BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19426_g3_i1 len=403 path=[2137:0-120 2258:121-402]

Length=403
                                                                      Score     E

emb|CBN72504.1|  putative autoinhibited H+ ATPase                       213   1e-66   
gb|AAF27113.1|AC018849_1  aha9, 5' partial; 1-2403                      221   1e-65   
ref|NP_001169998.1|  uncharacterized protein LOC100383904               214   4e-65   Zea mays [maize]
gb|AAA81348.1|  p-type H+-ATPase                                        213   5e-65   Vicia faba [broad bean]
dbj|BAF01699.1|  plasma membrane ATPase 3                               214   6e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001136587.1|  uncharacterized protein LOC100216710               214   1e-64   Zea mays [maize]
tpg|DAA59899.1|  TPA: membrane H(+)-ATPase1                             214   1e-64   
tpg|DAA59901.1|  TPA: membrane H(+)-ATPase1                             214   2e-64   
gb|AAA34096.1|  plasma membrane H+ ATPase                               213   2e-64   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
dbj|BAO02511.1|  predicted H+ ATPase ortholog                           218   3e-64   
dbj|BAG55917.1|  H+-ATPase                                              211   3e-64   Mimosa pudica [sensitive-plant]
gb|EPS59184.1|  hypothetical protein M569_15622                         215   3e-64   
dbj|BAM20992.1|  plasma membrane H+-ATPase                              214   3e-64   
gb|EMS46830.1|  ATPase 9, plasma membrane-type                          218   4e-64   
ref|NP_178181.1|  H(+)-ATPase 9                                         220   5e-64   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185450.1|  H(+)-ATPase 9                                      220   5e-64   
emb|CDP14275.1|  unnamed protein product                                216   7e-64   
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...    218   8e-64   Ricinus communis
ref|XP_010097155.1|  ATPase 9, plasma membrane-type                     219   9e-64   
dbj|BAM20988.1|  plasma membrane H+-ATPase                              213   9e-64   
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    219   1e-63   
ref|XP_011078615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    219   1e-63   
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    219   1e-63   
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    218   1e-63   
gb|KGN65225.1|  hypothetical protein Csa_1G267210                       218   2e-63   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    218   2e-63   
gb|ACC62036.1|  plasma membrane H+ ATPase                               201   2e-63   Suaeda maritima
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          218   2e-63   
gb|EMT29166.1|  ATPase 8, plasma membrane-type                          217   3e-63   
gb|AAR32129.2|  proton P-ATPase                                         218   3e-63   Nicotiana tabacum [American tobacco]
ref|XP_006848753.1|  hypothetical protein AMTR_s00026p00031590          211   3e-63   
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          218   3e-63   
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          218   3e-63   
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     218   3e-63   
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     217   4e-63   
dbj|BAM20990.1|  plasma membrane H+-ATPase                              217   4e-63   
gb|ACC62037.1|  Salt7 plasma membrane H+ ATPase                         201   4e-63   Suaeda maritima
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     217   4e-63   
emb|CDX87330.1|  BnaA07g35430D                                          217   4e-63   
emb|CDY39956.1|  BnaC06g40340D                                          217   4e-63   
gb|KHN22411.1|  ATPase 9, plasma membrane-type                          217   5e-63   
gb|KDP38637.1|  hypothetical protein JCGZ_03990                         217   5e-63   
ref|XP_002523524.1|  H(\+)-transporting atpase plant/fungi plasma...    216   5e-63   Ricinus communis
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                   216   5e-63   
gb|EEE65209.1|  hypothetical protein OsJ_20350                          216   6e-63   Oryza sativa Japonica Group [Japonica rice]
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                   216   6e-63   
ref|XP_007023381.1|  H(+)-ATPase 9                                      217   6e-63   
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           217   6e-63   
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                   216   7e-63   
ref|XP_001771404.1|  predicted protein                                  211   7e-63   
gb|KHN22097.1|  ATPase 8, plasma membrane-type                          218   7e-63   
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             216   7e-63   
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             216   7e-63   
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          216   7e-63   
ref|NP_001056980.1|  Os06g0181500                                       216   8e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006665055.1|  PREDICTED: plasma membrane ATPase-like             216   8e-63   
ref|XP_006648697.1|  PREDICTED: plasma membrane ATPase-like             216   8e-63   
ref|XP_002324564.1|  ATPase 6 family protein                            216   9e-63   Populus trichocarpa [western balsam poplar]
emb|CAD29316.1|  plasma membrane H+-ATPase                              216   9e-63   Oryza sativa [red rice]
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             216   9e-63   
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             216   9e-63   
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          216   9e-63   
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    216   9e-63   
gb|EYU24620.1|  hypothetical protein MIMGU_mgv1a001404mg                216   9e-63   
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    216   1e-62   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     216   1e-62   
gb|ACN49187.1|  plasma membrane ATPase 1-like protein                   213   1e-62   Triticum aestivum [Canadian hard winter wheat]
dbj|BAD72314.1|  plasma membrane H+-ATPase                              216   1e-62   Oryza sativa Japonica Group [Japonica rice]
emb|CDX79363.1|  BnaC06g19400D                                          216   1e-62   
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type-like     216   1e-62   
dbj|BAF03589.1|  P-type H+-ATPase                                       216   1e-62   Zostera marina
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             216   1e-62   
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                   216   1e-62   
gb|KGN64262.1|  hypothetical protein Csa_1G045600                       215   1e-62   
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like     216   1e-62   
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         216   1e-62   
gb|ABR15780.1|  plasma membrane H+ ATPase                               199   1e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          216   1e-62   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             216   1e-62   
gb|ABW74139.1|  plasma membrane H(+) ATPase                             199   1e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_004287218.1|  PREDICTED: ATPase 8, plasma membrane-type-like     216   1e-62   
gb|KEH19962.1|  plasma membrane H+-ATPase                               216   1e-62   
emb|CDX67957.1|  BnaA07g19970D                                          216   1e-62   
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    216   1e-62   
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          215   1e-62   
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           216   1e-62   
gb|KGN62872.1|  hypothetical protein Csa_2G378540                       211   1e-62   
gb|KEH37844.1|  plasma membrane H+-ATPase                               215   1e-62   
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          216   1e-62   Vitis vinifera
ref|XP_010472895.1|  PREDICTED: ATPase 9, plasma membrane-type is...    216   1e-62   
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                216   1e-62   
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          216   2e-62   
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...    216   2e-62   
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    216   2e-62   
gb|KHG26452.1|  Plasma membrane ATPase 4                                213   2e-62   
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     215   2e-62   
emb|CAN61424.1|  hypothetical protein VITISV_027272                     216   2e-62   Vitis vinifera
gb|KGN60742.1|  hypothetical protein Csa_2G009310                       215   2e-62   
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          215   2e-62   
gb|ACN34067.1|  unknown                                                 214   2e-62   Zea mays [maize]
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  215   2e-62   
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       215   2e-62   
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...    215   2e-62   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     215   2e-62   
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like    215   2e-62   
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           215   2e-62   
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     215   2e-62   
ref|XP_002437958.1|  hypothetical protein SORBIDRAFT_10g005500          215   2e-62   Sorghum bicolor [broomcorn]
gb|KHF98166.1|  Plasma membrane ATPase 4                                213   2e-62   
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    215   2e-62   
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     215   2e-62   
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    215   2e-62   
gb|KHG19606.1|  ATPase 5, plasma membrane-type -like protein            213   2e-62   
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     215   2e-62   
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             215   2e-62   Vitis vinifera
ref|XP_007012006.1|  H(+)-ATPase 8                                      215   2e-62   
emb|CAN78639.1|  hypothetical protein VITISV_031738                     215   2e-62   Vitis vinifera
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    215   2e-62   
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type          215   2e-62   
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         215   2e-62   
ref|XP_004159431.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 8, pl...    215   2e-62   
emb|CBI35956.3|  unnamed protein product                                215   2e-62   
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             215   2e-62   
gb|EMT25011.1|  Plasma membrane ATPase                                  215   2e-62   
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...    215   2e-62   
ref|XP_004139271.1|  PREDICTED: ATPase 8, plasma membrane-type-like     215   2e-62   
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             215   2e-62   
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like     215   3e-62   
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     215   3e-62   
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             215   3e-62   
ref|XP_002515334.1|  H(\+)-transporting atpase plant/fungi plasma...    214   3e-62   Ricinus communis
gb|KHG28536.1|  Plasma membrane ATPase 4                                213   3e-62   
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                215   3e-62   
ref|XP_008658955.1|  PREDICTED: uncharacterized protein LOC100501...    214   3e-62   
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          215   3e-62   
gb|ACN33231.1|  unknown                                                 210   3e-62   Zea mays [maize]
sp|P23980.1|PMA2_SOLLC  RecName: Full=Plasma membrane ATPase 2; A...    213   3e-62   Solanum lycopersicum
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     214   3e-62   
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           215   3e-62   
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             215   3e-62   
gb|ABW74138.1|  plasma membrane H(+) ATPase                             198   3e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type-like    215   3e-62   
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  215   3e-62   
ref|XP_007011593.1|  Plasma membrane ATPase 4 isoform 2                 213   3e-62   
emb|CDO98206.1|  unnamed protein product                                214   3e-62   
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  214   3e-62   
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          214   3e-62   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     214   3e-62   
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             214   3e-62   
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  214   4e-62   
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             214   4e-62   
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           214   4e-62   
gb|KHG12451.1|  ATPase 4, plasma membrane-type -like protein            213   4e-62   
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    214   4e-62   
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    214   4e-62   
gb|EEC83158.1|  hypothetical protein OsI_28372                          214   4e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                214   4e-62   
gb|AAK31799.2|  plasma membrane H+ ATPase                               214   4e-62   Lilium longiflorum [Easter lily]
ref|XP_004508384.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    214   4e-62   
gb|KHG14131.1|  ATPase 4, plasma membrane-type -like protein            213   4e-62   
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             214   4e-62   
ref|XP_002307856.1|  ATPase 6 family protein                            214   4e-62   Populus trichocarpa [western balsam poplar]
ref|XP_006654259.1|  PREDICTED: plasma membrane ATPase 4-like           214   4e-62   
ref|XP_010417679.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    214   4e-62   
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    214   4e-62   
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    214   4e-62   
ref|XP_002309321.1|  ATPase 6 family protein                            214   4e-62   Populus trichocarpa [western balsam poplar]
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    214   4e-62   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          214   4e-62   
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    214   4e-62   
ref|XP_003573592.1|  PREDICTED: ATPase 2, plasma membrane-type-like     214   5e-62   
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             214   5e-62   
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    214   5e-62   
dbj|BAD16686.1|  plasma membrane H+-ATPase                              214   5e-62   Daucus carota [carrots]
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                214   5e-62   
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             214   5e-62   
emb|CBW30211.1|  Plasma membrane ATPase                                 214   5e-62   
emb|CBW30173.1|  Plasma membrane ATPase 4                               214   5e-62   
emb|CAD29311.1|  plasma membrane H+-ATPase                              214   5e-62   Oryza sativa [red rice]
ref|XP_004973040.1|  PREDICTED: plasma membrane ATPase-like             214   5e-62   
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             214   5e-62   
gb|EAZ06139.1|  hypothetical protein OsI_28373                          214   5e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_009126895.1|  PREDICTED: ATPase 3, plasma membrane-type-like     213   5e-62   
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          214   5e-62   
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     214   5e-62   
dbj|BAD33363.1|  putative plasma membrane H+-ATPase                     214   5e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     214   5e-62   
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           214   6e-62   
dbj|BAD16689.1|  plasma membrane H+-ATPase                              214   6e-62   Daucus carota [carrots]
gb|AEQ27822.1|  PM H+-ATPase R                                          214   6e-62   
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           214   6e-62   
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           214   6e-62   
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           214   6e-62   
tpg|DAA54787.1|  TPA: hypothetical protein ZEAMMB73_074525              213   6e-62   
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                214   6e-62   
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          214   6e-62   
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             214   6e-62   
gb|AFM52333.1|  plasma membrane H+-ATPase                               214   6e-62   
gb|AFW76177.1|  hypothetical protein ZEAMMB73_418989                    214   6e-62   
ref|XP_007155352.1|  hypothetical protein PHAVU_003G193800g             213   6e-62   
dbj|BAM20989.1|  plasma membrane H+-ATPase                              214   6e-62   
ref|XP_002438748.1|  hypothetical protein SORBIDRAFT_10g025470          214   7e-62   Sorghum bicolor [broomcorn]
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       214   7e-62   
gb|EMS59303.1|  Plasma membrane ATPase                                  214   7e-62   
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             214   7e-62   
emb|CDY30730.1|  BnaA02g33520D                                          213   7e-62   
gb|AAO72564.1|  plasma membrane H+-ATPase-like protein                  208   7e-62   Oryza sativa Japonica Group [Japonica rice]
gb|ABR18001.1|  unknown                                                 214   7e-62   Picea sitchensis
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     214   7e-62   
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     214   7e-62   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   214   8e-62   
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     214   8e-62   
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       214   8e-62   
ref|XP_009773901.1|  PREDICTED: plasma membrane ATPase 4-like           214   8e-62   
gb|KFK27283.1|  h(+)-atpase 3                                           214   8e-62   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     214   8e-62   
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like           214   8e-62   
emb|CDP14278.1|  unnamed protein product                                216   8e-62   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     213   8e-62   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             214   8e-62   
dbj|BAK05828.1|  predicted protein                                      213   8e-62   
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     213   8e-62   
gb|KGN60167.1|  hypothetical protein Csa_3G881800                       211   9e-62   
ref|XP_008649034.1|  PREDICTED: ATPase 2, plasma membrane-type-like     213   9e-62   
gb|KGN63646.1|  hypothetical protein Csa_1G008520                       213   9e-62   
gb|ACE77057.1|  plasma membrane proton pump                             213   9e-62   Cucumis sativus [cucumbers]
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like           213   9e-62   
ref|XP_010539792.1|  PREDICTED: ATPase 3, plasma membrane-type-like     213   9e-62   
dbj|BAD19091.1|  putative H+-exporting ATPase                           213   9e-62   Oryza sativa Japonica Group [Japonica rice]
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        213   9e-62   Lilium longiflorum [Easter lily]
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             213   9e-62   
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...    213   9e-62   
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           213   9e-62   
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           213   9e-62   
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           213   9e-62   
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       214   9e-62   
ref|NP_001048395.2|  Os02g0797300                                       213   1e-61   Oryza sativa Japonica Group [Japonica rice]
ref|NP_200545.1|  H(+)-ATPase 3                                         213   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     213   1e-61   
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...    213   1e-61   
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type          213   1e-61   
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          213   1e-61   
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           213   1e-61   
gb|KEH39753.1|  plasma membrane H+-ATPase                               213   1e-61   
ref|XP_011045013.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     213   1e-61   
gb|AAL09726.1|  AT5g57350/MJB24_16                                      213   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAD46186.1|  plasma membrane proton ATPase                           213   1e-61   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1       214   1e-61   
dbj|BAD16687.1|  plasma membrane H+-ATPase                              213   1e-61   Daucus carota [carrots]
emb|CAD29312.1|  plasma membrane H+-ATPase                              213   1e-61   Oryza sativa [red rice]
gb|KDO72464.1|  hypothetical protein CISIN_1g0021762mg                  213   1e-61   
emb|CAC29435.1|  P-type H+-ATPase                                       213   1e-61   Vicia faba [broad bean]
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          213   1e-61   
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    213   1e-61   
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             213   1e-61   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           213   1e-61   
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          213   1e-61   
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    213   1e-61   
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           213   1e-61   
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             213   1e-61   
ref|XP_010691624.1|  PREDICTED: ATPase 9, plasma membrane-type is...    213   1e-61   
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         213   1e-61   
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 213   1e-61   
ref|XP_002444096.1|  hypothetical protein SORBIDRAFT_07g007610          213   1e-61   Sorghum bicolor [broomcorn]
tpg|DAA43142.1|  TPA: hypothetical protein ZEAMMB73_734128              213   1e-61   
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             213   1e-61   
emb|CAD29297.1|  plasma membrane H+ ATPase                              213   1e-61   Oryza sativa Japonica Group [Japonica rice]
gb|KHN16462.1|  Plasma membrane ATPase 4                                213   1e-61   
dbj|BAC77530.1|  plasma membrane H+-ATPase                              213   1e-61   Sesbania rostrata
gb|KDO72462.1|  hypothetical protein CISIN_1g0021762mg                  213   1e-61   
gb|KCW49373.1|  hypothetical protein EUGRSUZ_K02916                     213   1e-61   
gb|KCW49372.1|  hypothetical protein EUGRSUZ_K02916                     213   1e-61   
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           213   1e-61   
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like     213   1e-61   
ref|XP_008650970.1|  PREDICTED: uncharacterized protein LOC100216...    213   1e-61   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          213   1e-61   
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         213   1e-61   
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg             213   1e-61   
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    213   1e-61   
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1                213   1e-61   
ref|XP_010111939.1|  Plasma membrane ATPase 4                           213   1e-61   
ref|XP_002511508.1|  H(\+)-transporting atpase plant/fungi plasma...    212   1e-61   
gb|AEQ27823.1|  PM H+-ATPase L                                          213   1e-61   
ref|XP_002459489.1|  hypothetical protein SORBIDRAFT_02g005440          213   1e-61   
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg                213   1e-61   
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      213   1e-61   
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like     213   1e-61   
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    213   1e-61   
gb|KDP45466.1|  hypothetical protein JCGZ_09715                         213   1e-61   
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type         213   1e-61   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     213   1e-61   
emb|CDY45757.1|  BnaC02g42250D                                          213   1e-61   
gb|KEH39758.1|  plasma membrane H+-ATPase                               213   1e-61   
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             213   1e-61   
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       213   1e-61   
dbj|BAA06629.1|  plasma membrane H+-ATPase                              213   1e-61   
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         213   1e-61   
gb|ABA18112.1|  putative plasma membrane ATPase                         213   1e-61   
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           213   1e-61   
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    213   1e-61   
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like           213   1e-61   
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     213   1e-61   
gb|KEH31901.1|  plasma membrane H+-ATPase                               213   1e-61   
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like           213   1e-61   
ref|XP_003525017.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    213   1e-61   
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                    213   1e-61   
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like     213   1e-61   
ref|XP_002466646.1|  hypothetical protein SORBIDRAFT_01g011610          212   1e-61   
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type         213   1e-61   
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    213   1e-61   
ref|XP_009398402.1|  PREDICTED: plasma membrane ATPase 1-like           213   1e-61   
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             213   1e-61   
gb|AAV44084.1|  putative plasma membrane H+ ATPase                      213   1e-61   
ref|XP_003578172.1|  PREDICTED: plasma membrane ATPase 1                213   1e-61   
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                213   1e-61   
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             213   1e-61   
emb|CAA59799.1|  H(+)-transporting ATPase                               213   1e-61   
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         213   1e-61   
ref|XP_008776221.1|  PREDICTED: ATPase 8, plasma membrane-type-like     213   1e-61   
gb|KHN15309.1|  Plasma membrane ATPase 4                                213   1e-61   
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           213   1e-61   
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             213   1e-61   
gb|AAB84202.2|  plasma membrane proton ATPase                           213   1e-61   
dbj|BAC77531.1|  plasma membrane H+-ATPase                              213   1e-61   
gb|KHN22686.1|  Plasma membrane ATPase 4                                213   1e-61   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             213   2e-61   
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             213   2e-61   
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    213   2e-61   
ref|XP_002864812.1|  AHA11-ATPASE 11                                    213   2e-61   
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          213   2e-61   
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like    213   2e-61   
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    213   2e-61   
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like           213   2e-61   
ref|XP_008453171.1|  PREDICTED: plasma membrane ATPase 3                213   2e-61   
ref|XP_002324397.1|  H+-ATPase family protein                           213   2e-61   
ref|NP_201073.1|  H(+)-ATPase 11                                        213   2e-61   
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    213   2e-61   
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    213   2e-61   
gb|EEC69747.1|  hypothetical protein OsI_39279                          213   2e-61   
gb|EAZ21357.1|  hypothetical protein OsJ_37014                          213   2e-61   
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          213   2e-61   
emb|CDP14881.1|  unnamed protein product                                213   2e-61   
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     213   2e-61   
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like             213   2e-61   
ref|XP_003549657.1|  PREDICTED: ATPase 11, plasma membrane-type-like    213   2e-61   
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           213   2e-61   
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    213   2e-61   
dbj|BAD16684.1|  plasma membrane H+-ATPase                              213   2e-61   
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    213   2e-61   
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             213   2e-61   
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           213   2e-61   
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           213   2e-61   
gb|KEH39757.1|  plasma membrane H+-ATPase                               212   2e-61   
gb|AAA98916.1|  Theoretical protein with similarity to Swiss-Prot...    212   2e-61   
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                213   2e-61   
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg             213   2e-61   
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    213   2e-61   
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    213   2e-61   
ref|NP_001169274.1|  uncharacterized protein LOC100383137               213   2e-61   
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like             213   2e-61   
gb|EEC78976.1|  hypothetical protein OsI_19456                          213   2e-61   
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           213   2e-61   
ref|XP_006597964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     212   2e-61   
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           213   2e-61   
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          213   2e-61   
ref|XP_009398401.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     213   2e-61   
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4                212   2e-61   
gb|KGN65469.1|  hypothetical protein Csa_1G423270                       212   2e-61   
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           213   2e-61   
ref|XP_004171391.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 4, pl...    213   2e-61   
ref|XP_004138147.1|  PREDICTED: ATPase 4, plasma membrane-type-like     213   2e-61   
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1     213   2e-61   
gb|EEC81667.1|  hypothetical protein OsI_25220                          213   2e-61   
dbj|BAC77532.1|  plasma membrane H+-ATPase                              213   2e-61   
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                213   2e-61   
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like           213   2e-61   
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             213   2e-61   
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         213   2e-61   
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      213   2e-61   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    213   2e-61   
ref|NP_001059093.1|  Os07g0191200                                       213   2e-61   
ref|XP_006382164.1|  H+-ATPase family protein                           213   2e-61   
ref|XP_007138427.1|  hypothetical protein PHAVU_009G208000g             212   2e-61   
ref|NP_001234775.1|  plasma membrane ATPase 1                           213   2e-61   
gb|AFC88896.1|  plasma membrane H+-ATPase                               213   2e-61   
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    213   2e-61   
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    213   2e-61   
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...    213   2e-61   
gb|KHN18251.1|  ATPase 8, plasma membrane-type                          212   2e-61   
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    213   2e-61   
ref|NP_001067382.1|  Os12g0638700                                       213   2e-61   
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                213   2e-61   
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    213   2e-61   
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           213   2e-61   
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                213   2e-61   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             213   2e-61   
ref|NP_001234477.1|  plasma membrane H+-ATPase                          213   2e-61   
gb|AAA34052.1|  H+-translocating ATPase                                 213   2e-61   
gb|ABA18090.1|  putative plasma membrane ATPase                         213   2e-61   
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    213   2e-61   
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    213   2e-61   
ref|XP_008677590.1|  PREDICTED: uncharacterized protein LOC100383...    213   2e-61   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             213   2e-61   
emb|CDY47940.1|  BnaA02g08160D                                          213   2e-61   
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                213   2e-61   
ref|XP_010094202.1|  Plasma membrane ATPase 4                           213   2e-61   
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           213   2e-61   
dbj|BAA37150.1|  p-type H+-ATPase                                       212   2e-61   
ref|XP_002304716.2|  H+-ATPase family protein                           213   2e-61   
dbj|BAO45902.1|  plasma membrane H+-ATPase                              212   2e-61   
gb|KHN17608.1|  Plasma membrane ATPase 4                                212   2e-61   
gb|ABW25091.1|  plasma membrane proton pump                             212   2e-61   
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type          212   2e-61   
ref|XP_004966679.1|  PREDICTED: ATPase 6, plasma membrane-type-like     212   2e-61   
gb|KHN01287.1|  Plasma membrane ATPase 4                                212   2e-61   
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             212   2e-61   
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             212   2e-61   
ref|XP_002517457.1|  H(\+)-transporting atpase plant/fungi plasma...    211   2e-61   
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    212   2e-61   
emb|CAB69823.1|  plasma membrane H+ ATPase                              212   2e-61   
emb|CDY38294.1|  BnaA10g11420D                                          212   2e-61   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             212   2e-61   
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4                212   2e-61   
ref|XP_011082991.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    212   2e-61   
emb|CDY25913.1|  BnaC09g32850D                                          212   2e-61   
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    212   2e-61   
ref|NP_189850.1|  H(+)-ATPase 8                                         212   2e-61   
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     212   2e-61   
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    212   2e-61   
gb|EMT31912.1|  Plasma membrane ATPase 1                                213   3e-61   
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   212   3e-61   
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like           212   3e-61   
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                212   3e-61   
dbj|BAD16688.1|  plasma membrane H+-ATPase                              212   3e-61   
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                212   3e-61   
ref|XP_002459147.1|  hypothetical protein SORBIDRAFT_03g046720          212   3e-61   
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    212   3e-61   
ref|NP_001055186.1|  Os05g0319800                                       213   3e-61   
ref|XP_002452983.1|  hypothetical protein SORBIDRAFT_04g036040          212   3e-61   
ref|XP_011034499.1|  PREDICTED: plasma membrane ATPase 4-like           212   3e-61   
gb|AAY42948.1|  plasma membrane H+ ATPase                               212   3e-61   
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             212   3e-61   
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                212   3e-61   
emb|CAN64375.1|  hypothetical protein VITISV_014422                     212   3e-61   
ref|XP_006838797.1|  hypothetical protein AMTR_s00002p00260210          212   3e-61   
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    212   3e-61   
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    212   3e-61   
ref|XP_004508788.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    212   3e-61   
gb|KCW83495.1|  hypothetical protein EUGRSUZ_B00400                     212   3e-61   
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     212   3e-61   
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          212   3e-61   
ref|XP_002465931.1|  hypothetical protein SORBIDRAFT_01g048440          212   3e-61   
ref|XP_007032428.1|  H(+)-ATPase 4 isoform 2                            212   3e-61   
ref|XP_010028675.1|  PREDICTED: ATPase 11, plasma membrane-type         212   3e-61   
ref|NP_190378.2|  H(+)-ATPase 4                                         212   3e-61   
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           212   3e-61   
dbj|BAA08134.1|  putative plasma membrane H+-ATPase                     212   3e-61   
gb|KEH24965.1|  plasma membrane H+-ATPase                               212   3e-61   
gb|KEH24964.1|  plasma membrane H+-ATPase                               212   4e-61   
gb|EMT09250.1|  ATPase 8, plasma membrane-type                          210   4e-61   
ref|XP_006482527.1|  PREDICTED: plasma membrane ATPase 1-like           212   4e-61   
ref|XP_004955721.1|  PREDICTED: plasma membrane ATPase 1-like           212   4e-61   
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         212   4e-61   
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like           213   4e-61   
gb|ABJ53212.1|  plasma membrane H+ ATPase                               196   4e-61   
ref|XP_004508787.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    212   4e-61   
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like    212   4e-61   
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   212   4e-61   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                212   4e-61   
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg             212   4e-61   
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     212   4e-61   
ref|XP_006401213.1|  hypothetical protein EUTSA_v10015530mg             211   4e-61   
gb|KFK32649.1|  hypothetical protein AALP_AA6G270500                    211   4e-61   
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...    212   4e-61   
ref|XP_003554288.1|  PREDICTED: plasma membrane ATPase 1-like           212   4e-61   
emb|CAC29436.1|  P-type H+-ATPase                                       211   4e-61   
gb|KHN34200.1|  ATPase 11, plasma membrane-type                         212   4e-61   
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           211   4e-61   
gb|EPS57651.1|  hypothetical protein M569_17165                         211   4e-61   
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           211   4e-61   
dbj|BAD16685.1|  plasma membrane H+-ATPase                              211   5e-61   
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                211   5e-61   
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    211   5e-61   
dbj|BAM20991.1|  plasma membrane H+-ATPase                              211   5e-61   
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4                211   5e-61   
ref|XP_008644894.1|  PREDICTED: uncharacterized protein LOC100383...    211   5e-61   
gb|EPS66977.1|  hypothetical protein M569_07799                         211   5e-61   
emb|CAC50884.1|  plasma membrane H+-ATPase                              209   5e-61   
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3                211   5e-61   
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                211   5e-61   
emb|CDO97775.1|  unnamed protein product                                211   5e-61   
ref|XP_002282263.1|  PREDICTED: ATPase 4, plasma membrane-type          211   5e-61   
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                211   5e-61   
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...    211   5e-61   
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     211   5e-61   
gb|AAQ55291.1|  plasma membrane H+-ATPase                               211   6e-61   
ref|XP_002297804.2|  H+-ATPase family protein                           211   6e-61   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                211   6e-61   
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         211   6e-61   
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like           211   6e-61   



>emb|CBN72504.1| putative autoinhibited H+ ATPase [Populus x canadensis]
Length=246

 Score =   213 bits (543),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  92   KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  151

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF  +ALIWKFDF+PFMV
Sbjct  152  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMV  211

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  212  LIIAILNDGTIMTI  225



>gb|AAF27113.1|AC018849_1 aha9, 5' partial; 1-2403 [Arabidopsis thaliana]
Length=612

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  220  KADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  279

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  280  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLLALIWKFDFSPFMV  339

Query  362  LIVAVLNDGTIMTI  403
            LIVA+LNDGTIMTI
Sbjct  340  LIVAILNDGTIMTI  353



>ref|NP_001169998.1| uncharacterized protein LOC100383904 [Zea mays]
 gb|ACN35480.1| unknown [Zea mays]
Length=404

 Score =   214 bits (545),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  12   KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  71

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+AL+WKFDF+PFMV
Sbjct  72   DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALVWKFDFAPFMV  131

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  132  LIIAILNDGTIMTI  145



>gb|AAA81348.1| p-type H+-ATPase, partial [Vicia faba]
Length=373

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  224  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  283

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF  +ALIWKFDFSPFMV
Sbjct  284  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMV  343

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  344  LIIAILNDGTIMTI  357



>dbj|BAF01699.1| plasma membrane ATPase 3 [Arabidopsis thaliana]
Length=397

 Score =   214 bits (544),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  6    KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  65

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  66   DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  125

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  126  LIIAILNDGTIMTI  139



>ref|NP_001136587.1| uncharacterized protein LOC100216710 [Zea mays]
 gb|ACF82226.1| unknown [Zea mays]
Length=422

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVAD+TDAARSAS
Sbjct  27   KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADSTDAARSAS  86

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  87   DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  146

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  147  LIIAILNDGTIMTI  160



>tpg|DAA59899.1| TPA: membrane H(+)-ATPase1 [Zea mays]
Length=426

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVAD+TDAARSAS
Sbjct  31   KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADSTDAARSAS  90

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  91   DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  150

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  151  LIIAILNDGTIMTI  164



>tpg|DAA59901.1| TPA: membrane H(+)-ATPase1 [Zea mays]
Length=444

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVAD+TDAARSAS
Sbjct  49   KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADSTDAARSAS  108

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  109  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  168

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  169  LIIAILNDGTIMTI  182



>gb|AAA34096.1| plasma membrane H+ ATPase, partial [Nicotiana plumbaginifolia]
Length=440

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  45   KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  104

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  105  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  164

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  165  LIIAILNDGTIMTI  178



>dbj|BAO02511.1| predicted H+ ATPase ortholog [Nicotiana alata]
Length=652

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE NHICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  261  KADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  320

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF L+ALIWKFDFSPFMV
Sbjct  321  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFMLIALIWKFDFSPFMV  380

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  381  LIIAILNDGTIMTI  394



>dbj|BAG55917.1| H+-ATPase [Mimosa pudica]
Length=349

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  32   KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  91

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV GF  +ALIWKFDF+PFMV
Sbjct  92   DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMV  151

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  152  LIIAILNDGTIMTI  165



>gb|EPS59184.1| hypothetical protein M569_15622, partial [Genlisea aurea]
Length=522

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  130  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  189

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  190  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMV  249

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  250  LIIAILNDGTIMTI  263



>dbj|BAM20992.1| plasma membrane H+-ATPase, partial [Marchantia polymorpha]
Length=460

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  69   KADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  128

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+ AVLTSRAIFQRMKNYTIYAVSITIRIV+GF LL LIWKFDFSPFMV
Sbjct  129  DIVLTEPGLSVIIHAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLLTLIWKFDFSPFMV  188

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  189  LIIAILNDGTIMTI  202



>gb|EMS46830.1| ATPase 9, plasma membrane-type [Triticum urartu]
Length=677

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQEM HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  438  KADGFAGVFPEHKYEIVRRLQEMKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  497

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDF+PFMV
Sbjct  498  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGFLLLALIWKFDFAPFMV  557

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  558  LIIAILNDGTIMTI  571



>ref|NP_178181.1| H(+)-ATPase 9 [Arabidopsis thaliana]
 sp|Q42556.2|PMA9_ARATH RecName: Full=ATPase 9, plasma membrane-type; AltName: Full=Proton 
pump 9 [Arabidopsis thaliana]
 gb|AAF14653.1|AC011713_1 Identical to gb|X73676 aha9 (ATAHA9) ATPase gene from Arabidopsis 
thaliana [Arabidopsis thaliana]
 gb|AEE36433.1| H(+)-ATPase 9 [Arabidopsis thaliana]
Length=954

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLLALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LIVA+LNDGTIMTI
Sbjct  682  LIVAILNDGTIMTI  695



>ref|NP_001185450.1| H(+)-ATPase 9 [Arabidopsis thaliana]
 gb|AEE36434.1| H(+)-ATPase 9 [Arabidopsis thaliana]
Length=945

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  553  KADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  612

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  613  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLLALIWKFDFSPFMV  672

Query  362  LIVAVLNDGTIMTI  403
            LIVA+LNDGTIMTI
Sbjct  673  LIVAILNDGTIMTI  686



>emb|CDP14275.1| unnamed protein product [Coffea canephora]
Length=635

 Score =   216 bits (551),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  244  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  303

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  304  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMV  363

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  364  LIIAILNDGTIMTI  377



>ref|XP_002527322.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF35074.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=733

 Score =   218 bits (554),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  342  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  401

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  402  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLLALIWKFDFSPFMV  461

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  462  LIIAILNDGTIMTI  475



>ref|XP_010097155.1| ATPase 9, plasma membrane-type [Morus notabilis]
 gb|EXB67222.1| ATPase 9, plasma membrane-type [Morus notabilis]
Length=878

 Score =   219 bits (557),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE NHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  485  KADGFAGVFPEHKYEIVKKLQEKNHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  544

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  545  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLLALIWKFDFSPFMV  604

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  605  LIIAILNDGTIMTI  618



>dbj|BAM20988.1| plasma membrane H+-ATPase, partial [Marchantia polymorpha]
Length=484

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  88   KADGFAGVFPEHKYEIVKRLQAKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  147

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  148  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMV  207

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  208  LVIAILNDGTIMTI  221



>ref|XP_003542615.1| PREDICTED: ATPase 8, plasma membrane-type-like isoformX1 [Glycine 
max]
Length=947

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLVALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_011078615.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X2 [Sesamum 
indicum]
Length=932

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE NHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFLLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+AVLNDGTIMTI
Sbjct  680  LIIAVLNDGTIMTI  693



>ref|XP_003549696.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform 1 [Glycine 
max]
Length=947

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLVALIWRFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_006594226.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X2 [Glycine 
max]
Length=861

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLVALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>gb|KGN65225.1| hypothetical protein Csa_1G267210 [Cucumis sativus]
Length=778

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE NHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  389  KADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  448

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  449  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLVALIWKFDFSPFMV  508

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  509  LIIAILNDGTIMTI  522



>ref|XP_011078614.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X1 [Sesamum 
indicum]
Length=952

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE NHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFLLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+AVLNDGTIMTI
Sbjct  680  LIIAVLNDGTIMTI  693



>gb|ACC62036.1| plasma membrane H+ ATPase [Suaeda maritima]
Length=132

 Score =   201 bits (512),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  20   GVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasdiVLTE  199
            GVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTE
Sbjct  1    GVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTE  60

Query  200  PGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVLIVAVL  379
            PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMVLI+A+L
Sbjct  61   PGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMVLIIAIL  120

Query  380  NDGTIMTI  403
            NDGTIMTI
Sbjct  121  NDGTIMTI  128



>ref|XP_009587248.1| PREDICTED: ATPase 9, plasma membrane-type [Nicotiana tomentosiformis]
Length=951

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE NHICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>gb|EMT29166.1| ATPase 8, plasma membrane-type [Aegilops tauschii]
Length=812

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQEM HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  496  KADGFAGVFPEHKYEIVRRLQEMKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  555

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDF+PFMV
Sbjct  556  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGFLLLALIWKFDFAPFMV  615

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  616  LIIAILNDGTIMTI  629



>gb|AAR32129.2| proton P-ATPase [Nicotiana tabacum]
Length=951

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE NHICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_006848753.1| hypothetical protein AMTR_s00026p00031590 [Amborella trichopoda]
 gb|ERN10334.1| hypothetical protein AMTR_s00026p00031590 [Amborella trichopoda]
Length=438

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  133  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  192

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DI+LTEPGLSVIV AVLTSRAIFQRMKNYTIYAVSITIR+V+GF L+ALIWKFDFSPFM+
Sbjct  193  DIILTEPGLSVIVGAVLTSRAIFQRMKNYTIYAVSITIRMVLGFMLIALIWKFDFSPFMI  252

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  253  LVIAILNDGTIMTI  266



>ref|XP_009766358.1| PREDICTED: ATPase 8, plasma membrane-type [Nicotiana sylvestris]
Length=951

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE NHICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_008443886.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis melo]
Length=948

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE NHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLVALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>ref|XP_004146701.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004165941.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=948

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE NHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLVALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>ref|XP_010047150.1| PREDICTED: ATPase 8, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW78971.1| hypothetical protein EUGRSUZ_C00401 [Eucalyptus grandis]
Length=950

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE NHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  561  KADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  621  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMV  680

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  681  LIIAILNDGTIMTI  694



>dbj|BAM20990.1| plasma membrane H+-ATPase [Marchantia polymorpha]
Length=954

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  563  KADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  622

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  623  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLLALIWKFDFSPFMV  682

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  683  LIIAILNDGTIMTI  696



>gb|ACC62037.1| Salt7 plasma membrane H+ ATPase [Suaeda maritima]
Length=132

 Score =   201 bits (510),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 124/128 (97%), Gaps = 0/128 (0%)
 Frame = +2

Query  20   GVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasdiVLTE  199
            GVFPEHKYEIVK+LQE NHI GMTGDGVNDAPALKKADIGIAV DATDAARSASDIVLTE
Sbjct  1    GVFPEHKYEIVKKLQEKNHIVGMTGDGVNDAPALKKADIGIAVDDATDAARSASDIVLTE  60

Query  200  PGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVLIVAVL  379
            PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWK+DFSPFMVLI+A+L
Sbjct  61   PGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKYDFSPFMVLIIAIL  120

Query  380  NDGTIMTI  403
            NDGTIMTI
Sbjct  121  NDGTIMTI  128



>ref|XP_003547446.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE +HICGMTGDGVNDAPALK+ADIGIAVADATDAAR AS
Sbjct  557  KADGFAGVFPEHKYEIVKRLQERDHICGMTGDGVNDAPALKRADIGIAVADATDAARGAS  616

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  617  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMV  676

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  677  LIIAILNDGTIMTI  690



>emb|CDX87330.1| BnaA07g35430D [Brassica napus]
Length=861

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  470  ADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  529

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMVL
Sbjct  530  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFMLLALIWKFDFSPFMVL  589

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  590  VIAILNDGTIMTI  602



>emb|CDY39956.1| BnaC06g40340D [Brassica napus]
Length=861

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  470  ADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  529

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMVL
Sbjct  530  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFMLLALIWKFDFSPFMVL  589

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  590  VIAILNDGTIMTI  602



>gb|KHN22411.1| ATPase 9, plasma membrane-type [Glycine soja]
Length=916

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE +HICGMTGDGVNDAPALK+ADIGIAVADATDAAR AS
Sbjct  524  KADGFAGVFPEHKYEIVKRLQERDHICGMTGDGVNDAPALKRADIGIAVADATDAARGAS  583

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  584  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMV  643

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  644  LIIAILNDGTIMTI  657



>gb|KDP38637.1| hypothetical protein JCGZ_03990 [Jatropha curcas]
Length=930

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            +ADGFAGVFPEHKYEIVK+LQEM HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  559  RADGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLVALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+AVLNDGTIMTI
Sbjct  679  LIIAVLNDGTIMTI  692



>ref|XP_002523524.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF38863.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=747

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  357  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  416

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  417  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLVALIWKFDFSPFMV  476

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  477  LIIAILNDGTIMTI  490



>gb|KDO67285.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=847

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>gb|EEE65209.1| hypothetical protein OsJ_20350 [Oryza sativa Japonica Group]
Length=798

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            +ADGFAGVFPEHKYEIVKRLQEM+HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  488  RADGFAGVFPEHKYEIVKRLQEMSHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  547

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+A+IWKFDF+PFMV
Sbjct  548  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIAIIWKFDFAPFMV  607

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  608  LIIAILNDGTIMTI  621



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =   216 bits (551),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  493  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  552

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  553  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  612

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  613  LIIAILNDGTIMTI  626



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+ NHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  561  KADGFAGVFPEHKYEIVKRLQQRNHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIV AVLTSRAIFQRMKNYTIYAVSITIRIV GF LLALIWKFDFSPFMV
Sbjct  621  DIVLTEPGLSVIVCAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLLALIWKFDFSPFMV  680

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  681  LIIAILNDGTIMTI  694



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  558  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  618  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>gb|KDO67282.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=923

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_001771404.1| predicted protein [Physcomitrella patens]
 gb|EDQ63794.1| predicted protein [Physcomitrella patens]
Length=511

 Score =   211 bits (538),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HI GMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  297  KADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGIAVADATDAARSAS  356

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSR+IFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  357  DIVLTEPGLSVIISAVLTSRSIFQRMKNYTIYAVSITIRIVLGFLLLALIWKFDFSPFMV  416

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  417  LIIAILNDGTIMTI  430



>gb|KHN22097.1| ATPase 8, plasma membrane-type [Glycine soja]
Length=1183

 Score =   218 bits (556),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 128/134 (96%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLVALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_009106729.1| PREDICTED: ATPase 9, plasma membrane-type [Brassica rapa]
Length=954

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  563  ADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  622

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMVL
Sbjct  623  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFMLLALIWKFDFSPFMVL  682

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  683  VIAILNDGTIMTI  695



>ref|NP_001056980.1| Os06g0181500 [Oryza sativa Japonica Group]
 dbj|BAD72313.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
 dbj|BAD72570.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
 dbj|BAF18894.1| Os06g0181500 [Oryza sativa Japonica Group]
Length=859

 Score =   216 bits (550),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            +ADGFAGVFPEHKYEIVKRLQEM+HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  559  RADGFAGVFPEHKYEIVKRLQEMSHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+A+IWKFDF+PFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIAIIWKFDFAPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>ref|XP_006665055.1| PREDICTED: plasma membrane ATPase-like, partial [Oryza brachyantha]
Length=897

 Score =   216 bits (550),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  525  KADGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  584

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFM+
Sbjct  585  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMI  644

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  645  LIIAILNDGTIMTI  658



>ref|XP_006648697.1| PREDICTED: plasma membrane ATPase-like [Oryza brachyantha]
Length=936

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  564  KADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  623

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSR+IFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFM+
Sbjct  624  DIVLTEPGLSVIISAVLTSRSIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMI  683

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  684  LIIAILNDGTIMTI  697



>ref|XP_002324564.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEF03129.1| ATPase 6 family protein [Populus trichocarpa]
Length=949

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQEM HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  559  KADGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>emb|CAD29316.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=865

 Score =   216 bits (550),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            +ADGFAGVFPEHKYEIVKRLQEM+HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  555  RADGFAGVFPEHKYEIVKRLQEMSHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  614

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+A+IWKFDF+PFMV
Sbjct  615  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIAIIWKFDFAPFMV  674

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  675  LIIAILNDGTIMTI  688



>ref|XP_006389820.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
 gb|ESQ27106.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
Length=953

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  562  ADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  621

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMVL
Sbjct  622  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFLLLALIWKFDFSPFMVL  681

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  682  VIAILNDGTIMTI  694



>ref|XP_006300372.1| hypothetical protein CARUB_v10022427mg [Capsella rubella]
 gb|EOA33270.1| hypothetical protein CARUB_v10022427mg [Capsella rubella]
Length=955

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  564  ADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  623

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMVL
Sbjct  624  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFMLLALIWKFDFSPFMVL  683

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  684  VIAILNDGTIMTI  696



>ref|XP_010537896.1| PREDICTED: ATPase 9, plasma membrane-type [Tarenaya hassleriana]
Length=994

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  601  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  660

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF+PFMV
Sbjct  661  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLLALIWKFDFAPFMV  720

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  721  LIIAILNDGTIMTI  734



>ref|XP_010472896.1| PREDICTED: ATPase 9, plasma membrane-type isoform X3 [Camelina 
sativa]
 ref|XP_010472897.1| PREDICTED: ATPase 9, plasma membrane-type isoform X4 [Camelina 
sativa]
Length=955

 Score =   216 bits (551),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  563  ADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  622

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMVL
Sbjct  623  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFLLLALIWKFDFSPFMVL  682

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  683  VIAILNDGTIMTI  695



>gb|EYU24620.1| hypothetical protein MIMGU_mgv1a001404mg [Erythranthe guttata]
Length=825

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQEM HICGMTGDGVNDAPALKKADIGIAV DATDAAR AS
Sbjct  433  KADGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIAVDDATDAARGAS  492

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  493  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  552

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  553  LIIAILNDGTIMTI  566



>gb|KFK42449.1| hypothetical protein AALP_AA2G258100 [Arabis alpina]
Length=953

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  562  ADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  621

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMVL
Sbjct  622  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFMLLALIWKFDFSPFMVL  681

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  682  VIAILNDGTIMTI  694



>ref|XP_006343688.1| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum tuberosum]
Length=951

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQ+M HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQDMKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>gb|ACN49187.1| plasma membrane ATPase 1-like protein [Triticum aestivum]
Length=620

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  225  KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  284

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  285  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  344

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  345  LIIAILNDGTIMTI  358



>dbj|BAD72314.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
 dbj|BAD72571.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
 gb|EAY99917.1| hypothetical protein OsI_21917 [Oryza sativa Indica Group]
Length=869

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            +ADGFAGVFPEHKYEIVKRLQEM+HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  559  RADGFAGVFPEHKYEIVKRLQEMSHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+A+IWKFDF+PFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIAIIWKFDFAPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>emb|CDX79363.1| BnaC06g19400D [Brassica napus]
Length=864

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  489  ADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  548

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWK+DFSPFMVL
Sbjct  549  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVLGFMLLALIWKYDFSPFMVL  608

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  609  VIAILNDGTIMTI  621



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=954

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALK+ADIGIAV DATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKRADIGIAVDDATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGFLLLALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+AVLNDGTIMTI
Sbjct  682  LIIAVLNDGTIMTI  695



>dbj|BAF03589.1| P-type H+-ATPase [Zostera marina]
Length=964

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  561  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  621  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMV  680

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  681  LIIAILNDGTIMTI  694



>ref|XP_009419963.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  564  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  623

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  624  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIALIWRFDFSPFMV  683

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  684  LIIAILNDGTIMTI  697



>gb|KDO67283.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
 gb|KDO67284.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=883

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>gb|KGN64262.1| hypothetical protein Csa_1G045600 [Cucumis sativus]
Length=762

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ M HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  367  KADGFAGVFPEHKYEIVKRLQAMKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  426

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  427  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  486

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  487  LIIAILNDGTIMTI  500



>ref|XP_011084028.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  561  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  621  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMV  680

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  681  LIIAILNDGTIMTI  694



>gb|ABR15780.1| plasma membrane H+ ATPase [Oryza sativa Indica Group]
Length=132

 Score =   199 bits (507),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  20   GVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasdiVLTE  199
            GVFPEHKYEIVK+LQE  HI GMTGDGVNDAPALKKADIGIAV DATDAARSASDIVLTE
Sbjct  1    GVFPEHKYEIVKKLQEKKHIVGMTGDGVNDAPALKKADIGIAVDDATDAARSASDIVLTE  60

Query  200  PGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVLIVAVL  379
            PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMVLI+A+L
Sbjct  61   PGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAIL  120

Query  380  NDGTIMTI  403
            NDGTIMTI
Sbjct  121  NDGTIMTI  128



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>ref|XP_007150788.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
 gb|ESW22782.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
Length=949

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALK+ADIGIAVADATDAAR AS
Sbjct  557  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARGAS  616

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMV
Sbjct  617  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVLGFLLLALIWKFDFSPFMV  676

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  677  LIIAILNDGTIMTI  690



>gb|ABW74139.1| plasma membrane H(+) ATPase [Oryza sativa Indica Group]
Length=132

 Score =   199 bits (507),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 123/128 (96%), Gaps = 0/128 (0%)
 Frame = +2

Query  20   GVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasdiVLTE  199
            GVFPEHKYEIVK+LQE  HI GMTGDGVNDAPALKKADIGIAV DATDAARSASDIVLTE
Sbjct  1    GVFPEHKYEIVKKLQEKKHIVGMTGDGVNDAPALKKADIGIAVDDATDAARSASDIVLTE  60

Query  200  PGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVLIVAVL  379
            PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMVLI+A+L
Sbjct  61   PGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAIL  120

Query  380  NDGTIMTI  403
            NDGTIMTI
Sbjct  121  NDGTIMTI  128



>ref|XP_004287218.1| PREDICTED: ATPase 8, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=948

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALK+ADIGIAV DATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVDDATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGF LLALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFMLLALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  679  LVIAILNDGTIMTI  692



>gb|KEH19962.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=949

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>emb|CDX67957.1| BnaA07g19970D [Brassica napus]
Length=895

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  503  ADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  562

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWK+DFSPFMVL
Sbjct  563  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVLGFMLLALIWKYDFSPFMVL  622

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  623  VIAILNDGTIMTI  635



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  558  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  618  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>gb|KHN31888.1| ATPase 9, plasma membrane-type [Glycine soja]
Length=841

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALK+ADIGIAVADATDAAR AS
Sbjct  449  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRADIGIAVADATDAARGAS  508

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  509  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMV  568

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  569  LIIAILNDGTIMTI  582



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  558  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  618  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  678  LVIAILNDGTIMTI  691



>gb|KGN62872.1| hypothetical protein Csa_2G378540 [Cucumis sativus]
Length=546

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  360  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  419

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF  +ALIWKFDF+PFMV
Sbjct  420  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMV  479

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  480  LIIAILNDGTIMTI  493



>gb|KEH37844.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=903

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLVALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_010472895.1| PREDICTED: ATPase 9, plasma membrane-type isoform X2 [Camelina 
sativa]
Length=967

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  602  ADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  661

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMVL
Sbjct  662  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFLLLALIWKFDFSPFMVL  721

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  722  VIAILNDGTIMTI  734



>gb|EYU31795.1| hypothetical protein MIMGU_mgv1a000883mg [Erythranthe guttata]
Length=951

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  560  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+AL+WKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLIALLWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  558  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  618  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>ref|XP_010472893.1| PREDICTED: ATPase 9, plasma membrane-type isoform X1 [Camelina 
sativa]
Length=994

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  602  ADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  661

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMVL
Sbjct  662  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFLLLALIWKFDFSPFMVL  721

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  722  VIAILNDGTIMTI  734



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  558  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  618  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>gb|KHG26452.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV++LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  264  KADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  323

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  324  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  383

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  384  LIIAILNDGTIMTI  397



>ref|XP_011084026.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>emb|CAN61424.1| hypothetical protein VITISV_027272 [Vitis vinifera]
Length=967

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  575  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  634

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  635  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  694

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  695  LIIAILNDGTIMTI  708



>gb|KGN60742.1| hypothetical protein Csa_2G009310 [Cucumis sativus]
Length=814

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  450  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  509

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  510  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMV  569

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  570  LIIAILNDGTIMTI  583



>ref|XP_009104474.1| PREDICTED: ATPase 9, plasma membrane-type [Brassica rapa]
Length=954

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  563  ADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  622

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWK+DFSPFMVL
Sbjct  623  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVLGFMLLALIWKYDFSPFMVL  682

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  683  VIAILNDGTIMTI  695



>gb|ACN34067.1| unknown [Zea mays]
Length=698

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVAD+TDAARSAS
Sbjct  303  KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADSTDAARSAS  362

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  363  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  422

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  423  LIIAILNDGTIMTI  436



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>gb|KGN52915.1| hypothetical protein Csa_4G006220 [Cucumis sativus]
Length=890

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  498  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  557

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  558  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  617

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  618  LIIAILNDGTIMTI  631



>ref|XP_009341818.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Pyrus x 
bretschneideri]
Length=939

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  551  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  610

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGF L+ALIWKFDFSPFMV
Sbjct  611  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFMLVALIWKFDFSPFMV  670

Query  362  LIVAVLNDGTIMTI  403
            L++AVLNDGTIMTI
Sbjct  671  LVIAVLNDGTIMTI  684



>ref|XP_004488894.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cicer arietinum]
Length=947

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_004152442.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004157811.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
Length=956

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ M HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  561  KADGFAGVFPEHKYEIVKRLQAMKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  621  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  680

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  681  LIIAILNDGTIMTI  694



>ref|XP_004486623.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=949

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALK+ADIGIAVADATDAAR AS
Sbjct  557  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRADIGIAVADATDAARGAS  616

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  617  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLLALIWKFDFSPFMV  676

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  677  LIIAILNDGTIMTI  690



>ref|XP_003543699.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALK+ADIGIAVADATDAAR AS
Sbjct  557  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRADIGIAVADATDAARGAS  616

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMV
Sbjct  617  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMV  676

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  677  LIIAILNDGTIMTI  690



>ref|XP_002437958.1| hypothetical protein SORBIDRAFT_10g005500 [Sorghum bicolor]
 gb|EER89325.1| hypothetical protein SORBIDRAFT_10g005500 [Sorghum bicolor]
Length=874

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+ NHICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  557  KADGFAGVFPEHKYEIVKRLQDRNHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  616

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSR+IFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDF+PFMV
Sbjct  617  DIVLTEPGLSVIVSAVLTSRSIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFAPFMV  676

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  677  LIIAILNDGTIMTI  690



>gb|KHF98166.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=663

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  267  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  326

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF  +ALIWKFDF+PFMV
Sbjct  327  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMV  386

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  387  LIIAILNDGTIMTI  400



>ref|XP_010049874.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=942

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  552  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  611

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  612  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMV  671

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  672  LIIAILNDGTIMTI  685



>ref|XP_011084023.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  559  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>gb|KHG19606.1| ATPase 5, plasma membrane-type -like protein [Gossypium arboreum]
Length=659

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  267  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  326

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF  +ALIWKFDF+PFMV
Sbjct  327  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMV  386

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  387  LIIAILNDGTIMTI  400



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  559  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  558  KADGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  618  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFALIALIWKFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>ref|XP_007012006.1| H(+)-ATPase 8 [Theobroma cacao]
 gb|EOY29625.1| H(+)-ATPase 8 [Theobroma cacao]
Length=951

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLVALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>emb|CAN78639.1| hypothetical protein VITISV_031738 [Vitis vinifera]
Length=958

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  566  KADGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  625

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  626  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFALIALIWKFDFSPFMV  685

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  686  LIIAILNDGTIMTI  699



>ref|XP_010049873.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW82682.1| hypothetical protein EUGRSUZ_C04061 [Eucalyptus grandis]
Length=951

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  561  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  621  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMV  680

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  681  LIIAILNDGTIMTI  694



>ref|XP_008384624.1| PREDICTED: ATPase 8, plasma membrane-type [Malus domestica]
Length=947

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFMLVALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            L++AVLNDGTIMTI
Sbjct  679  LVIAVLNDGTIMTI  692



>ref|XP_008437674.1| PREDICTED: ATPase 11, plasma membrane-type [Cucumis melo]
Length=956

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ M HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  561  KADGFAGVFPEHKYEIVKRLQAMKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  621  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  680

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  681  LIIAILNDGTIMTI  694



>ref|XP_004159431.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 8, plasma membrane-type-like, 
partial [Cucumis sativus]
Length=903

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  539  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  598

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  599  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMV  658

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  659  LIIAILNDGTIMTI  672



>emb|CBI35956.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFALIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>gb|EMT25011.1| Plasma membrane ATPase [Aegilops tauschii]
Length=978

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQ+M HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  583  KADGFAGVFPEHKYEIVKKLQQMKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  642

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFM+
Sbjct  643  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMI  702

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  703  LVIAILNDGTIMTI  716



>ref|XP_009341817.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009341823.1| PREDICTED: ATPase 8, plasma membrane-type [Pyrus x bretschneideri]
Length=947

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFMLVALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            L++AVLNDGTIMTI
Sbjct  679  LVIAVLNDGTIMTI  692



>ref|XP_004139271.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=923

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  559  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAV+DATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVSDATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_009366133.1| PREDICTED: ATPase 8, plasma membrane-type-like [Pyrus x bretschneideri]
Length=947

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFMLVALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            L++AVLNDGTIMTI
Sbjct  679  LVIAVLNDGTIMTI  692



>ref|XP_011084027.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_006419170.1| hypothetical protein EUTSA_v10002391mg [Eutrema salsugineum]
 gb|ESQ37606.1| hypothetical protein EUTSA_v10002391mg [Eutrema salsugineum]
Length=948

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GFTL+ALIW+FDF+PFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFTLVALIWRFDFAPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_002515334.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF46783.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=734

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  342  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  401

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF  +ALIWKFDFSPFMV
Sbjct  402  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMV  461

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  462  LIIAILNDGTIMTI  475



>gb|KHG28536.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  264  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  323

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF  +ALIWKFDFSPFMV
Sbjct  324  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMV  383

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  384  LIIAILNDGTIMTI  397



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV++LQE+ HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  558  KADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  618  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLIALIWKFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>ref|XP_008658955.1| PREDICTED: uncharacterized protein LOC100501185 isoform X1 [Zea 
mays]
 gb|AFW85572.1| hypothetical protein ZEAMMB73_839541 [Zea mays]
Length=857

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+ NHICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  557  KADGFAGVFPEHKYEIVKRLQDRNHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  616

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSR+IFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDF+PFMV
Sbjct  617  DIVLTEPGLSVIVSAVLTSRSIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFAPFMV  676

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  677  LIIAILNDGTIMTI  690



>ref|XP_011084025.1| PREDICTED: ATPase 8, plasma membrane-type [Sesamum indicum]
Length=949

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>gb|ACN33231.1| unknown [Zea mays]
 tpg|DAA62236.1| TPA: hypothetical protein ZEAMMB73_373542 [Zea mays]
Length=525

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK LQ   HICGMTGDGVNDAPALKKADIGIAVAD+TDA RSAS
Sbjct  139  KADGFAGVFPEHKYEIVKGLQARKHICGMTGDGVNDAPALKKADIGIAVADSTDATRSAS  198

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  199  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  258

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  259  LIIAILNDGTIMTI  272



>sp|P23980.1|PMA2_SOLLC RecName: Full=Plasma membrane ATPase 2; AltName: Full=Proton 
pump 2, partial [Solanum lycopersicum]
Length=704

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  309  KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  368

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  369  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  428

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  429  LIIAILNDGTIMTI  442



>ref|XP_008456775.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis melo]
Length=923

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+AL+WKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALLWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_007154926.1| hypothetical protein PHAVU_003G159200g [Phaseolus vulgaris]
 gb|ESW26920.1| hypothetical protein PHAVU_003G159200g [Phaseolus vulgaris]
Length=946

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLVALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>gb|ABW74138.1| plasma membrane H(+) ATPase [Oryza sativa Indica Group]
Length=132

 Score =   198 bits (504),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/128 (92%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  20   GVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasdiVLTE  199
            GV PEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTE
Sbjct  1    GVCPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTE  60

Query  200  PGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVLIVAVL  379
            PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMVLI+A+L
Sbjct  61   PGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMVLIIAIL  120

Query  380  NDGTIMTI  403
            NDGTIMTI
Sbjct  121  NDGTIMTI  128



>ref|XP_004299601.1| PREDICTED: ATPase 11, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=957

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ M HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQAMKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLLALIWKFDFPPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLT+PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTQPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_007011593.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY29212.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=674

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  493  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  552

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF  +ALIWKFDF+PFMV
Sbjct  553  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMV  612

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  613  LIIAILNDGTIMTI  626



>emb|CDO98206.1| unnamed protein product [Coffea canephora]
Length=956

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  564  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  623

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  624  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  683

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  684  LIIAILNDGTIMTI  697



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_009390572.1| PREDICTED: ATPase 9, plasma membrane-type [Musa acuminata subsp. 
malaccensis]
Length=949

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  557  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  616

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  617  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWQFDFSPFMV  676

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  677  LIIAILNDGTIMTI  690



>ref|XP_011002373.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=944

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  554  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  613

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  614  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMV  673

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  674  LIIAILNDGTIMTI  687



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_009417440.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  564  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  623

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  624  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMV  683

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  684  LIIAILNDGTIMTI  697



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDF+PFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>gb|KHG12451.1| ATPase 4, plasma membrane-type -like protein [Gossypium arboreum]
Length=693

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  298  KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  357

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  358  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  417

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  418  LIIAILNDGTIMTI  431



>ref|XP_010033996.1| PREDICTED: ATPase 9, plasma membrane-type isoform X3 [Eucalyptus 
grandis]
Length=920

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  550  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  609

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWK+DFSPFMV
Sbjct  610  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLLALIWKYDFSPFMV  669

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIM I
Sbjct  670  LIIAILNDGTIMPI  683



>ref|XP_004508383.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X1 [Cicer 
arietinum]
Length=949

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLVALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>gb|EEC83158.1| hypothetical protein OsI_28372 [Oryza sativa Indica Group]
Length=874

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  478  KADGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  537

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLT+PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFM+
Sbjct  538  DIVLTQPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMI  597

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  598  LVIAILNDGTIMTI  611



>ref|XP_010932230.1| PREDICTED: plasma membrane ATPase 4 [Elaeis guineensis]
Length=953

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  559  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIW+FDFSPFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLLALIWQFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>ref|XP_004508384.1| PREDICTED: ATPase 8, plasma membrane-type-like isoform X2 [Cicer 
arietinum]
Length=865

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLVALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>gb|KHG14131.1| ATPase 4, plasma membrane-type -like protein [Gossypium arboreum]
Length=721

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  326  KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  385

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  386  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  445

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  446  LIIAILNDGTIMTI  459



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_002307856.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE91379.1| ATPase 6 family protein [Populus trichocarpa]
Length=944

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  554  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  613

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  614  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMV  673

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  674  LIIAILNDGTIMTI  687



>ref|XP_006654259.1| PREDICTED: plasma membrane ATPase 4-like [Oryza brachyantha]
Length=949

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  556  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  615

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDF+PFMV
Sbjct  616  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGFLLLALIWKFDFAPFMV  675

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  676  LIIAILNDGTIMTI  689



>ref|XP_010417679.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X2 [Camelina 
sativa]
Length=928

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKY+IVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  563  ADGFAGVFPEHKYKIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  622

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMVL
Sbjct  623  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFLLLALIWKFDFSPFMVL  682

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  683  VIAILNDGTIMTI  695



>ref|XP_009410182.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  492  KADGFAGVFPEHKYEIVRRLQEKEHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  551

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  552  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLVALIWRFDFSPFMV  611

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  612  LIIAILNDGTIMTI  625



>ref|XP_010417678.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X1 [Camelina 
sativa]
Length=955

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 131/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKY+IVKRLQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSASD
Sbjct  563  ADGFAGVFPEHKYKIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASD  622

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMVL
Sbjct  623  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFLLLALIWKFDFSPFMVL  682

Query  365  IVAVLNDGTIMTI  403
            ++A+LNDGTIMTI
Sbjct  683  VIAILNDGTIMTI  695



>ref|XP_002309321.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE92844.1| ATPase 6 family protein [Populus trichocarpa]
Length=949

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>ref|XP_010033994.1| PREDICTED: ATPase 9, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW53878.1| hypothetical protein EUGRSUZ_J03094 [Eucalyptus grandis]
Length=929

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  559  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWK+DFSPFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLLALIWKYDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIM I
Sbjct  679  LIIAILNDGTIMPI  692



>ref|XP_011033475.1| PREDICTED: ATPase 8, plasma membrane-type [Populus euphratica]
Length=949

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>ref|XP_010033995.1| PREDICTED: ATPase 9, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=931

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  561  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWK+DFSPFMV
Sbjct  621  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLLALIWKYDFSPFMV  680

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIM I
Sbjct  681  LIIAILNDGTIMPI  694



>ref|XP_003573592.1| PREDICTED: ATPase 2, plasma membrane-type-like [Brachypodium 
distachyon]
Length=953

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV++LQ+M HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  561  KADGFAGVFPEHKYEIVRKLQQMKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFM+
Sbjct  621  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMI  680

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  681  LVIAILNDGTIMTI  694



>ref|XP_010914190.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=957

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_009410181.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  492  KADGFAGVFPEHKYEIVRRLQEKEHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  551

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  552  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLVALIWRFDFSPFMV  611

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  612  LIIAILNDGTIMTI  625



>dbj|BAD16686.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  561  KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVVGF LLALIWKFDF PFMV
Sbjct  621  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVVGFMLLALIWKFDFPPFMV  680

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  681  LIIAILNDGTIMTI  694



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDF+PFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  H+CGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHLCGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>emb|CBW30211.1| Plasma membrane ATPase [Musa balbisiana]
Length=954

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>emb|CBW30173.1| Plasma membrane ATPase 4 [Musa balbisiana]
Length=954

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>emb|CAD29311.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=955

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  566  KADGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  625

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLT+PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFM+
Sbjct  626  DIVLTQPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMI  685

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  686  LVIAILNDGTIMTI  699



>ref|XP_004973040.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=950

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  558  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFM+
Sbjct  618  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMI  677

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  678  LVIAILNDGTIMTI  691



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV++LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>gb|EAZ06139.1| hypothetical protein OsI_28373 [Oryza sativa Indica Group]
Length=950

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  554  KADGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  613

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLT+PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFM+
Sbjct  614  DIVLTQPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMI  673

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  674  LVIAILNDGTIMTI  687



>ref|XP_009126895.1| PREDICTED: ATPase 3, plasma membrane-type-like, partial [Brassica 
rapa]
Length=703

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQ++ HICGMTGDGVNDAPALK+ADIGIAVADATDAAR AS
Sbjct  312  KADGFAGVFPEHKYEIVKKLQDLKHICGMTGDGVNDAPALKRADIGIAVADATDAARGAS  371

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  372  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  431

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  432  LIIAILNDGTIMTI  445



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV++LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  622  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWEFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDF+PFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>dbj|BAD33363.1| putative plasma membrane H+-ATPase [Oryza sativa Japonica Group]
 gb|EAZ42002.1| hypothetical protein OsJ_26551 [Oryza sativa Japonica Group]
Length=954

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQEM HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  558  KADGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLT+PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFM+
Sbjct  618  DIVLTQPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMI  677

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  678  LVIAILNDGTIMTI  691



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDF+PFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>dbj|BAD16689.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  561  KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVVGF LLALIWKFDF PFMV
Sbjct  621  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVVGFMLLALIWKFDFPPFMV  680

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  681  LIIAILNDGTIMTI  694



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV++LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  558  KADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  618  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>ref|XP_009381563.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=960

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  567  KADGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  626

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  627  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLVALIWRFDFSPFMV  686

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  687  LVIAILNDGTIMTI  700



>ref|XP_009392149.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=951

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE +HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  560  KADGFAGVFPEHKYEIVKRLQERSHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIW+F+FSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVLGFLLLALIWRFNFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDF+PFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>tpg|DAA54787.1| TPA: hypothetical protein ZEAMMB73_074525 [Zea mays]
Length=812

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  561  KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  621  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  680

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  681  LIIAILNDGTIMTI  694



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFM+
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMI  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_008228760.1| PREDICTED: ATPase 9, plasma membrane-type [Prunus mume]
Length=954

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALK+ADIGIAV DATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKRADIGIAVDDATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGFMLLALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  682  LVIAILNDGTIMTI  695



>ref|XP_009381583.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV++LQE  HICGMTGDGVNDAPALKKADIGIAV+DATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVSDATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDF+PFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>gb|AFW76177.1| hypothetical protein ZEAMMB73_418989 [Zea mays]
Length=924

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  530  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  589

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIW+FDF+PFMV
Sbjct  590  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGFLLLALIWRFDFAPFMV  649

Query  362  LIVAVLNDGTIMTI  403
            LI+AVLNDGTIMTI
Sbjct  650  LIIAVLNDGTIMTI  663



>ref|XP_007155352.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
 gb|ESW27346.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
Length=810

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  561  KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  621  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  680

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  681  LIIAILNDGTIMTI  694



>dbj|BAM20989.1| plasma membrane H+-ATPase [Marchantia polymorpha]
Length=957

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSASD
Sbjct  565  ADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASD  624

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LL LIWKFDFSPFMVL
Sbjct  625  IVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLLTLIWKFDFSPFMVL  684

Query  365  IVAVLNDGTIMTI  403
            I+A+LNDGTIMTI
Sbjct  685  IIAILNDGTIMTI  697



>ref|XP_002438748.1| hypothetical protein SORBIDRAFT_10g025470 [Sorghum bicolor]
 gb|EER90115.1| hypothetical protein SORBIDRAFT_10g025470 [Sorghum bicolor]
Length=956

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIW+FDF+PFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGFMLLALIWRFDFAPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+AVLNDGTIMTI
Sbjct  682  LIIAVLNDGTIMTI  695



>ref|XP_009399554.1| PREDICTED: plasma membrane ATPase isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=955

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  563  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  622

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFM+
Sbjct  623  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWQFDFSPFMI  682

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  683  LVIAILNDGTIMTI  696



>gb|EMS59303.1| Plasma membrane ATPase [Triticum urartu]
Length=1039

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQ+M HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  564  KADGFAGVFPEHKYEIVKKLQQMKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  623

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFM+
Sbjct  624  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMI  683

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  684  LVIAILNDGTIMTI  697



>ref|XP_007217150.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
 gb|EMJ18349.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
Length=954

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALK+ADIGIAV DATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKRADIGIAVDDATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGFMLLALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  682  LVIAILNDGTIMTI  695



>emb|CDY30730.1| BnaA02g33520D [Brassica napus]
Length=787

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  392  KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  451

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  452  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  511

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  512  LIIAILNDGTIMTI  525



>gb|AAO72564.1| plasma membrane H+-ATPase-like protein [Oryza sativa Japonica 
Group]
Length=503

 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HI GMTGDGVNDAPALKKADIGIAVADA DAARSAS
Sbjct  109  KADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGIAVADAIDAARSAS  168

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIV+GF L+ALIWK+DFSPFMV
Sbjct  169  DIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMV  228

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  229  LIIAILNDGTIMTI  242



>gb|ABR18001.1| unknown [Picea sitchensis]
Length=955

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  564  KADGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  623

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  624  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMV  683

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  684  LIIAILNDGTIMTI  697



>ref|XP_006465284.1| PREDICTED: ATPase 9, plasma membrane-type-like [Citrus sinensis]
Length=962

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV++LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  570  KADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  629

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  630  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMV  689

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  690  LIIAILNDGTIMTI  703



>ref|XP_010103366.1| ATPase 8, plasma membrane-type [Morus notabilis]
 gb|EXB95573.1| ATPase 8, plasma membrane-type [Morus notabilis]
Length=948

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFMV
Sbjct  619  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLVALIWEFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>gb|KDO45595.1| hypothetical protein CISIN_1g044543mg [Citrus sinensis]
Length=962

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV++LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  570  KADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  629

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  630  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMV  689

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  690  LIIAILNDGTIMTI  703



>ref|XP_011017965.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=949

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  559  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  619  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>ref|XP_009399553.1| PREDICTED: plasma membrane ATPase isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=981

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  589  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  648

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFM+
Sbjct  649  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWQFDFSPFMI  708

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  709  LVIAILNDGTIMTI  722



>ref|XP_009773901.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana sylvestris]
Length=954

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSASD
Sbjct  564  ADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASD  623

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMVL
Sbjct  624  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVL  683

Query  365  IVAVLNDGTIMTI  403
            I+A+LNDGTIMTI
Sbjct  684  IIAILNDGTIMTI  696



>gb|KFK27283.1| h(+)-atpase 3 [Arabis alpina]
Length=951

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_004242977.2| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum lycopersicum]
Length=951

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQ+  HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQDRKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_009607951.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana tomentosiformis]
Length=954

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 125/133 (94%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSASD
Sbjct  564  ADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASD  623

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMVL
Sbjct  624  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVL  683

Query  365  IVAVLNDGTIMTI  403
            I+A+LNDGTIMTI
Sbjct  684  IIAILNDGTIMTI  696



>emb|CDP14278.1| unnamed protein product [Coffea canephora]
Length=1297

 Score =   216 bits (549),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2     KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
             KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  906   KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  965

Query  182   diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
             DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  966   DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMV  1025

Query  362   LIVAVLNDGTIMTI  403
             LI+A+LNDGTIMTI
Sbjct  1026  LIMAILNDGTIMTI  1039


 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/74 (96%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVS  223
            DIVLTEPGLSVIVS
Sbjct  620  DIVLTEPGLSVIVS  633



>ref|XP_006343689.1| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum tuberosum]
Length=951

 Score =   213 bits (543),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQ+  HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQDRKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_006427547.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
 gb|ESR40787.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
Length=962

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV++LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  570  KADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  629

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMV
Sbjct  630  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMV  689

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  690  LIIAILNDGTIMTI  703



>dbj|BAK05828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=950

 Score =   213 bits (543),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  558  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGF L+AL+WKFDF+PFMV
Sbjct  618  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFMLVALLWKFDFAPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>ref|XP_010483247.1| PREDICTED: ATPase 3, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   213 bits (543),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  558  KADGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  618  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>gb|KGN60167.1| hypothetical protein Csa_3G881800 [Cucumis sativus]
Length=657

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 123/133 (92%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSASD
Sbjct  265  ADGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASD  324

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDF+PFMVL
Sbjct  325  IVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFLLIALIWKFDFAPFMVL  384

Query  365  IVAVLNDGTIMTI  403
            I+A+LNDGTIMTI
Sbjct  385  IIAILNDGTIMTI  397



>ref|XP_008649034.1| PREDICTED: ATPase 2, plasma membrane-type-like [Zea mays]
Length=954

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  560  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIW+FDF+PFMV
Sbjct  620  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGFLLLALIWRFDFAPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+AVLNDGTIMTI
Sbjct  680  LIIAVLNDGTIMTI  693



>gb|KGN63646.1| hypothetical protein Csa_1G008520 [Cucumis sativus]
Length=801

 Score =   213 bits (541),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  406  KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  465

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  466  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  525

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  526  LIIAILNDGTIMTI  539



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_004965734.1| PREDICTED: plasma membrane ATPase 4-like [Setaria italica]
Length=948

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  554  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  613

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+V+GF LLALIW+FDF+PFMV
Sbjct  614  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGFLLLALIWRFDFAPFMV  673

Query  362  LIVAVLNDGTIMTI  403
            LI+AVLNDGTIMTI
Sbjct  674  LIIAVLNDGTIMTI  687



>ref|XP_010539792.1| PREDICTED: ATPase 3, plasma membrane-type-like [Tarenaya hassleriana]
Length=918

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALK+ADIGIAVADATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>dbj|BAD19091.1| putative H+-exporting ATPase [Oryza sativa Japonica Group]
 gb|EAY87868.1| hypothetical protein OsI_09289 [Oryza sativa Indica Group]
 gb|EAZ24947.1| hypothetical protein OsJ_08728 [Oryza sativa Japonica Group]
Length=950

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  558  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+AL+WKFDF+PFMV
Sbjct  618  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLVALLWKFDFAPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>gb|ABO15469.2| plasma membrane H+-ATPase LilHA2 [Lilium longiflorum]
Length=954

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 125/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW FDFSPFMV
Sbjct  622  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWHFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_006282289.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
 gb|EOA15187.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
Length=949

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  558  KADGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  618  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>ref|XP_008677658.1| PREDICTED: uncharacterized protein LOC100383904 isoform X1 [Zea 
mays]
 gb|AFW64135.1| hypothetical protein ZEAMMB73_387587 [Zea mays]
Length=951

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+AL+WKFDF+PFMV
Sbjct  619  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVALVWKFDFAPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>ref|XP_009417143.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=955

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 126/134 (94%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ   HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  561  KADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  620

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDF PFMV
Sbjct  621  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMV  680

Query  362  LIVAVLNDGTIMTI  403
            LI+AVLNDGTIMTI
Sbjct  681  LIIAVLNDGTIMTI  694



>ref|XP_011082157.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR ASD
Sbjct  563  ADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASD  622

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF LLALIWKFDFSPFMVL
Sbjct  623  IVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVL  682

Query  365  IVAVLNDGTIMTI  403
            I+A+LNDGTIMTI
Sbjct  683  IIAILNDGTIMTI  695



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>ref|XP_009399552.1| PREDICTED: plasma membrane ATPase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=982

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  590  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  649

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFM+
Sbjct  650  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWQFDFSPFMI  709

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  710  LVIAILNDGTIMTI  723



>ref|NP_001048395.2| Os02g0797300 [Oryza sativa Japonica Group]
 dbj|BAF10309.2| Os02g0797300, partial [Oryza sativa Japonica Group]
Length=943

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  551  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  610

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+AL+WKFDF+PFMV
Sbjct  611  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLVALLWKFDFAPFMV  670

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  671  LIIAILNDGTIMTI  684



>ref|NP_200545.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 ref|NP_001190559.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 sp|P20431.2|PMA3_ARATH RecName: Full=ATPase 3, plasma membrane-type; AltName: Full=Proton 
pump 3 [Arabidopsis thaliana]
 gb|AAA32750.1| ATPase [Arabidopsis thaliana]
 dbj|BAB09963.1| plasma membrane ATPase 3 [Arabidopsis thaliana]
 gb|AAL59975.1| putative plasma membrane proton pump ATPase 3 [Arabidopsis thaliana]
 gb|AED96889.1| H(+)-ATPase 3 [Arabidopsis thaliana]
 gb|AED96890.1| H(+)-ATPase 3 [Arabidopsis thaliana]
Length=949

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  558  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  618  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>ref|XP_004253510.2| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum lycopersicum]
Length=951

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQ+  HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  560  KADGFAGVFPEHKYEIVKKLQDRKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  619

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF L+ALIWKFDFSPFMV
Sbjct  620  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFMLIALIWKFDFSPFMV  679

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  680  LIIAILNDGTIMTI  693



>ref|XP_010535850.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=881

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  493  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  552

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDF+PFMV
Sbjct  553  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLVALIWKFDFAPFMV  612

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  613  LIIAILNDGTIMTI  626



>ref|XP_010452018.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  558  KADGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  618  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>ref|XP_010443420.1| PREDICTED: ATPase 3, plasma membrane-type [Camelina sativa]
Length=949

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  558  KADGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  618  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  564  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  623

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  624  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFLLIALIWKFDFSPFMV  683

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  684  LIIAILNDGTIMTI  697



>gb|KEH39753.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  559  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  618

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSR+IFQRMKNYTIYAVSITIRIV GF L+ALIWKFDF+PFMV
Sbjct  619  DIVLTEPGLSVIISAVLTSRSIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMV  678

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  679  LIIAILNDGTIMTI  692



>ref|XP_011045013.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Populus euphratica]
Length=822

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  562  KADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  621

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF  +ALIWKFDF+PFMV
Sbjct  622  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMV  681

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  682  LIIAILNDGTIMTI  695



>gb|AAL09726.1| AT5g57350/MJB24_16 [Arabidopsis thaliana]
Length=949

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  558  KADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF L+ALIWKFDFSPFMV
Sbjct  618  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



>gb|AAD46186.1| plasma membrane proton ATPase [Nicotiana plumbaginifolia]
Length=954

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 129/133 (97%), Gaps = 0/133 (0%)
 Frame = +2

Query  5    ADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsasd  184
            ADGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR ASD
Sbjct  564  ADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASD  623

Query  185  iVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMVL  364
            IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIWKFDFSPFMVL
Sbjct  624  IVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVL  683

Query  365  IVAVLNDGTIMTI  403
            I+A+LNDGTIMTI
Sbjct  684  IIAILNDGTIMTI  696



>ref|XP_009399551.1| PREDICTED: plasma membrane ATPase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1008

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 131/134 (98%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIV+RLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAARSAS
Sbjct  616  KADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSAS  675

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+ALIW+FDFSPFM+
Sbjct  676  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWQFDFSPFMI  735

Query  362  LIVAVLNDGTIMTI  403
            L++A+LNDGTIMTI
Sbjct  736  LVIAILNDGTIMTI  749



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQE  HICGMTGDGVNDAPALKKADIGIAVADATDAAR AS
Sbjct  557  KADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARGAS  616

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF  +ALIWKFDFSPFMV
Sbjct  617  DIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMV  676

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  677  LIIAILNDGTIMTI  690



>emb|CAD29312.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=942

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  2    KADGFAGVFPEHKYEIVKRLQEMNHICGMTGDGVNDAPALKKadigiavadatdaarsas  181
            KADGFAGVFPEHKYEIVKRLQ+  HICGMTGDGVNDAPALKKADIGIAV DATDAARSAS
Sbjct  558  KADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSAS  617

Query  182  diVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGFTLLALIWKFDFSPFMV  361
            DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF L+AL+WKFDF+PFMV
Sbjct  618  DIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLVALLWKFDFAPFMV  677

Query  362  LIVAVLNDGTIMTI  403
            LI+A+LNDGTIMTI
Sbjct  678  LIIAILNDGTIMTI  691



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508466684456