSRSWSFMERPGLLLLGAFAIAQLIATLVAV  809

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI G+GWGWAGVIW+YSI+ YFPLDI+KF  R  L+        DN T+    
Sbjct  810  YANWGFARIHGVGWGWAGVIWLYSIVFYFPLDIMKFAIRYILSGKAWLNMLDNRTAFTTK  869

Query  506  ----------------------KAPNQC---NEKNS----SEMTDLECAPEEATRLREDD  598
                                  +AP      N+K+S    SE+ +      E  RLRE  
Sbjct  870  KDYGKEEREAQWAHAQRTLHGLQAPESSSLFNDKSSYRELSEIAEQAKRRAEMARLRELT  929

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SVAK K LD+++IQQH TV
Sbjct  930  TLKGHVE---SVAKLKGLDLDSIQQHYTV  955



>sp|Q9SJB3.3|PMA5_ARATH RecName: Full=ATPase 5, plasma membrane-type; AltName: Full=Proton 
pump 5 [Arabidopsis thaliana]
Length=949

 Score =   169 bits (429),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 179/269 (67%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDR+KPSP PDSWKL +IF+ G+ LG YQALMT +FF+++ D+DFF+++F V
Sbjct  684  DGTIMTISKDRMKPSPQPDSWKLRDIFSTGVVLGGYQALMTVVFFWVMKDSDFFSNYFGV  743

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + L   P ++ AA+YLQ+SIISQALIFVTRS+SWS+AE PG+LLL AF+ AQ VAT I V
Sbjct  744  RPLSQRPEQMMAALYLQVSIISQALIFVTRSRSWSYAECPGLLLLGAFVIAQLVATFIAV  803

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNET-----  502
            YANWSFARI+G GWGWAGVIW+YS +TY PLD++KF  R  L+        +N+T     
Sbjct  804  YANWSFARIEGAGWGWAGVIWLYSFLTYIPLDLLKFGIRYVLSGKAWLNLLENKTAFTTK  863

Query  503  ------------------------SKAPNQCNEKNS-SEMTDL-ECAPE--EATRLREDD  598
                                    ++  N  NEKNS SE++ + E A    E  RLRE +
Sbjct  864  KDYGKEEREAQWAAAQRTLHGLQPAEKNNIFNEKNSYSELSQIAEQAKRRAEVVRLREIN  923

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  924  TLKGHVE---SVVKLKGLDIDTIQQHYTV  949



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   169 bits (429),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG Y ALMT +FF+++ DTDFF D F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGGYLALMTVIFFWVMKDTDFFPDKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            KS+  SP E+ AA+YLQ+S++SQALIFVTRS+SWSF E PG+LL+ AF+ AQ VAT I V
Sbjct  749  KSIRDSPHEMMAALYLQVSVVSQALIFVTRSRSWSFVERPGLLLVTAFIIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G+GWGWAGV+WIYS++ Y PLD IKF  R  L+        +N+T+    
Sbjct  809  YANWGFARIKGMGWGWAGVVWIYSVVFYVPLDFIKFFIRYILSGKAWLNLLENKTAFTTK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  N   +KNS    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWALAQRTLHGLQPPETSNLFXDKNSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_008677658.1| PREDICTED: uncharacterized protein LOC100383904 isoform X1 [Zea 
mays]
 gb|AFW64135.1| hypothetical protein ZEAMMB73_387587 [Zea mays]
Length=951

 Score =   169 bits (429),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 166/273 (61%), Gaps = 52/273 (19%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LGTY AL TALFF+L  DTDFFT+ F V
Sbjct  686  DGTIMTISKDRVKPSPTPDSWKLKEIFATGIVLGTYMALATALFFYLAHDTDFFTNAFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  EL AA+YLQ+SIISQALIFVTRS+SWSF E PG LL+IAFLAAQ VAT I V
Sbjct  746  RSIKENDKELMAALYLQVSIISQALIFVTRSRSWSFVERPGALLVIAFLAAQLVATCIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDNETSKAPNQCNEKNS-  538
            YANW F ++QGIGWGW G IW +S++TYFPLD++KF  R AL    + KA N  N K + 
Sbjct  806  YANWEFCKMQGIGWGWGGAIWAFSVVTYFPLDVLKFAIRYAL----SGKAWNNINNKTAF  861

Query  539  --------------------------------------------SEMTDLECAPEEATRL  586
                                                        SE+ +      E  RL
Sbjct  862  TNRTDYGKGEREAQWATAQRTLHGLNQATATSDLFGDNQGYRELSELAEQAAKRAEVARL  921

Query  587  REDDAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
            RE   + G +    SV K K LDI+TIQQ  TV
Sbjct  922  RELHTLKGHVE---SVVKLKGLDIDTIQQSYTV  951



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =   169 bits (429),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 169/268 (63%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG Y A+MT +FF++   +DFFT+ F V
Sbjct  688  DGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGAYLAIMTVVFFWVAHSSDFFTEKFGV  747

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  ELTAAVYLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AFL AQ +AT I V
Sbjct  748  RSIRENHDELTAAVYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLIAQLIATIIAV  807

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            Y +W FARIQGIGWGWAGVIW+YSI+ Y PLD++KFI R AL+    DN           
Sbjct  808  YGDWKFARIQGIGWGWAGVIWLYSIVFYVPLDVLKFIIRYALSGKAWDNLVQNRTAFTTK  867

Query  497  -------------------------ETSKAPNQCNEKNSSEMTDLECAPEEATRLREDDA  601
                                     ET++     N +  SE+ +      E  RLRE   
Sbjct  868  KDYGRGEREAQWAAAQRTLHGLQPPETAELFQDKNYRELSEIAEQAKRRAEVARLRELHT  927

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI TIQQH TV
Sbjct  928  LKGHVE---SVVKLKGLDIETIQQHYTV  952



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score =   169 bits (429),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 142/270 (53%), Positives = 174/270 (64%), Gaps = 45/270 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIF+ GI LG Y ALMT LFF+++ DTDFF+D F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLKEIFSTGIVLGGYMALMTVLFFWIMKDTDFFSDKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  +  E+ AA+YLQ+SI+SQALIFVTRS+SWSF E PG LLL AF+AAQ +AT I V
Sbjct  749  RSLRKNDEEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGFLLLGAFVAAQLIATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+G GWGWAGVIW++S++TY PLDI+KF  R  L+        +N+T+    
Sbjct  809  YANWGFARIKGCGWGWAGVIWLFSVVTYVPLDILKFAIRYILSGKAWDNLLENKTAFTTK  868

Query  506  --------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLRED  595
                                       + N  +EKNS    SE+ +      E  RLRE 
Sbjct  869  KDYGKEEREAQWATAQRTLHGLQPPETSHNMFSEKNSYRELSEIAEQAKRRAEMARLREL  928

Query  596  DAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + + G +    SV K K LDI+TIQQH TV
Sbjct  929  NTLKGHVE---SVVKLKGLDIDTIQQHYTV  955



>ref|XP_002452983.1| hypothetical protein SORBIDRAFT_04g036040 [Sorghum bicolor]
 gb|EES05959.1| hypothetical protein SORBIDRAFT_04g036040 [Sorghum bicolor]
Length=951

 Score =   169 bits (429),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 141/273 (52%), Positives = 165/273 (60%), Gaps = 52/273 (19%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LGTY AL TALFF+L  DT+FF++ F V
Sbjct  686  DGTIMTISKDRVKPSPTPDSWKLKEIFATGIVLGTYMALATALFFYLAHDTEFFSETFGV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  EL AA+YLQ+SIISQALIFVTRS+SWSF E PG LL+IAFLAAQ VAT I V
Sbjct  746  RSIKENDKELMAALYLQVSIISQALIFVTRSRSWSFVERPGALLVIAFLAAQLVATCIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDNETSKAPNQCNEKNS-  538
            YANW F ++QGIGWGW G IW +S++TYFPLD++KF  R AL    + KA N  N K + 
Sbjct  806  YANWEFCKMQGIGWGWGGAIWAFSVVTYFPLDVLKFAIRYAL----SGKAWNNINNKTAF  861

Query  539  --------------------------------------------SEMTDLECAPEEATRL  586
                                                        SE+ D      E  RL
Sbjct  862  TNRTDYGKGEREAQWATAQRTLHGLNQATATSDLFGDNQGYRELSELADQAAKRAEVARL  921

Query  587  REDDAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
            RE   + G +    SV K K LDI+TI Q  TV
Sbjct  922  RELHTLKGHVE---SVVKLKGLDIDTINQSYTV  951



>gb|EYU20899.1| hypothetical protein MIMGU_mgv1a000880mg [Erythranthe guttata]
Length=952

 Score =   169 bits (429),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA G+ALG+Y ALMT +FF+L+  TDFF + F V
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLNEIFATGVALGSYLALMTVIFFWLMHKTDFFPEKFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +++  S  E+ AA+YLQ+SI+SQALIFVTRS+SWS+ E PG LL+IAF  AQ +AT I V
Sbjct  747  RNIRDSEEEMMAALYLQVSIVSQALIFVTRSRSWSYVERPGALLMIAFCIAQLIATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DN-------  496
            YANW FARI G GWGWAGVIW+YS++ Y PLD++KF TR  L+        DN       
Sbjct  807  YANWGFARISGCGWGWAGVIWLYSLVFYVPLDLMKFATRYILSGKAWQNLYDNKIAFTAK  866

Query  497  ----------------------ETSKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                  +TS+A N  ++K+S    SE+ +      E  RLRE  
Sbjct  867  NDYGKEEREAQWALAQRTLHGLQTSEASNVFHDKSSYRELSEIAEQAKRRAEIARLRELH  926

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TI QH TV
Sbjct  927  TLKGHVE---SVMKLKGLDIETIPQHYTV  952



>gb|AAO72564.1| plasma membrane H+-ATPase-like protein [Oryza sativa Japonica 
Group]
Length=503

 Score =   166 bits (419),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 140/271 (52%), Positives = 171/271 (63%), Gaps = 46/271 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG+Y ALMT +FF+ +  TDFFTD F V
Sbjct  236  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFTDKFGV  295

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  S  E+ +A+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+ AQ VAT + V
Sbjct  296  RSIRNSEHEMMSALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVATFLAV  355

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT-----------------  490
            YANW FARI+GIGWGWAGVIW+YSI+ YFPLDI KF  R  L+                 
Sbjct  356  YANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAFTTK  415

Query  491  ------DNETSKAPNQ----------------CNEKNS----SEMTDLECAPEEATRLRE  592
                  + E   A  Q                 N+K+S    SE+ +      E  RLRE
Sbjct  416  KDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKRRAEIARLRE  475

Query  593  DDAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + + G +    SV K K LDI+TIQQ+ TV
Sbjct  476  LNTLKGHVE---SVVKLKGLDIDTIQQNYTV  503



>ref|XP_010691622.1| PREDICTED: plasma membrane ATPase isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=950

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 179/270 (66%), Gaps = 45/270 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA G+ LG+Y ALMT LFF+ V+DTDFF++ F V
Sbjct  684  DGTIMTISKDRVKPSPTPDSWKLKEIFATGVVLGSYLALMTVLFFWAVNDTDFFSNTFHV  743

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+ G+  EL AA+YLQ+SI+SQALIFVTRS+S+SF E PG++L+ AF  AQ +AT I V
Sbjct  744  RSIRGNEQELMAALYLQVSIVSQALIFVTRSRSFSFIERPGLMLVGAFFLAQLIATLIAV  803

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DNE-------TSK  508
            YA+W FAR++GIGWGWAGVIW++SIITYFPLD++K+I R ALT    DN        TSK
Sbjct  804  YASWGFARVKGIGWGWAGVIWLFSIITYFPLDVLKYIIRYALTGKAWDNLLERKTAFTSK  863

Query  509  -----------------------APNQCN----EKNS----SEMTDLECAPEEATRLRED  595
                                   AP+  +    +KNS    SE+ +      E  RLRE 
Sbjct  864  KDYGKGEREAQWAAAQRTLHGLQAPDNSSDLLADKNSYRELSEIAEQAKRRAEIARLREL  923

Query  596  DAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
              + G +    SV K K LDI+TIQQH TV
Sbjct  924  HTLKGHVE---SVVKLKNLDIDTIQQHYTV  950



>gb|EYU24620.1| hypothetical protein MIMGU_mgv1a001404mg [Erythranthe guttata]
Length=825

 Score =   168 bits (426),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 167/269 (62%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKLNEIFA G+  GTYQA+MT +FF+ V ++ FFT+ F V
Sbjct  560  DGTIMTISKDRVKPSPMPDSWKLNEIFATGVVFGTYQAVMTVVFFWAVKESTFFTEKFGV  619

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  +   L +AVYLQ+SIISQALIFVTRS+SWS+ E PG+LL+ AF  AQ +AT I V
Sbjct  620  RHIGENNEALNSAVYLQVSIISQALIFVTRSRSWSYVERPGLLLVAAFCVAQLIATVIAV  679

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----------------D  493
            YANW FARI+GIGWGWAGVIWIYS+I Y PLDI KF+ R ALT                 
Sbjct  680  YANWGFARIEGIGWGWAGVIWIYSVIFYIPLDIFKFLIRYALTGKAWNNMINNRTAFQSK  739

Query  494  NETSKAPNQC---------------------NEKNS----SEMTDLECAPEEATRLREDD  598
            N+  +   +                      N++N+    SE+ +      E  RLRE  
Sbjct  740  NDYGRGEKEAQWALEQRTKHGLRRPENTELFNDRNNYRELSEIAEQAKKRAEVARLRELH  799

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+ I QH TV
Sbjct  800  TLKGHVE---SVVKLKGLDIDNINQHYTV  825



>ref|XP_010932230.1| PREDICTED: plasma membrane ATPase 4 [Elaeis guineensis]
Length=953

 Score =   169 bits (428),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 175/271 (65%), Gaps = 46/271 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LGTY ALMT LFF++  ++DFF++ FKV
Sbjct  686  DGTIMTISKDRVKPSPVPDSWKLREIFATGIVLGTYLALMTVLFFWIAQESDFFSNAFKV  745

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  ELTAA+YLQ+SIISQALIFVTRS+ W F E PG+LL+ AF+AAQ VAT I V
Sbjct  746  RSIRDNTDELTAALYLQVSIISQALIFVTRSRGWFFVERPGLLLVGAFVAAQLVATVIAV  805

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YA+W FA+I GIGWGWAGVIW+Y+I+T+FPLDI+KFI R +L+    DN           
Sbjct  806  YASWGFAQIHGIGWGWAGVIWLYTIVTFFPLDILKFIIRYSLSGQAWDNLFQNKTAFTNK  865

Query  497  -ETSKAPNQC----------------------NEKNS-----SEMTDLECAPEEATRLRE  592
             +  K   +                       NEKN+     SE+ +      E  RLRE
Sbjct  866  PDYGKGEREAQWALAQRTLHGLHPPEDSGSLFNEKNNNYRELSEIAEQAKRRAEVARLRE  925

Query  593  DDAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
               + G +    SV K K LDI TIQQH TV
Sbjct  926  LHTLKGHVE---SVVKLKGLDIETIQQHYTV  953



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =   169 bits (428),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 171/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA GI LG Y AL+T +FF+L+ DTDFF + F V
Sbjct  684  DGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGGYLALLTVIFFWLIKDTDFFPEKFGV  743

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +   P E+ A +YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AFL AQ +AT + V
Sbjct  744  RPIRNKPDEMMAVLYLQVSIVSQALIFVTRSRSWSFMERPGLLLVAAFLVAQLIATFVAV  803

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI G GWGWAGVIWIYSI+ Y PLDI+KF TR AL+        +N+T+    
Sbjct  804  YANWDFARIHGCGWGWAGVIWIYSIVFYIPLDILKFGTRYALSGKAWLNLLENKTAFTTK  863

Query  506  ----------------------KAPNQCN---EKNS----SEMTDLECAPEEATRLREDD  598
                                  + P   N   +KNS    SE+ +      E  RLRE  
Sbjct  864  KDYGKEEREAQWAHAQRTLHGLQPPADSNIFDDKNSYRELSEIAEQAKRRAEVARLRELH  923

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  924  TLKGHVE---SVVKLKGLDIDTIQQHYTV  949



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   169 bits (428),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 174/269 (65%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG Y AL T LFF+++ DT+FF+D F V
Sbjct  689  DGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGGYLALGTVLFFWVMKDTNFFSDKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  SP E+ AA+YLQ+SI+SQALIFVTRS+SWS+AE PG+ LL AFL AQ VAT I V
Sbjct  749  RSLRDSPREIMAALYLQVSIVSQALIFVTRSRSWSYAERPGMFLLSAFLIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FA+I+G GWGWAGVIW+YSI+TY PLDI+KF  R  L+        +N+T+    
Sbjct  809  YANWGFAKIKGCGWGWAGVIWLYSIVTYIPLDILKFCIRYVLSGKAWDNLLENKTAFTTK  868

Query  506  ----------------------KAPNQCN---EKNS----SEMTDLECAPEEATRLREDD  598
                                  + P   N   EK+S    SE+ +      E  RLRE  
Sbjct  869  SNYGKEEREAQWAAAQRTLHGLQPPETTNLFPEKSSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_009392149.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=951

 Score =   169 bits (428),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 168/268 (63%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIFA GI LGTY ALMT LFF++   TD F   F V
Sbjct  687  DGTIMTISKDRVKPSPMPDSWKLREIFATGIVLGTYLALMTVLFFWIADQTDLFPKTFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  +  ELT+A+YLQ+S++SQALIFVTRS+SW F E PG+LL+ AF+ AQ VAT I+V
Sbjct  747  RPIRDNQDELTSAIYLQVSVVSQALIFVTRSRSWCFVERPGLLLVAAFVVAQLVATFISV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAAL----------------TD  493
            YA+W FARI GIGWGWAGVIW++SI+T+FPLDI+KFI R  L                T 
Sbjct  807  YASWGFARIHGIGWGWAGVIWLFSIVTFFPLDILKFIIRYTLSGKAWVNLYESKTAFTTK  866

Query  494  NETSKAPNQC---------------------NEKNSSEMTDL-ECAPE--EATRLREDDA  601
             +  K   +                      NEKN  E++++ E A    E  RLRE   
Sbjct  867  LDYGKGEREAQWALAQRTLHGLQPPDSSGLFNEKNYRELSEIAEQAKRRAEVARLRELHT  926

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K LDI T+Q H T+
Sbjct  927  LKGHVE---SVVKLKGLDIETMQHHYTL  951



>gb|KHN18583.1| ATPase 8, plasma membrane-type [Glycine soja]
Length=920

 Score =   169 bits (427),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 169/264 (64%), Gaps = 39/264 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG Y A++T +FFFLV DTDFFT  F V
Sbjct  660  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGAYMAIITVVFFFLVHDTDFFTRVFGV  719

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  S  +L +A+YLQ+SIISQALIFVTRS+SWS+ E PGILL+ AF AAQ VAT I V
Sbjct  720  EPIVDSEEQLNSALYLQVSIISQALIFVTRSRSWSYVERPGILLITAFFAAQLVATVIAV  779

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARI G+GWGWAG IW++SI+TY PLDI+KF+ R  L+        DN+T+    
Sbjct  780  YAHWDFARINGVGWGWAGAIWVFSIVTYIPLDILKFLIRMGLSGKAWDNMLDNKTAFTTK  839

Query  506  ------------------------KAPNQCNEKNSSEMTDLECAPEEATRLREDDAV*GG  613
                                       N+  +   SE+ +      EA RLRE   + G 
Sbjct  840  KDYGRGEREAEWAVAQRTLHGLQVGESNKAKQHEQSEIAEQAKRRAEAARLRELHTLKGH  899

Query  614  MWNH*SVAKAKALDINTIQQHSTV  685
            +    SV K K +DI+TIQQH T+
Sbjct  900  VE---SVVKLKGIDIDTIQQHYTL  920



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   169 bits (427),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+ V DTDFF++ F V
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAVHDTDFFSNKFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  +  E+  A+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+ AQ VAT I V
Sbjct  747  RSLRDNDEEMMGALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVSAFMLAQLVATLIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+GIGWGWAGVIWIYSI+ YFPLDI+KF  R  L+        +N+T+    
Sbjct  807  YANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFAIRYILSGKAWLNLLENKTAFTTK  866

Query  506  ----KAPNQC---------------------NEKNS----SEMTDLECAPEEATRLREDD  598
                K   +                      NEK+S    SE+ +      E  RLRE  
Sbjct  867  KDYGKEEREAQWAHAQRTLHGLQPPETAGIFNEKSSYRELSEIAEQAKRRAEVARLRELH  926

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  927  TLKGHVE---SVVKLKGLDIDTIQQHYTV  952



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score =   169 bits (427),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 169/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+ +  T FF+D F V
Sbjct  689  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMHKTTFFSDKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL   P E  AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF  AQ +AT + V
Sbjct  749  RSLKDRPDEEMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLMSAFCVAQLIATVLAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITR--------AALTDNETS----  505
            YANW FA I+G GWGWAGVIW+YSI+TY PLDI+KF  R         ++ +N+T+    
Sbjct  809  YANWGFAEIKGCGWGWAGVIWLYSIVTYLPLDILKFAIRYILSGKAWVSMLENKTAFTTK  868

Query  506  ----KAPNQC---------------------NEKNS----SEMTDLECAPEEATRLREDD  598
                K   +                      N+K+S    SE+ +      E  RLRE +
Sbjct  869  KDYGKEEREAQWAHAQRTLHGLQPRETSSIFNDKHSYRELSEIAEQAKRRAEVARLREVN  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIDTIQQHYTV  954



>ref|XP_003549696.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform 1 [Glycine 
max]
Length=947

 Score =   169 bits (427),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 169/264 (64%), Gaps = 39/264 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG Y A++T +FFFLV DTDFFT  F V
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGAYMAIITVVFFFLVHDTDFFTRVFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  S  +L +A+YLQ+SIISQALIFVTRS+SWS+ E PGILL+ AF AAQ VAT I V
Sbjct  747  EPIVDSEEQLNSALYLQVSIISQALIFVTRSRSWSYVERPGILLITAFFAAQLVATVIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FARI G+GWGWAG IW++SI+TY PLDI+KF+ R  L+        DN+T+    
Sbjct  807  YAHWDFARINGVGWGWAGAIWVFSIVTYIPLDILKFLIRMGLSGKAWDNMLDNKTAFTTK  866

Query  506  ------------------------KAPNQCNEKNSSEMTDLECAPEEATRLREDDAV*GG  613
                                       N+  +   SE+ +      EA RLRE   + G 
Sbjct  867  KDYGRGEREAEWAVAQRTLHGLQVGESNKAKQHEQSEIAEQAKRRAEAARLRELHTLKGH  926

Query  614  MWNH*SVAKAKALDINTIQQHSTV  685
            +    SV K K +DI+TIQQH T+
Sbjct  927  VE---SVVKLKGIDIDTIQQHYTL  947



>ref|XP_010046966.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Eucalyptus grandis]
Length=990

 Score =   169 bits (427),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 169/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+ +  T FF+D F V
Sbjct  725  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMHKTTFFSDKFGV  784

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL   P E  AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF  AQ +AT + V
Sbjct  785  RSLKDRPDEEMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLMSAFCVAQLIATVLAV  844

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITR--------AALTDNETS----  505
            YANW FA I+G GWGWAGVIW+YSI+TY PLDI+KF  R         ++ +N+T+    
Sbjct  845  YANWGFAEIKGCGWGWAGVIWLYSIVTYLPLDILKFAIRYILSGKAWVSMLENKTAFTTK  904

Query  506  ----KAPNQC---------------------NEKNS----SEMTDLECAPEEATRLREDD  598
                K   +                      N+K+S    SE+ +      E  RLRE +
Sbjct  905  KDYGKEEREAQWAHAQRTLHGLQPRETSSIFNDKHSYRELSEIAEQAKRRAEVARLREVN  964

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  965  TLKGHVE---SVVKLKGLDIDTIQQHYTV  990



>ref|XP_006381782.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
 gb|ERP59579.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
Length=885

 Score =   168 bits (426),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 142/269 (53%), Positives = 171/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+ V DTDFF++ F V
Sbjct  620  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAVHDTDFFSEKFGV  679

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL  +  E+  A+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+ AQ VAT I V
Sbjct  680  RSLRKNDEEMMGALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVSAFMIAQLVATVIAV  739

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARI+GIGWGWAGVIWIYSI+ YFPLDI+KF  R  L+        +N+T+    
Sbjct  740  YANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFAIRYILSGKAWLNLLENKTAFTTK  799

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +     NEK+     SE+ +      E  RLRE  
Sbjct  800  KDYGKEEREAQWALAQRTLHGLQPPETAGVFNEKSGYRELSEIAEQAKRRAEVARLRELH  859

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  860  TLKGHVE---SVVKLKGLDIDTIQQHYTV  885



>ref|XP_011020653.1| PREDICTED: plasma membrane ATPase-like [Populus euphratica]
Length=963

 Score =   169 bits (427),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 172/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY ALMT +FF++V  +DFF+D F V
Sbjct  698  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVILGTYLALMTVVFFWIVHSSDFFSDKFGV  757

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  EL +AVYLQ+SI+SQALIFVTRS+SWS+ E PGI LLIAF+ AQ +AT I V
Sbjct  758  RSIRNNHYELISAVYLQVSIVSQALIFVTRSRSWSYVERPGIYLLIAFVLAQLIATIIAV  817

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDNE-----------TSK  508
            YANW FARI GIGWGWAGVIW+YSII Y PLD +KFI R AL+              TSK
Sbjct  818  YANWGFARIHGIGWGWAGVIWLYSIIFYIPLDFLKFIIRYALSSKSWDSLLQNKTAFTSK  877

Query  509  ---------APNQCNEK------------------NSSEMTDL-ECAPE--EATRLREDD  598
                     AP   +++                  N  E+ D+ E A    E  RLRE  
Sbjct  878  EEYGKRERMAPGAADQRTNHGLHPPEGSELFNDKSNYRELHDIAEHAKRRAEVARLRELH  937

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  938  TLKGHVE---SVVKLKGLDIETIQQHYTV  963



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =   168 bits (426),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 140/268 (52%), Positives = 172/268 (64%), Gaps = 44/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LG YQALMT +FF+ + DTDFF+D F V
Sbjct  689  DGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYQALMTVIFFWAMRDTDFFSDKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            K +  S +E+ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+AAQ VAT I V
Sbjct  749  KPIRNSSNEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVSAFVAAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITR--------AALTDNETS----  505
            YA W FARI+G GWGWAGVIW+YS++TY PLDI+KF  R         +L +N+T+    
Sbjct  809  YAEWGFARIKGTGWGWAGVIWLYSLVTYVPLDILKFAIRYILSGRAWNSLLENKTAFTSK  868

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +  NQ ++K S    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWATAQRTLHGLQPPETSNQKSDKGSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHST  682
             + G +    SV K K LDI++IQQH T
Sbjct  929  TLKGHVE---SVVKLKGLDIDSIQQHYT  953



>ref|XP_003542615.1| PREDICTED: ATPase 8, plasma membrane-type-like isoformX1 [Glycine 
max]
Length=947

 Score =   168 bits (425),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 134/264 (51%), Positives = 171/264 (65%), Gaps = 39/264 (15%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LG Y A++T +FFFLV DTDFFT  F V
Sbjct  687  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGAYMAIITVVFFFLVHDTDFFTRVFGV  746

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  +  +L +A+YLQ+SIISQALIFVTRS+SWS+ E PGILL+ AF AAQ VAT I V
Sbjct  747  EPIVDNEEQLNSALYLQVSIISQALIFVTRSRSWSYVERPGILLITAFFAAQLVATVIAV  806

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YA+W FAR+ G+GWGWAG IW++SI+TY PLDI+KF+ R  L+        +N+T+    
Sbjct  807  YAHWDFARVNGVGWGWAGAIWVFSIVTYIPLDILKFLIRLGLSGRAWDNMLENKTAFTTK  866

Query  506  ------------------------KAPNQCNEKNSSEMTDLECAPEEATRLREDDAV*GG  613
                                       N+ N+ + SE+ +      EA RLRE   + G 
Sbjct  867  KDYGRGEREAEWAVAQRTLHGLQVGESNKANQHDQSEIAEQAKRRAEAARLRELHTLKGH  926

Query  614  MWNH*SVAKAKALDINTIQQHSTV  685
            +    SV K K +DI+TIQQH T+
Sbjct  927  VE---SVVKLKGIDIDTIQQHYTL  947



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score =   168 bits (425),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 167/269 (62%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP PDSWKL EIFA GI LG Y ALMT +FF  + +TDFF D F V
Sbjct  689  DGTIMTISKDRVKPSPSPDSWKLKEIFATGIVLGGYLALMTVIFFLAMHETDFFHDKFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +++  S  E+ AA+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AFL AQ VAT I V
Sbjct  749  RNIRKSEEEMMAALYLQVSIVSQALIFVTRSRSWSFLERPGLLLVSAFLLAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DN-------  496
            YANW FAR++G GWGWAGVIW+YSI+ YFPLD +KF  R  L+        DN       
Sbjct  809  YANWGFARVKGCGWGWAGVIWLYSIVFYFPLDPMKFAIRYVLSGKAWNNLFDNRTAFTTK  868

Query  497  ----------------------ETSKAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                  +T+ A N   +K+S    SE+ +      E  RLRE  
Sbjct  869  KDYGKEEREAQWALAQRTMHGLKTNDAGNLFTDKSSYRELSEIAEQAKRRAEIARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIETIQQHYTV  954



>ref|XP_009410181.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   167 bits (424),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 172/268 (64%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIF+ G+ LG Y A+MT +FFFLV DTDFF   F V
Sbjct  619  DGTIMTISKDRVKPSPVPDSWKLQEIFSTGVVLGAYLAIMTVVFFFLVHDTDFFPKAFGV  678

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S++G+  ELTAA+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+AAQ VAT I V
Sbjct  679  RSINGNNDELTAALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVSAFVAAQLVATLIAV  738

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YA W FAR+ GIGWGWAGVIW+YS+ITYFPLDI+KFI R  L+    DN           
Sbjct  739  YATWGFARMNGIGWGWAGVIWLYSLITYFPLDILKFIIRYGLSGRAWDNLLQNKTAFTSK  798

Query  497  -------------------------ETSKAPNQCNEKNSSEMTDLECAPEEATRLREDDA  601
                                     ET+   ++ + +  SE+ +      E  RLRE   
Sbjct  799  KDYGKGEREAQWALAQRTLHGLHPPETTGLFDEKSYRELSEIAEQAKRRAEVARLRELHT  858

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K L+I  +QQH T+
Sbjct  859  LKGHVE---SVVKLKGLNIENMQQHYTL  883



>ref|XP_009410182.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   167 bits (423),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 139/268 (52%), Positives = 172/268 (64%), Gaps = 43/268 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIF+ G+ LG Y A+MT +FFFLV DTDFF   F V
Sbjct  619  DGTIMTISKDRVKPSPVPDSWKLQEIFSTGVVLGAYLAIMTVVFFFLVHDTDFFPVTFGV  678

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S++G+  ELTAA+YLQ+SI+SQALIFVTRS+SWSF E PG+LL+ AF+AAQ VAT I V
Sbjct  679  RSINGNNDELTAALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVSAFVAAQLVATLIAV  738

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT----DN-----------  496
            YA W FAR+ GIGWGWAGVIW+YS+ITYFPLDI+KFI R  L+    DN           
Sbjct  739  YATWGFARMNGIGWGWAGVIWLYSLITYFPLDILKFIIRYGLSGRAWDNLLQNKTAFTSK  798

Query  497  -------------------------ETSKAPNQCNEKNSSEMTDLECAPEEATRLREDDA  601
                                     ET+   ++ + +  SE+ +      E  RLRE   
Sbjct  799  KDYGKGEREAQWALAQRTLHGLHPPETTGLFDEKSYRELSEIAEQAKRRAEVARLRELHT  858

Query  602  V*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + G +    SV K K L+I  +QQH T+
Sbjct  859  LKGHVE---SVVKLKGLNIENMQQHYTL  883



>gb|KGN65469.1| hypothetical protein Csa_1G423270 [Cucumis sativus]
Length=807

 Score =   167 bits (422),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 139/270 (51%), Positives = 173/270 (64%), Gaps = 45/270 (17%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+++ +TDFF + F V
Sbjct  541  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGYLALMTVIFFWIMRETDFFPEKFNV  600

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  SP E+ AA+YLQ+SI+SQALIFVTRS+SWS+ E PG+LL+ AF+ AQ VAT I V
Sbjct  601  RPIKDSPKEMMAALYLQVSIVSQALIFVTRSRSWSYFERPGLLLMGAFVIAQLVATLIAV  660

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FA+I+G GWGWAGV+WIYS+I Y PLD IKF  R  L+        +N+T+    
Sbjct  661  YANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFAIRYILSGKAWLNLLENKTAFTTK  720

Query  506  -----------------------KAPNQCN---EKNS----SEMTDLECAPEEATRLRED  595
                                    AP + +   EKNS    SE+ +      E  RLRE 
Sbjct  721  KDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSEIAEQAKRRAEIARLREL  780

Query  596  DAV*GGMWNH*SVAKAKALDINTIQQHSTV  685
            + + G +    SV K K LDI+TIQQH TV
Sbjct  781  NTLKGHVE---SVVKLKGLDIDTIQQHYTV  807



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   167 bits (424),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 169/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LGTY A+MT +FF+   DTDFF+D F V
Sbjct  689  DGTIMTISKDRVKPSPVPDSWKLKEIFATGIILGTYLAVMTVIFFWAAHDTDFFSDRFGV  748

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  ELTAA+YLQ+SI+SQALIFVTRS+SWSF E PG++L+ AFL AQ VAT I V
Sbjct  749  RSIRKNDEELTAALYLQVSIVSQALIFVTRSRSWSFVERPGLMLVFAFLIAQLVATLIAV  808

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAAL----------------TD  493
            YA W FARI GIGWGWAGVIWI+S++ YFPLDI+KF+ R  L                T 
Sbjct  809  YAKWHFARISGIGWGWAGVIWIFSVVFYFPLDILKFLIRYGLSGKAWDNLLQNKTAFTTK  868

Query  494  NETSKAPNQC---------------------NEKNS----SEMTDLECAPEEATRLREDD  598
             +  K   +                      N+K+S    SE+ +      E  RLRE  
Sbjct  869  KDYGKGEREAQWALAQRTLHGLQPPETSSLFNDKSSYRELSEIAEQAKRRAEVARLRELH  928

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  929  TLKGHVE---SVVKLKGLDIETIQQHYTV  954



>gb|KHG26452.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   165 bits (418),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 138/269 (51%), Positives = 173/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA GI LG Y ALMT +FF+++ DTDFF++ F V
Sbjct  391  DGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLALMTVVFFWIMHDTDFFSEKFGV  450

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +SL     ++  A+YLQ+SI+SQALIFVTRS+SWS+ E PG+LL+ AF+ AQ VAT I V
Sbjct  451  RSLRKRDDQMMGALYLQVSIVSQALIFVTRSRSWSYFERPGLLLVTAFIIAQLVATVIAV  510

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALT--------DNETS----  505
            YANW FARIQGIGWGWAGVIW+YS++ Y PLD++KF  R  L+        +N+T+    
Sbjct  511  YANWGFARIQGIGWGWAGVIWLYSVVFYIPLDLMKFAIRYILSGKAWLNLLENKTAFTTK  570

Query  506  -------------------------KAPNQCNEKNS----SEMTDLECAPEEATRLREDD  598
                                     +A N  N+K+S    SE+ +      E  RLRE  
Sbjct  571  KDYGKEEREAQWALAQRTLHGLQPPEASNLFNDKSSYRELSEIAEQAKRRAEVARLRELH  630

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  631  TLKGHVE---SVVKLKGLDIDTIQQHYTV  656



>gb|KHN01287.1| Plasma membrane ATPase 4 [Glycine soja]
Length=885

 Score =   167 bits (423),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA GI LG Y A+MT +FF+    +DFFT+ F V
Sbjct  620  DGTIMTISKDRVKPSPLPDSWKLNEIFATGIVLGAYLAIMTVVFFWAAHASDFFTEKFGV  679

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +     ELTAAVYLQ+SI+SQALIFVTRS+++SF E PG+LL+ AF+ AQ +AT I V
Sbjct  680  RPIRNVQDELTAAVYLQVSIVSQALIFVTRSRNFSFLERPGLLLVTAFIIAQLIATLIAV  739

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAAL--------TDNETS----  505
            YANW FAR++GIGWGWAGVIW+YSII Y PLD +KF  R  L        T+N+T+    
Sbjct  740  YANWGFARMRGIGWGWAGVIWLYSIIFYIPLDFLKFGIRYFLSGKAWNNITENKTAFTTK  799

Query  506  ----------------KAPNQCN---------EKNS----SEMTDLECAPEEATRLREDD  598
                            +  +  N         EKN+    SE+ D      E  RLRE  
Sbjct  800  KDYGKEEREAQWATAQRTLHGLNPPETEQIFSEKNNYRELSEIADQARKRAEVARLRELH  859

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI+TIQQH TV
Sbjct  860  TLKGHVE---SVVKLKGLDIDTIQQHYTV  885



>gb|KHN38020.1| Plasma membrane ATPase [Glycine soja]
Length=885

 Score =   167 bits (422),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 138/269 (51%), Positives = 170/269 (63%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKLNEIFA GI LGTY A+MT +FF+    +DFFT+ F V
Sbjct  620  DGTIMTISKDRVKPSPLPDSWKLNEIFATGIVLGTYLAIMTVVFFWAAHASDFFTEKFGV  679

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            + +  +  ELTAAVYLQ+SI+SQALIFVTRS+++SF E PG+LL+ AF+ AQ +AT I V
Sbjct  680  RPIRNNQDELTAAVYLQVSIVSQALIFVTRSRNFSFLERPGLLLVTAFVIAQLIATIIAV  739

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAAL--------TDNETSKAPN  517
            YANW FAR++GIGWGWAGVIW+YSII Y PLD +KF  R  L        T+N+T+    
Sbjct  740  YANWGFARMKGIGWGWAGVIWLYSIIFYIPLDFLKFGIRYFLSGRAWNNITENKTAFTTK  799

Query  518  Q-----------------------------CNEKNS----SEMTDLECAPEEATRLREDD  598
            +                              +EKN+    S++ D      E  RLRE  
Sbjct  800  KDYGKEEREAQWVTAQRTLHGLNPPETEQIFSEKNNYRELSDIADQARKRAEVARLRELY  859

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  860  TLKGHVE---SVVKLKGLDIGTIQQHYTV  885



>ref|XP_011015389.1| PREDICTED: plasma membrane ATPase-like [Populus euphratica]
Length=963

 Score =   167 bits (423),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 171/269 (64%), Gaps = 44/269 (16%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSP+PDSWKL EIFA G+ LGTY ALMT +FF++V  +DFF+D F V
Sbjct  698  DGTIMTISKDRVKPSPLPDSWKLKEIFATGVILGTYLALMTVVFFWIVHSSDFFSDKFGV  757

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
            +S+  +  EL +AVYLQ+SI+SQALIFVTRS+SWS+ E PGI LLIAF+ AQ +AT I V
Sbjct  758  RSIRNNHYELISAVYLQVSIVSQALIFVTRSRSWSYVERPGIYLLIAFVLAQLIATIIAV  817

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDNE-----------TSK  508
            YANW FARI GIGWGWAGVIW+YSII Y PLD +KFI R AL+              TSK
Sbjct  818  YANWGFARIHGIGWGWAGVIWLYSIIFYIPLDFLKFIIRYALSSKSWDSLLQNKTAFTSK  877

Query  509  ---------APNQCNE------------------KNSSEMTDL-ECAPE--EATRLREDD  598
                     AP   ++                   N  E+ D+ E A    E  RLRE  
Sbjct  878  EEYGKRERMAPGAADQGTNHGLHPPEGSELFNDKSNYRELHDIAEHAKRRAEVARLRELH  937

Query  599  AV*GGMWNH*SVAKAKALDINTIQQHSTV  685
             + G +    SV K K LDI TIQQH TV
Sbjct  938  TLKGHVE---SVVKLKGLDIETIQQHYTV  963



>ref|XP_006848753.1| hypothetical protein AMTR_s00026p00031590 [Amborella trichopoda]
 gb|ERN10334.1| hypothetical protein AMTR_s00026p00031590 [Amborella trichopoda]
Length=438

 Score =   162 bits (411),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +2

Query  2    DGTIMTISKDRVKPSPMPDSWKLNEIFAIGIALGTYQALMTAlffflvsdtdfftdffkv  181
            DGTIMTISKDRVKPSPMPDSWKL EIF  G+ LGTY A+MT +FF++V  TDFF+D F V
Sbjct  260  DGTIMTISKDRVKPSPMPDSWKLKEIFTTGVVLGTYLAVMTVVFFWVVHKTDFFSDVFGV  319

Query  182  ksLHGSPSELTAAVYLQISIISQALIFVTRSQSWSFAEPPGillliaflaaqfvaTTITV  361
             S+  + +EL AA+YLQ+SI+SQALIFVTRS+S+SF E PG+LLL+AF  AQ +AT I V
Sbjct  320  HSIKDNHTELMAALYLQVSIVSQALIFVTRSRSFSFIERPGLLLLVAFTFAQLIATLIAV  379

Query  362  YANWSFARiqgigwgwagviwiYSIITYFPLDIIKFITRAALTDN  496
            YANW FARI GIGWGWAGVIW+YSIITYFPLDI KF+ R AL+D 
Sbjct  380  YANWGFARIAGIGWGWAGVIWLYSIITYFPLDIFKFVVRYALSDK  424



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2773039253754