BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19410_g1_i1 len=1102 path=[1180:0-407 1584:408-1101]

Length=1102
                                                                      Score     E

ref|XP_006356306.1|  PREDICTED: bidirectional sugar transporter S...    272   8e-86   
ref|XP_004237722.1|  PREDICTED: bidirectional sugar transporter S...    265   6e-83   
ref|XP_011101820.1|  PREDICTED: bidirectional sugar transporter S...    261   2e-81   
ref|XP_009792705.1|  PREDICTED: bidirectional sugar transporter S...    261   2e-81   
ref|XP_009625661.1|  PREDICTED: bidirectional sugar transporter S...    257   4e-80   
gb|AFK49066.1|  unknown                                                 255   2e-79   
ref|XP_010062171.1|  PREDICTED: bidirectional sugar transporter S...    255   3e-79   
gb|AFK34328.1|  unknown                                                 252   3e-78   
ref|XP_002526178.1|  conserved hypothetical protein                     252   3e-78   Ricinus communis
emb|CDP11997.1|  unnamed protein product                                252   5e-78   
gb|EYU32456.1|  hypothetical protein MIMGU_mgv1a012592mg                251   1e-77   
ref|XP_010270425.1|  PREDICTED: bidirectional sugar transporter S...    250   2e-77   
ref|XP_003526670.1|  PREDICTED: bidirectional sugar transporter S...    250   3e-77   
ref|XP_004150723.1|  PREDICTED: bidirectional sugar transporter S...    250   3e-77   
gb|KDP43062.1|  hypothetical protein JCGZ_25248                         250   4e-77   
ref|XP_002265836.1|  PREDICTED: bidirectional sugar transporter S...    249   4e-77   Vitis vinifera
ref|XP_006434359.1|  hypothetical protein CICLE_v10002276mg             249   6e-77   
ref|XP_003523404.1|  PREDICTED: bidirectional sugar transporter S...    249   6e-77   
ref|XP_010260493.1|  PREDICTED: bidirectional sugar transporter S...    249   7e-77   
ref|XP_006472908.1|  PREDICTED: bidirectional sugar transporter S...    249   7e-77   
ref|XP_010999825.1|  PREDICTED: bidirectional sugar transporter S...    249   9e-77   
ref|XP_007137524.1|  hypothetical protein PHAVU_009G134300g             248   9e-77   
gb|KHG09976.1|  Bidirectional sugar transporter SWEET1 -like protein    249   3e-76   
gb|AFK49440.1|  unknown                                                 247   3e-76   
ref|XP_004502575.1|  PREDICTED: bidirectional sugar transporter S...    247   4e-76   
ref|XP_004290589.1|  PREDICTED: bidirectional sugar transporter S...    246   6e-76   
gb|KHG21873.1|  Bidirectional sugar transporter SWEET1 -like protein    246   1e-75   
gb|ACU19281.1|  unknown                                                 245   3e-75   Glycine max [soybeans]
ref|XP_009382942.1|  PREDICTED: bidirectional sugar transporter S...    244   5e-75   
ref|XP_010911638.1|  PREDICTED: bidirectional sugar transporter S...    243   8e-75   
ref|XP_011027387.1|  PREDICTED: bidirectional sugar transporter S...    243   1e-74   
ref|XP_010270424.1|  PREDICTED: bidirectional sugar transporter S...    243   1e-74   
ref|XP_011027388.1|  PREDICTED: bidirectional sugar transporter S...    243   2e-74   
ref|XP_010679833.1|  PREDICTED: bidirectional sugar transporter S...    243   3e-74   
ref|XP_002300945.1|  nodulin MtN3 family protein                        242   5e-74   Populus trichocarpa [western balsam poplar]
ref|XP_010496503.1|  PREDICTED: bidirectional sugar transporter S...    240   1e-73   
ref|XP_007161383.1|  hypothetical protein PHAVU_001G064300g             240   2e-73   
ref|XP_008237695.1|  PREDICTED: bidirectional sugar transporter S...    241   2e-73   
ref|XP_006356304.1|  PREDICTED: bidirectional sugar transporter S...    240   2e-73   
ref|XP_007200590.1|  hypothetical protein PRUPE_ppa010181mg             240   2e-73   
ref|XP_006416299.1|  hypothetical protein EUTSA_v10008590mg             239   3e-73   
ref|XP_010539700.1|  PREDICTED: bidirectional sugar transporter S...    239   4e-73   
ref|XP_010270426.1|  PREDICTED: bidirectional sugar transporter S...    238   5e-73   
ref|XP_004498378.1|  PREDICTED: bidirectional sugar transporter S...    238   8e-73   
ref|XP_008810887.1|  PREDICTED: bidirectional sugar transporter S...    238   8e-73   
ref|XP_010260494.1|  PREDICTED: bidirectional sugar transporter S...    239   8e-73   
ref|XP_009377708.1|  PREDICTED: bidirectional sugar transporter S...    239   1e-72   
emb|CDY04628.1|  BnaC05g16660D                                          238   1e-72   
ref|XP_010498603.1|  PREDICTED: bidirectional sugar transporter S...    238   1e-72   
gb|KEH40468.1|  bidirectional sugar transporter                         238   2e-72   
ref|XP_006305555.1|  hypothetical protein CARUB_v10010111mg             237   2e-72   
ref|XP_002307476.2|  hypothetical protein POPTR_0005s20970g             239   3e-72   Populus trichocarpa [western balsam poplar]
ref|XP_010537332.1|  PREDICTED: bidirectional sugar transporter S...    237   3e-72   
emb|CDY50241.1|  BnaA06g15180D                                          236   4e-72   
ref|XP_009149662.1|  PREDICTED: bidirectional sugar transporter S...    236   4e-72   
ref|XP_008344428.1|  PREDICTED: bidirectional sugar transporter S...    237   5e-72   
ref|XP_003544735.1|  PREDICTED: bidirectional sugar transporter S...    236   5e-72   
gb|KEH35409.1|  bidirectional sugar transporter                         236   7e-72   
ref|XP_010064812.1|  PREDICTED: bidirectional sugar transporter S...    236   9e-72   
ref|XP_010459857.1|  PREDICTED: bidirectional sugar transporter S...    236   9e-72   
ref|XP_009360715.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-71   
ref|XP_009340984.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-71   
ref|XP_008441563.1|  PREDICTED: bidirectional sugar transporter S...    235   1e-71   
ref|XP_010064811.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-71   
ref|XP_009625660.1|  PREDICTED: bidirectional sugar transporter S...    235   1e-71   
ref|XP_009110184.1|  PREDICTED: bidirectional sugar transporter S...    235   2e-71   
emb|CDY67972.1|  BnaCnng57120D                                          234   3e-71   
gb|EYU32454.1|  hypothetical protein MIMGU_mgv1a012708mg                234   3e-71   
ref|XP_007019365.1|  Nodulin MtN3 family protein                        234   5e-71   
ref|XP_002893163.1|  nodulin MtN3 family protein                        233   6e-71   
ref|XP_009800957.1|  PREDICTED: bidirectional sugar transporter S...    233   8e-71   
ref|NP_564140.1|  bidirectional sugar transporter SWEET1                233   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006858415.1|  hypothetical protein AMTR_s00071p00055180          233   2e-70   
ref|NP_001044998.1|  Os01g0881300                                       233   3e-70   Oryza sativa Japonica Group [Japonica rice]
gb|EPS69723.1|  hypothetical protein M569_05042                         231   4e-70   
ref|XP_009775809.1|  PREDICTED: bidirectional sugar transporter S...    232   4e-70   
gb|KCW44925.1|  hypothetical protein EUGRSUZ_L01492                     231   5e-70   
ref|XP_011101806.1|  PREDICTED: bidirectional sugar transporter S...    232   5e-70   
ref|XP_003541791.1|  PREDICTED: bidirectional sugar transporter S...    231   6e-70   
ref|XP_010065109.1|  PREDICTED: bidirectional sugar transporter S...    231   6e-70   
ref|XP_010040793.1|  PREDICTED: bidirectional sugar transporter S...    231   7e-70   
ref|XP_009589302.1|  PREDICTED: bidirectional sugar transporter S...    231   8e-70   
ref|XP_010065111.1|  PREDICTED: bidirectional sugar transporter S...    231   9e-70   
ref|XP_006645124.1|  PREDICTED: bidirectional sugar transporter S...    231   1e-69   
emb|CDJ26295.1|  unnamed protein product                                231   1e-69   
ref|XP_003564773.1|  PREDICTED: bidirectional sugar transporter S...    230   2e-69   
ref|XP_004237723.1|  PREDICTED: bidirectional sugar transporter S...    229   4e-69   
ref|XP_008347232.1|  PREDICTED: bidirectional sugar transporter S...    228   1e-68   
ref|XP_011074778.1|  PREDICTED: bidirectional sugar transporter S...    228   1e-68   
ref|XP_008357046.1|  PREDICTED: bidirectional sugar transporter S...    227   2e-68   
emb|CDP11998.1|  unnamed protein product                                227   2e-68   
emb|CAN59909.1|  hypothetical protein VITISV_037479                     227   2e-68   Vitis vinifera
dbj|BAJ94374.1|  predicted protein                                      228   3e-68   
ref|XP_010063892.1|  PREDICTED: bidirectional sugar transporter S...    226   3e-68   
ref|XP_004242009.1|  PREDICTED: bidirectional sugar transporter S...    227   4e-68   
ref|XP_006366752.1|  PREDICTED: bidirectional sugar transporter S...    226   8e-68   
ref|XP_006654427.1|  PREDICTED: bidirectional sugar transporter S...    226   1e-67   
ref|XP_010921715.1|  PREDICTED: bidirectional sugar transporter S...    225   1e-67   
ref|XP_008366545.1|  PREDICTED: bidirectional sugar transporter S...    224   2e-67   
ref|XP_010040795.1|  PREDICTED: bidirectional sugar transporter S...    224   2e-67   
ref|XP_009399164.1|  PREDICTED: bidirectional sugar transporter S...    224   3e-67   
ref|XP_004970789.1|  PREDICTED: bidirectional sugar transporter S...    224   3e-67   
sp|B8AYH1.1|SWT1B_ORYSI  RecName: Full=Bidirectional sugar transp...    224   4e-67   Oryza sativa Indica Group [Indian rice]
ref|NP_001055599.1|  Os05g0426000                                       223   8e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004962025.1|  PREDICTED: bidirectional sugar transporter S...    223   8e-67   
gb|ABK22750.1|  unknown                                                 223   9e-67   Picea sitchensis
gb|AFW78061.1|  seven-transmembrane-domain protein 1                    223   9e-67   
gb|KHN23430.1|  Bidirectional sugar transporter SWEET1                  223   1e-66   
ref|XP_004242288.1|  PREDICTED: bidirectional sugar transporter S...    222   2e-66   
ref|NP_001148521.1|  LOC100282137                                       223   2e-66   Zea mays [maize]
gb|KCW69242.1|  hypothetical protein EUGRSUZ_F02750                     222   5e-66   
gb|KDO83582.1|  hypothetical protein CISIN_1g025686mg                   219   1e-65   
ref|XP_009610841.1|  PREDICTED: bidirectional sugar transporter S...    220   1e-65   
ref|XP_002441124.1|  hypothetical protein SORBIDRAFT_09g020860          220   2e-65   Sorghum bicolor [broomcorn]
ref|XP_010320028.1|  PREDICTED: bidirectional sugar transporter S...    219   2e-65   
ref|NP_001147686.1|  seven-transmembrane-domain protein 1               217   1e-64   Zea mays [maize]
ref|XP_010040791.1|  PREDICTED: bidirectional sugar transporter S...    217   2e-64   
ref|XP_009778146.1|  PREDICTED: bidirectional sugar transporter S...    215   1e-63   
ref|XP_002302198.2|  hypothetical protein POPTR_0002s07370g             214   3e-63   Populus trichocarpa [western balsam poplar]
gb|ACG41106.1|  seven-transmembrane-domain protein 1                    213   4e-63   Zea mays [maize]
ref|XP_006356303.1|  PREDICTED: bidirectional sugar transporter S...    213   4e-63   
gb|EAY76715.1|  hypothetical protein OsI_04670                          214   1e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_003568408.1|  PREDICTED: bidirectional sugar transporter S...    210   7e-62   
ref|XP_008353655.1|  PREDICTED: bidirectional sugar transporter S...    209   2e-61   
ref|XP_010041426.1|  PREDICTED: bidirectional sugar transporter S...    210   2e-61   
gb|KCW69243.1|  hypothetical protein EUGRSUZ_F02751                     208   3e-61   
gb|EMT14572.1|  Protein RUPTURED POLLEN GRAIN 1                         209   3e-61   
ref|XP_006366753.1|  PREDICTED: bidirectional sugar transporter S...    210   5e-61   
ref|XP_009610838.1|  PREDICTED: bidirectional sugar transporter S...    208   5e-61   
ref|XP_009610842.1|  PREDICTED: bidirectional sugar transporter S...    207   7e-61   
ref|XP_004237724.1|  PREDICTED: bidirectional sugar transporter S...    207   9e-61   
ref|XP_008356061.1|  PREDICTED: bidirectional sugar transporter S...    206   1e-60   
ref|XP_009778142.1|  PREDICTED: bidirectional sugar transporter S...    207   1e-60   
ref|XP_010320027.1|  PREDICTED: bidirectional sugar transporter S...    205   5e-60   
dbj|BAK08026.1|  predicted protein                                      206   5e-60   
ref|XP_009778144.1|  PREDICTED: bidirectional sugar transporter S...    204   3e-59   
ref|XP_006366755.1|  PREDICTED: bidirectional sugar transporter S...    204   6e-59   
ref|XP_009610840.1|  PREDICTED: bidirectional sugar transporter S...    202   2e-58   
tpg|DAA56533.1|  TPA: hypothetical protein ZEAMMB73_267913              197   1e-57   
ref|XP_006356305.1|  PREDICTED: bidirectional sugar transporter S...    199   1e-57   
gb|AFW78060.1|  hypothetical protein ZEAMMB73_315036                    196   7e-57   
ref|XP_009778143.1|  PREDICTED: bidirectional sugar transporter S...    196   2e-56   
ref|XP_008366546.1|  PREDICTED: bidirectional sugar transporter S...    193   8e-56   
ref|XP_009778136.1|  PREDICTED: bidirectional sugar transporter S...    192   4e-55   
ref|XP_006434360.1|  hypothetical protein CICLE_v10002276mg             191   4e-55   
ref|XP_006472909.1|  PREDICTED: bidirectional sugar transporter S...    191   5e-55   
ref|XP_009778138.1|  PREDICTED: bidirectional sugar transporter S...    189   9e-54   
gb|EMS49359.1|  Bidirectional sugar transporter SWEET1b                 189   1e-52   
ref|XP_010496504.1|  PREDICTED: bidirectional sugar transporter S...    184   2e-52   
ref|XP_008810889.1|  PREDICTED: bidirectional sugar transporter S...    182   7e-52   
ref|XP_010498604.1|  PREDICTED: bidirectional sugar transporter S...    181   2e-51   
ref|XP_010065110.1|  PREDICTED: uncharacterized protein LOC104452329    187   7e-51   
ref|XP_006581612.1|  PREDICTED: bidirectional sugar transporter S...    176   2e-49   
gb|AAF87899.1|AC015447_9  Unknown protein                               176   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011076028.1|  PREDICTED: bidirectional sugar transporter S...    177   5e-49   
ref|XP_008672859.1|  PREDICTED: LOC100282137 isoform X1                 175   9e-49   
gb|ADE75802.1|  unknown                                                 174   3e-48   
ref|XP_006442341.1|  hypothetical protein CICLE_v10021714mg             174   3e-48   
ref|XP_006477817.1|  PREDICTED: bidirectional sugar transporter S...    174   4e-48   
gb|EAZ14380.1|  hypothetical protein OsJ_04300                          176   6e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009778147.1|  PREDICTED: bidirectional sugar transporter S...    172   7e-48   
ref|XP_002269484.1|  PREDICTED: bidirectional sugar transporter S...    173   8e-48   Vitis vinifera
ref|XP_006449593.1|  hypothetical protein CICLE_v10016510mg             172   1e-47   
gb|EYU32455.1|  hypothetical protein MIMGU_mgv1a012708mg                171   2e-47   
gb|EYU26292.1|  hypothetical protein MIMGU_mgv1a012783mg                172   2e-47   
ref|XP_006467563.1|  PREDICTED: bidirectional sugar transporter S...    171   3e-47   
ref|XP_009344605.1|  PREDICTED: bidirectional sugar transporter S...    171   4e-47   
ref|XP_008779964.1|  PREDICTED: bidirectional sugar transporter S...    171   5e-47   
gb|KDO77996.1|  hypothetical protein CISIN_1g024679mg                   171   7e-47   
ref|XP_010552141.1|  PREDICTED: bidirectional sugar transporter S...    170   9e-47   
gb|KDO49284.1|  hypothetical protein CISIN_1g022823mg                   170   1e-46   
ref|XP_006467564.1|  PREDICTED: bidirectional sugar transporter S...    169   2e-46   
ref|XP_011045549.1|  PREDICTED: bidirectional sugar transporter S...    169   3e-46   
ref|XP_004488982.1|  PREDICTED: bidirectional sugar transporter S...    169   4e-46   
ref|XP_008810888.1|  PREDICTED: bidirectional sugar transporter S...    167   4e-46   
gb|KDO83583.1|  hypothetical protein CISIN_1g025686mg                   165   7e-46   
ref|XP_006597983.1|  PREDICTED: bidirectional sugar transporter S...    168   8e-46   
ref|XP_010926192.1|  PREDICTED: bidirectional sugar transporter S...    168   8e-46   
ref|XP_006597984.1|  PREDICTED: bidirectional sugar transporter S...    167   9e-46   
ref|XP_006356121.1|  PREDICTED: bidirectional sugar transporter S...    167   1e-45   
ref|XP_010052122.1|  PREDICTED: bidirectional sugar transporter S...    167   1e-45   
gb|EMT31247.1|  Protein RUPTURED POLLEN GRAIN 1                         167   1e-45   
ref|XP_010273402.1|  PREDICTED: bidirectional sugar transporter S...    167   1e-45   
ref|XP_008363645.1|  PREDICTED: bidirectional sugar transporter S...    167   2e-45   
ref|XP_004234244.1|  PREDICTED: bidirectional sugar transporter S...    167   2e-45   
emb|CDX86834.1|  BnaA09g22240D                                          167   2e-45   
ref|XP_010915676.1|  PREDICTED: bidirectional sugar transporter S...    167   3e-45   
ref|XP_010644065.1|  PREDICTED: bidirectional sugar transporter S...    166   3e-45   
ref|XP_010542326.1|  PREDICTED: bidirectional sugar transporter S...    167   3e-45   
gb|KDP35070.1|  hypothetical protein JCGZ_11040                         166   5e-45   
ref|XP_004244297.1|  PREDICTED: bidirectional sugar transporter S...    166   5e-45   
ref|XP_003540515.1|  PREDICTED: bidirectional sugar transporter S...    166   5e-45   
ref|NP_001146103.1|  hypothetical protein                               166   5e-45   Zea mays [maize]
ref|XP_011082807.1|  PREDICTED: bidirectional sugar transporter S...    166   5e-45   
ref|XP_010261514.1|  PREDICTED: bidirectional sugar transporter S...    166   6e-45   
ref|XP_006593345.1|  PREDICTED: uncharacterized protein LOC100305...    165   7e-45   
gb|EYU28153.1|  hypothetical protein MIMGU_mgv1a012941mg                165   7e-45   
gb|EPS71278.1|  hypothetical protein M569_03483                         165   7e-45   
ref|XP_007022013.1|  Nodulin MtN3 family protein isoform 2              165   7e-45   
sp|Q5NAZ9.2|SWT3B_ORYSJ  RecName: Full=Bidirectional sugar transp...    166   8e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009108217.1|  PREDICTED: bidirectional sugar transporter S...    165   9e-45   
ref|XP_003638394.1|  Protein RUPTURED POLLEN GRAIN                      165   1e-44   
gb|AFK41273.1|  unknown                                                 164   1e-44   
emb|CDP06059.1|  unnamed protein product                                164   1e-44   
gb|AFK48838.1|  unknown                                                 164   1e-44   
ref|NP_001237496.1|  uncharacterized protein LOC100305842               164   2e-44   
ref|XP_009376722.1|  PREDICTED: bidirectional sugar transporter S...    164   2e-44   
ref|XP_006377713.1|  hypothetical protein POPTR_0011s10470g             164   2e-44   
ref|XP_007133301.1|  hypothetical protein PHAVU_011G168100g             164   2e-44   
ref|XP_007022012.1|  Nodulin MtN3 family protein isoform 1              166   2e-44   
ref|XP_011096465.1|  PREDICTED: bidirectional sugar transporter S...    164   2e-44   
ref|XP_004968893.1|  PREDICTED: bidirectional sugar transporter S...    164   2e-44   
ref|XP_008226346.1|  PREDICTED: bidirectional sugar transporter S...    164   3e-44   
ref|XP_009382941.1|  PREDICTED: bidirectional sugar transporter S...    164   4e-44   
ref|XP_009772066.1|  PREDICTED: bidirectional sugar transporter S...    163   4e-44   
ref|XP_006348336.1|  PREDICTED: bidirectional sugar transporter S...    163   4e-44   
gb|KHG18550.1|  Bidirectional sugar transporter SWEET2 -like protein    163   4e-44   
ref|XP_009630052.1|  PREDICTED: bidirectional sugar transporter S...    163   4e-44   
ref|XP_006374131.1|  hypothetical protein POPTR_0015s02300g             163   5e-44   
ref|XP_002972407.1|  hypothetical protein SELMODRAFT_97165              164   5e-44   
ref|XP_010095123.1|  Bidirectional sugar transporter SWEET2a            163   5e-44   
ref|XP_010916112.1|  PREDICTED: bidirectional sugar transporter S...    163   6e-44   
ref|XP_004980179.1|  PREDICTED: bidirectional sugar transporter S...    163   7e-44   
ref|XP_008366018.1|  PREDICTED: bidirectional sugar transporter S...    163   7e-44   
gb|KHN36937.1|  Bidirectional sugar transporter SWEET2                  163   7e-44   
ref|XP_008784375.1|  PREDICTED: bidirectional sugar transporter S...    162   8e-44   
emb|CDY40867.1|  BnaC09g25980D                                          163   9e-44   
ref|XP_007149509.1|  hypothetical protein PHAVU_005G076300g             162   9e-44   
ref|XP_006643923.1|  PREDICTED: bidirectional sugar transporter S...    162   1e-43   
ref|XP_007212900.1|  hypothetical protein PRUPE_ppa021855mg             162   1e-43   
ref|XP_009786515.1|  PREDICTED: bidirectional sugar transporter S...    162   1e-43   
ref|XP_002971884.1|  hypothetical protein SELMODRAFT_36361              160   2e-43   
ref|XP_008775459.1|  PREDICTED: bidirectional sugar transporter S...    161   2e-43   
ref|XP_010104291.1|  Bidirectional sugar transporter SWEET1             160   2e-43   
ref|XP_008775458.1|  PREDICTED: bidirectional sugar transporter S...    161   3e-43   
ref|XP_011006813.1|  PREDICTED: bidirectional sugar transporter S...    161   3e-43   
ref|XP_004508856.1|  PREDICTED: bidirectional sugar transporter S...    161   3e-43   
ref|XP_003635940.1|  Protein RUPTURED POLLEN GRAIN                      161   3e-43   
gb|ACJ85342.1|  unknown                                                 161   3e-43   Medicago truncatula
ref|XP_009360807.1|  PREDICTED: bidirectional sugar transporter S...    161   3e-43   
ref|XP_008371546.1|  PREDICTED: bidirectional sugar transporter S...    161   3e-43   
gb|EAY74427.1|  hypothetical protein OsI_02317                          161   3e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_001043270.1|  Os01g0541800                                       161   4e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644291.1|  PREDICTED: bidirectional sugar transporter S...    161   4e-43   
ref|XP_002960314.1|  hypothetical protein SELMODRAFT_437420             160   4e-43   
ref|XP_008347233.1|  PREDICTED: bidirectional sugar transporter S...    159   4e-43   
ref|XP_006355568.1|  PREDICTED: bidirectional sugar transporter S...    160   4e-43   
ref|XP_004294170.1|  PREDICTED: bidirectional sugar transporter S...    160   4e-43   
ref|XP_010521381.1|  PREDICTED: bidirectional sugar transporter S...    161   5e-43   
ref|XP_009416883.1|  PREDICTED: bidirectional sugar transporter S...    160   6e-43   
ref|XP_008368421.1|  PREDICTED: bidirectional sugar transporter S...    160   6e-43   
ref|XP_010922652.1|  PREDICTED: bidirectional sugar transporter S...    160   6e-43   
ref|XP_009395814.1|  PREDICTED: bidirectional sugar transporter S...    160   6e-43   
ref|XP_008357047.1|  PREDICTED: bidirectional sugar transporter S...    159   6e-43   
ref|XP_010922627.1|  PREDICTED: bidirectional sugar transporter S...    160   7e-43   
ref|XP_003569166.1|  PREDICTED: bidirectional sugar transporter S...    160   8e-43   
ref|XP_010925760.1|  PREDICTED: bidirectional sugar transporter S...    160   8e-43   
ref|XP_004233011.1|  PREDICTED: bidirectional sugar transporter S...    160   8e-43   
ref|XP_010530419.1|  PREDICTED: bidirectional sugar transporter S...    160   9e-43   
ref|XP_008784372.1|  PREDICTED: bidirectional sugar transporter S...    160   1e-42   
ref|XP_006396996.1|  hypothetical protein EUTSA_v10029447mg             160   1e-42   
ref|XP_004960626.1|  PREDICTED: bidirectional sugar transporter S...    159   1e-42   
gb|KCW71180.1|  hypothetical protein EUGRSUZ_F04274                     160   1e-42   
ref|XP_008792820.1|  PREDICTED: bidirectional sugar transporter S...    159   1e-42   
ref|XP_010093445.1|  Bidirectional sugar transporter SWEET2             159   1e-42   
ref|XP_006422124.1|  hypothetical protein CICLE_v10007057mg             159   1e-42   
ref|XP_002888545.1|  nodulin MtN3 family protein                        160   2e-42   
ref|XP_006843876.1|  hypothetical protein AMTR_s00007p00265730          161   2e-42   
ref|XP_002283068.1|  PREDICTED: bidirectional sugar transporter S...    159   2e-42   Vitis vinifera
ref|XP_010925963.1|  PREDICTED: bidirectional sugar transporter S...    159   2e-42   
ref|XP_007211946.1|  hypothetical protein PRUPE_ppa010808mg             159   2e-42   
ref|XP_011028586.1|  PREDICTED: bidirectional sugar transporter S...    159   3e-42   
ref|XP_002267886.1|  PREDICTED: bidirectional sugar transporter S...    159   3e-42   Vitis vinifera
ref|XP_009604427.1|  PREDICTED: bidirectional sugar transporter S...    159   3e-42   
ref|XP_002321585.1|  hypothetical protein POPTR_0015s08560g             158   3e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009404049.1|  PREDICTED: bidirectional sugar transporter S...    158   3e-42   
ref|XP_010695602.1|  PREDICTED: bidirectional sugar transporter S...    159   4e-42   
ref|XP_009352039.1|  PREDICTED: bidirectional sugar transporter S...    158   4e-42   
ref|XP_002967398.1|  hypothetical protein SELMODRAFT_408391             158   4e-42   
gb|KDP45367.1|  hypothetical protein JCGZ_09616                         158   5e-42   
ref|XP_008228135.1|  PREDICTED: bidirectional sugar transporter S...    157   5e-42   
ref|XP_010675263.1|  PREDICTED: bidirectional sugar transporter S...    157   6e-42   
gb|KGN49882.1|  hypothetical protein Csa_5G139600                       158   6e-42   
gb|KCW89186.1|  hypothetical protein EUGRSUZ_A01497                     159   6e-42   
ref|XP_007217280.1|  hypothetical protein PRUPE_ppa017677mg             157   6e-42   
ref|XP_004170509.1|  PREDICTED: bidirectional sugar transporter S...    158   7e-42   
ref|XP_003526694.1|  PREDICTED: bidirectional sugar transporter S...    158   7e-42   
ref|XP_006401731.1|  hypothetical protein EUTSA_v10014447mg             158   8e-42   
ref|XP_009762096.1|  PREDICTED: bidirectional sugar transporter S...    157   8e-42   
ref|XP_009601651.1|  PREDICTED: bidirectional sugar transporter S...    158   8e-42   
ref|XP_002454927.1|  hypothetical protein SORBIDRAFT_03g001520          157   1e-41   
ref|XP_009352052.1|  PREDICTED: bidirectional sugar transporter S...    157   1e-41   
ref|XP_008800934.1|  PREDICTED: bidirectional sugar transporter S...    157   1e-41   
dbj|BAB08422.1|  MtN3 protein-like                                      157   1e-41   
ref|XP_010259506.1|  PREDICTED: bidirectional sugar transporter S...    160   1e-41   
ref|XP_007038962.1|  Nodulin MtN3 family protein                        157   1e-41   
ref|XP_009127187.1|  PREDICTED: bidirectional sugar transporter S...    157   2e-41   
gb|KEH38546.1|  sodium bile acid symporter family protein               164   2e-41   
emb|CDX96199.1|  BnaC02g14520D                                          157   2e-41   
ref|XP_010915992.1|  PREDICTED: bidirectional sugar transporter S...    157   2e-41   
ref|XP_008783153.1|  PREDICTED: bidirectional sugar transporter S...    157   2e-41   
emb|CDX98492.1|  BnaC05g38830D                                          156   2e-41   
emb|CDX90787.1|  BnaA03g24670D                                          155   2e-41   
sp|Q0J349.2|SWT7B_ORYSJ  RecName: Full=Bidirectional sugar transp...    157   2e-41   
ref|XP_002885055.1|  nodulin MtN3 family protein                        156   3e-41   
ref|XP_004234178.1|  PREDICTED: bidirectional sugar transporter S...    156   3e-41   
ref|XP_010926193.1|  PREDICTED: bidirectional sugar transporter S...    155   3e-41   
ref|XP_008374456.1|  PREDICTED: bidirectional sugar transporter S...    155   3e-41   
ref|XP_007025233.1|  Nodulin MtN3 family protein, putative              155   3e-41   
emb|CDX97600.1|  BnaA05g24790D                                          155   3e-41   
ref|XP_010034631.1|  PREDICTED: bidirectional sugar transporter S...    156   3e-41   
ref|NP_200131.2|  bidirectional sugar transporter SWEET3                156   3e-41   
ref|XP_006644571.1|  PREDICTED: bidirectional sugar transporter S...    155   3e-41   
ref|XP_008225395.1|  PREDICTED: bidirectional sugar transporter S...    155   4e-41   
ref|XP_009768019.1|  PREDICTED: bidirectional sugar transporter S...    155   4e-41   
ref|XP_010063893.1|  PREDICTED: bidirectional sugar transporter S...    154   4e-41   
ref|XP_007036182.1|  Nodulin MtN3 family protein                        155   4e-41   
gb|ACU24301.1|  unknown                                                 156   4e-41   
ref|XP_002872539.1|  nodulin MtN3 family protein                        156   4e-41   
ref|NP_001043983.1|  Os01g0700100                                       155   4e-41   
ref|XP_004293656.1|  PREDICTED: bidirectional sugar transporter S...    155   4e-41   
sp|A2YZ24.1|SWT7B_ORYSI  RecName: Full=Bidirectional sugar transp...    156   5e-41   
ref|NP_566493.1|  bidirectional sugar transporter SWEET2                155   5e-41   
gb|KDP22169.1|  hypothetical protein JCGZ_26000                         155   6e-41   
ref|XP_002518862.1|  conserved hypothetical protein                     155   6e-41   
ref|XP_009360806.1|  PREDICTED: bidirectional sugar transporter S...    155   6e-41   
ref|XP_006852648.1|  hypothetical protein AMTR_s00021p00241520          155   6e-41   
ref|XP_010107268.1|  Bidirectional sugar transporter SWEET7             155   6e-41   
ref|XP_010924221.1|  PREDICTED: bidirectional sugar transporter S...    155   7e-41   
ref|XP_010483997.1|  PREDICTED: bidirectional sugar transporter S...    155   8e-41   
ref|XP_010459386.1|  PREDICTED: bidirectional sugar transporter S...    155   8e-41   
ref|XP_010040792.1|  PREDICTED: bidirectional sugar transporter S...    154   8e-41   
ref|XP_009405124.1|  PREDICTED: bidirectional sugar transporter S...    154   8e-41   
emb|CDM83698.1|  unnamed protein product                                154   9e-41   
gb|KDO77995.1|  hypothetical protein CISIN_1g024679mg                   155   9e-41   
ref|XP_009795065.1|  PREDICTED: bidirectional sugar transporter S...    155   9e-41   
ref|XP_008808693.1|  PREDICTED: bidirectional sugar transporter S...    155   9e-41   
ref|XP_009130234.1|  PREDICTED: bidirectional sugar transporter S...    154   9e-41   
ref|XP_011001912.1|  PREDICTED: bidirectional sugar transporter S...    155   9e-41   
emb|CDY45751.1|  BnaC02g42310D                                          154   1e-40   
ref|XP_002865957.1|  nodulin MtN3 family protein                        155   1e-40   
ref|XP_008371543.1|  PREDICTED: bidirectional sugar transporter S...    154   1e-40   
ref|XP_002513584.1|  conserved hypothetical protein                     154   1e-40   
ref|XP_010465383.1|  PREDICTED: bidirectional sugar transporter S...    154   2e-40   
ref|XP_004171106.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    154   2e-40   
ref|XP_008371545.1|  PREDICTED: bidirectional sugar transporter S...    154   2e-40   
ref|XP_006279858.1|  hypothetical protein CARUB_v10028480mg             154   2e-40   
ref|XP_004952303.1|  PREDICTED: bidirectional sugar transporter S...    154   2e-40   
ref|NP_176849.1|  bidirectional sugar transporter SWEET6                154   2e-40   
ref|XP_010519561.1|  PREDICTED: bidirectional sugar transporter S...    154   2e-40   
ref|XP_010455476.1|  PREDICTED: bidirectional sugar transporter S...    154   2e-40   
gb|EMS57673.1|  Bidirectional sugar transporter SWEET2b                 153   2e-40   
ref|XP_010049431.1|  PREDICTED: bidirectional sugar transporter S...    154   2e-40   
ref|XP_007155413.1|  hypothetical protein PHAVU_003G199300g             153   2e-40   
gb|KHG27771.1|  Bidirectional sugar transporter SWEET7 -like protein    154   3e-40   
ref|XP_009381769.1|  PREDICTED: bidirectional sugar transporter S...    154   3e-40   
ref|XP_010487280.1|  PREDICTED: bidirectional sugar transporter S...    153   3e-40   
ref|XP_010062769.1|  PREDICTED: bidirectional sugar transporter S...    153   3e-40   
ref|XP_006644347.1|  PREDICTED: bidirectional sugar transporter S...    154   3e-40   
gb|EMS47629.1|  Bidirectional sugar transporter SWEET6b                 153   3e-40   
ref|XP_010317476.1|  PREDICTED: bidirectional sugar transporter S...    154   3e-40   
ref|XP_006407046.1|  hypothetical protein EUTSA_v10021415mg             153   4e-40   
ref|XP_009772067.1|  PREDICTED: bidirectional sugar transporter S...    152   4e-40   
ref|XP_008383530.1|  PREDICTED: bidirectional sugar transporter S...    152   4e-40   
ref|XP_004152552.1|  PREDICTED: bidirectional sugar transporter S...    153   4e-40   
ref|XP_010444139.1|  PREDICTED: bidirectional sugar transporter S...    153   4e-40   
ref|XP_010243612.1|  PREDICTED: bidirectional sugar transporter S...    154   4e-40   
ref|XP_010925964.1|  PREDICTED: bidirectional sugar transporter S...    153   4e-40   
gb|EYU25199.1|  hypothetical protein MIMGU_mgv1a021292mg                153   4e-40   
gb|KFK28013.1|  hypothetical protein AALP_AA8G460200                    153   4e-40   
ref|XP_008438271.1|  PREDICTED: bidirectional sugar transporter S...    152   5e-40   
ref|XP_009630053.1|  PREDICTED: bidirectional sugar transporter S...    152   5e-40   
ref|XP_009112036.1|  PREDICTED: bidirectional sugar transporter S...    152   5e-40   
ref|XP_003569629.1|  PREDICTED: bidirectional sugar transporter S...    152   5e-40   
emb|CDY16757.1|  BnaA09g06250D                                          152   5e-40   
gb|KFK38831.1|  hypothetical protein AALP_AA3G166000                    152   6e-40   
gb|KDP25260.1|  hypothetical protein JCGZ_20416                         153   6e-40   
ref|XP_007137571.1|  hypothetical protein PHAVU_009G137700g             152   6e-40   
sp|A2WSD3.1|SWT6B_ORYSI  RecName: Full=Bidirectional sugar transp...    152   7e-40   
ref|XP_006298454.1|  hypothetical protein CARUB_v10014524mg             152   8e-40   
ref|XP_008775460.1|  PREDICTED: bidirectional sugar transporter S...    152   8e-40   
ref|XP_009352020.1|  PREDICTED: bidirectional sugar transporter S...    152   9e-40   
ref|XP_006476341.1|  PREDICTED: bidirectional sugar transporter S...    152   9e-40   
gb|EMT14864.1|  Protein RUPTURED POLLEN GRAIN 1                         152   9e-40   
sp|Q0DJY3.2|SWT3A_ORYSJ  RecName: Full=Bidirectional sugar transp...    152   9e-40   
ref|XP_010422008.1|  PREDICTED: bidirectional sugar transporter S...    152   1e-39   
ref|XP_006360745.1|  PREDICTED: bidirectional sugar transporter S...    152   1e-39   
ref|XP_008393043.1|  PREDICTED: bidirectional sugar transporter S...    152   1e-39   
ref|XP_010111763.1|  Bidirectional sugar transporter SWEET6b            152   1e-39   
ref|XP_007040592.1|  Nodulin MtN3 family protein isoform 1              152   1e-39   
ref|XP_010555611.1|  PREDICTED: bidirectional sugar transporter S...    152   1e-39   
ref|XP_004969103.1|  PREDICTED: bidirectional sugar transporter S...    152   1e-39   
ref|XP_010060764.1|  PREDICTED: bidirectional sugar transporter S...    151   2e-39   
ref|NP_567366.1|  bidirectional sugar transporter SWEET7                152   2e-39   
ref|XP_003563427.1|  PREDICTED: bidirectional sugar transporter S...    151   2e-39   
ref|XP_006401730.1|  hypothetical protein EUTSA_v10014447mg             151   2e-39   
ref|XP_009409477.1|  PREDICTED: bidirectional sugar transporter S...    151   2e-39   
emb|CDY05123.1|  BnaC03g29210D                                          150   2e-39   
ref|XP_010442876.1|  PREDICTED: bidirectional sugar transporter S...    151   2e-39   
ref|XP_006394345.1|  hypothetical protein EUTSA_v10004842mg             150   3e-39   
gb|KCW69900.1|  hypothetical protein EUGRSUZ_F03230                     150   3e-39   
ref|XP_003544116.1|  PREDICTED: bidirectional sugar transporter S...    151   3e-39   
ref|XP_004515200.1|  PREDICTED: bidirectional sugar transporter S...    150   3e-39   
ref|XP_008230949.1|  PREDICTED: bidirectional sugar transporter S...    150   3e-39   
gb|KDO49282.1|  hypothetical protein CISIN_1g022823mg                   152   3e-39   
ref|XP_003572491.1|  PREDICTED: bidirectional sugar transporter S...    150   3e-39   
ref|NP_001046621.1|  Os02g0301100                                       151   3e-39   
ref|NP_001043523.2|  Os01g0606000                                       151   4e-39   
sp|A2WSD8.1|SWT6A_ORYSI  RecName: Full=Bidirectional sugar transp...    151   4e-39   
gb|EMT16545.1|  Protein RUPTURED POLLEN GRAIN 1                         150   4e-39   
ref|XP_009130235.1|  PREDICTED: bidirectional sugar transporter S...    150   4e-39   
ref|XP_010502075.1|  PREDICTED: bidirectional sugar transporter S...    150   4e-39   
emb|CDY20083.1|  BnaA01g29190D                                          150   4e-39   
ref|XP_007217416.1|  hypothetical protein PRUPE_ppa024244mg             149   5e-39   
ref|XP_004969658.1|  PREDICTED: bidirectional sugar transporter S...    150   5e-39   
ref|XP_004145981.1|  PREDICTED: bidirectional sugar transporter S...    150   5e-39   
ref|XP_004300494.1|  PREDICTED: bidirectional sugar transporter S...    150   5e-39   
gb|KHG04958.1|  Bidirectional sugar transporter SWEET7 -like protein    150   5e-39   
ref|XP_006281467.1|  hypothetical protein CARUB_v10027550mg             150   6e-39   
ref|XP_002866519.1|  hypothetical protein ARALYDRAFT_496468             150   6e-39   
ref|XP_006654158.1|  PREDICTED: bidirectional sugar transporter S...    150   6e-39   
ref|XP_010927277.1|  PREDICTED: bidirectional sugar transporter S...    150   6e-39   
ref|XP_006439288.1|  hypothetical protein CICLE_v10024343mg             150   7e-39   
ref|XP_004143859.1|  PREDICTED: bidirectional sugar transporter S...    150   7e-39   
ref|XP_010678743.1|  PREDICTED: bidirectional sugar transporter S...    149   8e-39   
ref|XP_010034633.1|  PREDICTED: bidirectional sugar transporter S...    149   8e-39   
ref|NP_001043522.1|  Os01g0605700                                       150   8e-39   
ref|XP_004308007.1|  PREDICTED: bidirectional sugar transporter S...    149   9e-39   
ref|XP_010445610.1|  PREDICTED: bidirectional sugar transporter S...    150   9e-39   
ref|NP_001149011.1|  LOC100282631                                       149   9e-39   
ref|XP_010436689.1|  PREDICTED: bidirectional sugar transporter S...    149   1e-38   
ref|XP_004300894.1|  PREDICTED: bidirectional sugar transporter S...    149   1e-38   
emb|CDY56741.1|  BnaC09g50910D                                          149   1e-38   
ref|XP_004162108.1|  PREDICTED: bidirectional sugar transporter S...    149   1e-38   
ref|XP_010025254.1|  PREDICTED: bidirectional sugar transporter S...    149   1e-38   
ref|XP_009116660.1|  PREDICTED: bidirectional sugar transporter S...    149   1e-38   
ref|XP_002456211.1|  hypothetical protein SORBIDRAFT_03g032190          149   1e-38   
ref|XP_009788248.1|  PREDICTED: bidirectional sugar transporter S...    149   1e-38   
emb|CDY32341.1|  BnaC01g36600D                                          148   2e-38   
ref|XP_011071833.1|  PREDICTED: bidirectional sugar transporter S...    149   2e-38   
ref|XP_009146326.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    148   2e-38   
ref|XP_007040593.1|  Nodulin MtN3 family protein, putative isoform 2    149   2e-38   
ref|XP_010482706.1|  PREDICTED: bidirectional sugar transporter S...    149   2e-38   
gb|KCW67619.1|  hypothetical protein EUGRSUZ_F01371                     149   2e-38   
ref|XP_004252656.1|  PREDICTED: bidirectional sugar transporter S...    148   2e-38   
ref|NP_201091.2|  bidirectional sugar transporter SWEET5                148   2e-38   
ref|XP_007199140.1|  hypothetical protein PRUPE_ppa019530mg             148   2e-38   
ref|XP_004952305.1|  PREDICTED: bidirectional sugar transporter S...    149   2e-38   
ref|XP_002985731.1|  hypothetical protein SELMODRAFT_424686             154   2e-38   
ref|XP_008374457.1|  PREDICTED: bidirectional sugar transporter S...    147   2e-38   
ref|XP_006289873.1|  hypothetical protein CARUB_v10003485mg             149   2e-38   
gb|ADE76727.1|  unknown                                                 149   3e-38   
ref|XP_006299003.1|  hypothetical protein CARUB_v10015138mg             148   3e-38   
ref|XP_002453768.1|  hypothetical protein SORBIDRAFT_04g015420          148   3e-38   
ref|XP_003541525.1|  PREDICTED: bidirectional sugar transporter S...    148   3e-38   
ref|XP_010033268.1|  PREDICTED: bidirectional sugar transporter S...    148   3e-38   
ref|XP_004146078.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    147   3e-38   
ref|XP_009127188.1|  PREDICTED: bidirectional sugar transporter S...    148   3e-38   
ref|NP_001140368.1|  uncharacterized protein LOC100272419               147   3e-38   
ref|XP_008437400.1|  PREDICTED: bidirectional sugar transporter S...    148   3e-38   
gb|KDP31116.1|  hypothetical protein JCGZ_11492                         147   3e-38   
ref|XP_004963467.1|  PREDICTED: bidirectional sugar transporter S...    148   4e-38   
gb|ACN27754.1|  unknown                                                 148   4e-38   
ref|XP_008673522.1|  PREDICTED: bidirectional sugar transporter S...    148   4e-38   
gb|KHG29008.1|  Bidirectional sugar transporter SWEET7 -like protein    148   4e-38   
ref|NP_001143639.1|  uncharacterized protein LOC100276360               148   4e-38   
ref|XP_009613290.1|  PREDICTED: bidirectional sugar transporter S...    147   4e-38   
gb|AHG94617.1|  sugar transporter                                       147   4e-38   
ref|XP_008237119.1|  PREDICTED: bidirectional sugar transporter S...    147   4e-38   
ref|XP_003568735.1|  PREDICTED: bidirectional sugar transporter S...    147   4e-38   
ref|XP_011036889.1|  PREDICTED: bidirectional sugar transporter S...    147   4e-38   
ref|XP_010107266.1|  Bidirectional sugar transporter SWEET4             148   5e-38   
ref|XP_004498397.1|  PREDICTED: bidirectional sugar transporter S...    148   5e-38   
ref|XP_004153501.1|  PREDICTED: bidirectional sugar transporter S...    149   5e-38   
ref|XP_004502067.1|  PREDICTED: bidirectional sugar transporter S...    147   6e-38   
ref|XP_004161952.1|  PREDICTED: bidirectional sugar transporter S...    148   6e-38   
ref|XP_002318374.1|  hypothetical protein POPTR_0012s01400g             147   6e-38   
ref|XP_006647194.1|  PREDICTED: bidirectional sugar transporter S...    147   6e-38   
ref|XP_010925759.1|  PREDICTED: bidirectional sugar transporter S...    148   7e-38   
ref|XP_006600650.1|  PREDICTED: bidirectional sugar transporter S...    146   7e-38   
gb|KEH40411.1|  bidirectional sugar transporter                         147   8e-38   
ref|XP_009615359.1|  PREDICTED: bidirectional sugar transporter S...    147   8e-38   
ref|NP_001150719.1|  seven-transmembrane-domain protein 1               147   9e-38   
emb|CDP14575.1|  unnamed protein product                                146   9e-38   
dbj|BAJ94303.1|  predicted protein                                      146   9e-38   
ref|XP_007160194.1|  hypothetical protein PHAVU_002G300900g             147   9e-38   
ref|XP_004305773.1|  PREDICTED: bidirectional sugar transporter S...    146   1e-37   
ref|XP_009129386.1|  PREDICTED: bidirectional sugar transporter S...    147   1e-37   
ref|XP_006470352.1|  PREDICTED: bidirectional sugar transporter S...    146   1e-37   
ref|XP_006345190.1|  PREDICTED: bidirectional sugar transporter S...    146   1e-37   
ref|XP_002441609.1|  hypothetical protein SORBIDRAFT_09g030270          146   1e-37   
ref|NP_001168479.1|  uncharacterized protein LOC100382256               147   1e-37   
ref|XP_002455919.1|  hypothetical protein SORBIDRAFT_03g027260          146   1e-37   
tpg|DAA52821.1|  TPA: hypothetical protein ZEAMMB73_558646              149   1e-37   
ref|XP_010695604.1|  PREDICTED: bidirectional sugar transporter S...    147   1e-37   
ref|XP_010042024.1|  PREDICTED: bidirectional sugar transporter S...    145   1e-37   
emb|CDP12368.1|  unnamed protein product                                145   1e-37   
ref|XP_006350581.1|  PREDICTED: bidirectional sugar transporter S...    147   1e-37   
ref|XP_002453747.1|  hypothetical protein SORBIDRAFT_04g012910          146   2e-37   
ref|XP_010090241.1|  Bidirectional sugar transporter SWEET6b            146   2e-37   



>ref|XP_006356306.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Solanum 
tuberosum]
Length=253

 Score =   272 bits (696),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 149/253 (59%), Positives = 182/253 (72%), Gaps = 1/253 (0%)
 Frame = +1

Query  115  GLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            G+  TLH  FGIF NATA F+FLAPI TFKR+I+ RSTE+FSG PYV+T L+C+L AWYG
Sbjct  2    GVVHTLHFVFGIFGNATALFLFLAPIITFKRVIQNRSTEQFSGLPYVMTLLNCLLSAWYG  61

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
            LPFVSPNN+LV+TI+G G VIE  +V+IFI FAP  EKKKI  LL+LV+ +F AVAL+S+
Sbjct  62   LPFVSPNNLLVSTINGTGAVIETIYVLIFIAFAPSKEKKKISALLLLVLTVFAAVALVSM  121

Query  475  fvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
               HG  R+LFCG AA I + IMY SPLS+IR+V+KTKSVEFMPF L+  + LC  +W  
Sbjct  122  LALHGSKRKLFCGIAATIFSIIMYGSPLSIIRLVIKTKSVEFMPFFLSLFVFLCGASWFA  181

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKK  834
            FGLL KDPFV +PN  G G+G +QLILYAIY EK  F T K +F   +   N     E+K
Sbjct  182  FGLLGKDPFVAIPNGFGFGLGTVQLILYAIYCEKKGF-TKKSTFDESLTTGNVKSHQEEK  240

Query  835  QPSITSSKYDELV  873
            Q S  +    E V
Sbjct  241  QSSNNNKSKLEQV  253



>ref|XP_004237722.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Solanum 
lycopersicum]
Length=246

 Score =   265 bits (676),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 145/243 (60%), Positives = 176/243 (72%), Gaps = 5/243 (2%)
 Frame = +1

Query  115  GLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            G+  TLH  FGIF NATA F+FLAPI TFKR+I+ RSTE+FSG PYV+T L+C+L AWYG
Sbjct  2    GVVHTLHFVFGIFGNATALFLFLAPIITFKRVIQNRSTEQFSGLPYVMTLLNCLLSAWYG  61

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
            LPFVSPNN+LV+TI+G G VIE  +V+IFI FAP  EKKKI  L +LV+ +F AVAL+S+
Sbjct  62   LPFVSPNNLLVSTINGTGAVIETIYVLIFIAFAPTKEKKKISALFLLVLTVFAAVALVSM  121

Query  475  fvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
               HG  R+LFCG AA I + IMY SPLS+IR+V+KTKSVEFMPF L+  + LC  +W  
Sbjct  122  LGLHGSKRKLFCGIAATIFSIIMYGSPLSIIRLVIKTKSVEFMPFFLSLFVFLCGASWFA  181

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKK  834
            FGLL KDPFV +PN  G G+G +QLILYAIY EK  F T K +        N     E+K
Sbjct  182  FGLLGKDPFVAIPNGFGFGLGTVQLILYAIYCEKKGF-TRKSNLDES----NGKSHQEEK  236

Query  835  QPS  843
            Q S
Sbjct  237  QSS  239



>ref|XP_011101820.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Sesamum 
indicum]
Length=246

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/252 (55%), Positives = 178/252 (71%), Gaps = 6/252 (2%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            +  TLH  FGIF NA A F+FLAP+ TFKRI+KKRSTE+FSG PYV+T L+C+L  WYGL
Sbjct  1    MENTLHFVFGIFGNAFALFLFLAPLITFKRIVKKRSTEQFSGIPYVMTLLNCLLSCWYGL  60

Query  298  PFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvf  477
            PFVSPNN+LV+TI+G G  IE  +V+IF++FAPK EK KI  LL +V+ +F  V  +S+F
Sbjct  61   PFVSPNNLLVSTINGTGAAIESVYVLIFLIFAPKKEKGKILGLLSIVLAVFATVVFVSLF  120

Query  478  vfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIF  657
              HG  R+LFCG AA + + IMY SPL++IR+V+KTKSVEFMPF L+  + LC T+W +F
Sbjct  121  ALHGNARKLFCGIAATVFSIIMYGSPLTIIRLVIKTKSVEFMPFFLSLFVFLCGTSWFVF  180

Query  658  GLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            GLL KDPFV +PN  GCG+G +QLILYAIY +       +   S  M + N+    EK  
Sbjct  181  GLLGKDPFVAIPNGFGCGLGAVQLILYAIYRDN----KGQNKGSLEMEKTNSKSHQEK--  234

Query  838  PSITSSKYDELV  873
            PS +    DE V
Sbjct  235  PSNSLHSQDEQV  246



>ref|XP_009792705.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Nicotiana 
sylvestris]
Length=247

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 175/231 (76%), Gaps = 1/231 (0%)
 Frame = +1

Query  115  GLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            G+  TLH  FGIF NATA F+FLAPI TFKRII+KRSTE+FSG PYV+T L+C+L AWYG
Sbjct  2    GVVHTLHFVFGIFGNATALFLFLAPIITFKRIIQKRSTEQFSGLPYVMTLLNCLLSAWYG  61

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
            LPFVSPNN+LV+TI+G G  IE  +V+IFI FAPK EKKKI  LL+LV+ +F AVAL+S+
Sbjct  62   LPFVSPNNLLVSTINGTGAAIESIYVLIFIAFAPKKEKKKISALLLLVLAVFAAVALVSM  121

Query  475  fvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
               HG  R+LFCG AA I + IMY SPLS+IR+V+KTKSVEFMPF L+  + LC  +W  
Sbjct  122  LALHGNNRKLFCGIAATIFSIIMYGSPLSIIRLVIKTKSVEFMPFFLSLFVFLCGASWFA  181

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQI  807
            FGLL KDPFV +PN  G G+G +QLILYAIY +K    T K+S     L+I
Sbjct  182  FGLLGKDPFVAIPNGFGFGLGTVQLILYAIYCDKKGLFT-KKSTPDDSLEI  231



>ref|XP_009625661.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Nicotiana 
tomentosiformis]
Length=245

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 176/241 (73%), Gaps = 1/241 (0%)
 Frame = +1

Query  115  GLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            G+  TLH  FGIF NATA F+FLAPI T KRI++KRSTE+FSG PYV+T L+C+L AWYG
Sbjct  2    GVVHTLHFVFGIFGNATALFLFLAPIITSKRIVQKRSTEQFSGLPYVMTLLNCLLSAWYG  61

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
            LPFVSPNN+LV+TI+G G  IE  +V+IFI FAPK EKKKI  LL+LV+ +F AVAL+S+
Sbjct  62   LPFVSPNNLLVSTINGTGAAIESIYVLIFIAFAPKKEKKKISALLLLVLAVFAAVALVSM  121

Query  475  fvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
               HG  R+LFCG AA I + IMY SPLS+IR+V+KTKSVEFMPF L+  + LC  +W  
Sbjct  122  LALHGNNRKLFCGIAATIFSIIMYGSPLSIIRLVIKTKSVEFMPFFLSLFVFLCGASWFA  181

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKK  834
            FGLL KDPFV +PN  G G+G +QLILYAIY +K    T K+S     L++       K 
Sbjct  182  FGLLGKDPFVAIPNGFGFGLGTVQLILYAIYCDKKELFT-KKSTPDDSLEMGNDKSSGKS  240

Query  835  Q  837
            +
Sbjct  241  R  241



>gb|AFK49066.1| unknown [Lotus japonicus]
Length=247

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 171/242 (71%), Gaps = 0/242 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NA+A F+FLAP+ TFKRII  RSTEEFSGFPYV+T L+C+L AWYGLPFVSP
Sbjct  5    HFVFGIFGNASALFLFLAPVITFKRIITNRSTEEFSGFPYVMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILV+T++G G  IE+ +V+IFI  APK EK KI  L   V+ +F  V  +S+   HG 
Sbjct  65   DNILVSTVNGTGAAIEIVYVLIFITLAPKKEKAKIFCLFTFVLLVFSVVIFVSLCALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I +AIMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W IFGL+  
Sbjct  125  SRKLFCGFAAAIFSAIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLIGH  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV VPN +G  +G +QLILY IY +K      + +     ++      H++KQP+   
Sbjct  185  DPFVAVPNGIGSILGTMQLILYFIYRDKKCVPRKQATTKEESMETGHAKPHKEKQPNANG  244

Query  853  SK  858
            ++
Sbjct  245  AQ  246



>ref|XP_010062171.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Eucalyptus 
grandis]
 gb|KCW69241.1| hypothetical protein EUGRSUZ_F02749 [Eucalyptus grandis]
Length=256

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 174/253 (69%), Gaps = 5/253 (2%)
 Frame = +1

Query  130  LHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVS  309
            LH  FGIF NATA F+FLAP  TFKRIIK RSTEEFSG PYV+T L+C+L AWYGLPFVS
Sbjct  4    LHFVFGIFGNATALFLFLAPAITFKRIIKSRSTEEFSGIPYVMTLLNCLLSAWYGLPFVS  63

Query  310  PNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHG  489
            PNN+LV+TI+G G  IE  +VVIF++FAP+ EK KI  LL  V+ +F AVAL+S+   HG
Sbjct  64   PNNLLVSTINGTGAAIEFVYVVIFLIFAPRKEKAKILGLLTFVLTVFAAVALVSLLALHG  123

Query  490  RIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLE  669
              R+LFCG AA + + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W I+GLL 
Sbjct  124  NKRKLFCGVAATVFSIIMYASPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFIYGLLG  183

Query  670  KDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQP---  840
             DPFV VPN  G G+G +QLILYAIY         K +    M  +    +   + P   
Sbjct  184  HDPFVAVPNGFGSGLGAMQLILYAIYRNNKGEPKKKVNNDGSMEMMGGTGKDADRDPVKH  243

Query  841  --SITSSKYDELV  873
              S T+ + DE V
Sbjct  244  QLSSTNKQVDEQV  256



>gb|AFK34328.1| unknown [Lotus japonicus]
Length=247

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 170/242 (70%), Gaps = 0/242 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NA+A F+FLAP+ TFKRII  RSTEEFSGFPYV+T L+C+L AWYGLPFVSP
Sbjct  5    HFVFGIFGNASALFLFLAPVITFKRIITNRSTEEFSGFPYVMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILV+T++G G  IE+ +V+IFI  APK EK KI  L   V+ +F  V  +S+   HG 
Sbjct  65   DNILVSTVNGTGAAIEIVYVLIFITLAPKKEKAKIFCLFTFVLLVFSVVIFVSLCALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I +AIMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W IFGL+  
Sbjct  125  SRKLFCGFAAAIFSAIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLIGH  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV VPN +G  +G +QLILY IY +K      + +     ++      H++KQ +   
Sbjct  185  DPFVAVPNGIGSILGTMQLILYFIYRDKKCVPRKQATTKEESMETGHAKPHKEKQSNANG  244

Query  853  SK  858
            ++
Sbjct  245  AQ  246



>ref|XP_002526178.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36254.1| conserved hypothetical protein [Ricinus communis]
Length=248

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 172/248 (69%), Gaps = 3/248 (1%)
 Frame = +1

Query  130  LHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVS  309
            LH  FG+F NATA F+FL+P  TFKRIIK +STE+FSG PYV+T L+C+L AWYGLPFVS
Sbjct  4    LHFLFGVFGNATALFLFLSPTITFKRIIKSKSTEQFSGIPYVMTLLNCLLSAWYGLPFVS  63

Query  310  PNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHG  489
             NN+LV+TI+G G VIE  +V+IFI++AP+ EK KI  L  LV+ IF  VA +S+F  HG
Sbjct  64   KNNLLVSTINGTGAVIETIYVLIFIIYAPRREKSKILGLFTLVLTIFALVAFVSLFALHG  123

Query  490  RIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLE  669
              R+LFCG AA I + IMY SPLS+IR+V+KTKSVEFMPF L+  + LC T+W I+GLL 
Sbjct  124  STRKLFCGLAATIFSIIMYASPLSIIRLVIKTKSVEFMPFFLSLFVFLCGTSWFIYGLLG  183

Query  670  KDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSIT  849
            +DPFV +PN  GCG+G LQLILY IY         K+  +    Q   M    K Q  + 
Sbjct  184  RDPFVAIPNGFGCGLGTLQLILYFIYRNSKASAEAKKQPTS---QSMEMGPSGKPQKMVA  240

Query  850  SSKYDELV  873
            +   DE V
Sbjct  241  NGSQDEQV  248



>emb|CDP11997.1| unnamed protein product [Coffea canephora]
Length=248

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 176/240 (73%), Gaps = 6/240 (3%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NA+A F+FLAP+ TF+RII KRSTE+FSG PYV+T L+C+L AWYGLPFVSP
Sbjct  6    HFVFGVFGNASALFLFLAPVITFRRIIIKRSTEQFSGVPYVMTLLNCLLSAWYGLPFVSP  65

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +N+ V+TI+G G  IE  +V+IF++FAPK EK KI  +L+LV+  F AVAL+S+FV HG+
Sbjct  66   HNLPVSTINGTGAAIEFIYVLIFLIFAPKKEKTKIFSILVLVITAFAAVALVSLFVLHGQ  125

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA I +  MY SPL++IR+V+KTKSVEFMPF L+  + LC T+W IFGLL +
Sbjct  126  SRKLFCGLAATIFSITMYASPLTIIRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLLGR  185

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQI----NAMPQHEKKQP  840
            DPFV +PN  G G+G +QLILYAIY +       KR  S    Q+    N  PQ EK+ P
Sbjct  186  DPFVAIPNGFGSGLGTVQLILYAIYHDNK--GPGKREVSDASSQLKDLENGKPQEEKQTP  243



>gb|EYU32456.1| hypothetical protein MIMGU_mgv1a012592mg [Erythranthe guttata]
Length=245

 Score =   251 bits (641),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/252 (52%), Positives = 178/252 (71%), Gaps = 7/252 (3%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            +   LH  FGIF NA+A F+FLAP+ TFKRI+  +ST++FSG PYV+T L+C+L AWYGL
Sbjct  1    MENVLHFVFGIFGNASALFLFLAPLITFKRIVMNKSTQQFSGIPYVMTLLNCLLSAWYGL  60

Query  298  PFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvf  477
            PFVSPNN+LV+TI+G G VIE  +V++F+VFAPK EK K+  LL +V+ IF  V L+S+ 
Sbjct  61   PFVSPNNLLVSTINGTGAVIESVYVIVFLVFAPKKEKAKMLGLLSVVLTIFGTVVLVSLL  120

Query  478  vfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIF  657
            V HG  R+LFCG    I + +MY SPL++IR+V+KTKSVEFMPF L+  + LC T+W +F
Sbjct  121  VLHGNGRKLFCGVVTTIFSIVMYGSPLTIIRLVIKTKSVEFMPFFLSLFVFLCGTSWFVF  180

Query  658  GLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            GLL KDPFV +PN  GCG+G +QLILYAIY +      IK+      ++++ +   + +Q
Sbjct  181  GLLGKDPFVAIPNGFGCGLGAVQLILYAIYRKNK--GEIKKQTGEESVEMDKIGNGKTEQ  238

Query  838  PSITSSKYDELV  873
                  K DE V
Sbjct  239  -----QKQDEQV  245



>ref|XP_010270425.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Nelumbo nucifera]
Length=243

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/238 (57%), Positives = 171/238 (72%), Gaps = 6/238 (3%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NATA F+FLAP  TF+RIIK +STE+FSG PYV+T L+C+L AWYGLPFVSP
Sbjct  5    HFLFGIFGNATALFLFLAPTITFRRIIKNKSTEKFSGLPYVMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILV+TI+G G+ IE  +V+IFI++APK EK KI  LL  V+ +F AVA++S+   HG 
Sbjct  65   HNILVSTINGTGSAIESVYVLIFIIYAPKKEKAKILALLSFVLAVFSAVAVVSLCALHGS  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W IFGLL +
Sbjct  125  SRKLFCGLAATIFSIIMYASPLSIVRMVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQH---EKKQ  837
            DPFV VPN  GC +G +QLILYAIY +        ++    M      PQ    EKKQ
Sbjct  185  DPFVAVPNGFGCALGTVQLILYAIYRKNK---GGAKADDDSMEMGYGKPQQQVEEKKQ  239



>ref|XP_003526670.1| PREDICTED: bidirectional sugar transporter SWEET1 isoform X1 
[Glycine max]
Length=247

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 171/236 (72%), Gaps = 1/236 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NA+A F+FLAP+ TFKRIIK RSTE+FSG PYV+T L+C+L AWYGLPFVSP
Sbjct  5    HFLFGIFGNASALFLFLAPVITFKRIIKNRSTEKFSGIPYVMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILV+T++G G+ IE+ +V+IFIV AP+ EK KI  L   V+ +F AV  +S+F  HG 
Sbjct  65   HNILVSTVNGTGSFIEIIYVLIFIVLAPRKEKAKILGLFTFVLSVFSAVVFVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W IFGLL +
Sbjct  125  SRKLFCGFAAAIFSIIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSE-KTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            DPFV VPN VG  +G +QLILY IY + K +      +    M   +A PQ  K+ 
Sbjct  185  DPFVAVPNGVGSALGTMQLILYFIYRDNKGVPRKQAPTEEESMEMGDAKPQQGKQS  240



>ref|XP_004150723.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Cucumis 
sativus]
 ref|XP_004167649.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Cucumis 
sativus]
 gb|KGN47489.1| hypothetical protein Csa_6G343690 [Cucumis sativus]
Length=252

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 178/248 (72%), Gaps = 2/248 (1%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+  NATA F+FL+P+ TFKRII+ +STEEFSG PYV+T L+C+L AWYGLPFVSP
Sbjct  5    HFLFGVLGNATALFLFLSPMVTFKRIIRSKSTEEFSGIPYVMTMLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILV+TI+G G VIEL +V++FI++APK EK KIG L    +G F AVAL+SVF   G+
Sbjct  65   HNILVSTINGTGAVIELIYVMVFIIYAPKKEKGKIGGLFGFAMGAFTAVALVSVFALEGK  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            IR+LFCG AA + + IMY SPLS++R V+KTKSVE+MPFLL+  + LC T+W I+GLL +
Sbjct  125  IRKLFCGLAASVFSIIMYGSPLSIMRTVIKTKSVEYMPFLLSLFVFLCGTSWFIYGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHG--MLQINAMPQHEKKQPSI  846
            DPFV VPN  GCG+G LQLILY IY         K + + G  M      PQ +K Q + 
Sbjct  185  DPFVAVPNGFGCGLGALQLILYFIYRAPRPAPDEKPTNNDGPNMEMGLHKPQLDKPQATA  244

Query  847  TSSKYDEL  870
               + D++
Sbjct  245  KVDRDDQV  252



>gb|KDP43062.1| hypothetical protein JCGZ_25248 [Jatropha curcas]
Length=254

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 180/255 (71%), Gaps = 4/255 (2%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            +   LH  FG+F NATA F+FL+P  TFKRIIK +STE+FSG PYV+T L+C+L AWYGL
Sbjct  1    MVNVLHFLFGVFGNATALFLFLSPTITFKRIIKSKSTEQFSGVPYVMTLLNCLLSAWYGL  60

Query  298  PFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvf  477
            PFVS NNILV+TI+G G+VIE  +V++FI++A + EK KI  LL LV+ IF  VA +S+F
Sbjct  61   PFVSKNNILVSTINGTGSVIESIYVLVFILYATRKEKGKILGLLTLVLTIFATVAFVSLF  120

Query  478  vfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIF  657
              HG  R+LFCG AA + + IMY SPLS+IR+V+KTKSVEFMPF L+  + LC T+W ++
Sbjct  121  ALHGSTRKLFCGLAATVFSIIMYASPLSIIRLVIKTKSVEFMPFFLSLFVFLCGTSWFVY  180

Query  658  GLLEKDPFVYVPNAVGCGVGVLQLILYAIYSE-KTIFMT--IKRSFSHGMLQINAMPQHE  828
            GLL  DPFV VPN  GCG+G +QLILY IY   K +  +  +K+  S  +      PQ E
Sbjct  181  GLLGHDPFVAVPNGFGCGLGTVQLILYFIYRNGKGVDDSDDVKKPTSQSVEMGVGKPQLE  240

Query  829  KKQPSITSSKYDELV  873
            K Q  +  S +DE V
Sbjct  241  KNQVMVNGS-HDEQV  254



>ref|XP_002265836.1| PREDICTED: bidirectional sugar transporter SWEET1 [Vitis vinifera]
 emb|CBI19954.3| unnamed protein product [Vitis vinifera]
Length=248

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 171/238 (72%), Gaps = 1/238 (0%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
              LH  FGIF NATA F+FLAP+ TFKRIIK +STE+FSG PYV+T L+C+L AWYGLPF
Sbjct  5    HALHFTFGIFGNATALFLFLAPLITFKRIIKSKSTEQFSGIPYVMTLLNCLLSAWYGLPF  64

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VS NNILV+TI+G G  IE+ +V+IFI ++ K E+ KI  L I V+ +F  V  +S+F  
Sbjct  65   VSKNNILVSTINGTGAAIEIIYVLIFIAYSIKKERAKILGLFIFVLSVFGVVVFVSLFAL  124

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG  R+LFCG AA I + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W +FGL
Sbjct  125  HGHSRKLFCGLAATIFSIIMYASPLSIMRMVIKTKSVEYMPFFLSLFVFLCGTSWFVFGL  184

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            L KDPFV VPN  GCG+G +QLILYAIY +K     +  +     +++   PQ EK+ 
Sbjct  185  LGKDPFVAVPNGFGCGLGAMQLILYAIYCKKGKSKNLAAADKPVDMELGK-PQQEKQS  241



>ref|XP_006434359.1| hypothetical protein CICLE_v10002276mg [Citrus clementina]
 gb|ESR47599.1| hypothetical protein CICLE_v10002276mg [Citrus clementina]
 gb|KDO83581.1| hypothetical protein CISIN_1g025686mg [Citrus sinensis]
Length=249

 Score =   249 bits (636),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TF+RI++++STE+FSG PYV+T L+C+L AWYGLPFVS 
Sbjct  5    HFLFGVFGNATALFLFLAPTITFRRIVRRKSTEQFSGIPYVMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNILV+TI+G G+ IE+ +V+IF++FAPK EK KI  L +LV+ +F AVAL+S+  FHG 
Sbjct  65   NNILVSTINGTGSAIEIIYVLIFLLFAPKKEKAKIFGLFMLVLTVFAAVALVSLLAFHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R++FCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W +FGLL +
Sbjct  125  ARKIFCGFAATIFSIIMYASPLSIMRMVIKTKSVEFMPFFLSLFVFLCGTSWFVFGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            DPFV VPN  GCG+G +QLILY IY +K
Sbjct  185  DPFVAVPNGFGCGLGTMQLILYFIYHKK  212



>ref|XP_003523404.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Glycine 
max]
 gb|KHN44261.1| Bidirectional sugar transporter SWEET1 [Glycine soja]
Length=247

 Score =   249 bits (636),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 170/237 (72%), Gaps = 0/237 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NA+A F+FLAP+ TFKRIIK RSTE+FSG PYV+T L+C+L AWYGLPFVSP
Sbjct  5    HFLFGIFGNASALFLFLAPVITFKRIIKNRSTEKFSGIPYVMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILV+T++G G++IE+ +V+IFIV AP+ EK KI  L   V+ +F AV  +S+F  HG 
Sbjct  65   HNILVSTVNGTGSLIEIIYVLIFIVLAPRKEKAKILGLFTFVLSVFSAVVFVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W IFGLL +
Sbjct  125  SRKLFCGFAAAIFSIIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPS  843
            DPFV VPN VG  +G  QLILY IY +       +       ++I  +   + KQ +
Sbjct  185  DPFVAVPNGVGSALGTTQLILYFIYRDNKGVTGKQAPTEEESMEIGDVKPQQGKQSN  241



>ref|XP_010260493.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Nelumbo 
nucifera]
Length=242

 Score =   249 bits (635),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 131/242 (54%), Positives = 171/242 (71%), Gaps = 10/242 (4%)
 Frame = +1

Query  130  LHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVS  309
            LH  FGIF NAT  F+FLAP  TF RI+K RSTE+FSG PYV+T L+C+L AWYGLPFVS
Sbjct  4    LHFVFGIFGNATGLFLFLAPTITFYRIMKNRSTEQFSGIPYVMTLLNCLLSAWYGLPFVS  63

Query  310  PNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHG  489
            P+NILV+ I+G G  IE  +V+IF++FAPK EK ++  LL  V+ +F AV ++S+   HG
Sbjct  64   PHNILVSVINGTGAAIESVYVLIFLIFAPKKEKARVAALLSFVLAVFSAVVVVSLCALHG  123

Query  490  RIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLE  669
              R++FCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W I+GLL 
Sbjct  124  NTRKIFCGFAATIFSIIMYASPLSIMRIVIKTKSVEFMPFFLSLFVFLCGTSWFIYGLLG  183

Query  670  KDPFVYVPNAVGCGVGVLQLILYAIY------SEKTIFMTIKRSFSHGMLQINAMPQHEK  831
            +DPF+ VPN  GCG+G LQLILYAIY      +E+    ++  S   G+      PQ  +
Sbjct  184  RDPFIAVPNGFGCGLGTLQLILYAIYRKNKGGAEEEAQKSVDDSIEMGL----GKPQGPQ  239

Query  832  KQ  837
             Q
Sbjct  240  SQ  241



>ref|XP_006472908.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Citrus sinensis]
Length=249

 Score =   249 bits (635),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TF+RI++++STE+FSG PYV+T L+C+L AWYGLPFVS 
Sbjct  5    HFLFGVFGNATALFLFLAPTITFRRIVRRKSTEQFSGIPYVMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNILV+TI+G G+ IE+ +V+IF++FAPK EK KI  L +LV+ +F AVAL+S+  FHG 
Sbjct  65   NNILVSTINGTGSAIEIIYVLIFLLFAPKKEKAKIFGLFMLVLTVFAAVALVSLLAFHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R++FCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W +FGLL +
Sbjct  125  ARKIFCGFAATIFSIIMYASPLSIMRMVIKTKSVEFMPFFLSLFVFLCGTSWFVFGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            DPFV VPN  GCG+G +QLILY IY +K
Sbjct  185  DPFVAVPNGFGCGLGTMQLILYFIYHKK  212



>ref|XP_010999825.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Populus 
euphratica]
Length=248

 Score =   249 bits (635),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 178/248 (72%), Gaps = 3/248 (1%)
 Frame = +1

Query  130  LHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVS  309
            LH  FG+F NATA F+FLAP  TFKRII+ +STE+FSG PYV+T L+C+L AWYGLPFVS
Sbjct  4    LHFLFGVFGNATALFLFLAPTITFKRIIRSKSTEQFSGIPYVMTLLNCLLSAWYGLPFVS  63

Query  310  PNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHG  489
             NN+LV+TI+G G+ IE  +V+IF+++APK EK K+  LL LV+ IF  VAL+S+F  HG
Sbjct  64   KNNVLVSTINGAGSAIETIYVLIFLIYAPKKEKAKVLGLLTLVITIFTGVALVSLFALHG  123

Query  490  RIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLE  669
              R+LFCG AA + + IMY SPLS++R V+KTKSVE+MPF L+  + LC T+W ++GL+ 
Sbjct  124  NARKLFCGCAAAVFSIIMYGSPLSIMRTVIKTKSVEYMPFFLSLFVFLCGTSWFVYGLVG  183

Query  670  KDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSIT  849
            +DPFV VPN VGCG+G LQLILY IY         K+      L+I     H++K+  + 
Sbjct  184  RDPFVAVPNGVGCGLGALQLILYFIYRNNK--GEAKKPIPTHSLEIGPGKVHQEKK-LVA  240

Query  850  SSKYDELV  873
            +  +DE V
Sbjct  241  NGSHDEQV  248



>ref|XP_007137524.1| hypothetical protein PHAVU_009G134300g [Phaseolus vulgaris]
 gb|ESW09518.1| hypothetical protein PHAVU_009G134300g [Phaseolus vulgaris]
Length=247

 Score =   248 bits (634),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 171/242 (71%), Gaps = 0/242 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF N +A F+FLAP+ TFKRIIK RSTE+FSG PYV+T L+C+L AWYGLPFVSP
Sbjct  5    HFLFGIFGNVSALFLFLAPVITFKRIIKNRSTEKFSGIPYVMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILV+T++G G++IE+ +V+IFIV APK EK KI  L   V+ +F AV  +S+F  HG 
Sbjct  65   HNILVSTVNGTGSLIEIVYVLIFIVLAPKKEKVKILGLFTFVLSVFSAVVFVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W IFGLL +
Sbjct  125  SRKLFCGFAAAIFSIIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV VPN VG  +G +QLILY IY +       +       +++      + KQ +   
Sbjct  185  DPFVAVPNGVGSALGTMQLILYFIYRDNKGAARKQTPAEEEFMEMGVAKPQQGKQSNANG  244

Query  853  SK  858
            ++
Sbjct  245  TQ  246



>gb|KHG09976.1| Bidirectional sugar transporter SWEET1 -like protein [Gossypium 
arboreum]
Length=316

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 174/251 (69%), Gaps = 1/251 (0%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
              LH  FG+F NATA F+FL+P  TFKRII+ +STE+FSG PYV+T L+C+L AWYGLPF
Sbjct  66   EVLHFVFGVFGNATALFLFLSPTITFKRIIRSKSTEQFSGIPYVMTLLNCLLSAWYGLPF  125

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VS NNILV+TI+G G  IE  +V+IFI++APK EK KI  L   V+ +F AVAL+S+F  
Sbjct  126  VSKNNILVSTINGTGAAIESIYVLIFIIYAPKKEKAKIFGLFTFVLTVFTAVALISLFAL  185

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG  R+LFCG AA I + IMY SPLS++R+V+K+KSVEFMPF L+  + LC T+W I+GL
Sbjct  186  HGNGRKLFCGLAATIFSIIMYASPLSIMRLVIKSKSVEFMPFFLSLFVFLCGTSWFIYGL  245

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGM-LQINAMPQHEKKQP  840
            L +D FV VPN  GCG+G +QLILY IY        IK+   +G  ++I     H+ KQ 
Sbjct  246  LGRDAFVAVPNGFGCGLGTMQLILYFIYRNNKGSQEIKKPSGNGTSIEIGEKKPHQDKQH  305

Query  841  SITSSKYDELV  873
                   DE V
Sbjct  306  PNGKVPQDEQV  316



>gb|AFK49440.1| unknown [Lotus japonicus]
Length=247

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/242 (53%), Positives = 167/242 (69%), Gaps = 0/242 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NA+A F+FLAP+ TFKRII  RSTEEFSGFPYV+T L+C+L AWYGLPFVSP
Sbjct  5    HFVFGIFGNASALFLFLAPVITFKRIITNRSTEEFSGFPYVMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILV+T++G G  IE+ +V+IFI  APK EK KI  L   V+ +F  V  + +    G 
Sbjct  65   DNILVSTVNGTGAAIEIVYVLIFITLAPKKEKAKIFCLFTFVLLVFSVVIFVPLCALRGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I +AIMY SPLS+ R+V+KTKSVEFMPF L+  + LC T+W IFGL+  
Sbjct  125  SRKLFCGFAAAIFSAIMYGSPLSIKRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLIGH  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV VPN +G  +G +QLILY IY +K      + +     ++      H++KQ +   
Sbjct  185  DPFVAVPNGIGSILGTMQLILYFIYRDKKCVPRKQATTKEESMETGHAKPHKEKQSNANG  244

Query  853  SK  858
            ++
Sbjct  245  AQ  246



>ref|XP_004502575.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004502576.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X2 [Cicer arietinum]
Length=247

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/235 (54%), Positives = 171/235 (73%), Gaps = 0/235 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            HL FGIF NA+A F+FLAP+ TFKRII  RSTE+FSG PYV+T L+C+L AWYGLPFVSP
Sbjct  5    HLLFGIFGNASAMFLFLAPVITFKRIIVNRSTEKFSGIPYVMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNILV+T++G G  IE+ +V++FI+F+PK E+ KI  L  +V+ +F  V  +S+F  HG 
Sbjct  65   NNILVSTVNGTGAGIEIIYVLVFIIFSPKKERIKIVGLFTVVLSMFSTVVFVSLFALHGI  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W IFG+L +
Sbjct  125  SRKLFCGFAAAIFSVIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGVLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            D F+ VPN +G  +GV+QLILY IY +K      +     G ++I     ++ KQ
Sbjct  185  DLFIAVPNGLGSVLGVMQLILYFIYRDKKGITKKQAQIEEGSMEIGNAKPYQMKQ  239



>ref|XP_004290589.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Fragaria 
vesca subsp. vesca]
Length=243

 Score =   246 bits (629),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 168/234 (72%), Gaps = 4/234 (2%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FGIF NATA F+FL+P  TFKRI+K RSTE+FSG PYV+T L+C+L AWYGLPFVSPNNI
Sbjct  9    FGIFGNATALFLFLSPTITFKRIVKNRSTEQFSGIPYVMTLLNCLLSAWYGLPFVSPNNI  68

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQ  501
            LV+TI+G G VIE  +V+IFI FAPK EK KI  L   V+ +F  VAL+SVF  HG  R+
Sbjct  69   LVSTINGTGAVIESVYVLIFIAFAPKKEKAKILGLFTFVLAVFSIVALVSVFALHGNSRK  128

Query  502  LFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPF  681
            LFCGFAA I + +MY SPLS++R V+KTKSVEFMPF ++  + LC T+W ++GLL  DPF
Sbjct  129  LFCGFAAAIFSIVMYGSPLSIMRTVVKTKSVEFMPFFMSLFVFLCGTSWFVYGLLGHDPF  188

Query  682  VYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPS  843
            V VPN  GC +G LQLILY  Y +    +  ++  +   +++     H+ KQ +
Sbjct  189  VAVPNGFGCALGALQLILYFFYRD----IKKQQPSAEDSVELGLEKPHQSKQAN  238



>gb|KHG21873.1| Bidirectional sugar transporter SWEET1 -like protein [Gossypium 
arboreum]
Length=250

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 171/237 (72%), Gaps = 0/237 (0%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
              LH  FG+F NATA F+FLAP  TF RII+ +STE+FSG PYV+T L+C+L AWYGLPF
Sbjct  2    EVLHFIFGVFGNATALFLFLAPTITFTRIIRSKSTEQFSGIPYVMTLLNCLLSAWYGLPF  61

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VS NN+LV+TI+G G  IE  +V++FI +APK EK +I  L   V+ +F AVAL+S+F  
Sbjct  62   VSKNNLLVSTINGTGAGIETIYVLVFIFYAPKTEKARILGLFACVLTVFSAVALISLFAL  121

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG  R+LFCG AA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W ++GL
Sbjct  122  HGNGRKLFCGLAATIFSIIMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVYGL  181

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKK  834
            L +D FV +PN  GCG+G +QLILY+IY         K+  ++G +++ A   H++K
Sbjct  182  LGRDAFVAIPNGFGCGLGFMQLILYSIYRNNKGSGQAKKPTANGTVEMGAEKSHQEK  238



>gb|ACU19281.1| unknown [Glycine max]
Length=247

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 169/237 (71%), Gaps = 0/237 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NA+A F+FLAP+ TFKRIIK RSTE+FSG PYV+T L+C+L AWYGLPFV P
Sbjct  5    HFLFGIFGNASALFLFLAPVITFKRIIKNRSTEKFSGIPYVMTLLNCLLSAWYGLPFVFP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILV+T++G G+++E+ +V+IFIV AP+ EK KI  L   V+ +F AV  +S+F  HG 
Sbjct  65   HNILVSTVNGTGSLMEIIYVLIFIVLAPRKEKAKILGLFTFVLSVFSAVVFVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W IFGLL +
Sbjct  125  SRKLFCGFAAAIFSIIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPS  843
            DPFV VPN VG  +G  QLILY IY +       +       ++I  +   + KQ +
Sbjct  185  DPFVAVPNGVGSALGTTQLILYFIYRDNKGVTGKQAPTEEESMEIGDVKPQQGKQSN  241



>ref|XP_009382942.1| PREDICTED: bidirectional sugar transporter SWEET1a-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=249

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 168/234 (72%), Gaps = 0/234 (0%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FGIF NATA F+FL+P+ TF+RII+KRSTE+FSG PY +T L+C+L AWYGLPFVSPNN+
Sbjct  8    FGIFGNATALFLFLSPLVTFQRIIRKRSTEDFSGVPYTMTLLNCLLSAWYGLPFVSPNNL  67

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQ  501
            LV+TI+G G+VIE  +V+IF+VFAPK E+ ++  L   V+ +F  +AL+S+    G+ R+
Sbjct  68   LVSTINGAGSVIEAVYVLIFLVFAPKKERARVAALFTFVLSVFAVIALVSLLALRGQRRK  127

Query  502  LFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPF  681
            +FCGFAA I +  MY SPLS++R+V+KTKSVE+MPFLL+  + LC T+W ++GLL  DPF
Sbjct  128  IFCGFAAAIFSICMYASPLSIMRLVIKTKSVEYMPFLLSLFVFLCGTSWFVYGLLGGDPF  187

Query  682  VYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPS  843
            V VPN  G  +G +QLILYAIY   T           G  ++    +  +K+P 
Sbjct  188  VTVPNGCGSALGAIQLILYAIYRNHTTTDGGSEMNGQGHKRLEDDSRATEKKPD  241



>ref|XP_010911638.1| PREDICTED: bidirectional sugar transporter SWEET1a-like [Elaeis 
guineensis]
Length=246

 Score =   243 bits (621),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 158/213 (74%), Gaps = 0/213 (0%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            + +  H  FGIF NATA F+FL+PI TF RIIK +STE+FSG PY +T L+C L AWYGL
Sbjct  1    MMKVAHFVFGIFGNATALFLFLSPIVTFWRIIKHKSTEDFSGIPYNMTLLNCFLSAWYGL  60

Query  298  PFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvf  477
            PFVSPNN+LV+TI+G G VIEL +V+IFIV+AP+ ++ K      +VV +   VAL+S+F
Sbjct  61   PFVSPNNLLVSTINGTGMVIELVYVMIFIVYAPRKQRIKTLAFFTMVVTVSAMVALVSLF  120

Query  478  vfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIF  657
              H   R+LFCGFAA I + IMY SPLS++R+V++TKSVEFMPF L+    LC T+W IF
Sbjct  121  ALHSHARKLFCGFAAAIFSVIMYGSPLSIMRLVIRTKSVEFMPFFLSLFSFLCGTSWFIF  180

Query  658  GLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            GLL +DPFV VPN  G  +G +QLILYAIY  +
Sbjct  181  GLLGRDPFVAVPNGCGSALGAVQLILYAIYRNR  213



>ref|XP_011027387.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Populus 
euphratica]
Length=249

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 171/246 (70%), Gaps = 1/246 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NATA F+FLAP  TF+RII+ +STE FSG PYV+T L+C+L AWYG+PFVS 
Sbjct  5    HFLFGIFGNATALFLFLAPTITFRRIIRSKSTELFSGIPYVMTLLNCLLSAWYGMPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNILV+TI+G G +IE  +V+ FI++APK +K K   LL +V+  F  VAL+S+ V HG+
Sbjct  65   NNILVSTINGTGALIEAIYVLTFIIYAPKKDKAKFIGLLTVVLTTFAGVALVSLVVLHGK  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R++FCGFAA I + IMY SPLS++R V+KTKSVE+MPF L+  + LC T+W +FGLL  
Sbjct  125  SREIFCGFAAAIFSIIMYGSPLSIMRTVIKTKSVEYMPFFLSLFVFLCGTSWFVFGLLGS  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            D FV VPN VGCG+G LQLILY IY         K +     +Q+     H++KQ     
Sbjct  185  DLFVAVPNGVGCGLGALQLILYFIYRNNK-GEAKKPALPVQSMQMGIAKLHQEKQLVSNG  243

Query  853  SKYDEL  870
            S  D++
Sbjct  244  SHVDKV  249



>ref|XP_010270424.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Nelumbo 
nucifera]
Length=254

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 169/238 (71%), Gaps = 0/238 (0%)
 Frame = +1

Query  130  LHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVS  309
            LH  FGIF NAT  F+FL+P  TF+RIIK RSTE+FSG PYV+T L+C+L  WYGLPFVS
Sbjct  4    LHFLFGIFGNATGLFLFLSPTITFRRIIKSRSTEQFSGVPYVMTLLNCLLSTWYGLPFVS  63

Query  310  PNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHG  489
            P+NILV+ I+G G+ IE  +V+IF++FA K EK ++  LL LV+ IF  V L+S+F  HG
Sbjct  64   PHNILVSVINGAGSAIESVYVMIFLIFASKKEKVRVMGLLFLVLTIFSVVVLVSLFALHG  123

Query  490  RIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLE  669
              R+LF GFAA I + IMY SPLSV+R+V+KTKSVEFMPF L+  + LC T+W I+GLL 
Sbjct  124  NARKLFSGFAASIFSIIMYASPLSVMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIYGLLG  183

Query  670  KDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPS  843
            +DPF++VPNA GC +G +QLILYAIY +              +      PQHE+ Q S
Sbjct  184  RDPFLFVPNAFGCVLGTMQLILYAIYRKNEGGADTATKGGDFIEMGLGKPQHEEMQRS  241



>ref|XP_011027388.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Populus 
euphratica]
Length=249

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 171/246 (70%), Gaps = 1/246 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NATA F+FLAP  TF+RII+ +STE FSG PYV+T L+C+L AWYG+PFVS 
Sbjct  5    HFLFGIFGNATALFLFLAPTITFRRIIRSKSTELFSGIPYVMTLLNCLLSAWYGMPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNILV+TI+G G +IE  +V+ FI++APK +K K   LL +V+  F  VAL+S+ V HG+
Sbjct  65   NNILVSTINGTGALIEAIYVLTFIIYAPKKDKAKFIGLLTVVLTTFAGVALVSLVVLHGK  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R++FCGFAA I + IMY SPLS++R V+KTKSVE+MPF L+  + LC T+W +FGLL  
Sbjct  125  SREIFCGFAAAIFSIIMYGSPLSIMRTVIKTKSVEYMPFFLSLFVFLCGTSWFVFGLLGS  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            D FV VPN VGCG+G LQLILY IY         K +     +Q+     H++KQ     
Sbjct  185  DLFVAVPNGVGCGLGALQLILYFIYRNNK-GEAKKPALPVQSMQMGIAKLHQEKQLVSNG  243

Query  853  SKYDEL  870
            S  D++
Sbjct  244  SPVDKV  249



>ref|XP_010679833.1| PREDICTED: bidirectional sugar transporter SWEET1 [Beta vulgaris 
subsp. vulgaris]
Length=255

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 172/248 (69%), Gaps = 9/248 (4%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP+ TFKRIIK +STE+FSG PYV+T L+ +L AWYGLPFVSP
Sbjct  5    HFIFGVFGNATALFLFLAPVVTFKRIIKNKSTEQFSGIPYVMTLLNNLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNILVTTI+G G VIE  +V+IF++ AP+ EK KIG LL +++ IF  VAL+S+   H  
Sbjct  65   NNILVTTINGTGAVIESVYVLIFLILAPRKEKVKIGGLLAIILSIFAIVALVSLLALHDT  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R++FCG AA + + IMY SPLS++R+V+KTKSVE+MPFLL+    LC T+W IFGL+ +
Sbjct  125  KRKVFCGVAASVFSIIMYGSPLSIMRLVIKTKSVEYMPFLLSLFCFLCGTSWFIFGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGM---LQINAMPQHE-----  828
            DPF+ VPN  G  +G +QLILY IY +K      K +  HG+   L  N    H      
Sbjct  185  DPFIAVPNGFGSALGAMQLILYFIYYDKNPEEKKKTTTDHGVELGLNGNGKAHHNIQDGK  244

Query  829  -KKQPSIT  849
               QPSI 
Sbjct  245  SNTQPSIN  252



>ref|XP_002300945.1| nodulin MtN3 family protein [Populus trichocarpa]
 ref|XP_002300944.2| nodulin MtN3 family protein [Populus trichocarpa]
 gb|EEE80218.1| nodulin MtN3 family protein [Populus trichocarpa]
 gb|EEE80217.2| nodulin MtN3 family protein [Populus trichocarpa]
Length=250

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 167/235 (71%), Gaps = 1/235 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NATA F+FLAP  TF+RII+ +STE FSG PYV+T L+C+L AWYG+PFVS 
Sbjct  5    HFLFGIFGNATALFLFLAPTITFRRIIRSKSTELFSGIPYVMTMLNCLLSAWYGMPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNILV+TI+G G VIE  +V+ FI++APK EK K   LL LV+  F  VAL+S+ V HG+
Sbjct  65   NNILVSTINGTGAVIEAVYVLTFIIYAPKKEKAKFIGLLTLVLTTFAGVALVSLVVLHGK  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R++FCGFAA I + IMY SPLS++R V+KTKSVEFMPF L+  + LC T+W +FGLL  
Sbjct  125  PREIFCGFAAAIFSIIMYGSPLSIMRTVVKTKSVEFMPFFLSLFVFLCGTSWFVFGLLGG  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            D FV VPN VGCG+G LQLILY IY         K +     +Q+     H++K+
Sbjct  185  DLFVAVPNGVGCGLGALQLILYFIYRNNK-GEDKKPALPVKSMQMGIAKLHQQKE  238



>ref|XP_010496503.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Camelina sativa]
Length=248

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 169/244 (69%), Gaps = 3/244 (1%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TFKRIIK +STE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +N LV+TI+G G VIE  +V IF+++APK EK KI  +   V+ +F  VAL+S+F  HG 
Sbjct  65   DNTLVSTINGTGAVIETIYVFIFLIYAPKKEKVKIFGIFSCVLAVFGTVALVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA + + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W ++GL+ +
Sbjct  125  ARKLFCGLAATVFSIIMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVYGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV +PN  GC +G LQLILY IY       +        M++   M   EKK+ ++ +
Sbjct  185  DPFVAIPNGFGCALGTLQLILYFIYCGNKGEKSGDAEKDEKMVE---MKDEEKKKQNVVN  241

Query  853  SKYD  864
             K D
Sbjct  242  GKQD  245



>ref|XP_007161383.1| hypothetical protein PHAVU_001G064300g [Phaseolus vulgaris]
 gb|AGV54435.1| bidirectional sugar transporter sweet1-like protein [Phaseolus 
vulgaris]
 gb|ESW33377.1| hypothetical protein PHAVU_001G064300g [Phaseolus vulgaris]
Length=251

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 168/247 (68%), Gaps = 0/247 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NA+  F+FLAPI TFKR+I  +STE+FSG PY +T L+C+L AWYGLPFVSP
Sbjct  5    HFVFGIFGNASGLFLFLAPIVTFKRVITNKSTEKFSGVPYPMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILV+ I+GIG  IE+ +V IF++FAPK EK KI  L   VV +F AV L+S+   HG 
Sbjct  65   DNILVSIINGIGAAIEVTYVFIFVLFAPKKEKAKILGLFSFVVAVFSAVVLVSLLALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I + IMY SPLS++R+V++TKSVEFMPF L+  + LC T+W I+GLL +
Sbjct  125  ARKLFCGFAASIFSIIMYGSPLSIMRLVIRTKSVEFMPFFLSLFVFLCGTSWFIYGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV VPN VG  +G +QLILY IY +         + S    Q     +  K   S  +
Sbjct  185  DPFVAVPNGVGSALGTIQLILYFIYRDSKSDGKKATAASSSGTQEEGTVEMAKHANSNGT  244

Query  853  SKYDELV  873
            +  +E V
Sbjct  245  TTQEEQV  251



>ref|XP_008237695.1| PREDICTED: bidirectional sugar transporter SWEET1 [Prunus mume]
Length=261

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 172/255 (67%), Gaps = 10/255 (4%)
 Frame = +1

Query  130  LHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVS  309
            L + FG+  NATA F+FLAPI TFKRII+KRSTE+FSG PYV+T L+C+L AWYGLPFVS
Sbjct  4    LKVFFGVVGNATALFLFLAPIITFKRIIQKRSTEQFSGIPYVMTLLNCLLSAWYGLPFVS  63

Query  310  PNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHG  489
            PNNILV+TI+G G  IE  +V+IFI+FAPK EK KI  L   V+ +F  VAL+SVF  H 
Sbjct  64   PNNILVSTINGTGAAIEAIYVLIFIIFAPKREKFKILGLFTFVLALFSTVALVSVFALHS  123

Query  490  RIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLE  669
            + R+LFCG AA + + IMY SPL+++  V+KTKSVEFMPF L+    LC T+W IFGLL 
Sbjct  124  KARKLFCGLAATVFSIIMYGSPLAIMSTVIKTKSVEFMPFFLSLFSFLCGTSWFIFGLLG  183

Query  670  KDPFVYVPNAVGCGVGVLQLILYAIYSE---KTIFMTIKRSFSHGM-------LQINAMP  819
             DPFV VPN  G G+G LQL+LY IY +   K    +IK+  S          +++    
Sbjct  184  HDPFVAVPNGFGSGLGALQLVLYFIYRDLDSKGSTGSIKKPSSSSTAATADESMEMGFAE  243

Query  820  QHEKKQPSITSSKYD  864
             H+ KQ    S   D
Sbjct  244  PHQSKQSIAISGAQD  258



>ref|XP_006356304.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Solanum 
tuberosum]
Length=250

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 172/245 (70%), Gaps = 2/245 (1%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            + LH  FGIF N T  F+FLAP+ TFKR+I  +STE+FSG PYV+T L+C+L  WYGLPF
Sbjct  5    KILHTLFGIFGNITGLFLFLAPMITFKRVIMHKSTEQFSGIPYVMTLLNCLLSTWYGLPF  64

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSPNN+LV+ I+G G  +E  +V++F++FAPK EK KI  +L +V+ IF  VAL+S+   
Sbjct  65   VSPNNMLVSIINGTGAGLEAFYVLVFLIFAPKKEKAKISGILCVVLSIFSTVALVSMLAL  124

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG  R++F GFAA I + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W ++GL
Sbjct  125  HGNKRKVFSGFAAAIFSIIMYGSPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFVYGL  184

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPS  843
            L KDPF+ VPN VG  +G  QLILYAIY E      IK+    G +++     +EK+ P+
Sbjct  185  LGKDPFIAVPNGVGSFLGTAQLILYAIYRENK--GQIKKGEEDGRVEMELEKPYEKEIPN  242

Query  844  ITSSK  858
              S  
Sbjct  243  TQSGD  247



>ref|XP_007200590.1| hypothetical protein PRUPE_ppa010181mg [Prunus persica]
 gb|EMJ01789.1| hypothetical protein PRUPE_ppa010181mg [Prunus persica]
Length=260

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 174/254 (69%), Gaps = 9/254 (4%)
 Frame = +1

Query  130  LHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVS  309
            L + FG+  NATA F+FLAPI TFKRII+KRSTE+FSG PYV+T L+C+L AWYGLPFVS
Sbjct  4    LKVFFGVVGNATALFLFLAPIITFKRIIQKRSTEQFSGIPYVMTMLNCLLSAWYGLPFVS  63

Query  310  PNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHG  489
            PNNILV+TI+G G  IE  +V+IFI+FAPK EK KI  L  +V+ IF  VAL+SVF  H 
Sbjct  64   PNNILVSTINGTGAAIEAIYVLIFIIFAPKREKFKILGLFTIVLAIFSTVALVSVFALHS  123

Query  490  RIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLE  669
            + R+LFCG AA + + IMY SPL+++  V++TKSVEFMPF L+    LC T+W IFGLL 
Sbjct  124  KARKLFCGLAATVFSIIMYGSPLAIMSTVIRTKSVEFMPFFLSLFSFLCGTSWFIFGLLG  183

Query  670  KDPFVYVPNAVGCGVGVLQLILYAIY--SEKTIFMTIKR-------SFSHGMLQINAMPQ  822
             DPFV VPN  G G+G LQL+LY IY  S K    +IK+       + +   +++     
Sbjct  184  HDPFVAVPNGFGSGLGALQLVLYFIYRDSSKGSTGSIKKASSSSTAATADESMEMGVAKP  243

Query  823  HEKKQPSITSSKYD  864
            H+ KQ    S   D
Sbjct  244  HQSKQSMAISGAQD  257



>ref|XP_006416299.1| hypothetical protein EUTSA_v10008590mg [Eutrema salsugineum]
 gb|ESQ34652.1| hypothetical protein EUTSA_v10008590mg [Eutrema salsugineum]
Length=247

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/247 (52%), Positives = 172/247 (70%), Gaps = 4/247 (2%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TFKRIIK +STE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +N LV+TI+G G VIE  +V+IF+ +APK EK KI  +   V+ +F  VAL+S+F  HG 
Sbjct  65   DNTLVSTINGTGAVIETIYVLIFLFYAPKKEKAKIFGIFTAVLAVFATVALVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA + + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W ++GL+ +
Sbjct  125  ARKLFCGIAATVFSIIMYASPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFVYGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV +PN  GC +G LQLILY IY         K + +  + +   M   EKKQ ++ +
Sbjct  185  DPFVAIPNGFGCALGTLQLILYFIYCGNK---GEKSAVAEKIEKSVEMKDEEKKQ-NVVN  240

Query  853  SKYDELV  873
             K D+ V
Sbjct  241  GKQDQQV  247



>ref|XP_010539700.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Tarenaya 
hassleriana]
Length=235

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 156/205 (76%), Gaps = 0/205 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+  NATA F+FLAP  TFKRI+K RSTE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTIFGVLGNATALFLFLAPTITFKRIVKNRSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NN LV+TI+G G  IE+ +V+IF+VFAPK EK KI  +   V+ +F AVAL+S+F  HG 
Sbjct  65   NNTLVSTINGTGAAIEIIYVLIFLVFAPKKEKAKIFGIFTCVITLFSAVALVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA I + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W I+GLL +
Sbjct  125  SRKLFCGLAATIFSIIMYASPLSIMRMVIKTKSVEYMPFFLSLFVFLCGTSWFIYGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIY  747
            DPFV +PN  GCG+G  QLILY IY
Sbjct  185  DPFVAIPNGFGCGLGATQLILYLIY  209



>ref|XP_010270426.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X2 [Nelumbo nucifera]
Length=238

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 133/238 (56%), Positives = 167/238 (70%), Gaps = 11/238 (5%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NATA F+FLAP      IIK +STE+FSG PYV+T L+C+L AWYGLPFVSP
Sbjct  5    HFLFGIFGNATALFLFLAP-----TIIKNKSTEKFSGLPYVMTLLNCLLSAWYGLPFVSP  59

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILV+TI+G G+ IE  +V+IFI++APK EK KI  LL  V+ +F AVA++S+   HG 
Sbjct  60   HNILVSTINGTGSAIESVYVLIFIIYAPKKEKAKILALLSFVLAVFSAVAVVSLCALHGS  119

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W IFGLL +
Sbjct  120  SRKLFCGLAATIFSIIMYASPLSIVRMVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLLGR  179

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQH---EKKQ  837
            DPFV VPN  GC +G +QLILYAIY +        ++    M      PQ    EKKQ
Sbjct  180  DPFVAVPNGFGCALGTVQLILYAIYRKNK---GGAKADDDSMEMGYGKPQQQVEEKKQ  234



>ref|XP_004498378.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Cicer 
arietinum]
Length=242

 Score =   238 bits (608),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 164/237 (69%), Gaps = 7/237 (3%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NA   F+FLAPI TFKRII  +STE+FSG PY++T L+C+L AWYGLPFVSP
Sbjct  5    HFMFGVFGNAFGLFLFLAPIITFKRIIVHKSTEKFSGIPYIMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNILV+ I+G G +IE  +V  FI +APK EK KI  L   V+ +F AV L+S+F  HG 
Sbjct  65   NNILVSIINGTGAIIETIYVFTFIFYAPKKEKVKISGLFAFVITVFSAVVLISLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R++FCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W IFGLL  
Sbjct  125  SRKVFCGFAAAIFSIIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLLGH  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPS  843
            DPF+ VPN VG  +G +QLILY IY +        +  +    Q ++M     KQPS
Sbjct  185  DPFIAVPNGVGSALGTVQLILYLIYRD-------NKENAKTTTQEDSMEMGTAKQPS  234



>ref|XP_008810887.1| PREDICTED: bidirectional sugar transporter SWEET1a isoform X1 
[Phoenix dactylifera]
Length=246

 Score =   238 bits (608),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 153/208 (74%), Gaps = 0/208 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NATA F+FL+PI TF RIIK +STE+FSG PY +T L+C L AWYGLPFVSP
Sbjct  5    HFLFGIFGNATALFLFLSPIVTFWRIIKHKSTEDFSGIPYNMTLLNCFLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NN+LV+TI+G GTVIEL +VVIFIV+AP+  + K      +VV I   VA +S+   HG 
Sbjct  65   NNLLVSTINGAGTVIELVYVVIFIVYAPRKVRTKTLCFFAIVVAISAIVAFVSLLALHGH  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I + +MY SPL ++R+V++TKSVEFMPF L+    LC T+W I+GLL +
Sbjct  125  ARKLFCGFAASIFSVVMYGSPLFIMRLVIRTKSVEFMPFFLSLFSFLCGTSWFIYGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            DPFV+V N  G  +G +QLILYAIY   
Sbjct  185  DPFVWVQNGCGSALGAVQLILYAIYRNH  212



>ref|XP_010260494.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Nelumbo 
nucifera]
Length=255

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 158/204 (77%), Gaps = 0/204 (0%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            G+F NA A F+FLAP  TF+RI+K RSTE+FSG PYV+T L+C+L AWYGLPFVSP+NIL
Sbjct  9    GVFGNAVALFLFLAPAITFRRIVKSRSTEKFSGIPYVMTLLNCLLSAWYGLPFVSPHNIL  68

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            V+TI+G GTVIE  +V+IF+++APK E+ KI  LL  V+ +F AV ++S+   HG  R+L
Sbjct  69   VSTINGAGTVIESLYVLIFLIYAPKKERTKILALLTFVLAVFSAVVVVSLCALHGNRRKL  128

Query  505  FCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFV  684
             CG AA I + +MY SPLS++R V++TKSVEFMPF L+  + +C T+W I+GLL +DPF+
Sbjct  129  LCGLAATIFSIVMYASPLSIMRAVIRTKSVEFMPFFLSLFVFMCGTSWFIYGLLGRDPFI  188

Query  685  YVPNAVGCGVGVLQLILYAIYSEK  756
             VPN  GCG+G +QLILYAIY + 
Sbjct  189  AVPNGFGCGLGTMQLILYAIYRKN  212



>ref|XP_009377708.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Pyrus 
x bretschneideri]
Length=263

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/262 (52%), Positives = 174/262 (66%), Gaps = 19/262 (7%)
 Frame = +1

Query  124  RTLHLA---FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            +T+H+    FG+  N TA F+FLAP  TFKRII+KRSTE+FSG PYV+T L+C+L AWYG
Sbjct  4    KTMHVLKVFFGVIGNGTALFLFLAPTITFKRIIRKRSTEQFSGIPYVMTMLNCLLSAWYG  63

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
            LPFVSPNNILV+TI+G G  IEL +V+IFI+FAPK E+ KI  L   V+ +F AVAL+S+
Sbjct  64   LPFVSPNNILVSTINGTGAAIELIYVLIFIIFAPKRERAKILGLFTAVLALFSAVALVSL  123

Query  475  fvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
            F  H + R+LFCG AA + + IMY SP S++  V++TKSVEFMPF L+    LC T+W I
Sbjct  124  FALHDKSRKLFCGLAATVFSVIMYSSPFSIMSTVVRTKSVEFMPFFLSLFSFLCGTSWFI  183

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKT-----------IFMTIKRSFSHGML  801
            FGLL  DPFV +PN  G G+G LQL+LY IY +                T   S   G+ 
Sbjct  184  FGLLGHDPFVAIPNGFGSGLGALQLLLYFIYRDNKGKGSGTKKPNGAVTTADESMEMGV-  242

Query  802  QINAMPQHEKKQPSITSSKYDE  867
               A P  + KQ SIT++   +
Sbjct  243  ---AKPDQQPKQ-SITNNGAQD  260



>emb|CDY04628.1| BnaC05g16660D [Brassica napus]
Length=246

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/248 (52%), Positives = 169/248 (68%), Gaps = 7/248 (3%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TFKRIIK +STE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +N LV+TI+G G VIE  +V+IF+ +APK EK KI  +   V+ +F  VAL+S+F  HG 
Sbjct  65   DNTLVSTINGTGAVIETVYVLIFLFYAPKKEKAKIFGVFTAVLAVFATVALVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA + + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W I+GL+ +
Sbjct  125  ARKLFCGIAATVFSIIMYASPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFIYGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQIN-AMPQHEKKQPSIT  849
            DPFV +PN  GC +G LQLILY IY         K   S G    +  M   EKKQ  + 
Sbjct  185  DPFVAIPNGFGCALGTLQLILYVIYCGN------KGEKSAGKDDKSLEMKVEEKKQNVVN  238

Query  850  SSKYDELV  873
              + ++ V
Sbjct  239  GKQQEQQV  246



>ref|XP_010498603.1| PREDICTED: bidirectional sugar transporter SWEET1 isoform X1 
[Camelina sativa]
Length=247

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 169/244 (69%), Gaps = 4/244 (2%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TFKRIIK +STE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +N LV+TI+G G VIE  +V IF+++APK EK KI  +   V+ +F  VAL+S+F  HG 
Sbjct  65   DNTLVSTINGTGAVIETIYVFIFLIYAPKKEKVKIFGIFSCVLAVFGTVALVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA + + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W ++GL+ +
Sbjct  125  ARKLFCGLAATVFSIIMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVYGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV +PN  GC +G LQLILY IY       +        M++   M   EKKQ ++ +
Sbjct  185  DPFVAIPNGFGCALGTLQLILYFIYCGNKGEKSGDAEKDEKMVE---MKDEEKKQ-NVVN  240

Query  853  SKYD  864
             K D
Sbjct  241  GKQD  244



>gb|KEH40468.1| bidirectional sugar transporter [Medicago truncatula]
Length=244

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 164/240 (68%), Gaps = 0/240 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NA   F+FLAPI TFKRII  +STE+FSG PY +T L+C+L AWYGLPFVSP
Sbjct  5    HFIFGVFGNAFGLFLFLAPIITFKRIIVNKSTEKFSGVPYPMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILVT I+G G VIE+ +V IFIVFAPK EK KI  L   V+ +F AV  +S+F  HG 
Sbjct  65   DNILVTIINGTGAVIEIIYVFIFIVFAPKKEKLKISGLFAFVITVFAAVVFISLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R++FCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W IFGLL +
Sbjct  125  SRKVFCGFAAAIFSIIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPF++VPN VG  +G LQLILY IY           +    M    A P  E +    T+
Sbjct  185  DPFIFVPNGVGSFLGTLQLILYFIYRGNKGNAKTPTTKEEAMEMGTAKPMGEGELKGDTT  244



>ref|XP_006305555.1| hypothetical protein CARUB_v10010111mg [Capsella rubella]
 gb|EOA38453.1| hypothetical protein CARUB_v10010111mg [Capsella rubella]
Length=248

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 171/247 (69%), Gaps = 3/247 (1%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TFKRIIK +STE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +N LV+TI+G G VIE  +V+IF+ +APK EK KI  +   V+ +F  VAL+S+F  HG 
Sbjct  65   DNTLVSTINGTGAVIETIYVLIFLFYAPKKEKVKIFGIFSCVLAVFGTVALVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA + + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W ++GL+ +
Sbjct  125  GRKLFCGLAATVFSIIMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVYGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV +PN  GC +G LQLILY IY         K+S      +     + E+K+ ++ +
Sbjct  185  DPFVAIPNGFGCALGTLQLILYFIYCGNK---GEKKSGDAEKDEKTVEMKDEEKKQTVVN  241

Query  853  SKYDELV  873
             K D+ V
Sbjct  242  GKQDQQV  248



>ref|XP_002307476.2| hypothetical protein POPTR_0005s20970g, partial [Populus trichocarpa]
 gb|EEE94472.2| hypothetical protein POPTR_0005s20970g, partial [Populus trichocarpa]
Length=294

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 172/239 (72%), Gaps = 3/239 (1%)
 Frame = +1

Query  157  NATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTTI  336
            NATA F+FLAP  TFKRII+ +S E+FSG PYV+T L+C+L AWYGLPFVS NN+LV+TI
Sbjct  59   NATALFLFLAPTITFKRIIRSKSIEQFSGIPYVMTLLNCLLSAWYGLPFVSKNNVLVSTI  118

Query  337  DGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCGF  516
            +G G+ IE  +V+IFI++APK EK K+  LL LV+ IF  VAL+S+F  HG  R+LFCG 
Sbjct  119  NGAGSAIETIYVLIFIIYAPKKEKAKVLGLLTLVITIFTGVALVSLFALHGNARKLFCGC  178

Query  517  AALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVPN  696
            AA + + IMY SPLS++R V+KTKSVE+MPF L+  + LC T+W ++GLL +DPFV VPN
Sbjct  179  AAAVFSIIMYGSPLSIMRTVIKTKSVEYMPFFLSLFVFLCGTSWFVYGLLGRDPFVAVPN  238

Query  697  AVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITSSKYDELV  873
             VGCG+G LQLILY IY         K+  S   L+I     H++K+  + +  +DE V
Sbjct  239  GVGCGLGALQLILYFIYRNNK--GEAKKPISTHSLEIGPGKVHQEKK-LVANGSHDERV  294



>ref|XP_010537332.1| PREDICTED: bidirectional sugar transporter SWEET1 [Tarenaya hassleriana]
Length=243

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 169/248 (68%), Gaps = 10/248 (4%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+  NATA F+FLAP  TFKRIIK +STE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTVFGVLGNATALFLFLAPTITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NN LV+TI+G G  IE+ +V+IF+V+APK EK KI  +   V+ +F  V  +S+F  HG 
Sbjct  65   NNTLVSTINGTGAAIEIVYVLIFLVYAPKKEKAKIFGIFSCVMAVFSVVVFVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W I+GL+ +
Sbjct  125  PRKLFCGLAATIFSIIMYASPLSIMRMVIKTKSVEFMPFFLSLFVFLCGTSWFIYGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIY-SEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSIT  849
            DPFV +PN  GCG+G +QLILY IY   K   +  K+           M   EKKQ S  
Sbjct  185  DPFVAIPNGFGCGLGTMQLILYFIYCGNKGEKVEEKKCVE--------MKGEEKKQ-SAE  235

Query  850  SSKYDELV  873
            + K ++ V
Sbjct  236  NGKQEQHV  243



>emb|CDY50241.1| BnaA06g15180D [Brassica napus]
Length=246

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 171/247 (69%), Gaps = 5/247 (2%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TFKRIIK +STE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +N LV+TI+G G +IE  +V+IF+ +APK EK KI  +  +V+ +F  VAL+S+F  HG 
Sbjct  65   DNTLVSTINGTGALIETVYVLIFLFYAPKKEKAKIFGVFTVVLAVFATVALVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA + + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W I+GL+ +
Sbjct  125  ARKLFCGIAATVFSIIMYASPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFIYGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV +PN  GC +G LQLILY IY       + ++      L+   M   EKKQ  +  
Sbjct  185  DPFVAIPNGFGCALGTLQLILYVIYCGNKGEKSAEK--DDKSLE---MKGEEKKQNVVNG  239

Query  853  SKYDELV  873
             + ++ V
Sbjct  240  KQQEQQV  246



>ref|XP_009149662.1| PREDICTED: bidirectional sugar transporter SWEET1 [Brassica rapa]
Length=246

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 170/247 (69%), Gaps = 5/247 (2%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TFKRIIK +STE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +N LV+TI+G G +IE  +V+IF+ +APK EK KI  +   V+ +F  VAL+S+F  HG 
Sbjct  65   DNTLVSTINGTGALIETVYVLIFLFYAPKKEKAKIFGVFTAVLTVFATVALVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA + + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W I+GL+ +
Sbjct  125  ARKLFCGIAATVFSIIMYASPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFIYGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV +PN  GC +G LQLILY IY       + ++      L+   M   EKKQ  +  
Sbjct  185  DPFVAIPNGFGCALGTLQLILYVIYCGNKGEKSAEK--DDKSLE---MKGEEKKQNVVNG  239

Query  853  SKYDELV  873
             + ++ V
Sbjct  240  KQQEQQV  246



>ref|XP_008344428.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Malus 
domestica]
Length=263

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 159/214 (74%), Gaps = 3/214 (1%)
 Frame = +1

Query  124  RTLHLA---FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            +T+H+    FG+  N TA F+FLAP  TF+RII+KRSTE+FSG PYV+T L+C+L AWYG
Sbjct  4    KTMHVFKVFFGVIGNGTALFLFLAPTITFRRIIRKRSTEQFSGIPYVMTMLNCLLSAWYG  63

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
            LPFVSPNNILV+TI+G G  IEL +V+IFI+FAPK E+ KI  L   V+ +F AVAL+S+
Sbjct  64   LPFVSPNNILVSTINGTGAAIELIYVLIFIIFAPKRERAKILGLFTAVLALFSAVALVSL  123

Query  475  fvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
            F  H + R+LFCG AA + + IMY SP S++  V++TKSVEFMPF L+    LC T+W I
Sbjct  124  FTLHDKTRKLFCGLAATVFSVIMYSSPFSIMSTVVRTKSVEFMPFFLSLFSFLCGTSWFI  183

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            FGLL  DPFV +PN  G G+G LQL+LY IY + 
Sbjct  184  FGLLGHDPFVAIPNGFGSGLGALQLLLYFIYRDN  217



>ref|XP_003544735.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Glycine 
max]
 gb|KHN28726.1| Bidirectional sugar transporter SWEET1 [Glycine soja]
Length=249

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 154/208 (74%), Gaps = 0/208 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF N +  F+FLAPI TF RIIK +STE+FSG PY +T L+C+L AWYGLPFVSP
Sbjct  5    HFIFGIFGNVSGLFLFLAPIVTFWRIIKNKSTEKFSGVPYPMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNILVT I+G G  IE+ +V IFI FAPK EK KI  L   VV +F  V L+S+F  HG 
Sbjct  65   NNILVTIINGTGAGIEIIYVFIFIYFAPKKEKAKILGLFSFVVAVFSVVVLVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W I+GLL +
Sbjct  125  ARKLFCGFAAAIFSIIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIYGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            DPFV VPN VG  +G  QLILY IY +K
Sbjct  185  DPFVAVPNGVGSALGTAQLILYFIYRDK  212



>gb|KEH35409.1| bidirectional sugar transporter [Medicago truncatula]
Length=247

 Score =   236 bits (602),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 129/235 (55%), Positives = 167/235 (71%), Gaps = 0/235 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            HL FGIF NA+A F+FLAP+ TFKRII  +STE+FSG PYV+T L+C+L AWYGLPFVSP
Sbjct  5    HLLFGIFGNASALFLFLAPVITFKRIIVNKSTEKFSGLPYVMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNI VTT++G G  IE+ +V+IFI+FAPK EK KI  L  LV+ +F AV  +S+F FHG 
Sbjct  65   NNIPVTTVNGTGAGIEIIYVLIFIIFAPKKEKIKIFALFTLVLSVFSAVVFVSLFAFHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+ FCGFA  I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC ++W IFGLL +
Sbjct  125  HRKAFCGFAMAIFSVIMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGSSWFIFGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            D FV VPN +G  +G +QLILY IY +       +       +++     H+ KQ
Sbjct  185  DLFVAVPNGLGSVLGTMQLILYFIYRDNKGSPKQQEPTEGESMEMGNGKNHQMKQ  239



>ref|XP_010064812.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Eucalyptus 
grandis]
Length=259

 Score =   236 bits (602),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 172/255 (67%), Gaps = 6/255 (2%)
 Frame = +1

Query  127  TLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFV  306
            TLH  FGIF N TA F+FLAP  TF RI K +STE+FSG PYV+T L+C+L AWYGLPFV
Sbjct  5    TLHTVFGIFGNITALFLFLAPTITFVRIYKSKSTEKFSGIPYVMTLLNCLLSAWYGLPFV  64

Query  307  SPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfH  486
            SPNN+LV+TI+G G  IE+ +VV F+ +AP+ EK KI  L +LV+ +F  +AL+S+F  H
Sbjct  65   SPNNMLVSTINGTGAAIEVLYVVGFLFYAPRKEKTKIFGLFMLVLTVFATIALVSLFALH  124

Query  487  GRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLL  666
            G  R+LFCG AA + +  MY SPLS++R+V+KTKSVE+MPF L+  + LC T+W +FGLL
Sbjct  125  GNKRKLFCGVAATVFSITMYASPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFVFGLL  184

Query  667  EKDPFVYVPNAVGCGVGVLQLILYAIYS------EKTIFMTIKRSFSHGMLQINAMPQHE  828
              D FV++PN  GCG+G  QLILY IY       +  +        + G  + +A     
Sbjct  185  GNDIFVFLPNGFGCGLGTAQLILYFIYRNYKGEPKNKVHNYAGSMETTGETEKDADRDPA  244

Query  829  KKQPSITSSKYDELV  873
            K QP + + + DE V
Sbjct  245  KHQPDLMNKQADEQV  259



>ref|XP_010459857.1| PREDICTED: bidirectional sugar transporter SWEET1 [Camelina sativa]
Length=247

 Score =   236 bits (601),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 168/244 (69%), Gaps = 4/244 (2%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TFKRIIK +STE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +N LV+TI+G G  IE  +V IF+++APK EK KI  +   V+ +F  VAL+S+F  HG 
Sbjct  65   DNTLVSTINGTGAFIETIYVFIFLIYAPKKEKVKIFGIFSCVLAVFGTVALVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA + + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W ++GL+ +
Sbjct  125  ARKLFCGLAATVFSIIMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVYGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV +PN  GC +G LQLILY IY       +        M++   M   EKKQ ++ +
Sbjct  185  DPFVAIPNGFGCALGTLQLILYFIYCGNKGEKSGDAEKDEKMVE---MKDEEKKQ-NVVN  240

Query  853  SKYD  864
             K D
Sbjct  241  GKQD  244



>ref|XP_009360715.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Pyrus 
x bretschneideri]
Length=263

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 169/261 (65%), Gaps = 18/261 (7%)
 Frame = +1

Query  124  RTLHL---AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            +T+H+    FG+  N TA F+FLAP  TFKRII+K+ TE+FSG PYV+T L+C+L AWYG
Sbjct  4    KTMHVFKVLFGVLGNGTALFLFLAPTITFKRIIRKKCTEQFSGIPYVMTMLNCLLSAWYG  63

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
            LPFVS NNILV+TI+G G  IEL +V++FI+FAPK EK KI  L   V+ +F AVAL+S+
Sbjct  64   LPFVSANNILVSTINGTGAAIELIYVLVFIIFAPKREKAKILGLFTAVLALFSAVALVSL  123

Query  475  fvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
            F  H + R+LFCG AA + + IMY SP S++  V++TKSVEFMPF L+    LC T+W I
Sbjct  124  FALHDKTRKLFCGLAATVFSIIMYSSPFSIMSTVVRTKSVEFMPFFLSLFSFLCGTSWFI  183

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSE-----------KTIFMTIKRSFSHGML  801
            +GLL  DPFV +PN +G G+G LQLILY IY +                T   S   G+ 
Sbjct  184  YGLLGHDPFVAIPNGLGSGLGALQLILYVIYRDNKGKGSGTKKPNDAATTADESMDTGL-  242

Query  802  QINAMPQHEKKQPSITSSKYD  864
               A P  + KQ    +   D
Sbjct  243  ---AKPDQQSKQSVTINGAQD  260



>ref|XP_009340984.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Pyrus 
x bretschneideri]
Length=263

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 169/261 (65%), Gaps = 18/261 (7%)
 Frame = +1

Query  124  RTLHL---AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            +T+H+    FG+  N TA F+FLAP  TFKRII+K+ TE+FSG PYV+T L+C+L AWYG
Sbjct  4    KTMHVFKVLFGVLGNGTALFLFLAPTITFKRIIRKKCTEQFSGIPYVMTMLNCLLSAWYG  63

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
            LPFVS NNILV+TI+G G  IEL +V++FI+FAPK EK KI  L   V+ +F AVAL+S+
Sbjct  64   LPFVSANNILVSTINGTGAAIELIYVLVFIIFAPKREKAKILGLFTAVLALFSAVALVSL  123

Query  475  fvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
            F  H + R+LFCG AA + + IMY SP S++  V++TKSVEFMPF L+    LC T+W I
Sbjct  124  FALHDKTRKLFCGLAATVFSIIMYSSPFSIMSTVVRTKSVEFMPFFLSLFSFLCGTSWFI  183

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSE-----------KTIFMTIKRSFSHGML  801
            +GLL  DPFV +PN +G G+G LQLILY IY +                T   S   G+ 
Sbjct  184  YGLLGHDPFVAIPNGLGSGLGALQLILYVIYRDNKGKASGTKKPNDAATTADESMDTGL-  242

Query  802  QINAMPQHEKKQPSITSSKYD  864
               A P  + KQ    +   D
Sbjct  243  ---AKPDQQSKQSVTINGAQD  260



>ref|XP_008441563.1| PREDICTED: bidirectional sugar transporter SWEET1 [Cucumis melo]
Length=252

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 177/245 (72%), Gaps = 1/245 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+  NATA F+FL+P+ TFKRII+ +STE+FSG PYV+T L+C+L AWYGLPFVSP
Sbjct  5    HFLFGVLGNATALFLFLSPMVTFKRIIRSKSTEQFSGIPYVMTMLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILV+TI+G G VIEL +V++FIV+A K EK KIG L    +G F AVAL+SVF   G+
Sbjct  65   HNILVSTINGTGAVIELIYVMVFIVYAGKKEKGKIGGLFAFAMGAFTAVALVSVFALEGK  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            IR+LFCG AA + + IMY SPLS++R V+KTKSVE+MPFLL+  + LC T+W I+GLL +
Sbjct  125  IRKLFCGLAASVFSIIMYGSPLSIMRTVIKTKSVEYMPFLLSLFVFLCGTSWFIYGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV VPN  GCG+G LQLILY IY         K + + G+    ++ + +  +P  T 
Sbjct  185  DPFVAVPNGFGCGLGALQLILYFIYRRPGAAPDEKPTNNDGLNMEMSLHKAQLDKPQAT-  243

Query  853  SKYDE  867
            +K D 
Sbjct  244  AKVDR  248



>ref|XP_010064811.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Eucalyptus 
grandis]
Length=258

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 175/257 (68%), Gaps = 11/257 (4%)
 Frame = +1

Query  127  TLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFV  306
            TLH  FGIF N TA F+FLAPI TF RI K +STE+FSG PYV+T L+C+L AWYGLPFV
Sbjct  5    TLHTVFGIFGNITALFLFLAPIITFIRIYKSKSTEKFSGIPYVMTLLNCLLSAWYGLPFV  64

Query  307  SPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfH  486
            SPNN+LV+TI+G G  IE+ +VV F+ +AP+ EK KI  L +LV+ +F A+AL+S+F  H
Sbjct  65   SPNNMLVSTINGTGAAIEVVYVVFFLFYAPRKEKAKIFGLFMLVLTVFAAIALVSLFALH  124

Query  487  GRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLL  666
            G  R+LFCG AA + +  MY SPLS++R+V+KTKSVE+MPF L+  + LC T+W IFGLL
Sbjct  125  GNKRKLFCGVAATVFSITMYASPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFIFGLL  184

Query  667  EKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGML--------QINAMPQ  822
              D FV++PN  GCG+G  QLILY IY     +    ++  H ++        + NA   
Sbjct  185  GHDIFVFLPNGFGCGLGTAQLILYFIYRN---YKGEPKNKVHDVVCVEEKVETEKNAEGD  241

Query  823  HEKKQPSITSSKYDELV  873
              K Q  + + K DE V
Sbjct  242  PAKHQLDLMNKKADEQV  258



>ref|XP_009625660.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Nicotiana 
tomentosiformis]
Length=253

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 169/246 (69%), Gaps = 1/246 (0%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            + LH  FGIF N T  F+FLAP+ TFKR+I  +STE+FSG PYV+T L+C+L  WYGLPF
Sbjct  5    KILHTLFGIFGNVTGLFLFLAPMITFKRVIMNKSTEQFSGIPYVMTLLNCLLSTWYGLPF  64

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSPNNILV+ I+G G  +E  +V+ F+ FAPK EK KI  +L +V+ IF  VAL+S+   
Sbjct  65   VSPNNILVSIINGTGAGLEAFYVLTFLTFAPKREKAKISGILFVVLSIFSTVALVSMLAL  124

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG  R++FCGFAA I + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W ++GL
Sbjct  125  HGNKRKIFCGFAAAIFSIIMYGSPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFVYGL  184

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQIN-AMPQHEKKQP  840
            L KDPF+ VPN VG  +G  QLILYAIY +       K+   +   ++    P+  K+ P
Sbjct  185  LGKDPFIAVPNGVGGLLGTTQLILYAIYRDNKGKGKGKKGEENTTAEMELGKPKENKELP  244

Query  841  SITSSK  858
            +  +  
Sbjct  245  NTQNGD  250



>ref|XP_009110184.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Brassica 
rapa]
 emb|CDX96591.1| BnaA08g21340D [Brassica napus]
Length=251

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/247 (49%), Positives = 167/247 (68%), Gaps = 0/247 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TFKRIIK +STE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +N LV+TI+G G  IE  +V+IF+ +AP+ EK KI  +   V+ +F  VAL+S+F  HG 
Sbjct  65   DNTLVSTINGTGAAIETIYVLIFLFYAPRKEKAKIFAIFAAVLAVFATVALVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA + + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W I+GL+ +
Sbjct  125  GRKLFCGIAATVFSIIMYASPLSIMRLVVKTKSVEYMPFFLSLFVFLCGTSWFIYGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV +PN  GC +G +QLILY IY       +   +       +    + +KKQ  +  
Sbjct  185  DPFVAIPNGFGCALGTVQLILYFIYCGNKGEKSTDDAEKDEKKTVEMKDEEKKKQNVVNG  244

Query  853  SKYDELV  873
             K ++ V
Sbjct  245  KKQEQQV  251



>emb|CDY67972.1| BnaCnng57120D [Brassica napus]
Length=251

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 167/245 (68%), Gaps = 1/245 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TFKRIIK +STE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +N LV+TI+G G  IE  +V+IF+ +AP+ EK KI  +   V+ +F  VAL+S+F  HG 
Sbjct  65   DNTLVSTINGTGAAIETIYVLIFLFYAPRKEKAKIFAIFAAVLAVFATVALVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA + + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W I+GL+ +
Sbjct  125  GRKLFCGIAATVFSIIMYASPLSIMRLVVKTKSVEYMPFFLSLFVFLCGTSWFIYGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV +PN  GC +G +QLILY IY       +   +       +  M   EKK+ ++ +
Sbjct  185  DPFVAIPNGFGCALGTVQLILYFIYCGNKGDKSTDDAEKDEKKTVE-MKDEEKKKQNVVN  243

Query  853  SKYDE  867
             K  E
Sbjct  244  GKQQE  248



>gb|EYU32454.1| hypothetical protein MIMGU_mgv1a012708mg [Erythranthe guttata]
Length=242

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 165/216 (76%), Gaps = 2/216 (1%)
 Frame = +1

Query  115  GLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            G  + LHL FGIF NAT  F+FLAP  TFKRII  +STE+FSG PYV+T L+C+L AWYG
Sbjct  2    GKEKILHLVFGIFGNATGLFLFLAPTVTFKRIITNKSTEQFSGIPYVMTLLNCLLAAWYG  61

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
            +PF+SPNN+LV+ I+G G VIE  +V+IF+++APK EK KI  LL+L++ IF  VAL+S+
Sbjct  62   MPFISPNNVLVSAINGTGVVIESIYVLIFLIYAPKKEKGKILGLLLLILAIFTTVALVSI  121

Query  475  fv--fHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAW  648
                 H  +++LFCG AA + + IMY SPLSV+R+V+KTKSVE+MPFLL+  + LC T+W
Sbjct  122  LAFRGHDNLKKLFCGIAATLFSIIMYASPLSVMRLVIKTKSVEYMPFLLSLFVFLCGTSW  181

Query  649  LIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            LI+GL+ KD F+Y+PN  GC +G +QL +YAIY  K
Sbjct  182  LIYGLIGKDMFIYIPNGFGCLLGTMQLCIYAIYRNK  217



>ref|XP_007019365.1| Nodulin MtN3 family protein [Theobroma cacao]
 gb|EOY16590.1| Nodulin MtN3 family protein [Theobroma cacao]
Length=252

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/253 (50%), Positives = 174/253 (69%), Gaps = 2/253 (1%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            +   LH  FGIF NATA F+FL+P  TF R+IK +STE+FSG PYV+T L+C+L AWYGL
Sbjct  1    MNHVLHFMFGIFGNATAAFLFLSPTITFWRVIKSKSTEQFSGIPYVMTLLNCLLSAWYGL  60

Query  298  PFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvf  477
            PFVS NNILV TI+G G+ +E  +V+IFI  APK EK K+  L   V+ +F AVAL+SV 
Sbjct  61   PFVSENNILVVTINGAGSGLEFIYVLIFIYHAPKKEKIKVLALFGFVLAVFSAVALVSVL  120

Query  478  vfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIF  657
              HG  R++FCG  A + +  MY SPLS++R+V+KTKSVEFMPF L+  + LC T+W ++
Sbjct  121  ALHGTGRKVFCGVVAAVFSVAMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVY  180

Query  658  GLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQIN-AMPQHEKK  834
            G+L +D F+ VPN  GC +G +QLILY+IY +       K+  ++G +++    P H++K
Sbjct  181  GILGRDAFIAVPNGFGCTLGTMQLILYSIYHKNKGSKETKKPTANGTVEMGPEKPPHQEK  240

Query  835  QPSITSSKYDELV  873
            Q + +    DE V
Sbjct  241  QEN-SQVPQDEQV  252



>ref|XP_002893163.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69422.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=247

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 167/244 (68%), Gaps = 4/244 (2%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TFKRIIK +STE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +N LV+TI+G G VIE  +V+IF+ +APK EK KI  +   V+ +F  VAL+S+F  HG 
Sbjct  65   DNTLVSTINGTGAVIETVYVLIFLFYAPKKEKVKIFGIFSCVLAVFATVALVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA + + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W ++GL+ +
Sbjct  125  GRKLFCGLAATVFSIIMYASPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFVYGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV +PN  GC +G LQLILY IY       +         ++   M   EKKQ  + +
Sbjct  185  DPFVAIPNGFGCALGTLQLILYFIYCGNKGEKSADAEKDEKSVE---MKGDEKKQ-HVVN  240

Query  853  SKYD  864
             K D
Sbjct  241  GKQD  244



>ref|XP_009800957.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Nicotiana 
sylvestris]
Length=252

 Score =   233 bits (595),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 124/238 (52%), Positives = 164/238 (69%), Gaps = 1/238 (0%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            + LH  FGIF N T  F+FLAP+ TFKR+I  +STE+FSG PYV+T L+C+L  WYGLPF
Sbjct  5    KILHTLFGIFGNVTGLFLFLAPMITFKRVIMNKSTEQFSGIPYVMTLLNCLLSTWYGLPF  64

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSPNNILV+ I+G G  +E  +V+ F++FAPK EK KI  +L +V+ IF  VAL+S+   
Sbjct  65   VSPNNILVSIINGTGAGLEAFYVLTFLIFAPKREKAKISGILFVVLSIFSTVALVSMLAL  124

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            H   R++FCGFAA I + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W ++GL
Sbjct  125  HANKRKIFCGFAAAIFSIIMYGSPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFVYGL  184

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            L KDPF+ VPN VG  +G  QLILYAIY +               +++   PQ  K Q
Sbjct  185  LGKDPFIAVPNGVGGLLGTAQLILYAIYRDNKGKGKKGEEDKTSEMELGK-PQENKDQ  241



>ref|NP_564140.1| bidirectional sugar transporter SWEET1 [Arabidopsis thaliana]
 sp|Q8L9J7.1|SWET1_ARATH RecName: Full=Bidirectional sugar transporter SWEET1; Short=AtSWEET1 
[Arabidopsis thaliana]
 gb|AAM65929.1| unknown [Arabidopsis thaliana]
 gb|AAO42204.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63896.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30104.1| bidirectional sugar transporter SWEET1 [Arabidopsis thaliana]
Length=247

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 168/244 (69%), Gaps = 4/244 (2%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TFKRIIK +STE+FSG PY +T L+C+L AWYGLPFVS 
Sbjct  5    HTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +N LV+TI+G G VIE  +V+IF+ +APK EK KI  +   V+ +F  VAL+S+F   G 
Sbjct  65   DNTLVSTINGTGAVIETVYVLIFLFYAPKKEKIKIFGIFSCVLAVFATVALVSLFALQGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA + + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W ++GL+ +
Sbjct  125  GRKLFCGLAATVFSIIMYASPLSIMRLVVKTKSVEFMPFFLSLFVFLCGTSWFVYGLIGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITS  852
            DPFV +PN  GC +G LQLILY IY         K + +    +   M   EKKQ ++ +
Sbjct  185  DPFVAIPNGFGCALGTLQLILYFIYCGNK---GEKSADAQKDEKSVEMKDDEKKQ-NVVN  240

Query  853  SKYD  864
             K D
Sbjct  241  GKQD  244



>ref|XP_006858415.1| hypothetical protein AMTR_s00071p00055180 [Amborella trichopoda]
 gb|ERN19882.1| hypothetical protein AMTR_s00071p00055180 [Amborella trichopoda]
Length=251

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 159/211 (75%), Gaps = 5/211 (2%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NATA F+FLAP+ TF+RII  +STE+FSG PYV T L+C+L AWYGLPFVSP
Sbjct  5    HFLFGIFGNATALFLFLAPVITFRRIIGSKSTEDFSGVPYVSTLLNCLLAAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKK---Kigvllilvvgifvavallsvfvf  483
            +NILV+TI+G G  IE  FV IF+++A  N+KK   KI  LL + + +F  V L+S+F  
Sbjct  65   HNILVSTINGAGATIEFVFVTIFLIYA--NQKKVRVKIFGLLCIALSVFALVVLISLFAL  122

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG+ R+LFCG AA I +  MY SPLSV+R+V++TKSVEFMPF L+  + LC T+W I+GL
Sbjct  123  HGQSRKLFCGLAATIFSICMYASPLSVMRMVIRTKSVEFMPFFLSLFVFLCGTSWFIYGL  182

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            + +DPF+Y PN  GC +G +QLILYAIY ++
Sbjct  183  IGRDPFIYTPNGFGCALGTIQLILYAIYRKR  213



>ref|NP_001044998.1| Os01g0881300 [Oryza sativa Japonica Group]
 sp|Q8RZQ8.1|SWT1A_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET1a; Short=OsSWEET1a 
[Oryza sativa Japonica Group]
 dbj|BAB90353.1| putative MtN3 [Oryza sativa Japonica Group]
 dbj|BAC06235.1| putative MtN3 [Oryza sativa Japonica Group]
 dbj|BAF06912.1| Os01g0881300 [Oryza sativa Japonica Group]
 dbj|BAG90683.1| unnamed protein product [Oryza sativa Japonica Group]
Length=273

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 159/211 (75%), Gaps = 3/211 (1%)
 Frame = +1

Query  133  HLA---FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            H+A   FG+  N  A F+FL+P+ TF RIIKKRSTE+FSG PY +T L+C+L AWYGLPF
Sbjct  3    HIARFFFGVSGNVIALFLFLSPVVTFWRIIKKRSTEDFSGVPYNMTLLNCLLSAWYGLPF  62

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSPNNILVTTI+G G+VIE  +VVIF++FA +  + K+  LL LV  IF  V L+S+   
Sbjct  63   VSPNNILVTTINGTGSVIEAIYVVIFLIFAERKARLKMMGLLGLVTSIFTMVVLVSLLAL  122

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG+ R+LFCG AA I +  MY SPLS++R+V+KTKSVEFMPFLL+ S+ LC T+W I+GL
Sbjct  123  HGQGRKLFCGLAATIFSICMYASPLSIMRLVIKTKSVEFMPFLLSLSVFLCGTSWFIYGL  182

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            L +DPF+ +PN  G  +G++QLILYAIY   
Sbjct  183  LGRDPFIAIPNGCGSFLGLMQLILYAIYRNH  213



>gb|EPS69723.1| hypothetical protein M569_05042 [Genlisea aurea]
Length=240

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 158/215 (73%), Gaps = 1/215 (0%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            +  TLH  FGIF NAT  F+FL+P+ TFK+I+  RST++FSG PYV+T L+C+L AWYGL
Sbjct  1    MENTLHFVFGIFGNATGLFLFLSPLITFKKIVSSRSTQQFSGVPYVMTLLNCLLSAWYGL  60

Query  298  PFVSPNNILVTTIDGIGTVIELAFVVIFIVF-APKNEKKKigvllilvvgifvavallsv  474
            PFVSPNN+LV+ I+G G VIE  +V++F+VF A K  +  I  LL L++ +F  V  +S+
Sbjct  61   PFVSPNNLLVSAINGTGAVIESVYVILFVVFSATKKGRATILGLLSLILAVFAVVVFVSL  120

Query  475  fvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
            F   G  R+LFCG AA + + +MY SPL+VIR+V+KTKSVEFMPF L+    LC T+W +
Sbjct  121  FALAGNGRKLFCGIAAAVFSIVMYGSPLTVIRLVIKTKSVEFMPFFLSLFAFLCGTSWFV  180

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            FGLL KDPF+ +PN  G G+G +QLI+YAIYS K 
Sbjct  181  FGLLGKDPFIAIPNGFGSGLGAVQLIMYAIYSSKN  215



>ref|XP_009775809.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Nicotiana 
sylvestris]
Length=253

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 172/250 (69%), Gaps = 2/250 (1%)
 Frame = +1

Query  115  GLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            G+  TL   FGIF NA   F+FL P  TFKRIIK RSTE+FSG PYV+TFL+C+L AWYG
Sbjct  2    GVVHTLQFTFGIFGNAATLFLFLVPTFTFKRIIKNRSTEQFSGLPYVMTFLNCLLSAWYG  61

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
            LPF++ +NILV TI+G G  IEL +V+IF+  AP  +K KI   L+LV+ +F   AL+S+
Sbjct  62   LPFITSDNILVATINGAGAAIELIYVLIFLALAPNKQKGKILATLLLVLLVFAGAALVSL  121

Query  475  fvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
             VFHG+ R+LFCG AA I + +MY SP+S+IR+V++TKSVE+MPF L+F++V+  T W  
Sbjct  122  LVFHGKNRKLFCGTAATIFSIVMYASPMSIIRLVIRTKSVEYMPFFLSFAVVISCTCWFT  181

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGML--QINAMPQHE  828
            + +L +DPF+ +   VG  +G++QLILYAIY +K +        S  M     N    +E
Sbjct  182  YAMLGRDPFIGISTGVGLFLGIVQLILYAIYCDKKVLTNKSTDVSLEMDNGHSNVKLHYE  241

Query  829  KKQPSITSSK  858
            +KQ + +S +
Sbjct  242  EKQYNQSSHE  251



>gb|KCW44925.1| hypothetical protein EUGRSUZ_L01492 [Eucalyptus grandis]
Length=243

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 164/242 (68%), Gaps = 4/242 (2%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            R L    G+  NA   F+FLAP+ TFKRII+ RSTE+FSG PYV+  L+C++  WYGLPF
Sbjct  2    RVLRFLIGVLGNAAGLFLFLAPVITFKRIIRSRSTEQFSGIPYVMALLNCLVFTWYGLPF  61

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VS NN+LV+T+ GIG VIE  ++VIF+++APK E+ KI  L  L++ +F+ +A +S+   
Sbjct  62   VSRNNLLVSTVSGIGGVIEFTYIVIFLIYAPKKERTKIIGLFSLIMTVFLVIASVSLLAL  121

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG  R+LFCG AA + +  MY SPLSV+R+V+KTKSVE+MPF L+    L   +WL FGL
Sbjct  122  HGNTRKLFCGIAAALFSTTMYASPLSVMRMVIKTKSVEYMPFFLSLFAFLSGVSWLTFGL  181

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIY--SEKTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            L  DPF+ VPN  G G+G+ QLILYAIY  S+     TIK  F+   + +  + Q +K  
Sbjct  182  LSGDPFIIVPNGFGTGLGIAQLILYAIYCKSKSHTENTIKDDFTE--MDLGKIDQAKKPD  239

Query  838  PS  843
             S
Sbjct  240  SS  241



>ref|XP_011101806.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Sesamum 
indicum]
Length=261

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 129/250 (52%), Positives = 174/250 (70%), Gaps = 10/250 (4%)
 Frame = +1

Query  121  ARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLP  300
             + LHLAFG+F NAT  F+FL+P  TFKRI+ K+ST++FSG PYV+T L+C+L AWYGLP
Sbjct  4    GKALHLAFGVFGNATGLFLFLSPAVTFKRIVAKKSTQQFSGIPYVMTLLNCLLAAWYGLP  63

Query  301  FVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfv  480
            F+S NN LV+ I+G G VIE  +V+IF+++A K EK KI  LL+ ++ IF  +AL+SV  
Sbjct  64   FISKNNFLVSAINGTGAVIESVYVLIFLIYAAKKEKGKIAGLLLCILAIFATIALVSVLA  123

Query  481  fHGRI-RQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIF  657
            F     RQL CGFAA + + IMY SPLSV+R+V+KTKSVE+MPFLL+  + LC T+W I+
Sbjct  124  FTSMARRQLLCGFAATVFSIIMYASPLSVMRMVIKTKSVEYMPFLLSLFVFLCGTSWFIY  183

Query  658  GLLEKDPFVYVPNAVGCGVGVLQLILYAIY-SEKTIFMTIKRSFSHGMLQI-------NA  813
            GL+  D F+Y+PN  GC +G +QLILYAIY + K        S + G L++       N 
Sbjct  184  GLIGNDKFLYIPNGFGCVLGAMQLILYAIYRNNKGDDAKKPASPTEGSLEMGVAIAIANG  243

Query  814  MPQHEKKQPS  843
             P H+  QP+
Sbjct  244  KPHHQ-NQPT  252



>ref|XP_003541791.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Glycine 
max]
Length=248

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 161/240 (67%), Gaps = 5/240 (2%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NA+  F+FLAPI TF RI+  +STE+FSG PY +T L+C+L AWYGLPFVSP
Sbjct  5    HFIFGIFGNASGLFLFLAPIVTFWRIVSNKSTEKFSGVPYPMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NN+LVT I+G G  IE+ +V IFI FAPK EK KI  L   VV +F  V L+S+F   G 
Sbjct  65   NNLLVTIINGTGAGIEIIYVFIFIYFAPKKEKTKIIGLFSFVVAVFSVVVLVSLFALQGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I + +MY SPLS++R+V+KTKSVEFMPF L+  + LC T+W I+GLL +
Sbjct  125  ARKLFCGFAAAIFSIVMYGSPLSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIYGLLGR  184

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSE-----KTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            DPFV VPN VG  +G  QLILY IY +     K I  T + +   G    N +      Q
Sbjct  185  DPFVAVPNGVGSALGTAQLILYFIYRDNKSDPKKIPRTEEEAMEMGTANKNPISNSNGIQ  244



>ref|XP_010065109.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Eucalyptus 
grandis]
 gb|KCW71177.1| hypothetical protein EUGRSUZ_F04270 [Eucalyptus grandis]
Length=243

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 165/242 (68%), Gaps = 4/242 (2%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            R L    G+  NA   F+FLAP+ TFKRI++ RSTE+FSG PYV+  L+C++  WYGLPF
Sbjct  2    RILRFLIGVLGNAAGLFLFLAPVITFKRILRSRSTEQFSGIPYVMALLNCLVFTWYGLPF  61

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VS NN+LV+T+ GIG VIE  ++VIF+++APK E+ KI  L  L++ +F+ +A +S+   
Sbjct  62   VSRNNLLVSTVSGIGGVIEFTYIVIFLIYAPKKERTKIIGLFALIMTVFLVIACVSLLAL  121

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG  R+LFCG AA + + IMY SPLSV+R+V+KTKSVE+MPF L+   +L   +WL FGL
Sbjct  122  HGNTRKLFCGIAAALFSTIMYASPLSVMRMVIKTKSVEYMPFFLSLFALLSGVSWLTFGL  181

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFM--TIKRSFSHGMLQINAMPQHEKKQ  837
            L  DPF+ VPN  G G+G+ QLILYAIY +       TIK  F+   + +  + Q +K  
Sbjct  182  LSGDPFIIVPNGFGTGLGIAQLILYAIYCKNKSHTENTIKDDFTE--MDLGMIDQAKKPD  239

Query  838  PS  843
             S
Sbjct  240  SS  241



>ref|XP_010040793.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Eucalyptus 
grandis]
 gb|KCW44923.1| hypothetical protein EUGRSUZ_L01489 [Eucalyptus grandis]
Length=243

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 152/204 (75%), Gaps = 0/204 (0%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            G+  NAT  F+FLAP+ TFKRII+ RSTE+FSG PYV+T L+C++  WYGLPFVS NNI 
Sbjct  9    GVLGNATGLFLFLAPMVTFKRIIRNRSTEQFSGIPYVMTLLNCIVSTWYGLPFVSRNNIF  68

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            + TI+G G VIE  ++VIFI++APK E+ K+  L  L++ +F A+A +S+   HG  R+ 
Sbjct  69   IWTINGTGGVIEFTYIVIFIIYAPKKERMKVMGLFALIMTVFSAIASVSLLALHGNTRKF  128

Query  505  FCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFV  684
            FCG AA + + IMY SPLSV+R+V+KTKSVEFMPF L+    LCA +W I+GLL  DPFV
Sbjct  129  FCGVAAALFSIIMYASPLSVMRMVIKTKSVEFMPFFLSLFAFLCALSWFIYGLLSGDPFV  188

Query  685  YVPNAVGCGVGVLQLILYAIYSEK  756
             VPNA G G+G+ QLILYAIY + 
Sbjct  189  LVPNAFGTGLGIAQLILYAIYYKN  212



>ref|XP_009589302.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Nicotiana 
tomentosiformis]
Length=253

 Score =   231 bits (588),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 172/244 (70%), Gaps = 4/244 (2%)
 Frame = +1

Query  115  GLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            G+   L   FGIF NA   F+FL P  TFKRIIK RSTE+FSG PYV+TFL+C+L AWYG
Sbjct  2    GVVHALQFTFGIFGNAATLFLFLVPTFTFKRIIKNRSTEQFSGLPYVMTFLNCLLSAWYG  61

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
            LPF++ +NILVTTI+G G  IEL +V+IF+  AP  +K KI   L+LV+ +F   AL+S+
Sbjct  62   LPFITSDNILVTTINGAGATIELIYVLIFLALAPNKQKGKILATLLLVLLVFAGAALVSL  121

Query  475  fvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
             VFHG+ R+LFCG AA I + +MY SP+S+IR+V++TKSVE+MPF L+F++V+  T W  
Sbjct  122  LVFHGKNRKLFCGTAATIFSIVMYASPMSIIRLVIRTKSVEYMPFFLSFAVVISCTCWFT  181

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRS---FSHGMLQINAMPQH  825
            + +L +DPF+ +   VG  +G++QLILYAIY +K + +T K +      G   IN    +
Sbjct  182  YAMLGRDPFIGISTGVGLFLGIVQLILYAIYCDKKV-LTNKSTDVPVEMGNGHINIKFHY  240

Query  826  EKKQ  837
            E+KQ
Sbjct  241  EEKQ  244



>ref|XP_010065111.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Eucalyptus 
grandis]
Length=249

 Score =   231 bits (588),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 168/238 (71%), Gaps = 2/238 (1%)
 Frame = +1

Query  130  LHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVS  309
            L  A GI ANATA  ++LAP  TFKRII+ RSTE+FSG PYVIT L+C+L  WYGLPF+S
Sbjct  4    LRFAVGIIANATALLMYLAPTITFKRIIRSRSTEQFSGAPYVITLLNCLLYCWYGLPFIS  63

Query  310  PNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHG  489
            PNNIL++TI G G +IE  +V+IF+++APK E+ KI  L+ L V IF  VAL+S FVF G
Sbjct  64   PNNILLSTITGTGAIIESTYVLIFVIYAPKMERTKIFGLVALAVAIFSTVALVSFFVFDG  123

Query  490  RIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLE  669
            + R+LF G    I A  M+ SPLS++R+V+KTKSVEFMPF L+   +LCA +W +FGL+ 
Sbjct  124  KTRKLFTGVFVDIFAIAMFASPLSIMRLVIKTKSVEFMPFFLSLFGLLCAVSWTVFGLIN  183

Query  670  KDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPS  843
             DPFV VPNA+G G+G+ Q+ILYAIY E++           G L+ +     EK+QP 
Sbjct  184  SDPFVIVPNALGSGLGIAQMILYAIYHERS--RQHDNVVKDGSLERDLQITLEKQQPE  239



>ref|XP_006645124.1| PREDICTED: bidirectional sugar transporter SWEET1a-like [Oryza 
brachyantha]
Length=277

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 159/211 (75%), Gaps = 3/211 (1%)
 Frame = +1

Query  133  HLA---FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            H+A   FG+  N  A F+FL+P+ TF RII+KRSTE+FSG PY +T L+C+L AWYGLPF
Sbjct  3    HIARFFFGVSGNVIALFLFLSPVVTFWRIIRKRSTEDFSGVPYNMTLLNCLLSAWYGLPF  62

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSPNNILVTTI+G G+VIE  +VVIF++FA +  + K+  LL +V  IF  V L+S+   
Sbjct  63   VSPNNILVTTINGTGSVIEAIYVVIFLIFAERKTRLKMMGLLGIVTSIFTMVVLVSLLAL  122

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG+ R+LFCG AA I +  MY SPLS++R+V+KTKSVEFMPFLL+ S+ LC T+W I+GL
Sbjct  123  HGQGRKLFCGLAATIFSICMYASPLSIMRLVVKTKSVEFMPFLLSLSVFLCGTSWFIYGL  182

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            L +DPF+ +PN  G  +G++QLILYAIY   
Sbjct  183  LGRDPFIAIPNGCGSFLGLMQLILYAIYRNH  213



>emb|CDJ26295.1| unnamed protein product [Triticum aestivum]
Length=274

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 159/211 (75%), Gaps = 3/211 (1%)
 Frame = +1

Query  133  HLA---FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            H+A   FG+  N  A F+FL+P+ TF RIIK++STE+FSG PY +T L+C+L AWYGLPF
Sbjct  3    HIARFFFGVSGNVIALFLFLSPVVTFWRIIKRKSTEDFSGVPYNMTLLNCLLSAWYGLPF  62

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSPNNILVTTI+G G+VIE  +VVIF++FA +  K ++  LL +V  IF  V L+S+   
Sbjct  63   VSPNNILVTTINGAGSVIEAIYVVIFLIFAERKAKIRMLGLLSVVTTIFATVVLVSLLAL  122

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HGR R +FCG AA + +  MY SPLS++R+V+KTKSVE+MPFLL+ S+ LC T+W I+GL
Sbjct  123  HGRARTVFCGLAATVFSICMYASPLSIMRLVIKTKSVEYMPFLLSLSVFLCGTSWFIYGL  182

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            L  DPF+Y+PN  G  +G++QLILYAIY + 
Sbjct  183  LGLDPFIYIPNGCGSFLGLMQLILYAIYRKN  213



>ref|XP_003564773.1| PREDICTED: bidirectional sugar transporter SWEET1a [Brachypodium 
distachyon]
Length=259

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 156/205 (76%), Gaps = 0/205 (0%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FG+  N  A F+FL+P+ TF RII+KRSTE+FSG PY +T L+C+L AWYGLPFVSPNNI
Sbjct  9    FGVSGNVIALFLFLSPVVTFWRIIRKRSTEDFSGVPYNMTLLNCLLSAWYGLPFVSPNNI  68

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQ  501
            LVTTI+G G+VIE  +V+IF++FA +  + ++  LL LV  IF  V L+S+   HG+ R+
Sbjct  69   LVTTINGAGSVIEAIYVIIFLIFAERKSRLRMTGLLGLVTSIFTTVVLVSLLALHGQARK  128

Query  502  LFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPF  681
            +FCG AA + +  MY SPLS++R+V+KTKSVEFMPFLL+ S+ LC T+W I+GLL +DPF
Sbjct  129  VFCGLAATVFSICMYASPLSIMRLVIKTKSVEFMPFLLSLSVFLCGTSWFIYGLLGRDPF  188

Query  682  VYVPNAVGCGVGVLQLILYAIYSEK  756
            + +PN  G  +G++QLILYAIY   
Sbjct  189  IAIPNGCGSFLGLMQLILYAIYRNN  213



>ref|XP_004237723.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Solanum 
lycopersicum]
Length=245

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 126/245 (51%), Positives = 171/245 (70%), Gaps = 10/245 (4%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            + LH  FGIF N T  F+FLAP+ TFKR+I  +STE+FSG PYV+T L+C+L  WYGLPF
Sbjct  5    KILHTLFGIFGNITGLFLFLAPMITFKRVIMNKSTEQFSGIPYVMTLLNCLLSTWYGLPF  64

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSPNN+LV+ I+G G  +E  +V++F++FAPK EK KI  +L +V+ IF  VAL+S+   
Sbjct  65   VSPNNMLVSIINGTGAGLEAFYVLVFLIFAPKKEKAKISGILFVVLSIFSTVALVSMLAL  124

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            H   R++F GFAA I + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W ++GL
Sbjct  125  HDNKRKVFSGFAAAIFSIIMYGSPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFVYGL  184

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIY-SEKTIFMTIKRSFSHGMLQINAMPQHEKKQP  840
            L KDPF+ VPN VG  +G  QLILYAIY  EK      K+    G +++      E ++P
Sbjct  185  LGKDPFIAVPNGVGSLLGTAQLILYAIYRGEKG---QSKKGEEDGRVEM------ELEKP  235

Query  841  SITSS  855
            S T +
Sbjct  236  SNTQN  240



>ref|XP_008347232.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Malus domestica]
Length=243

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 154/205 (75%), Gaps = 0/205 (0%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FG+  N TAFF+FL+P  TFKRI++K+ TE+FSG PYV+T L+C+L AWYGLPFVS NN 
Sbjct  8    FGVLGNGTAFFLFLSPTITFKRIMRKKCTEQFSGIPYVMTMLNCLLYAWYGLPFVSANNF  67

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQ  501
            LV+T++G G  +EL +V++FI+FAPK EK KI  L   V+ +F AVAL+S+F  H + R+
Sbjct  68   LVSTVNGTGAAMELIYVLVFIIFAPKREKAKILGLFTAVLALFSAVALVSLFALHDKTRK  127

Query  502  LFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPF  681
            LFCG AA + A IM+ SPLS++  V++TKSVEFMPF L+    LC T+W I+GLL +DPF
Sbjct  128  LFCGLAATVFAIIMFSSPLSIMSTVVRTKSVEFMPFFLSLFSFLCGTSWFIYGLLGRDPF  187

Query  682  VYVPNAVGCGVGVLQLILYAIYSEK  756
            V +PN  G G+G LQLILY IY + 
Sbjct  188  VAIPNGCGSGLGALQLILYFIYRDN  212



>ref|XP_011074778.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Sesamum 
indicum]
Length=246

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/247 (52%), Positives = 172/247 (70%), Gaps = 4/247 (2%)
 Frame = +1

Query  115  GLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            G    LHL FGI  NAT  F+FL+P  TFKRII KRSTE+FSG PYV+T L+C+L AWYG
Sbjct  2    GNGDALHLTFGIIGNATGLFLFLSPTVTFKRIIAKRSTEQFSGIPYVMTLLNCLLAAWYG  61

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
            LPF++ NN LV+ I+G+G +IE  +V+IF++FAPK EK KI  LL+ ++ +F AV L+S+
Sbjct  62   LPFITTNNYLVSAINGVGALIESIYVLIFLIFAPKKEKAKILGLLVCILTLFSAVVLVSL  121

Query  475  fvfHG-RIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWL  651
            F  H  + R+L CGFA+ I + IMY SPLSV+RVV+KTKSVE+MPFLL+  + LC   WL
Sbjct  122  FALHKEKQRKLVCGFASTIFSIIMYASPLSVMRVVIKTKSVEYMPFLLSLFVFLCGCCWL  181

Query  652  IFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQIN-AMPQHE  828
            ++GL+ KD F+ VPN  G  +G +QLILY IY +       K+    G L++    P   
Sbjct  182  VYGLIGKDIFLIVPNGFGTVLGTMQLILYTIYYKNE--GEAKKPTMDGSLEMGLNNPYQL  239

Query  829  KKQPSIT  849
            +KQP+ +
Sbjct  240  EKQPNCS  246



>ref|XP_008357046.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Malus domestica]
Length=243

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 153/205 (75%), Gaps = 0/205 (0%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FG+  N TAFF+FL+P  TFKRII+K+ TE+FSG PYV+T L+C+L  WYGLPFVS NN 
Sbjct  8    FGVLGNGTAFFLFLSPTITFKRIIRKKCTEQFSGIPYVMTMLNCLLYTWYGLPFVSANNF  67

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQ  501
            LV+T++G G  +EL +V++FI+FAPK EK KI  L   V+ +F AVAL+S+F  H + R+
Sbjct  68   LVSTVNGTGAAMELIYVLVFIIFAPKREKAKILGLFTAVLALFSAVALVSLFALHDKTRK  127

Query  502  LFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPF  681
            LFCG AA + A IM+ SPLS++  V++TKSVEFMPF L+    LC T+W I+GLL +DPF
Sbjct  128  LFCGLAATVFAIIMFSSPLSIMSTVVRTKSVEFMPFFLSLFSFLCGTSWFIYGLLGRDPF  187

Query  682  VYVPNAVGCGVGVLQLILYAIYSEK  756
            V +PN  G G+G LQLILY IY + 
Sbjct  188  VAIPNGCGSGLGALQLILYFIYRDN  212



>emb|CDP11998.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 165/242 (68%), Gaps = 2/242 (1%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            +   LH  FG+  NA   F+FLAP  TFKRI++KRSTE+FSG PY +  L+C+L AWYGL
Sbjct  1    MVHILHTVFGVIGNACGLFLFLAPTITFKRILRKRSTEDFSGVPYTMALLNCLLYAWYGL  60

Query  298  PFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvf  477
            PFVSPNNILV+ I+G G V+E  +V+IF++ APK EK K+  +L+LV+  F AV L+S+ 
Sbjct  61   PFVSPNNILVSIINGTGAVLESIYVLIFLILAPKKEKAKVFGILVLVLTTFAAVVLVSML  120

Query  478  vfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIF  657
              HG+ R+LF G  A I +  MY +PLSV+R+V+K KSVE+MPF L+  + L  T W I+
Sbjct  121  ALHGKTRKLFVGLIATIFSIAMYAAPLSVMRLVIKAKSVEYMPFFLSLFVFLTGTTWFIY  180

Query  658  GLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            G++ KDPF+ VPN  GC +G +QL+LYAIY +        +  ++G L++     H++K 
Sbjct  181  GMIGKDPFLAVPNGFGCVLGAMQLMLYAIYHKNK--GDNNKGVANGSLEMGIEQSHQQKH  238

Query  838  PS  843
             +
Sbjct  239  AT  240



>emb|CAN59909.1| hypothetical protein VITISV_037479 [Vitis vinifera]
Length=249

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 165/239 (69%), Gaps = 2/239 (1%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
              LH  FGIF NATA F+FLAP+ TFKRIIK +STE+FSG PYV+T L+C+L AWYGLPF
Sbjct  5    HALHFTFGIFGNATALFLFLAPLITFKRIIKSKSTEQFSGIPYVMTLLNCLLSAWYGLPF  64

Query  304  VSPNNILVTTID-GIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfv  480
            VS NNIL       +   +++ +V+IFI ++ K E+ KI  L I V+ +F  V  +S+F 
Sbjct  65   VSKNNILDDPPSMALEQPLKIIYVLIFIAYSIKKERAKILGLFIFVLSVFGVVVFVSLFA  124

Query  481  fHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFG  660
             HG  R+LFCG AA I + IMY SPLS++R+V+KTKSVE+MPF L+  + LC T+W +FG
Sbjct  125  LHGHGRKLFCGLAATIFSIIMYASPLSIMRMVIKTKSVEYMPFFLSLFVFLCGTSWFVFG  184

Query  661  LLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            LL KDPFV VPN  GCG+G +QLILYAIY +K     +  +     +++   PQ EK+ 
Sbjct  185  LLGKDPFVAVPNGFGCGLGAMQLILYAIYCKKGKSKNLAAADKPVDMELGK-PQQEKQS  242



>dbj|BAJ94374.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 158/211 (75%), Gaps = 3/211 (1%)
 Frame = +1

Query  133  HLA---FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            H+A   FG+  N  A F+FL+P+ TF RIIK++STE+FSG PY +T L+C+L AWYGLPF
Sbjct  3    HIARFFFGVSGNVIALFLFLSPVVTFWRIIKRKSTEDFSGVPYNMTLLNCLLSAWYGLPF  62

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSPNNILVTTI+G G+VIE  +VVIF++FA +  K ++  LL +V  IF  V L+S+   
Sbjct  63   VSPNNILVTTINGAGSVIEAIYVVIFLIFAERRSKIRMLGLLSVVTAIFTTVVLVSLLAL  122

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG+ R +FCG AA + +  MY SPLS++R+V+KTK VEFMPFLL+ S+ LC T+W I+GL
Sbjct  123  HGKGRTVFCGLAATVFSICMYASPLSIMRLVIKTKCVEFMPFLLSLSVFLCGTSWFIYGL  182

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            L  DPF+Y+PN  G  +G++QLILYAIY + 
Sbjct  183  LGLDPFIYIPNGCGSFLGLMQLILYAIYRKN  213



>ref|XP_010063892.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW71175.1| hypothetical protein EUGRSUZ_F04268 [Eucalyptus grandis]
Length=243

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 151/204 (74%), Gaps = 0/204 (0%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            G+  NAT  F+FLAP+ TFKRII+ RSTE+FSG PYV+T L+C++  WYGLPFVS NNIL
Sbjct  9    GVLGNATGLFLFLAPMVTFKRIIRNRSTEQFSGIPYVMTLLNCIVFTWYGLPFVSRNNIL  68

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            + TI+  G VIE  ++VIFI+F PK E+ K+  L  L++ +F A+A +S+   HG  R+ 
Sbjct  69   IWTINATGGVIEFTYIVIFIIFGPKKERMKVMGLFALIMTVFSAIASISLLALHGNTRKF  128

Query  505  FCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFV  684
            FCG AA + + +M+ SPLSV+R+V+KTKSVEFMPF L+    LCA +WLI+GLL  DPFV
Sbjct  129  FCGVAAALFSTVMFASPLSVMRMVIKTKSVEFMPFFLSLFAFLCALSWLIYGLLSGDPFV  188

Query  685  YVPNAVGCGVGVLQLILYAIYSEK  756
             VPN  G G+G+ QLILYAIY + 
Sbjct  189  LVPNVFGTGLGIAQLILYAIYYKN  212



>ref|XP_004242009.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Solanum 
lycopersicum]
Length=256

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 164/232 (71%), Gaps = 1/232 (0%)
 Frame = +1

Query  109  MHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAW  288
            M GL  T+   FGI  NA   F+FL P  TFKRII+ +STE+FSG PYV+TFL+C+L AW
Sbjct  1    MGGLVHTIQFIFGIVGNAATLFLFLVPTFTFKRIIENKSTEQFSGVPYVMTFLNCLLSAW  60

Query  289  YGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavall  468
            YGLPF+S NNIL+ TI+G G  IEL +V+IF ++AP  +K KI  +LILV+  F   A++
Sbjct  61   YGLPFISSNNILIATINGAGAAIELIYVLIFFIYAPNKQKGKILAMLILVIIAFAIAAVI  120

Query  469  svfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAW  648
            SV  FHG+ RQLFCG AA I + +MY SP+S+IR+V+KTKSVE+MPF L+F++V+  + W
Sbjct  121  SVLAFHGKNRQLFCGTAATIFSIVMYASPMSIIRLVIKTKSVEYMPFFLSFAVVVSCSCW  180

Query  649  LIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQ  804
              + +L  DPFV +   VG  +G++QLILY IY +K I +  K S +   LQ
Sbjct  181  FTYAMLGMDPFVGISTGVGLALGIVQLILYFIYCDKKI-LNKKTSATDESLQ  231



>ref|XP_006366752.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Solanum 
tuberosum]
Length=256

 Score =   226 bits (575),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 173/257 (67%), Gaps = 3/257 (1%)
 Frame = +1

Query  109  MHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAW  288
            M GL +T+   FGI  NA   F+FL P  TFKRII+ +STE+FSG PYV+TFL+C+L AW
Sbjct  1    MGGLVQTIKFVFGIVGNAATLFLFLVPTFTFKRIIENKSTEQFSGIPYVMTFLNCLLSAW  60

Query  289  YGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavall  468
            YGLPF++ NNIL+ T++G G  IEL +V+IF ++AP  +K KI  +LILV+  F A A++
Sbjct  61   YGLPFITSNNILIATVNGAGAAIELIYVLIFFLYAPNKQKGKILAMLILVILAFAAAAVI  120

Query  469  svfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAW  648
            SV  FHG+ RQLFCG AA I + +MY SP+S+IR+V+KTKSVE+MPF L+F++V+  + W
Sbjct  121  SVLAFHGKNRQLFCGTAATIFSIVMYASPMSIIRLVIKTKSVEYMPFFLSFAVVVSCSCW  180

Query  649  LIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQI--NAMPQ  822
              + +L  DPFV +   VG  +G++QLILY IY +K I +  K + +   LQ   N    
Sbjct  181  FTYAMLGMDPFVGISTGVGLALGIVQLILYFIYCDKKI-LNKKTTATDESLQNMGNGYSN  239

Query  823  HEKKQPSITSSKYDELV  873
            + K       S + E V
Sbjct  240  NVKCYNDEKQSNFHEQV  256



>ref|XP_006654427.1| PREDICTED: bidirectional sugar transporter SWEET1b-like [Oryza 
brachyantha]
Length=261

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 161/217 (74%), Gaps = 4/217 (2%)
 Frame = +1

Query  109  MHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAW  288
            M  LA+ L   FGI  N  A F+FL+P+ TF RII+++STE+FSG PY +T ++C+L AW
Sbjct  1    MEDLAKFL---FGIAGNVIALFLFLSPVPTFWRIIRRKSTEDFSGVPYNMTLINCLLSAW  57

Query  289  YGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKK-Kigvllilvvgifvaval  465
            YGLPFVSPNN+LV+TI+G G VIE A+VV+F+VFA  ++ + ++  L   V   F  VAL
Sbjct  58   YGLPFVSPNNMLVSTINGAGAVIETAYVVVFLVFASSHKTRLRMAGLASAVASAFAVVAL  117

Query  466  lsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATA  645
            +S+   HG+ R+LFCG AA +C+  MY SPLS++R+V+KTKSVE+MPFLL+ ++ LC T+
Sbjct  118  VSLLALHGQGRKLFCGVAATVCSICMYASPLSIMRLVIKTKSVEYMPFLLSLAVFLCGTS  177

Query  646  WLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            W I+GLL +DPFV +PN  G  +G +QL+LYAIY + 
Sbjct  178  WFIYGLLGRDPFVTIPNGCGSFLGAVQLVLYAIYRKN  214



>ref|XP_010921715.1| PREDICTED: bidirectional sugar transporter SWEET1a-like [Elaeis 
guineensis]
Length=253

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 153/209 (73%), Gaps = 0/209 (0%)
 Frame = +1

Query  130  LHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVS  309
            LH  FGIF N TA F+FL+PI TF+RIIK + TE+FSG PY +  L+C+L AWYGLPFVS
Sbjct  4    LHFLFGIFGNVTALFLFLSPIVTFRRIIKNKLTEDFSGVPYNMALLNCLLCAWYGLPFVS  63

Query  310  PNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHG  489
            PNN+L +TI+G G V+E  +VVIFI++AP+  +  +  L  LVV +F AVAL S+   HG
Sbjct  64   PNNMLFSTINGTGAVLEAVYVVIFIIYAPQKVRSMMLGLFALVVTLFAAVALASLLFLHG  123

Query  490  RIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLE  669
            + R+LFCGFAA + +  MY SPL V+R+V++TKSVEFMPF L+  + LC T+W IFGLL 
Sbjct  124  QTRKLFCGFAAAVFSICMYASPLFVMRLVIRTKSVEFMPFFLSLFVFLCGTSWFIFGLLG  183

Query  670  KDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
             DPF+ VPN  G  +G +QLILYAIY   
Sbjct  184  HDPFISVPNGCGSVLGAMQLILYAIYRNH  212



>ref|XP_008366545.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Malus domestica]
Length=248

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 158/214 (74%), Gaps = 3/214 (1%)
 Frame = +1

Query  124  RTLHL---AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            +T+H+    FG+  N TAFF+FL+P  TFKRI++K+ TE+FSG PYV+T L+C+L AWYG
Sbjct  4    KTVHVFKVLFGVLGNGTAFFLFLSPTITFKRIMRKKCTEQFSGIPYVMTMLNCLLYAWYG  63

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
            LPFVS NN LV+T++G G  +EL +V++FI+FAPK E+ KI  L   V+ +F AVAL+S+
Sbjct  64   LPFVSANNFLVSTVNGTGAAMELIYVLVFIIFAPKRERAKILGLFTAVLALFSAVALVSL  123

Query  475  fvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
            F  H + R+LFCG AA + A IM+ SPLS++  V++TKSVEFMPF L+    LC T+W I
Sbjct  124  FALHDKTRKLFCGLAATVFAIIMFSSPLSIMSTVVRTKSVEFMPFFLSLFSFLCGTSWFI  183

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            +GLL +DPFV +PN  G  +G LQLILY IY + 
Sbjct  184  YGLLGRDPFVAIPNGCGSXLGALQLILYFIYRDN  217



>ref|XP_010040795.1| PREDICTED: bidirectional sugar transporter SWEET1-like, partial 
[Eucalyptus grandis]
Length=238

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 160/232 (69%), Gaps = 4/232 (2%)
 Frame = +1

Query  154  ANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTT  333
             NA   F+FLAP+ TFKRII+ RSTE+FSG PYV+  L+C++  WYGLPFVS NN+LV+T
Sbjct  7    GNAAGLFLFLAPVITFKRIIRSRSTEQFSGIPYVMALLNCLVFTWYGLPFVSRNNLLVST  66

Query  334  IDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCG  513
            + GIG VIE  ++VIF+++APK E+ KI  L  L++ +F+ +A +S+   HG  R+LFCG
Sbjct  67   VSGIGGVIEFTYIVIFLIYAPKKERTKIIGLFSLIMTVFLVIASVSLLALHGNTRKLFCG  126

Query  514  FAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVP  693
             AA + +  MY SPLSV+R+V+KTKSVE+MPF L+    L   +WL FGLL  DPF+ VP
Sbjct  127  IAAALFSTTMYASPLSVMRMVIKTKSVEYMPFFLSLFAFLSGVSWLTFGLLSGDPFIIVP  186

Query  694  NAVGCGVGVLQLILYAIY--SEKTIFMTIKRSFSHGMLQINAMPQHEKKQPS  843
            N  G G+G+ QLILYAIY  S+     TIK  F+   + +  + Q +K   S
Sbjct  187  NGFGTGLGIAQLILYAIYCKSKSHTENTIKDDFTE--MDLGKIDQAKKPDSS  236



>ref|XP_009399164.1| PREDICTED: bidirectional sugar transporter SWEET1a-like [Musa 
acuminata subsp. malaccensis]
Length=257

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 166/247 (67%), Gaps = 9/247 (4%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
              L   FGIF NATA F+FL+P+ TF+RI++KRSTE+FSG PY +TFL+C+L AWYGLPF
Sbjct  2    EVLKFLFGIFGNATALFLFLSPVVTFRRIVRKRSTEDFSGVPYNVTFLNCLLFAWYGLPF  61

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSPNNILV+TI+G G  IE  +V+IF+ FAPK  + ++  L  LV+ IF  +AL+S+   
Sbjct  62   VSPNNILVSTINGTGAAIEAVYVIIFLSFAPKKVRARMAGLFALVLSIFAVIALVSLLAL  121

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
             G+ R++FCG AA   +  MY SPLS++R+V++TKSVE+MPFLL+  + +  T W I+GL
Sbjct  122  RGQDRKVFCGVAATFFSICMYASPLSIMRLVIRTKSVEYMPFLLSLFVFVSGTLWFIYGL  181

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSE---------KTIFMTIKRSFSHGMLQINAM  816
            L  DPFV VPN  G  +G +QL+LYA+Y +         K + M  ++   +  +     
Sbjct  182  LGHDPFVTVPNGCGSALGAMQLVLYAVYRKNKGGGDADGKMVEMNGEKPPKNDAVSAEKT  241

Query  817  PQHEKKQ  837
            P H  ++
Sbjct  242  PHHPMEE  248



>ref|XP_004970789.1| PREDICTED: bidirectional sugar transporter SWEET1a-like [Setaria 
italica]
Length=265

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 159/211 (75%), Gaps = 3/211 (1%)
 Frame = +1

Query  133  HLA---FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            H+A   FG+  N  A F+FL+P+ TF RII+KRSTE+FSG PY +T L+C+L AWYGLPF
Sbjct  3    HIARFFFGVSGNVIALFLFLSPVVTFWRIIRKRSTEDFSGVPYNMTLLNCLLSAWYGLPF  62

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSPNNILVTTI+G G++IE  +VVIF++FA +  + ++  LL +V  IF AV L+S+   
Sbjct  63   VSPNNILVTTINGTGSLIEAIYVVIFLIFAERRIRLRMLGLLGVVTSIFAAVVLISLLAL  122

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG  R++FCG AA I +  MY SPLS++R+V+KTKSVEFMPFLL+ S+ LC T+W I+GL
Sbjct  123  HGNGRKIFCGLAATIFSICMYASPLSIMRLVIKTKSVEFMPFLLSLSVFLCGTSWFIYGL  182

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            L +DPF+ +PN  G  +G+ QL+LYA+Y + 
Sbjct  183  LGRDPFIIIPNGCGSFLGLTQLVLYAMYRKN  213



>sp|B8AYH1.1|SWT1B_ORYSI RecName: Full=Bidirectional sugar transporter SWEET1b; Short=OsSWEET1b 
[Oryza sativa Indica Group]
 gb|EEC79257.1| hypothetical protein OsI_20031 [Oryza sativa Indica Group]
Length=261

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/217 (53%), Positives = 160/217 (74%), Gaps = 4/217 (2%)
 Frame = +1

Query  109  MHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAW  288
            M  LA+ L   FG+  N  A F+FL+P+ TF RII+++STE+FSG PY +T ++C+L AW
Sbjct  1    MEDLAKFL---FGVSGNVIALFLFLSPVPTFWRIIRRKSTEDFSGVPYNMTLINCLLSAW  57

Query  289  YGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKK-Kigvllilvvgifvaval  465
            YGLPFVSPNNILV+TI+G G VIE A+VV+F+VFA  ++ + +   L   V  +F AVAL
Sbjct  58   YGLPFVSPNNILVSTINGAGAVIETAYVVVFLVFASTHKTRLRTLGLAAAVASVFAAVAL  117

Query  466  lsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATA  645
            +S+   HG+ R+L CG AA +C+  MY SPLS++R+V+KTKSVE+MPFLL+ ++ LC T+
Sbjct  118  VSLLALHGQHRKLLCGVAATVCSICMYASPLSIMRLVIKTKSVEYMPFLLSLAVFLCGTS  177

Query  646  WLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            W I+GLL +DPFV +PN  G  +G +QL+LYAIY   
Sbjct  178  WFIYGLLGRDPFVTIPNGCGSFLGAVQLVLYAIYRNN  214



>ref|NP_001055599.1| Os05g0426000 [Oryza sativa Japonica Group]
 sp|Q60EC2.1|SWT1B_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET1b; Short=OsSWEET1b 
[Oryza sativa Japonica Group]
 gb|AAV25007.1| unknow protein [Oryza sativa Japonica Group]
 dbj|BAF17513.1| Os05g0426000 [Oryza sativa Japonica Group]
 dbj|BAG88723.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63783.1| hypothetical protein OsJ_18606 [Oryza sativa Japonica Group]
Length=261

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 160/217 (74%), Gaps = 4/217 (2%)
 Frame = +1

Query  109  MHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAW  288
            M  LA+ L   FG+  N  A F+FL+P+ TF RII+++STE+FSG PY +T ++C+L AW
Sbjct  1    MEDLAKFL---FGVSGNVIALFLFLSPVPTFWRIIRRKSTEDFSGVPYNMTLINCLLSAW  57

Query  289  YGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKK-Kigvllilvvgifvaval  465
            YGLPFVSPNNILV+TI+G G VIE A+VV+F+VFA  ++ + +   L   V  +F AVAL
Sbjct  58   YGLPFVSPNNILVSTINGAGAVIETAYVVVFLVFASTHKTRLRTLGLAAAVASVFAAVAL  117

Query  466  lsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATA  645
            +S+   HG+ R+L CG AA +C+  MY SPLS++R+V+KTKSVE+MPFL++ ++ LC T+
Sbjct  118  VSLLALHGQHRKLLCGVAATVCSICMYASPLSIMRLVIKTKSVEYMPFLMSLAVFLCGTS  177

Query  646  WLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            W I+GLL +DPFV +PN  G  +G +QL+LYAIY   
Sbjct  178  WFIYGLLGRDPFVTIPNGCGSFLGAVQLVLYAIYRNN  214



>ref|XP_004962025.1| PREDICTED: bidirectional sugar transporter SWEET1b-like [Setaria 
italica]
Length=264

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 152/206 (74%), Gaps = 1/206 (0%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FGI  N  A F+FL+P+ TF RII++RSTE+FSG PY +T L+C+L AWYGLPFVSPNNI
Sbjct  9    FGISGNVIALFLFLSPVPTFWRIIRRRSTEDFSGVPYNMTLLNCLLSAWYGLPFVSPNNI  68

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKK-KigvllilvvgifvavallsvfvfHGRIR  498
            LV+TI+G G  IE  +VVIF+VFA   + + ++  L   V  +F AVAL+S+   HG  R
Sbjct  69   LVSTINGAGAAIETVYVVIFLVFASSRQTRLRMLGLASAVAMVFAAVALVSMLALHGERR  128

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            +L CG AA +C+  MY SPLS++R+V+KTKSVE+MPFLL+ ++ LC T+W ++GLL +DP
Sbjct  129  KLLCGIAATVCSICMYGSPLSIMRLVVKTKSVEYMPFLLSLAVFLCGTSWFVYGLLGRDP  188

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEK  756
            FV +PN  G  +G +QLILYAIY   
Sbjct  189  FVAIPNGCGSFLGAVQLILYAIYRNS  214



>gb|ABK22750.1| unknown [Picea sitchensis]
 gb|ACN40940.1| unknown [Picea sitchensis]
Length=260

 Score =   223 bits (569),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 166/249 (67%), Gaps = 12/249 (5%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF N TA  +FLAP+ TF  IIK +STE+FSGFPYV T L+C+L AWYGLPFVSP
Sbjct  5    HFIFGIFGNITALTLFLAPLITFWTIIKNKSTEQFSGFPYVSTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVF-APKNEKKKigvllilvvgifvavallsvfvfHG  489
            NN+LV+T++G G  IEL +V++F+ +   K  + KI  LL++V+  F  VAL+S+   HG
Sbjct  65   NNLLVSTVNGTGAAIELCYVIVFLFYIRDKKYRVKIFGLLVIVLKFFALVALVSLLALHG  124

Query  490  RIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLE  669
              R+LFCGFAA I +  MY SPLS++R V+KTKSV++MPF L+  + LC T+W IFGLL 
Sbjct  125  HARKLFCGFAAAIFSICMYASPLSIMRTVIKTKSVKYMPFFLSLCVFLCGTSWFIFGLLG  184

Query  670  KDPFVYVPNAVGCGVGVLQLILYAIYSE------KTIFMTIKRSFSHGMLQINAMP----  819
            KDPF+ VPN VG  +G +QLILYA+Y +       T    ++     G   +NAM     
Sbjct  185  KDPFLAVPNGVGSALGAMQLILYAVYKDWKKKDSNTWSPPVQEEGKAGADHMNAMEMGSY  244

Query  820  -QHEKKQPS  843
             Q E   PS
Sbjct  245  GQTEAHNPS  253



>gb|AFW78061.1| seven-transmembrane-domain protein 1 [Zea mays]
Length=250

 Score =   223 bits (568),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/245 (47%), Positives = 164/245 (67%), Gaps = 4/245 (2%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FG+  N  A F+FL+P+ TF RII+++STE+FSG PY +T L+C+L AWYGLPFVSPNN+
Sbjct  9    FGVSGNVIALFLFLSPVPTFWRIIRRKSTEDFSGVPYSMTLLNCLLSAWYGLPFVSPNNM  68

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKK-KigvllilvvgifvavallsvfvfHGRIR  498
            LV+TI+G G  IE  +VVIF+ FA     + ++  L   V   F AVAL S+   HG+ R
Sbjct  69   LVSTINGAGAAIEAVYVVIFLAFASSQRTRLRMLGLASAVSAAFAAVALASMLALHGQGR  128

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            +L CG AA +C+  MY SPLS++R+V+KTKSVE+MPFLL+ ++ LC T+W ++GLL +DP
Sbjct  129  KLMCGLAATVCSICMYASPLSIMRLVVKTKSVEYMPFLLSLAVFLCGTSWFVYGLLGRDP  188

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITSSK  858
            FV +PN  G  +G +QL+LYAIY +     +  +  +   +++ +  +  KK       K
Sbjct  189  FVAIPNGCGSFLGAVQLVLYAIYRDSN---SGGKQQAGDDVEMASDAKSSKKVADDVGGK  245

Query  859  YDELV  873
             D LV
Sbjct  246  EDRLV  250



>gb|KHN23430.1| Bidirectional sugar transporter SWEET1 [Glycine soja]
Length=265

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 155/215 (72%), Gaps = 1/215 (0%)
 Frame = +1

Query  196  TFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVV  375
            TFKRIIK RSTE+FSG PYV+T L+C+L AWYGLPFVSP+NILV+T++G G+ IE+ +V+
Sbjct  44   TFKRIIKNRSTEKFSGIPYVMTLLNCLLSAWYGLPFVSPHNILVSTVNGTGSFIEIIYVL  103

Query  376  IFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSP  555
            IFIV AP+ EK KI  L   V+ +F AV  +S+F  HG  R+LFCGFAA I + IMY SP
Sbjct  104  IFIVLAPRKEKAKILGLFTFVLSVFSAVVFVSLFALHGNSRKLFCGFAAAIFSIIMYGSP  163

Query  556  LSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLIL  735
            LS++R+V+KTKSVEFMPF L+  + LC T+W IFGLL +DPFV VPN VG  +G +QLIL
Sbjct  164  LSIMRLVIKTKSVEFMPFFLSLFVFLCGTSWFIFGLLGRDPFVAVPNGVGSALGTMQLIL  223

Query  736  YAIYSE-KTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            Y IY + K +      +    M   +A PQ  K+ 
Sbjct  224  YFIYRDNKGVPRKQAPTEEESMEMGDAKPQQGKQS  258



>ref|XP_004242288.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Solanum 
lycopersicum]
Length=252

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 169/251 (67%), Gaps = 2/251 (1%)
 Frame = +1

Query  109  MHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAW  288
            M GL  T+   FGI  N    F+FL P  TFKRIIK +STE+FSG PYV+ FL+C++ AW
Sbjct  1    MRGLVHTIQFVFGILGNVATLFLFLVPTHTFKRIIKNKSTEQFSGIPYVMAFLNCLISAW  60

Query  289  YGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavall  468
            YGLPFV+ NNILV TI+G G  IEL +V+IF+++AP  +K++I  + +LVV  F A A++
Sbjct  61   YGLPFVTSNNILVATINGTGAAIELIYVLIFLLYAPNKQKRRIFAIFVLVVVAFAAAAVI  120

Query  469  svfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAW  648
            SV  FHG+ R+LFCG A+ + + +MY +PLS+IR+V+ TKSVE+MPFLL+F+ +L  T+W
Sbjct  121  SVLFFHGKNRKLFCGIASTVFSIVMYAAPLSIIRLVITTKSVEYMPFLLSFAAILSCTSW  180

Query  649  LIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHE  828
             I+ +L  DP++ +   VG  +G++QL+LY  Y +K I    K++F+    Q N     +
Sbjct  181  FIYAILGMDPYIGISTGVGLTLGIVQLVLYFSYCDKRILN--KKTFAVEESQKNMDNDVK  238

Query  829  KKQPSITSSKY  861
                SI    Y
Sbjct  239  PYDESIHECPY  249



>ref|NP_001148521.1| LOC100282137 [Zea mays]
 gb|ACF84394.1| unknown [Zea mays]
 gb|ACG31821.1| seven-transmembrane-domain protein 1 [Zea mays]
 tpg|DAA56534.1| TPA: Seven-transmembrane-domain protein 1 [Zea mays]
Length=267

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 158/212 (75%), Gaps = 4/212 (2%)
 Frame = +1

Query  133  HLA---FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            H+A   FG+  N  A F+FL+P+ TF R+I+KRSTE+FSG PY +T L+C+L AWYGLPF
Sbjct  3    HIARFFFGVSGNVIALFLFLSPVVTFWRVIRKRSTEDFSGVPYNMTLLNCLLSAWYGLPF  62

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFA-PKNEKKKigvllilvvgifvavallsvfv  480
            VSPNNILV+TI+G G+VIE  +VVIF++FA  +  +  +  LL +V  IF  V L+S+  
Sbjct  63   VSPNNILVSTINGTGSVIEAIYVVIFLIFAVDRRARLSMLGLLGIVASIFTTVVLVSLLA  122

Query  481  fHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFG  660
             HG  R++FCG AA I +  MY SPLS++R+V+KTKSVEFMPFLL+ ++ LC T+W I+G
Sbjct  123  LHGNARKVFCGLAATIFSICMYASPLSIMRLVIKTKSVEFMPFLLSLAVFLCGTSWFIYG  182

Query  661  LLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            LL +DPF+ +PN  G  +G++QLILYAIY + 
Sbjct  183  LLGRDPFIIIPNGCGSFLGLMQLILYAIYRKN  214



>gb|KCW69242.1| hypothetical protein EUGRSUZ_F02750 [Eucalyptus grandis]
Length=268

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 168/248 (68%), Gaps = 11/248 (4%)
 Frame = +1

Query  154  ANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTT  333
             N TA F+FLAPI TF RI K +STE+FSG PYV+T L+C+L AWYGLPFVSPNN+LV+T
Sbjct  24   GNITALFLFLAPIITFIRIYKSKSTEKFSGIPYVMTLLNCLLSAWYGLPFVSPNNMLVST  83

Query  334  IDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCG  513
            I+G G  IE+ +VV F+ +AP+ EK KI  L +LV+ +F A+AL+S+F  HG  R+LFCG
Sbjct  84   INGTGAAIEVVYVVFFLFYAPRKEKAKIFGLFMLVLTVFAAIALVSLFALHGNKRKLFCG  143

Query  514  FAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVP  693
             AA + +  MY SPLS++R+V+KTKSVE+MPF L+  + LC T+W IFGLL  D FV++P
Sbjct  144  VAATVFSITMYASPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFIFGLLGHDIFVFLP  203

Query  694  NAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGML--------QINAMPQHEKKQPSIT  849
            N  GCG+G  QLILY IY     +    ++  H ++        + NA     K Q  + 
Sbjct  204  NGFGCGLGTAQLILYFIYRN---YKGEPKNKVHDVVCVEEKVETEKNAEGDPAKHQLDLM  260

Query  850  SSKYDELV  873
            + K DE V
Sbjct  261  NKKADEQV  268



>gb|KDO83582.1| hypothetical protein CISIN_1g025686mg [Citrus sinensis]
Length=214

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TF+RI++++STE+FSG PYV+T L+C+L AWYGLPFVS 
Sbjct  5    HFLFGVFGNATALFLFLAPTITFRRIVRRKSTEQFSGIPYVMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNILV+TI+G G+ IE+ +V+IF++FAPK EK KI  L +LV+ +F AVAL+S+  FHG 
Sbjct  65   NNILVSTINGTGSAIEIIYVLIFLLFAPKKEKAKIFGLFMLVLTVFAAVALVSLLAFHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R++FCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L+  + LC T+W +FGLL +
Sbjct  125  ARKIFCGFAATIFSIIMYASPLSIMRMVIKTKSVEFMPFFLSLFVFLCGTSWFVFGLLGR  184

Query  673  DPFVYV  690
            DPFV V
Sbjct  185  DPFVAV  190



>ref|XP_009610841.1| PREDICTED: bidirectional sugar transporter SWEET1a-like isoform 
X2 [Nicotiana tomentosiformis]
Length=250

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 155/211 (73%), Gaps = 0/211 (0%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            + LH  FGI  +     +F+AP+ TFKRII+K+STE+FS  PY+I+ L C+L AWY LPF
Sbjct  5    KILHTTFGILGDVFGLLLFMAPMITFKRIIRKKSTEQFSSMPYLISLLQCLLSAWYSLPF  64

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSPNN+LVT I  IG  +E  +V+IF++F+PK  K KI   L +V+ IF ++AL+S+  F
Sbjct  65   VSPNNLLVTVISAIGIGLEATYVLIFLIFSPKKGKAKICGYLFVVLSIFSSLALVSILAF  124

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG  R+LFCGFA      +MY SPLSV+R+V+K+KSVE+MPF L+ S+ + +T+WLIF L
Sbjct  125  HGNKRKLFCGFAFAAACVMMYGSPLSVMRLVIKSKSVEYMPFFLSLSVFINSTSWLIFAL  184

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            L KDPF++VPNA G  +G  QLILYA+Y +K
Sbjct  185  LGKDPFIFVPNAAGTILGAAQLILYAVYRDK  215



>ref|XP_002441124.1| hypothetical protein SORBIDRAFT_09g020860 [Sorghum bicolor]
 gb|EES19554.1| hypothetical protein SORBIDRAFT_09g020860 [Sorghum bicolor]
Length=256

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 161/233 (69%), Gaps = 2/233 (1%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FGI  N  A F+FL+P+ TF RII++RSTE+FSG PY +T L+C+L AWYGLPFVSPNNI
Sbjct  9    FGICGNVIALFLFLSPVPTFWRIIRRRSTEDFSGVPYNMTLLNCLLSAWYGLPFVSPNNI  68

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKK-KigvllilvvgifvavallsvfvfH-GRI  495
            LV+TI+G G  IE  +VVIF+VFA     + ++  L   V  +F AVAL+S+   H G+ 
Sbjct  69   LVSTINGAGAAIEAVYVVIFLVFASSQRTRLRMLGLASAVAAVFAAVALVSMLALHQGQG  128

Query  496  RQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKD  675
            R+L CG AA +C+  MY SPLS++R+V+KTKSVE+MPFLL+ ++ LC T+W ++GLL +D
Sbjct  129  RKLMCGLAATVCSICMYASPLSIMRLVVKTKSVEYMPFLLSLAVFLCGTSWFVYGLLGRD  188

Query  676  PFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKK  834
            PFV +PN  G  +G +QL+LYAIY          +  +   +++ A  +  KK
Sbjct  189  PFVAIPNGCGSFLGAVQLVLYAIYRNSAGTAGAGKQQAGDDVEMAADAKSSKK  241



>ref|XP_010320028.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X2 [Solanum lycopersicum]
Length=244

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/239 (51%), Positives = 160/239 (67%), Gaps = 3/239 (1%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            + LH AFGI  N     +F+AP+ TFKRII KRSTE+FS  PYVI  L+C+L  WY LPF
Sbjct  5    KVLHTAFGILGNVFGVLLFMAPMITFKRIISKRSTEQFSNIPYVIALLNCLLSVWYSLPF  64

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSP+N+LVT ++ IG  +E  +V+IF++FAPK EK KI   L++V  I   VAL+S+  F
Sbjct  65   VSPDNLLVTIVNSIGAGLEATYVLIFLIFAPKKEKAKICGYLVVVFSIVSCVALVSLLAF  124

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG  R+L CGFA  +   +MY SPLSV+R V+K+KSVE+MPF L+ ++ +C+ +W  F L
Sbjct  125  HGNKRKLLCGFAFTVSCIMMYGSPLSVMRRVIKSKSVEYMPFFLSLAVFICSLSWFFFAL  184

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIY--SE-KTIFMTIKRSFSHGMLQINAMPQHEK  831
            L KDPF+ VPNA+G  +G +QLILYAIY  SE K   M        G LQ   +  +E 
Sbjct  185  LGKDPFILVPNAIGTLLGAMQLILYAIYRASEVKKDEMNESVETRTGELQDKKLAYNED  243



>ref|NP_001147686.1| seven-transmembrane-domain protein 1 [Zea mays]
 gb|ACG28388.1| seven-transmembrane-domain protein 1 [Zea mays]
Length=251

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/254 (45%), Positives = 163/254 (64%), Gaps = 5/254 (2%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            +   +  AFG+  N  A F+FL+P+ TF RII+++STE+FSG PY +T L+C+L AWYGL
Sbjct  1    MEDVVKFAFGVSGNVIALFLFLSPVPTFWRIIRRKSTEDFSGVPYSMTLLNCLLSAWYGL  60

Query  298  PFVSPNNILVTTIDGIGTVIELAFVVIF--IVFAPKNEKKKigvllilvvgifvavalls  471
            PFVSPNN+LV+TI+G G  IE  +VVIF  +   P +     G         F AVAL S
Sbjct  61   PFVSPNNMLVSTINGAGAAIEAVYVVIFLGVRVQPADAAADAGAWRRRFSAAFAAVALAS  120

Query  472  vfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWL  651
            +   HG+ R+L CG AA +C+  MY SPLS++R+V+KTKSVE+MPFLL+ ++ LC T+W 
Sbjct  121  MLALHGQGRKLMCGLAATVCSICMYASPLSIMRLVVKTKSVEYMPFLLSLAVFLCGTSWF  180

Query  652  IFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEK  831
            ++GLL +DPFV +PN  G  +G +QL+LYAIY +     +  +  +   +++ +  +  K
Sbjct  181  VYGLLGRDPFVAIPNGCGSFLGAVQLVLYAIYRDSN---SGGKQQAGDDVEMASDAKSSK  237

Query  832  KQPSITSSKYDELV  873
            K       K D LV
Sbjct  238  KVADDVGGKEDRLV  251



>ref|XP_010040791.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW44924.1| hypothetical protein EUGRSUZ_L01491 [Eucalyptus grandis]
Length=242

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 150/229 (66%), Gaps = 0/229 (0%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            G+  NA   F+FLAPI TFKRII+ +STE+FSG PYVI+ L+C+L  WYGLPFVS +N+L
Sbjct  9    GVLGNAVGLFLFLAPIMTFKRIIRSQSTEQFSGVPYVISLLNCLLYTWYGLPFVSSDNLL  68

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            ++ I GIG VIE  +V IFI   PK E+ KI  L  L + +F+  A +S+F  HG+ R+L
Sbjct  69   ISIISGIGVVIEFTYVSIFITNGPKKERAKIIGLCALALILFITFAFVSLFALHGKTRKL  128

Query  505  FCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFV  684
             CG    I + IMY SPLSV+  V+K KSVEFMPFLL+    LC   WL +GLL +DPF+
Sbjct  129  LCGITLDISSTIMYASPLSVMMSVIKKKSVEFMPFLLSLFTFLCGIFWLTYGLLSRDPFL  188

Query  685  YVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEK  831
             VPN +G G+G  QLILYAIY +    MT + +       +    Q +K
Sbjct  189  IVPNGLGTGLGTAQLILYAIYCKNQSHMTNEITDEFAETDLETTDQMQK  237



>ref|XP_009778146.1| PREDICTED: bidirectional sugar transporter SWEET1a-like isoform 
X3 [Nicotiana sylvestris]
Length=250

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 154/211 (73%), Gaps = 0/211 (0%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            + LH  FGI  +     +F+AP+ TFKRII+K+STE+FS  PY+I+ L C+L AWY LPF
Sbjct  5    KILHTTFGILGDVFGLLLFMAPLITFKRIIRKKSTEQFSCMPYLISLLQCLLAAWYSLPF  64

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSPNN+LVT I  IG  +E  +V+IF++F+PK  K KI   L +V+ IF ++AL+S+  F
Sbjct  65   VSPNNLLVTVISAIGIGLEATYVLIFLIFSPKKGKAKICGYLFVVLSIFSSLALVSMLAF  124

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG  R+LFCGFA      +MY SPLSV+R+V+K+KSVE+MPF L+ S+ + +T+W IF L
Sbjct  125  HGNRRKLFCGFAFAAACIMMYGSPLSVMRLVIKSKSVEYMPFFLSLSVFINSTSWSIFSL  184

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            L KDPF++VPNA G  +G +QLILY +Y +K
Sbjct  185  LGKDPFIFVPNAAGTILGAVQLILYVVYRDK  215



>ref|XP_002302198.2| hypothetical protein POPTR_0002s07370g [Populus trichocarpa]
 gb|EEE81471.2| hypothetical protein POPTR_0002s07370g [Populus trichocarpa]
Length=259

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/239 (52%), Positives = 164/239 (69%), Gaps = 11/239 (5%)
 Frame = +1

Query  124  RTLHLAFG-IFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLP  300
            R L ++F  +  NATA F+FLAP  TF+RII+ +STE FSG PYV+T L+C+L AWYG+P
Sbjct  19   RFLSVSFSSVTGNATALFLFLAPTITFRRIIRSKSTELFSGIPYVMTMLNCLLSAWYGMP  78

Query  301  FVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfv  480
            FVS NNILV+TI+G G VIE  +V+ FI++APK EK K   LL LV+  F  VAL+S+ V
Sbjct  79   FVSKNNILVSTINGTGAVIEAVYVLTFIIYAPKKEKAKFIGLLTLVLTTFAGVALVSLVV  138

Query  481  fHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFG  660
             HG+ R++FCGFAA I + IMY SPLS++  V+KTKSVEFMPF L+  + LC T+W +FG
Sbjct  139  LHGKPREIFCGFAAAIFSIIMYGSPLSIM--VLKTKSVEFMPFFLSLFVFLCGTSWFVFG  196

Query  661  LLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            L       +VPN VGCG+G LQLILY IY         K +     +Q+     H++K+
Sbjct  197  L-------FVPNGVGCGLGALQLILYFIYRNNK-GEDKKPALPVKSMQMGIAKLHQEKE  247



>gb|ACG41106.1| seven-transmembrane-domain protein 1 [Zea mays]
Length=235

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 159/244 (65%), Gaps = 17/244 (7%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FG+  N  A F+FL+P+ TF RII+++STE+FSG PY +T L+C+L AWYGLPFVSPNN+
Sbjct  9    FGVSGNVIALFLFLSPVPTFWRIIRRKSTEDFSGVPYSMTLLNCLLSAWYGLPFVSPNNM  68

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQ  501
            LV+TI+G G  IE  +VVIF+  A              V   F AVAL S+   HG+ R+
Sbjct  69   LVSTINGAGAAIEAVYVVIFLASA--------------VSAAFAAVALASMLALHGQGRK  114

Query  502  LFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPF  681
            L CG AA +C+  MY SPLS++R+V+KTKSVE+MPFLL+ ++ LC T+W ++GLL +DPF
Sbjct  115  LMCGLAATVCSICMYASPLSIMRLVVKTKSVEYMPFLLSLAVFLCGTSWFVYGLLGRDPF  174

Query  682  VYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITSSKY  861
            V +PN  G  +G +QL+LYAIY +     +  +  +   +++ +  +  KK       K 
Sbjct  175  VAIPNGCGSFLGAVQLVLYAIYRDSN---SGGKQQAGDDVEMASDAKSSKKVADDVGGKE  231

Query  862  DELV  873
            D LV
Sbjct  232  DRLV  235



>ref|XP_006356303.1| PREDICTED: bidirectional sugar transporter SWEET1a-like [Solanum 
tuberosum]
Length=246

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/237 (48%), Positives = 157/237 (66%), Gaps = 2/237 (1%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            + L  AFGI  N     +F++P+ TFKRII KRSTE+FS  PYVI  L+C+L  WY LPF
Sbjct  5    KVLRTAFGILGNVFGVLLFMSPMITFKRIISKRSTEQFSSIPYVIALLNCLLSVWYSLPF  64

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSP+N+LVT ++ IG  +E  +V+IF++FAPK EK KI   L +V  I   VAL+S+  F
Sbjct  65   VSPDNLLVTIVNSIGAGLEATYVLIFLIFAPKKEKAKICGYLFVVFSIVSCVALISLLAF  124

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            HG  R+L CGFA      +MY SPLSV+R+V+K+KSVE+MPF L+ ++ +C+ +W IF L
Sbjct  125  HGNKRKLLCGFAFTTSCIMMYGSPLSVMRLVIKSKSVEYMPFFLSLAVFICSISWFIFAL  184

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKK  834
            L KDPF+ VPN +G  +G +QLILY IY +      +K+   +  ++       +KK
Sbjct  185  LGKDPFILVPNVIGTLLGAVQLILYGIYRDNR--GVVKKDEMNESIETRTGELQDKK  239



>gb|EAY76715.1| hypothetical protein OsI_04670 [Oryza sativa Indica Group]
Length=314

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 159/249 (64%), Gaps = 42/249 (17%)
 Frame = +1

Query  133  HLA---FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAW-----  288
            H+A   FG+  N  A F+FL+P+ TF RIIKKRSTE+FSG PY +T L+C+L AW     
Sbjct  3    HIARFFFGVSGNVIALFLFLSPVVTFWRIIKKRSTEDFSGVPYNMTLLNCLLSAWMAVMW  62

Query  289  ----------------------------------YGLPFVSPNNILVTTIDGIGTVIELA  366
                                              YGLPFVSPNNILVTTI+G G+VIE  
Sbjct  63   AQEAVVQAHAASRSSVCSSKKWVRNTIRESILRRYGLPFVSPNNILVTTINGTGSVIEAI  122

Query  367  FVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCGFAALICAAIMY  546
            +VVIF++FA +  + K+  LL LV  IF  V L+S+   HG+ R+LFCG AA I +  MY
Sbjct  123  YVVIFLIFAERKARLKMMGLLGLVTSIFTMVVLVSLLALHGQGRKLFCGLAATIFSICMY  182

Query  547  FSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQ  726
             SPLS++R+V+KTKSVEFMPFLL+ S+ LC T+W I+GLL +DPF+ +PN  G  +G++Q
Sbjct  183  ASPLSIMRLVIKTKSVEFMPFLLSLSVFLCGTSWFIYGLLGRDPFIAIPNGCGSFLGLMQ  242

Query  727  LILYAIYSE  753
            LILYAIY  
Sbjct  243  LILYAIYRN  251



>ref|XP_003568408.1| PREDICTED: bidirectional sugar transporter SWEET1b-like [Brachypodium 
distachyon]
Length=256

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 152/222 (68%), Gaps = 7/222 (3%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FGI  N  A F+FL+P+ TF RII+K+STEEFSG PY +T L+C+L AWYGLPFVSPNNI
Sbjct  9    FGISGNVIALFLFLSPVPTFWRIIRKKSTEEFSGVPYNMTLLNCLLSAWYGLPFVSPNNI  68

Query  322  LVTTIDGIGTVIELAFVVIFIVFA-PKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            LV+TI+G G  IE  +VVIF+ FA  K  + +   L   VV +F AVAL+S+   HG  R
Sbjct  69   LVSTINGAGAAIEACYVVIFLCFASSKKARLRTLGLASAVVAVFAAVALVSMLALHGPGR  128

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            +L  G A  + +  MY SPLS++R+V++TKSVE+MPFLL+ ++ LC T+W ++GLL +DP
Sbjct  129  KLLSGLAMAVFSICMYASPLSIMRLVIRTKSVEYMPFLLSLAVFLCGTSWFVYGLLGRDP  188

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQ  804
            FV VPN  G  +G  QLILYA+Y         K   S G LQ
Sbjct  189  FVAVPNGCGSVLGAAQLILYAVYRNN------KGKSSDGKLQ  224



>ref|XP_008353655.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Malus 
domestica]
Length=252

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 153/220 (70%), Gaps = 13/220 (6%)
 Frame = +1

Query  136  LAFGIF-ANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            L F IF  N TAFF+FL+P  TFKRI++K+ TE+FSG PYV+T L+C+L AWYGLPFVS 
Sbjct  2    LCFFIFTGNGTAFFLFLSPTITFKRIMRKKCTEQFSGIPYVMTMLNCLLYAWYGLPFVSA  61

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NN LV+T++G G  +EL +V++FI+FAPK E+ KI  L   V+ +F AVAL+S+F  H +
Sbjct  62   NNFLVSTVNGTGAAMELIYVLVFIIFAPKRERAKILGLFTAVLALFSAVALVSLFALHDK  121

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCG AA + A IM+ SPLS++  V++TKSVEFMPF L+    LC T+W I+GLL +
Sbjct  122  TRKLFCGLAATVFAIIMFSSPLSIMSTVVRTKSVEFMPFFLSLFSFLCGTSWFIYGLLGR  181

Query  673  DPFVYV------------PNAVGCGVGVLQLILYAIYSEK  756
            DPFV               N  G G+G LQLILY IY + 
Sbjct  182  DPFVATFRLMNDLMCGADSNGCGSGLGALQLILYFIYRDN  221



>ref|XP_010041426.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Eucalyptus 
grandis]
Length=276

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/237 (49%), Positives = 151/237 (64%), Gaps = 33/237 (14%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            G+  NAT  F+FLAP+ TFKRII+ RSTE+FSG PYV+T L+C++  WYGLPFVS NNIL
Sbjct  9    GVLGNATGLFLFLAPMVTFKRIIRNRSTEQFSGIPYVMTLLNCIVFTWYGLPFVSRNNIL  68

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            + TI+  G VIE  ++VIFI+F PK E+ K+  L  L++ +F A+A +S+   HG  R+ 
Sbjct  69   IWTINATGGVIEFTYIVIFIIFGPKKERMKVMGLFALIMTVFSAIASISLLALHGNTRKF  128

Query  505  FCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFV  684
            FCG AA + + +M+ SPLSV+R+V+KTKSVEFMPF L+    LCA +WLI+GLL  DPFV
Sbjct  129  FCGVAAALFSTVMFASPLSVMRMVIKTKSVEFMPFFLSLFAFLCALSWLIYGLLSGDPFV  188

Query  685  YV---------------------------------PNAVGCGVGVLQLILYAIYSEK  756
             V                                 PN  G G+G+ QLILYAIY + 
Sbjct  189  LVRYNPYIFAYYLWKLLQHRNFFTSLLKSASVKKLPNVFGTGLGIAQLILYAIYYKN  245



>gb|KCW69243.1| hypothetical protein EUGRSUZ_F02751, partial [Eucalyptus grandis]
Length=233

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 156/232 (67%), Gaps = 6/232 (3%)
 Frame = +1

Query  196  TFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVV  375
            TF RI K +STE+FSG PYV+T L+C+L AWYGLPFVSPNN+LV+TI+G G  IE+ +VV
Sbjct  2    TFVRIYKSKSTEKFSGIPYVMTLLNCLLSAWYGLPFVSPNNMLVSTINGTGAAIEVLYVV  61

Query  376  IFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSP  555
             F+ +AP+ EK KI  L +LV+ +F  +AL+S+F  HG  R+LFCG AA + +  MY SP
Sbjct  62   GFLFYAPRKEKTKIFGLFMLVLTVFATIALVSLFALHGNKRKLFCGVAATVFSITMYASP  121

Query  556  LSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLIL  735
            LS++R+V+KTKSVE+MPF L+  + LC T+W +FGLL  D FV++PN  GCG+G  QLIL
Sbjct  122  LSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFVFGLLGNDIFVFLPNGFGCGLGTAQLIL  181

Query  736  YAIYS------EKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITSSKYDELV  873
            Y IY       +  +        + G  + +A     K QP + + + DE V
Sbjct  182  YFIYRNYKGEPKNKVHNYAGSMETTGETEKDADRDPAKHQPDLMNKQADEQV  233



>gb|EMT14572.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=261

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 145/206 (70%), Gaps = 1/206 (0%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FGI  N  A F+FL+P+ TF RII+ +STEEFSG PY +T L+C+L AWYGLPFVSPNN+
Sbjct  9    FGISGNVIALFLFLSPVPTFWRIIRNKSTEEFSGVPYNMTLLNCLLSAWYGLPFVSPNNV  68

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKK-KigvllilvvgifvavallsvfvfHGRIR  498
            LV+TI+G+G VIE  +VVIF+VFA   + + +   L   V  +F  VAL+S+   HG  R
Sbjct  69   LVSTINGVGAVIETVYVVIFLVFASNRKARLRTLGLASAVAAVFTVVALVSMLALHGPAR  128

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            +L  G A  + +  MY SPLS++R+V+KTKSVE+MPFLL+ ++ LC T+W I+GLL  D 
Sbjct  129  KLLAGLAMTVFSICMYASPLSIMRMVIKTKSVEYMPFLLSLAVFLCGTSWFIYGLLGHDL  188

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEK  756
            FV +PN  G  +G  QLILYAIY   
Sbjct  189  FVTIPNGCGSVLGAAQLILYAIYRNN  214



>ref|XP_006366753.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Solanum 
tuberosum]
Length=312

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 161/226 (71%), Gaps = 2/226 (1%)
 Frame = +1

Query  157  NATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTTI  336
            N  + F+FL P  TFKRIIK +STE+FSG PYV+ FL+C+L AWYGLPF++ +NILVTTI
Sbjct  83   NVASLFLFLVPTYTFKRIIKNKSTEQFSGIPYVMAFLNCLLTAWYGLPFITSSNILVTTI  142

Query  337  DGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCGF  516
            +G G  IEL +V+IF+++AP  +K+KI  + +LV+  F A A++SV VFHG+ R+LFCG 
Sbjct  143  NGTGATIELIYVLIFLLYAPNKQKRKILAIFVLVLVAFAAAAVISVLVFHGKNRELFCGI  202

Query  517  AALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVPN  696
            A+ + + +MY +PLS+IR+V+ TKSVE+MPFLL+F+ +L  T+W I+ +L  DP++ +  
Sbjct  203  ASTVFSIVMYAAPLSIIRLVITTKSVEYMPFLLSFAAILSCTSWFIYAILGMDPYIGIST  262

Query  697  AVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKK  834
             VG  +G++QLILY  Y +K I    K++F+    Q N    H   
Sbjct  263  GVGLTLGIVQLILYFCYCDKKILN--KKTFAVEESQQNMDNGHNND  306



>ref|XP_009610838.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Nicotiana 
tomentosiformis]
Length=266

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/242 (48%), Positives = 161/242 (67%), Gaps = 2/242 (1%)
 Frame = +1

Query  109  MHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAW  288
            M  + + LH  FG+F N     +FLAP+ TFKRII KRSTE+FSG PY+++  +C+  AW
Sbjct  1    MGHVIKILHTTFGLFGNVFGILLFLAPLITFKRIIMKRSTEKFSGVPYLMSLFNCLFSAW  60

Query  289  YGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavall  468
            YGLPFVS NN L+T +  IG  +E  +V+IF++FAPK EK K+   L +V+ IF  VAL+
Sbjct  61   YGLPFVSANNTLLTVLASIGGGLEAIYVLIFLIFAPKREKIKMSGTLFVVLSIFSIVALV  120

Query  469  svfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAW  648
            SV   HG  R+L CG A  I   +M+ +PL+V+R V+K+KSVE+MPF L+ S+   +T+W
Sbjct  121  SVLTLHGNKRKLLCGLAFAITCIMMFAAPLTVMRQVIKSKSVEYMPFFLSLSVFNSSTSW  180

Query  649  LIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHE  828
             I+GLL KDPF+ VPNA+G  +G +QLILYAIY +       K+   +G ++       E
Sbjct  181  AIYGLLGKDPFIIVPNAIGTLLGSVQLILYAIYRDNK--GEGKKDEMNGSIETGLGKFQE  238

Query  829  KK  834
            KK
Sbjct  239  KK  240



>ref|XP_009610842.1| PREDICTED: bidirectional sugar transporter SWEET1a-like isoform 
X3 [Nicotiana tomentosiformis]
Length=227

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 146/192 (76%), Gaps = 0/192 (0%)
 Frame = +1

Query  181  LAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIE  360
            +AP+ TFKRII+K+STE+FS  PY+I+ L C+L AWY LPFVSPNN+LVT I  IG  +E
Sbjct  1    MAPMITFKRIIRKKSTEQFSSMPYLISLLQCLLSAWYSLPFVSPNNLLVTVISAIGIGLE  60

Query  361  LAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCGFAALICAAI  540
              +V+IF++F+PK  K KI   L +V+ IF ++AL+S+  FHG  R+LFCGFA      +
Sbjct  61   ATYVLIFLIFSPKKGKAKICGYLFVVLSIFSSLALVSILAFHGNKRKLFCGFAFAAACVM  120

Query  541  MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGV  720
            MY SPLSV+R+V+K+KSVE+MPF L+ S+ + +T+WLIF LL KDPF++VPNA G  +G 
Sbjct  121  MYGSPLSVMRLVIKSKSVEYMPFFLSLSVFINSTSWLIFALLGKDPFIFVPNAAGTILGA  180

Query  721  LQLILYAIYSEK  756
             QLILYA+Y +K
Sbjct  181  AQLILYAVYRDK  192



>ref|XP_004237724.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Solanum 
lycopersicum]
Length=250

 Score =   207 bits (527),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 158/227 (70%), Gaps = 2/227 (1%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            R LH  FGIF N     +FLAP+ TFKRII KRSTE+FSG PY+++  +C+  AWYGLPF
Sbjct  8    RILHTTFGIFGNVFGILLFLAPMITFKRIIMKRSTEKFSGVPYLMSLFNCLFSAWYGLPF  67

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VSPNN L+T +  IG  +E  +V+IF++FAPK EK KI  +L L++ IF  VAL+SV   
Sbjct  68   VSPNNTLLTVLASIGGALEAIYVLIFLIFAPKKEKFKISGILFLIISIFSIVALVSVLTL  127

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
            H   R+L CG A  I   +M+ +PL+++R V+K+KSVE+MPF L+ S+   +T+W I+GL
Sbjct  128  HDNKRKLLCGLAFAITCIMMFGAPLTIMRQVIKSKSVEYMPFFLSLSIFNSSTSWAIYGL  187

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIY--SEKTIFMTIKRSFSHGM  798
            L KD F+ VPN++G  +  +QLILYAIY  SEK + + ++ S   G+
Sbjct  188  LGKDLFIIVPNSIGSLLACVQLILYAIYRDSEKKLDVEMEGSIEKGL  234



>ref|XP_008356061.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Malus 
domestica]
Length=222

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +1

Query  196  TFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVV  375
            TFKRI++K+ TE+FSG PYV+T L+C+L AWYGLPFVS NN LV+T++G G  +EL +V+
Sbjct  5    TFKRIMRKKCTEQFSGIPYVMTMLNCLLYAWYGLPFVSANNFLVSTVNGTGAAMELIYVL  64

Query  376  IFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSP  555
            +FI+FAPK E+ KI  L   V+ +F AVAL+S+F  H + R+LFCG AA + A IM+ SP
Sbjct  65   VFIIFAPKRERAKILGLFTAVLALFSAVALVSLFALHDKTRKLFCGLAATVFAIIMFSSP  124

Query  556  LSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLIL  735
            LS++  V++TKSVEFMPF L+    LC T+W I+GLL +DPFV +PN  G G+G LQLIL
Sbjct  125  LSIMSTVVRTKSVEFMPFFLSLFSFLCGTSWFIYGLLGRDPFVAIPNGCGSGLGALQLIL  184

Query  736  YAIYSEK  756
            Y IY + 
Sbjct  185  YFIYRDN  191



>ref|XP_009778142.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Nicotiana 
sylvestris]
Length=259

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/255 (47%), Positives = 165/255 (65%), Gaps = 6/255 (2%)
 Frame = +1

Query  109  MHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAW  288
            M  + + LH  FG+F N     +FLAP+ TFKRII KRSTE+FSG PY+++  +C+  AW
Sbjct  1    MSHVIKILHTTFGLFGNVFGILLFLAPLITFKRIIMKRSTEKFSGVPYLMSLFNCLFSAW  60

Query  289  YGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavall  468
            YGL FVS NN L+T +  IG  +E  +V+IF++FAPK EK KI  +L +V+ IF  VAL+
Sbjct  61   YGLAFVSRNNTLLTVLASIGGGLEAIYVLIFLIFAPKREKLKISGILFVVLSIFSMVALV  120

Query  469  svfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAW  648
            SV   HG  R+L CG A  I   +M+ +PL+V+R V+K+KSVE+MPF L+ S+   +T+W
Sbjct  121  SVLTLHGNKRKLLCGLAFAITCIMMFGAPLTVMRQVIKSKSVEYMPFFLSLSVFNSSTSW  180

Query  649  LIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHE  828
             I+G+L KDPF+ VPNA+G  +G +QLILYAIY +       K+   +G ++       E
Sbjct  181  AIYGILGKDPFIIVPNAIGTLLGSVQLILYAIYRDNK--GEGKKDEMNGSIETGLGKPQE  238

Query  829  KK----QPSITSSKY  861
            KK    Q  I   KY
Sbjct  239  KKLDCIQNEIQKEKY  253



>ref|XP_010320027.1| PREDICTED: bidirectional sugar transporter SWEET1a-like isoform 
X1 [Solanum lycopersicum]
Length=245

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 144/203 (71%), Gaps = 0/203 (0%)
 Frame = +1

Query  154  ANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTT  333
             N     +F+AP+ TFKRII KRSTE+FS  PYVI  L+C+L  WY LPFVSP+N+LVT 
Sbjct  16   GNVFGVLLFMAPMITFKRIISKRSTEQFSNIPYVIALLNCLLSVWYSLPFVSPDNLLVTI  75

Query  334  IDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCG  513
            ++ IG  +E  +V+IF++FAPK EK KI   L++V  I   VAL+S+  FHG  R+L CG
Sbjct  76   VNSIGAGLEATYVLIFLIFAPKKEKAKICGYLVVVFSIVSCVALVSLLAFHGNKRKLLCG  135

Query  514  FAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVP  693
            FA  +   +MY SPLSV+R V+K+KSVE+MPF L+ ++ +C+ +W  F LL KDPF+ VP
Sbjct  136  FAFTVSCIMMYGSPLSVMRRVIKSKSVEYMPFFLSLAVFICSLSWFFFALLGKDPFILVP  195

Query  694  NAVGCGVGVLQLILYAIYSEKTI  762
            NA+G  +G +QLILYAIY    +
Sbjct  196  NAIGTLLGAMQLILYAIYRASEV  218



>dbj|BAK08026.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=262

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FGI  N  A F+FL+P+ TF RII+ +STEEFSG PY +T L+C+L AWYGLPFVSPNN+
Sbjct  9    FGISGNVIALFLFLSPVPTFWRIIRNKSTEEFSGVPYNMTLLNCLLSAWYGLPFVSPNNV  68

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKK-KigvllilvvgifvavallsvfvfHGRIR  498
            LV+TI+G+G  IE  +VVIF+VFA   + + +   L   V  +F  VAL+S+   HG  R
Sbjct  69   LVSTINGVGAAIETVYVVIFLVFASSRKARLRTLGLASAVAAVFAVVALVSMLALHGPAR  128

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            +L  G A  + +  MY SPLS++R+V+KTKSVE+MPFLL+ ++ LC T+W I+GLL  D 
Sbjct  129  KLLAGLAMTVFSICMYASPLSIMRMVIKTKSVEYMPFLLSLAVFLCGTSWFIYGLLGHDL  188

Query  679  FVYVPNAVGCGVGVLQLILYAIY  747
            FV +PN  G  +G  QLILYA+Y
Sbjct  189  FVTIPNGCGSVLGAAQLILYAVY  211



>ref|XP_009778144.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X2 [Nicotiana sylvestris]
Length=264

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 147/197 (75%), Gaps = 0/197 (0%)
 Frame = +1

Query  166  AFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTTIDGI  345
               +F+AP+ TFKRII+K+STE+FS  PY+I+ L C+L AWY LPFVSPNN+LVT I  I
Sbjct  33   GLLLFMAPLITFKRIIRKKSTEQFSCMPYLISLLQCLLAAWYSLPFVSPNNLLVTVISAI  92

Query  346  GTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCGFAAL  525
            G  +E  +V+IF++F+PK  K KI   L +V+ IF ++AL+S+  FHG  R+LFCGFA  
Sbjct  93   GIGLEATYVLIFLIFSPKKGKAKICGYLFVVLSIFSSLALVSMLAFHGNRRKLFCGFAFA  152

Query  526  ICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVPNAVG  705
                +MY SPLSV+R+V+K+KSVE+MPF L+ S+ + +T+W IF LL KDPF++VPNA G
Sbjct  153  AACIMMYGSPLSVMRLVIKSKSVEYMPFFLSLSVFINSTSWSIFSLLGKDPFIFVPNAAG  212

Query  706  CGVGVLQLILYAIYSEK  756
              +G +QLILY +Y +K
Sbjct  213  TILGAVQLILYVVYRDK  229



>ref|XP_006366755.1| PREDICTED: bidirectional sugar transporter SWEET1-like [Solanum 
tuberosum]
Length=294

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 147/201 (73%), Gaps = 0/201 (0%)
 Frame = +1

Query  154  ANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTT  333
             N  + F+FL P+ TFKRIIK +STE+FSG PYV+T L+C+L AWYGLPF++ NNILV T
Sbjct  82   GNVASLFLFLVPMYTFKRIIKNKSTEQFSGIPYVMTLLNCLLTAWYGLPFITSNNILVAT  141

Query  334  IDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCG  513
            I+G+G  IEL +V IF+++    +K+KI V+ +LV+  F   A++S+  FHG+ R+ FCG
Sbjct  142  INGVGAAIELTYVFIFLLYGSNKQKRKILVIFVLVLIAFATAAVISISFFHGKNRRFFCG  201

Query  514  FAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVP  693
             AA I   +MY SPLS IR+V++TKSVE+MPF L+F++V+  T W I+G+L  D F+ + 
Sbjct  202  MAATIITVVMYASPLSNIRLVIRTKSVEYMPFFLSFAVVVSCTNWFIYGMLGMDLFIGIS  261

Query  694  NAVGCGVGVLQLILYAIYSEK  756
              +G  +GV+QLILY IY EK
Sbjct  262  TCIGLILGVVQLILYFIYREK  282



>ref|XP_009610840.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=279

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +1

Query  196  TFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVV  375
            TFKRII+K+STE+FS  PY+I+ L C+L AWY LPFVSPNN+LVT I  IG  +E  +V+
Sbjct  58   TFKRIIRKKSTEQFSSMPYLISLLQCLLSAWYSLPFVSPNNLLVTVISAIGIGLEATYVL  117

Query  376  IFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSP  555
            IF++F+PK  K KI   L +V+ IF ++AL+S+  FHG  R+LFCGFA      +MY SP
Sbjct  118  IFLIFSPKKGKAKICGYLFVVLSIFSSLALVSILAFHGNKRKLFCGFAFAAACVMMYGSP  177

Query  556  LSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLIL  735
            LSV+R+V+K+KSVE+MPF L+ S+ + +T+WLIF LL KDPF++VPNA G  +G  QLIL
Sbjct  178  LSVMRLVIKSKSVEYMPFFLSLSVFINSTSWLIFALLGKDPFIFVPNAAGTILGAAQLIL  237

Query  736  YAIYSEK  756
            YA+Y +K
Sbjct  238  YAVYRDK  244



>tpg|DAA56533.1| TPA: hypothetical protein ZEAMMB73_267913 [Zea mays]
Length=198

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 142/190 (75%), Gaps = 4/190 (2%)
 Frame = +1

Query  133  HLA---FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
            H+A   FG+  N  A F+FL+P+ TF R+I+KRSTE+FSG PY +T L+C+L AWYGLPF
Sbjct  3    HIARFFFGVSGNVIALFLFLSPVVTFWRVIRKRSTEDFSGVPYNMTLLNCLLSAWYGLPF  62

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFA-PKNEKKKigvllilvvgifvavallsvfv  480
            VSPNNILV+TI+G G+VIE  +VVIF++FA  +  +  +  LL +V  IF  V L+S+  
Sbjct  63   VSPNNILVSTINGTGSVIEAIYVVIFLIFAVDRRARLSMLGLLGIVASIFTTVVLVSLLA  122

Query  481  fHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFG  660
             HG  R++FCG AA I +  MY SPLS++R+V+KTKSVEFMPFLL+ ++ LC T+W I+G
Sbjct  123  LHGNARKVFCGLAATIFSICMYASPLSIMRLVIKTKSVEFMPFLLSLAVFLCGTSWFIYG  182

Query  661  LLEKDPFVYV  690
            LL +DPF+ V
Sbjct  183  LLGRDPFIIV  192



>ref|XP_006356305.1| PREDICTED: bidirectional sugar transporter SWEET1a-like, partial 
[Solanum tuberosum]
Length=236

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 158/238 (66%), Gaps = 11/238 (5%)
 Frame = +1

Query  148  IFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILV  327
            +  N     +FLAP+ TFKRII KRSTE+FSG PY+++  +C+  AWYGLPFVSPNN L+
Sbjct  2    LIGNVFGILLFLAPMITFKRIIMKRSTEKFSGVPYLMSLFNCLFSAWYGLPFVSPNNTLL  61

Query  328  TTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLF  507
            T +  IG  +E  +V+IF++FAPK EK KI  +L LV+ IF  VAL+SV   HG  R+L 
Sbjct  62   TVLASIGGALEAIYVLIFLIFAPKKEKFKISGILFLVLSIFSIVALVSVLKLHGDKRKLL  121

Query  508  CGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVY  687
            CG A  I   +M+ +PL+V+R V+K+KSVE+MPF L+ S+   +T+W I+GLL KDPF+ 
Sbjct  122  CGLAFAITCIMMFGAPLTVMRQVIKSKSVEYMPFFLSLSIFNSSTSWAIYGLLGKDPFII  181

Query  688  VPNAVGCGVGVLQLILYAIY--SEKTIFMTIKRSFSHGMLQINAMPQHEKKQPSITSS  855
            VPN+VG  +  +QLILYAIY  S+K + +  + S   G         HEK Q  I  +
Sbjct  182  VPNSVGSLLACVQLILYAIYRDSKKKLDVETEGSIETG---------HEKPQIEIQKN  230



>gb|AFW78060.1| hypothetical protein ZEAMMB73_315036 [Zea mays]
Length=217

 Score =   196 bits (498),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 136/188 (72%), Gaps = 1/188 (1%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FG+  N  A F+FL+P+ TF RII+++STE+FSG PY +T L+C+L AWYGLPFVSPNN+
Sbjct  9    FGVSGNVIALFLFLSPVPTFWRIIRRKSTEDFSGVPYSMTLLNCLLSAWYGLPFVSPNNM  68

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKK-KigvllilvvgifvavallsvfvfHGRIR  498
            LV+TI+G G  IE  +VVIF+ FA     + ++  L   V   F AVAL S+   HG+ R
Sbjct  69   LVSTINGAGAAIEAVYVVIFLAFASSQRTRLRMLGLASAVSAAFAAVALASMLALHGQGR  128

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            +L CG AA +C+  MY SPLS++R+V+KTKSVE+MPFLL+ ++ LC T+W ++GLL +DP
Sbjct  129  KLMCGLAATVCSICMYASPLSIMRLVVKTKSVEYMPFLLSLAVFLCGTSWFVYGLLGRDP  188

Query  679  FVYVPNAV  702
            FV V   V
Sbjct  189  FVAVRKHV  196



>ref|XP_009778143.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Nicotiana sylvestris]
Length=265

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = +1

Query  196  TFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVV  375
            TFKRII+K+STE+FS  PY+I+ L C+L AWY LPFVSPNN+LVT I  IG  +E  +V+
Sbjct  44   TFKRIIRKKSTEQFSCMPYLISLLQCLLAAWYSLPFVSPNNLLVTVISAIGIGLEATYVL  103

Query  376  IFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSP  555
            IF++F+PK  K KI   L +V+ IF ++AL+S+  FHG  R+LFCGFA      +MY SP
Sbjct  104  IFLIFSPKKGKAKICGYLFVVLSIFSSLALVSMLAFHGNRRKLFCGFAFAAACIMMYGSP  163

Query  556  LSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLIL  735
            LSV+R+V+K+KSVE+MPF L+ S+ + +T+W IF LL KDPF++VPNA G  +G +QLIL
Sbjct  164  LSVMRLVIKSKSVEYMPFFLSLSVFINSTSWSIFSLLGKDPFIFVPNAAGTILGAVQLIL  223

Query  736  YAIYSEK  756
            Y +Y +K
Sbjct  224  YVVYRDK  230



>ref|XP_008366546.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X2 [Malus domestica]
 ref|XP_008366547.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X2 [Malus domestica]
Length=213

 Score =   193 bits (491),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 135/182 (74%), Gaps = 0/182 (0%)
 Frame = +1

Query  211  IKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVF  390
            ++K+ TE+FSG PYV+T L+C+L AWYGLPFVS NN LV+T++G G  +EL +V++FI+F
Sbjct  1    MRKKCTEQFSGIPYVMTMLNCLLYAWYGLPFVSANNFLVSTVNGTGAAMELIYVLVFIIF  60

Query  391  APKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIR  570
            APK E+ KI  L   V+ +F AVAL+S+F  H + R+LFCG AA + A IM+ SPLS++ 
Sbjct  61   APKRERAKILGLFTAVLALFSAVALVSLFALHDKTRKLFCGLAATVFAIIMFSSPLSIMS  120

Query  571  VVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYS  750
             V++TKSVEFMPF L+    LC T+W I+GLL +DPFV +PN  G  +G LQLILY IY 
Sbjct  121  TVVRTKSVEFMPFFLSLFSFLCGTSWFIYGLLGRDPFVAIPNGCGSXLGALQLILYFIYR  180

Query  751  EK  756
            + 
Sbjct  181  DN  182



>ref|XP_009778136.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Nicotiana sylvestris]
Length=252

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 144/215 (67%), Gaps = 1/215 (0%)
 Frame = +1

Query  115  GLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            G+   LH AFGIF       + LAP  TF+R+I+KRSTE FSG PYVI+ ++C+   WY 
Sbjct  2    GVIHILHTAFGIFGILNTLLLLLAPRITFQRVIRKRSTENFSGIPYVISLVNCLFSMWYS  61

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPK-NEKKKigvllilvvgifvavalls  471
            LPFVSPNN+LVT I   GT I+   V+IF+ FAP   EK KI  +L L   IF  VAL+S
Sbjct  62   LPFVSPNNMLVTIIAASGTSIQPIHVLIFLPFAPSWKEKAKISGILFLFFLIFSTVALVS  121

Query  472  vfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWL  651
            +F  HG  R+LFCGF + I    MY SPL+++R V+KTKSVE+MP  L+  +  C   WL
Sbjct  122  IFALHGHKRKLFCGFISGIVGISMYGSPLTILRQVIKTKSVEYMPLFLSIFVFTCGVTWL  181

Query  652  IFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            ++ LL  DPF+YVPN +G  +G++QLILYA+Y + 
Sbjct  182  VYRLLGVDPFIYVPNMIGALLGLVQLILYAVYRDN  216



>ref|XP_006434360.1| hypothetical protein CICLE_v10002276mg [Citrus clementina]
 gb|ESR47600.1| hypothetical protein CICLE_v10002276mg [Citrus clementina]
Length=204

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +1

Query  256  ITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllil  435
            +T L+C+L AWYGLPFVS NNILV+TI+G G+ IE+ +V+IF++FAPK EK KI  L +L
Sbjct  1    MTLLNCLLSAWYGLPFVSKNNILVSTINGTGSAIEIIYVLIFLLFAPKKEKAKIFGLFML  60

Query  436  vvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLL  615
            V+ +F AVAL+S+  FHG  R++FCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L
Sbjct  61   VLTVFAAVALVSLLAFHGNARKIFCGFAATIFSIIMYASPLSIMRMVIKTKSVEFMPFFL  120

Query  616  TFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            +  + LC T+W +FGLL +DPFV VPN  GCG+G +QLILY IY +K
Sbjct  121  SLFVFLCGTSWFVFGLLGRDPFVAVPNGFGCGLGTMQLILYFIYHKK  167



>ref|XP_006472909.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X2 [Citrus sinensis]
Length=204

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +1

Query  256  ITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllil  435
            +T L+C+L AWYGLPFVS NNILV+TI+G G+ IE+ +V+IF++FAPK EK KI  L +L
Sbjct  1    MTLLNCLLSAWYGLPFVSKNNILVSTINGTGSAIEIIYVLIFLLFAPKKEKAKIFGLFML  60

Query  436  vvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLL  615
            V+ +F AVAL+S+  FHG  R++FCGFAA I + IMY SPLS++R+V+KTKSVEFMPF L
Sbjct  61   VLTVFAAVALVSLLAFHGNARKIFCGFAATIFSIIMYASPLSIMRMVIKTKSVEFMPFFL  120

Query  616  TFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            +  + LC T+W +FGLL +DPFV VPN  GCG+G +QLILY IY +K
Sbjct  121  SLFVFLCGTSWFVFGLLGRDPFVAVPNGFGCGLGTMQLILYFIYHKK  167



>ref|XP_009778138.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Nicotiana sylvestris]
Length=256

 Score =   189 bits (481),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 153/232 (66%), Gaps = 3/232 (1%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FGI     +  + LAP+ TF+R+I+KRSTE+ SG PYVI+  +C+   WY LPFVSPNN+
Sbjct  7    FGILGILNSLLLLLAPMITFQRVIRKRSTEKISGIPYVISLFNCLFSMWYSLPFVSPNNM  66

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPK-NEKKKigvllilvvgifvavallsvfvfHGRIR  498
            LVT I   GT I+  +V+IF++FAP   EK KI  +L L+  IF  VAL+S+F  HG  R
Sbjct  67   LVTIIGASGTSIQATYVLIFLIFAPSWKEKAKISGILFLLFLIFSTVALVSIFALHGYKR  126

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
             LFCG  + I    MY SPL+++R+V+KTKSVE+MP  L+     C+  WL++GLL  DP
Sbjct  127  MLFCGLVSAIVGISMYGSPLTIMRLVIKTKSVEYMPLFLSIFAFTCSITWLVYGLLGADP  186

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKK  834
            F+YVPN VG  +G++QLILYA+Y  + I   +K+      +++     +E+K
Sbjct  187  FIYVPNVVGALLGLVQLILYAVY--RDIKREVKKEAVDESVKMELENPNEEK  236



>gb|EMS49359.1| Bidirectional sugar transporter SWEET1b [Triticum urartu]
Length=335

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 134/188 (71%), Gaps = 1/188 (1%)
 Frame = +1

Query  196  TFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVV  375
            TF RII+ +STEEFSG PY +T L+C+L AWYGLPFVSPNN+LV+TI+G+G  IE  +VV
Sbjct  22   TFWRIIRNKSTEEFSGVPYNMTLLNCLLSAWYGLPFVSPNNVLVSTINGVGAAIETVYVV  81

Query  376  IFIVFAPKNEKK-KigvllilvvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFS  552
            IF+VFA   + + +   L   V  +FV VAL+S+ V HG  R+L  G A  + +  MY S
Sbjct  82   IFLVFASNKKARLRTLGLASAVATVFVVVALVSMLVLHGPARKLLAGLAMTVFSICMYAS  141

Query  553  PLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLI  732
            PLS++R+V+KTKSVE+MPFLL+ ++ LC T+W I+GLL  D FV +PN  G  +G  QLI
Sbjct  142  PLSIMRMVIKTKSVEYMPFLLSLAVFLCGTSWFIYGLLGHDLFVTIPNGCGSVLGAAQLI  201

Query  733  LYAIYSEK  756
            LYAIY   
Sbjct  202  LYAIYRNN  209



>ref|XP_010496504.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X2 [Camelina sativa]
Length=203

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 137/203 (67%), Gaps = 3/203 (1%)
 Frame = +1

Query  256  ITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllil  435
            +T L+C+L AWYGLPFVS +N LV+TI+G G VIE  +V IF+++APK EK KI  +   
Sbjct  1    MTLLNCLLSAWYGLPFVSKDNTLVSTINGTGAVIETIYVFIFLIYAPKKEKVKIFGIFSC  60

Query  436  vvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLL  615
            V+ +F  VAL+S+F  HG  R+LFCG AA + + IMY SPLS++R+V+KTKSVEFMPF L
Sbjct  61   VLAVFGTVALVSLFALHGNARKLFCGLAATVFSIIMYASPLSIMRLVIKTKSVEFMPFFL  120

Query  616  TFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHG  795
            +  + LC T+W ++GL+ +DPFV +PN  GC +G LQLILY IY       +        
Sbjct  121  SLFVFLCGTSWFVYGLIGRDPFVAIPNGFGCALGTLQLILYFIYCGNKGEKSGDAEKDEK  180

Query  796  MLQINAMPQHEKKQPSITSSKYD  864
            M++   M   EKK+ ++ + K D
Sbjct  181  MVE---MKDEEKKKQNVVNGKQD  200



>ref|XP_008810889.1| PREDICTED: bidirectional sugar transporter SWEET1a isoform X3 
[Phoenix dactylifera]
Length=201

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 121/167 (72%), Gaps = 0/167 (0%)
 Frame = +1

Query  256  ITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllil  435
            +T L+C L AWYGLPFVSPNN+LV+TI+G GTVIEL +VVIFIV+AP+  + K      +
Sbjct  1    MTLLNCFLSAWYGLPFVSPNNLLVSTINGAGTVIELVYVVIFIVYAPRKVRTKTLCFFAI  60

Query  436  vvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLL  615
            VV I   VA +S+   HG  R+LFCGFAA I + +MY SPL ++R+V++TKSVEFMPF L
Sbjct  61   VVAISAIVAFVSLLALHGHARKLFCGFAASIFSVVMYGSPLFIMRLVIRTKSVEFMPFFL  120

Query  616  TFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            +    LC T+W I+GLL +DPFV+V N  G  +G +QLILYAIY   
Sbjct  121  SLFSFLCGTSWFIYGLLGRDPFVWVQNGCGSALGAVQLILYAIYRNH  167



>ref|XP_010498604.1| PREDICTED: bidirectional sugar transporter SWEET1 isoform X2 
[Camelina sativa]
Length=202

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 137/203 (67%), Gaps = 4/203 (2%)
 Frame = +1

Query  256  ITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllil  435
            +T L+C+L AWYGLPFVS +N LV+TI+G G VIE  +V IF+++APK EK KI  +   
Sbjct  1    MTLLNCLLSAWYGLPFVSKDNTLVSTINGTGAVIETIYVFIFLIYAPKKEKVKIFGIFSC  60

Query  436  vvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLL  615
            V+ +F  VAL+S+F  HG  R+LFCG AA + + IMY SPLS++R+V+KTKSVEFMPF L
Sbjct  61   VLAVFGTVALVSLFALHGNARKLFCGLAATVFSIIMYASPLSIMRLVIKTKSVEFMPFFL  120

Query  616  TFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHG  795
            +  + LC T+W ++GL+ +DPFV +PN  GC +G LQLILY IY       +        
Sbjct  121  SLFVFLCGTSWFVYGLIGRDPFVAIPNGFGCALGTLQLILYFIYCGNKGEKSGDAEKDEK  180

Query  796  MLQINAMPQHEKKQPSITSSKYD  864
            M++   M   EKKQ ++ + K D
Sbjct  181  MVE---MKDEEKKQ-NVVNGKQD  199



>ref|XP_010065110.1| PREDICTED: uncharacterized protein LOC104452329 [Eucalyptus grandis]
Length=468

 Score =   187 bits (476),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 104/214 (49%), Positives = 142/214 (66%), Gaps = 0/214 (0%)
 Frame = +1

Query  196  TFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVV  375
            TFKRII+ +STE+FSG PY++T LSC L  WYGLPF+SP+N+L+  I  IG VIEL +V 
Sbjct  252  TFKRIIRNQSTEQFSGVPYMVTLLSCSLYTWYGLPFMSPDNLLLLIISVIGVVIELTYVW  311

Query  376  IFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSP  555
            IFI +APK E+ KI VL  L + + +  AL+S+F  H + R+LFCG    I + I Y SP
Sbjct  312  IFITYAPKKERAKIMVLSGLALILILTFALVSLFALHSKTRKLFCGIMLDIFSTITYASP  371

Query  556  LSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLIL  735
            LS++ +V+KTKS EFMPFLL+    LC   WL +GLL +DPF+ VPN +G G+G+ QLIL
Sbjct  372  LSIMMLVIKTKSAEFMPFLLSLLFFLCGIFWLAYGLLSRDPFLIVPNGLGTGLGIAQLIL  431

Query  736  YAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
            YA Y +       +     G + +    Q+E+ +
Sbjct  432  YAKYRKNQSHTKNEVRDEFGEMDLEKTDQNEETE  465


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = +1

Query  199  FKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVVI  378
            FKRII   STE+ SG  YVIT L+C+   WY  PF+S +++L++ I  IG VIE   V I
Sbjct  24   FKRIITSWSTEQVSGVSYVITLLNCLFYTWYEFPFLSSDSLLISIISSIGVVIEFVHVPI  83

Query  379  FIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSPL  558
            FI +A K E  KI  L  L + +F+  A +S+F+ HG+  +L       I + IMY SPL
Sbjct  84   FITYASKKESAKIMRLPGLALILFITFAFVSLFILHGKTCKLSRSITLDISSTIMYASPL  143

Query  559  SVIR  570
            S ++
Sbjct  144  SALQ  147


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 82/160 (51%), Gaps = 19/160 (12%)
 Frame = +1

Query  304  VSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvf  483
            VS +N+L+  I  +G VIEL +V+IFI +APK E+ KI     L +  F+  A  S+F  
Sbjct  157  VSSDNLLLLIISAMGVVIELTYVLIFIAYAPKKERAKIMGFSGLALIFFLTFAFASLFAL  216

Query  484  HGRIRQLFCGFAALICAAIMYFSPLSVI----------RVVMKTKSVEF--MPFLLTFSM  627
              + R+L C     I + IM  SPLSV+          R++    + +F  +P+++T   
Sbjct  217  QSKNRKLLCSITLDIFSTIMCASPLSVMLHYYSRTTFKRIIRNQSTEQFSGVPYMVT---  273

Query  628  VLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIY  747
            +L  + +  +GL    PF+   N +   + V+ +++   Y
Sbjct  274  LLSCSLYTWYGL----PFMSPDNLLLLIISVIGVVIELTY  309



>ref|XP_006581612.1| PREDICTED: bidirectional sugar transporter SWEET1 isoform X2 
[Glycine max]
Length=207

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 139/236 (59%), Gaps = 41/236 (17%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NA+A F+FLAP+ TFKRIIK RSTE+FSG PYV+T L+C+L AWYGLPFVSP
Sbjct  5    HFLFGIFGNASALFLFLAPVITFKRIIKNRSTEKFSGIPYVMTLLNCLLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            +NILV+T++G G+ IE+ +V+IFIV AP+ EK KI  L   V+ +F AV  +S+F  HG 
Sbjct  65   HNILVSTVNGTGSFIEIIYVLIFIVLAPRKEKAKILGLFTFVLSVFSAVVFVSLFALHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I + IMY SPLS++                                   
Sbjct  125  SRKLFCGFAAAIFSIIMYGSPLSIM-----------------------------------  149

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSE-KTIFMTIKRSFSHGMLQINAMPQHEKKQ  837
                 VPN VG  +G +QLILY IY + K +      +    M   +A PQ  K+ 
Sbjct  150  -----VPNGVGSALGTMQLILYFIYRDNKGVPRKQAPTEEESMEMGDAKPQQGKQS  200



>gb|AAF87899.1|AC015447_9 Unknown protein [Arabidopsis thaliana]
Length=202

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 136/203 (67%), Gaps = 4/203 (2%)
 Frame = +1

Query  256  ITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllil  435
            +T L+C+L AWYGLPFVS +N LV+TI+G G VIE  +V+IF+ +APK EK KI  +   
Sbjct  1    MTLLNCLLSAWYGLPFVSKDNTLVSTINGTGAVIETVYVLIFLFYAPKKEKIKIFGIFSC  60

Query  436  vvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLL  615
            V+ +F  VAL+S+F   G  R+LFCG AA + + IMY SPLS++R+V+KTKSVEFMPF L
Sbjct  61   VLAVFATVALVSLFALQGNGRKLFCGLAATVFSIIMYASPLSIMRLVVKTKSVEFMPFFL  120

Query  616  TFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHG  795
            +  + LC T+W ++GL+ +DPFV +PN  GC +G LQLILY IY         K + +  
Sbjct  121  SLFVFLCGTSWFVYGLIGRDPFVAIPNGFGCALGTLQLILYFIYCGNK---GEKSADAQK  177

Query  796  MLQINAMPQHEKKQPSITSSKYD  864
              +   M   EKKQ ++ + K D
Sbjct  178  DEKSVEMKDDEKKQ-NVVNGKQD  199



>ref|XP_011076028.1| PREDICTED: bidirectional sugar transporter SWEET3b [Sesamum indicum]
Length=279

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 144/216 (67%), Gaps = 3/216 (1%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            +   L LA GI  NAT+  ++ API TF R+IKKRSTEEFS  PY++  L+C L  WYGL
Sbjct  1    MEEKLRLAVGIMGNATSLLLYAAPILTFSRVIKKRSTEEFSCVPYILALLNCFLYTWYGL  60

Query  298  PFVSP--NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavalls  471
            P VS    N  V TI+G+G ++E++F++I+  FAP N KKK+ +L I V+ +   VA+LS
Sbjct  61   PVVSYKWENFPVVTINGLGILLEISFILIYFYFAPANGKKKVAMLTIPVLLVSCLVAILS  120

Query  472  vfvfHGRI-RQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAW  648
             FVFH    R+ F G   L+ +  MY SPL V++ V++TKSVEFMPF L+F   L ++ W
Sbjct  121  AFVFHDHHHRKAFVGSVGLVASVAMYGSPLVVVKQVIQTKSVEFMPFYLSFFSFLASSLW  180

Query  649  LIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            + +GLL  D F+  PN VG  +G+LQL+LY +Y +K
Sbjct  181  MAYGLLSHDLFLASPNLVGSPLGILQLVLYCMYRKK  216



>ref|XP_008672859.1| PREDICTED: LOC100282137 isoform X1 [Zea mays]
 gb|ACN28152.1| unknown [Zea mays]
 tpg|DAA56531.1| TPA: hypothetical protein ZEAMMB73_267913 [Zea mays]
Length=221

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = +1

Query  256  ITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFA-PKNEKKKigvlli  432
            +T L+C+L AWYGLPFVSPNNILV+TI+G G+VIE  +VVIF++FA  +  +  +  LL 
Sbjct  1    MTLLNCLLSAWYGLPFVSPNNILVSTINGTGSVIEAIYVVIFLIFAVDRRARLSMLGLLG  60

Query  433  lvvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFL  612
            +V  IF  V L+S+   HG  R++FCG AA I +  MY SPLS++R+V+KTKSVEFMPFL
Sbjct  61   IVASIFTTVVLVSLLALHGNARKVFCGLAATIFSICMYASPLSIMRLVIKTKSVEFMPFL  120

Query  613  LTFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            L+ ++ LC T+W I+GLL +DPF+ +PN  G  +G++QLILYAIY + 
Sbjct  121  LSLAVFLCGTSWFIYGLLGRDPFIIIPNGCGSFLGLMQLILYAIYRKN  168



>gb|ADE75802.1| unknown [Picea sitchensis]
Length=231

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 142/202 (70%), Gaps = 0/202 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H A GI  N  A  +FL+PI TF+RI K +STE+FSG PY+   L+C++  WYGLPFVS 
Sbjct  9    HYATGIADNFFALGLFLSPIPTFRRITKNKSTEQFSGLPYIFALLNCLICTWYGLPFVSR  68

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNILVTT++G G + +L ++ ++IV++ K  + K+ VLL LV+ IF+++ L++       
Sbjct  69   NNILVTTVNGTGAIFQLFYISLYIVYSQKEARVKMVVLLSLVMAIFISIVLVTYEFMKQP  128

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            +R++F G  ++I    M+ SPLS+I++V++T SVE+MPF L+ S +L + ++  +G L +
Sbjct  129  LRKVFVGSLSVISLVSMFASPLSIIKLVIETHSVEYMPFYLSLSTLLMSVSFFTYGFLGQ  188

Query  673  DPFVYVPNAVGCGVGVLQLILY  738
            DPFVYVPN +G  +G++QL LY
Sbjct  189  DPFVYVPNGIGSVLGIIQLGLY  210



>ref|XP_006442341.1| hypothetical protein CICLE_v10021714mg [Citrus clementina]
 gb|ESR55581.1| hypothetical protein CICLE_v10021714mg [Citrus clementina]
 gb|KDO49280.1| hypothetical protein CISIN_1g022823mg [Citrus sinensis]
 gb|KDO49281.1| hypothetical protein CISIN_1g022823mg [Citrus sinensis]
Length=235

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 145/212 (68%), Gaps = 4/212 (2%)
 Frame = +1

Query  130  LHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVS  309
            L  A GI  N  AF +F++P+ TF+RII+  STEEFSG PYV   L+C++  WYG P VS
Sbjct  13   LKDAVGIAGNIFAFGLFVSPVPTFRRIIRNHSTEEFSGLPYVYALLNCLITMWYGTPLVS  72

Query  310  PNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHG  489
             +NILVTT++ IG   +L ++++FI +  K++K ++  LL+ V+GIF  +  +S+ + + 
Sbjct  73   ADNILVTTVNSIGAAFQLVYIILFITYTEKDKKVRMLGLLLAVIGIFSIIVAVSLQIVNP  132

Query  490  RIRQLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
              RQ+F G   L CAA+  M+ SPL +I +V++TKSVEFMPF L+ S  L +T++L +G+
Sbjct  133  FSRQMFVGL--LSCAALISMFASPLFIINLVIQTKSVEFMPFYLSLSTFLMSTSFLAYGI  190

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            +  DPF+YVPN +G  +G++QL LY  Y E +
Sbjct  191  MNWDPFIYVPNGIGTILGIVQLALYFNYKETS  222



>ref|XP_006477817.1| PREDICTED: bidirectional sugar transporter SWEET2-like isoform 
X2 [Citrus sinensis]
Length=235

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 145/212 (68%), Gaps = 4/212 (2%)
 Frame = +1

Query  130  LHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVS  309
            L  A GI  N  AF +F++P+ TF+RII+  STEEFSG PYV   L+C++  WYG P VS
Sbjct  13   LKDAVGIAGNIFAFGLFVSPVPTFRRIIRNHSTEEFSGLPYVYALLNCLITMWYGTPLVS  72

Query  310  PNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHG  489
             +NILVTT++ IG   +L ++++FI +  K++K ++  LL+ V+GIF  +  +S+ + + 
Sbjct  73   ADNILVTTVNSIGAAFQLVYIILFITYTEKDKKVRMLGLLLAVIGIFSIIVAVSLQIVNP  132

Query  490  RIRQLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGL  663
              RQ+F G   L CAA+  M+ SPL +I +V++TKSVEFMPF L+ S  L +T++L +G+
Sbjct  133  FSRQMFVGL--LSCAALISMFASPLFIINLVIQTKSVEFMPFYLSLSAFLMSTSFLAYGI  190

Query  664  LEKDPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            +  DPF+YVPN +G  +G++QL LY  Y E +
Sbjct  191  MNWDPFIYVPNGIGTILGIVQLALYFNYKETS  222



>gb|EAZ14380.1| hypothetical protein OsJ_04300 [Oryza sativa Japonica Group]
Length=311

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 148/261 (57%), Gaps = 67/261 (26%)
 Frame = +1

Query  133  HLA---FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGA------  285
            H+A   FG+  N  A F+FL+P+ TF RIIKKRSTE+FSG PY +T L+C+L A      
Sbjct  3    HIARFFFGVSGNVIALFLFLSPVVTFWRIIKKRSTEDFSGVPYNMTLLNCLLSACSSYSP  62

Query  286  ---------------------------------W------------YGLPFVSPNNILVT  330
                                             W            YGLPFVSPNNILVT
Sbjct  63   CCRHGQDGCDMWAQEAVVQAHAASRSSVCSSKKWVRNTIRESILRRYGLPFVSPNNILVT  122

Query  331  TIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFC  510
            TI+G G+VIE  +VVIF++FA +  + K+  LL LV  IF  V L+S+   HG+ R+LFC
Sbjct  123  TINGTGSVIEAIYVVIFLIFAERKARLKMMGLLGLVTSIFTMVVLVSLLALHGQGRKLFC  182

Query  511  GFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYV  690
            G AA I +  MY SPLS++R+V+KTKSVEFMPFLL+ S+ LC T             V +
Sbjct  183  GLAATIFSICMYASPLSIMRLVIKTKSVEFMPFLLSLSVFLCGT-------------VLI  229

Query  691  PNAVGCGVGVLQLILYAIYSE  753
            PN  G  +G++QLILYAIY  
Sbjct  230  PNGCGSFLGLMQLILYAIYRN  250



>ref|XP_009778147.1| PREDICTED: bidirectional sugar transporter SWEET1a-like isoform 
X4 [Nicotiana sylvestris]
Length=206

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 126/170 (74%), Gaps = 0/170 (0%)
 Frame = +1

Query  247  PYVITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvl  426
            PY+I+ L C+L AWY LPFVSPNN+LVT I  IG  +E  +V+IF++F+PK  K KI   
Sbjct  2    PYLISLLQCLLAAWYSLPFVSPNNLLVTVISAIGIGLEATYVLIFLIFSPKKGKAKICGY  61

Query  427  lilvvgifvavallsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMP  606
            L +V+ IF ++AL+S+  FHG  R+LFCGFA      +MY SPLSV+R+V+K+KSVE+MP
Sbjct  62   LFVVLSIFSSLALVSMLAFHGNRRKLFCGFAFAAACIMMYGSPLSVMRLVIKSKSVEYMP  121

Query  607  FLLTFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            F L+ S+ + +T+W IF LL KDPF++VPNA G  +G +QLILY +Y +K
Sbjct  122  FFLSLSVFINSTSWSIFSLLGKDPFIFVPNAAGTILGAVQLILYVVYRDK  171



>ref|XP_002269484.1| PREDICTED: bidirectional sugar transporter SWEET2a [Vitis vinifera]
 emb|CBI30772.3| unnamed protein product [Vitis vinifera]
Length=232

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 139/207 (67%), Gaps = 0/207 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N +AF +F++PI TF+RII+  STE+FSG PY+   L+C++  WYG+P VSP  
Sbjct  11   AAGIAGNLSAFVLFVSPIPTFRRIIRNGSTEQFSGLPYIYALLNCLICLWYGMPLVSPGI  70

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILV T++ +G + +L ++ IFI FA K +K K+  LL  + GI+  +   S+ +F    R
Sbjct  71   ILVATVNSVGAIFQLIYIGIFITFAEKAKKMKMSGLLTAIFGIYAIIVFASMKLFDPHAR  130

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            QLF G+ ++     M+ SPL +I +V++T+SVE+MPF L+ S  L + ++  +G+ + DP
Sbjct  131  QLFVGYLSVASLISMFASPLFIINLVIRTRSVEYMPFYLSLSTFLMSLSFFTYGMFKHDP  190

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKT  759
            F+YVPN +G  +GV+QL+LYA YS  +
Sbjct  191  FIYVPNGIGTILGVVQLVLYAYYSRTS  217



>ref|XP_006449593.1| hypothetical protein CICLE_v10016510mg [Citrus clementina]
 ref|XP_006449594.1| hypothetical protein CICLE_v10016510mg [Citrus clementina]
 gb|ESR62833.1| hypothetical protein CICLE_v10016510mg [Citrus clementina]
 gb|ESR62834.1| hypothetical protein CICLE_v10016510mg [Citrus clementina]
Length=235

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 144/209 (69%), Gaps = 0/209 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
             +A G+  N  AF +F++PI TF+RI++ +STE+FSG PY+ + L+C++  WYG+P VSP
Sbjct  14   SVAAGVTGNIFAFVLFVSPIPTFRRILRNKSTEQFSGLPYIYSLLNCLITLWYGMPLVSP  73

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
              ILV T++ +G V +L +V IFI +A K  K KI  LLI V  +F+A+   S+ VF   
Sbjct  74   GIILVATVNSVGAVFQLIYVSIFISYAEKAIKLKIAGLLIAVFLVFLAIVFTSMEVFDSN  133

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LF G+ ++     M+ SPL +I++V+KT+S+EFMPF L+ S  L + ++L +G+ + 
Sbjct  134  GRRLFVGYLSVASLISMFASPLFIIKLVIKTRSIEFMPFYLSLSTFLMSLSFLAYGMFKD  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            DPF+YVPN +G  +G+ QL+LY+ YS K+
Sbjct  194  DPFIYVPNGIGTLLGIAQLMLYSYYSTKS  222



>gb|EYU32455.1| hypothetical protein MIMGU_mgv1a012708mg [Erythranthe guttata]
Length=194

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 130/169 (77%), Gaps = 2/169 (1%)
 Frame = +1

Query  256  ITFLSCMLGAWYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllil  435
            +T L+C+L AWYG+PF+SPNN+LV+ I+G G VIE  +V+IF+++APK EK KI  LL+L
Sbjct  1    MTLLNCLLAAWYGMPFISPNNVLVSAINGTGVVIESIYVLIFLIYAPKKEKGKILGLLLL  60

Query  436  vvgifvavallsvfv--fHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPF  609
            ++ IF  VAL+S+     H  +++LFCG AA + + IMY SPLSV+R+V+KTKSVE+MPF
Sbjct  61   ILAIFTTVALVSILAFRGHDNLKKLFCGIAATLFSIIMYASPLSVMRLVIKTKSVEYMPF  120

Query  610  LLTFSMVLCATAWLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            LL+  + LC T+WLI+GL+ KD F+Y+PN  GC +G +QL +YAIY  K
Sbjct  121  LLSLFVFLCGTSWLIYGLIGKDMFIYIPNGFGCLLGTMQLCIYAIYRNK  169



>gb|EYU26292.1| hypothetical protein MIMGU_mgv1a012783mg [Erythranthe guttata]
Length=240

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 143/207 (69%), Gaps = 4/207 (2%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            GI  N  AF +FL+P+ TF+RII+  STE+FSG PY+ T L+C++ AWYGLP +S NN+L
Sbjct  19   GIAGNVFAFGLFLSPVATFQRIIRNESTEQFSGLPYIYTLLNCLITAWYGLPVISSNNLL  78

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            VTT++ IG + +L ++ IFI +A K +K ++  LL+ V  +F A+ + S+ +    IR L
Sbjct  79   VTTVNSIGAIFQLVYITIFIKYAEKTKKLRMIGLLLSVFVLFAAIIVGSLLIVDFEIRHL  138

Query  505  FCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
              GF  L CA +  M+ SPL VI +V++T+SVEFMPF L+    L +T++L++G+   DP
Sbjct  139  TIGF--LSCATLISMFASPLFVINLVIQTRSVEFMPFHLSLCTFLMSTSFLLYGIFNFDP  196

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKT  759
            F+Y PN +G  +GV+QL+L++ + + +
Sbjct  197  FIYAPNGIGTILGVVQLLLFSYFKKPS  223



>ref|XP_006467563.1| PREDICTED: bidirectional sugar transporter SWEET2a-like isoform 
X1 [Citrus sinensis]
Length=235

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/209 (45%), Positives = 144/209 (69%), Gaps = 0/209 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
             +A G+  N  AF +F++PI TF+RI++ +STE+FSG PY+ + L+C++  WYG+P VSP
Sbjct  14   SVAAGVTGNIFAFVLFVSPIPTFRRILRNKSTEQFSGLPYICSLLNCLITLWYGMPLVSP  73

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
              ILV T++ +G V +L +V IFI +A K  K KI  LLI V  +F+A+   S+ VF   
Sbjct  74   GIILVATVNSVGAVFQLIYVSIFISYAEKAIKLKISGLLIAVFLVFLAIVFTSMEVFDSN  133

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LF G+ ++     M+ SPL +I++V+KT+SVEFMPF L+ S  L + ++L +GL + 
Sbjct  134  GRRLFVGYLSVASLISMFASPLFIIKLVIKTRSVEFMPFYLSLSNFLMSLSFLAYGLFKD  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            DPF+YVPN +G  +G+ Q++LY+ YS K+
Sbjct  194  DPFIYVPNGIGTLLGIAQVMLYSYYSTKS  222



>ref|XP_009344605.1| PREDICTED: bidirectional sugar transporter SWEET2-like [Pyrus 
x bretschneideri]
Length=235

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 140/209 (67%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +F++PI TF+RI++ R+TEEFSG PY+   L+C++  WYG P +SP+N
Sbjct  16   AAGIAGNIFAFGLFVSPIHTFRRIMRNRATEEFSGLPYIYALLNCLISMWYGSPIISPDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            I+V T++ +G V +L ++ +FI++A K +K K+  LL  V G+   +   S+ +    IR
Sbjct  76   IMVMTVNSVGAVFQLVYIALFIIYAEKTKKMKMLGLLAAVCGLIAIIVYGSLQIADAAIR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            Q+  G   L CA++  M+ SPL +I +V++TKSVEFMPF L+ S  L +T++L++G+   
Sbjct  136  QIVVG--VLSCASLISMFASPLFIINLVIRTKSVEFMPFYLSLSTFLMSTSFLLYGIFNC  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D FVYVPN VG  +G++QL LY  Y + +
Sbjct  194  DLFVYVPNGVGTILGIVQLALYFHYKDSS  222



>ref|XP_008779964.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Phoenix 
dactylifera]
Length=238

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 139/205 (68%), Gaps = 0/205 (0%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            GI  N  AF +FL+PI TFKRI+K RSTE+FSG PYV + L+C++  WYGLP V+P  IL
Sbjct  19   GIAGNLFAFVLFLSPIPTFKRIVKNRSTEQFSGLPYVYSLLNCLICFWYGLPCVAPGVIL  78

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            V T++ IG + +  +V +FI++A K +K K+  LLI V   F  +  +S+ +F GR R++
Sbjct  79   VATVNSIGAIFQSVYVALFIIYADKAKKLKMSGLLIAVFCAFALIIYISLELFDGRRRRM  138

Query  505  FCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFV  684
            F G+ ++     M  SPL +I +V++ +SVEFMPF L+ +  L + ++  +G+L+ D F+
Sbjct  139  FVGYLSVASLISMSASPLCIINLVIRRRSVEFMPFYLSLATFLMSISFFAYGMLKHDFFI  198

Query  685  YVPNAVGCGVGVLQLILYAIYSEKT  759
            YVPN +G  +GV+QL LYA YS K+
Sbjct  199  YVPNGIGTILGVVQLFLYAYYSRKS  223



>gb|KDO77996.1| hypothetical protein CISIN_1g024679mg [Citrus sinensis]
Length=235

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 144/209 (69%), Gaps = 0/209 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
             +A G+  N  AF +F++PI TF+RI++ +STE+FSG PY+ + L+C++  WYG+P VSP
Sbjct  14   SVAAGVTGNIFAFVLFVSPIPTFRRILRNKSTEQFSGLPYICSLLNCLITLWYGMPLVSP  73

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
              ILV T++ +G V +L +V IFI +A K  K KI  LLI V  +F+A+   S+ VF   
Sbjct  74   GIILVATVNSVGAVFQLIYVSIFISYAEKAIKLKISGLLIAVFLVFLAIVFTSMEVFDSN  133

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LF G+ ++     M+ SPL +I++V+KT+SVEFMPF L+ S  L + ++L +G+ + 
Sbjct  134  GRRLFVGYLSVASLISMFASPLFIIKLVIKTRSVEFMPFYLSLSNFLMSLSFLAYGMFKD  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            DPF+YVPN +G  +G+ Q++LY+ YS K+
Sbjct  194  DPFIYVPNGIGTLLGIAQVMLYSYYSTKS  222



>ref|XP_010552141.1| PREDICTED: bidirectional sugar transporter SWEET2-like [Tarenaya 
hassleriana]
Length=236

 Score =   170 bits (431),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 139/205 (68%), Gaps = 0/205 (0%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            GI  N  AF +F++PI TF+RII+ RSTE+FSG PY+   L+C++  WYG PFVSPNN++
Sbjct  18   GIAGNIFAFGLFVSPIPTFRRIIRNRSTEQFSGLPYIYAILNCLICLWYGTPFVSPNNVM  77

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            V T++ IG V +L+++++FIVFA K  K ++  LL++V+ +F  +   S+ + +   R  
Sbjct  78   VVTVNSIGAVFQLSYIILFIVFAEKKTKMRMLGLLLVVLSVFAVIVAGSLQIPNKLTRWF  137

Query  505  FCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFV  684
            F GF +      M+ SPL VI +V++TKS+EFMPF L+ S  L + ++ ++GL   D F+
Sbjct  138  FVGFLSCGSLVSMFASPLFVINLVIRTKSLEFMPFYLSLSTFLMSFSFSLYGLFNNDAFI  197

Query  685  YVPNAVGCGVGVLQLILYAIYSEKT  759
            +VPN +G  +GV+QL+LY  Y  K+
Sbjct  198  FVPNGIGTVLGVVQLVLYFHYHRKS  222



>gb|KDO49284.1| hypothetical protein CISIN_1g022823mg [Citrus sinensis]
Length=229

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 141/204 (69%), Gaps = 4/204 (2%)
 Frame = +1

Query  154  ANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTT  333
             N  AF +F++P+ TF+RII+  STEEFSG PYV   L+C++  WYG P VS +NILVTT
Sbjct  15   GNIFAFGLFVSPVPTFRRIIRNHSTEEFSGLPYVYALLNCLITMWYGTPLVSADNILVTT  74

Query  334  IDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCG  513
            ++ IG   +L ++++FI +  K++K ++  LL+ V+GIF  +  +S+ + +   RQ+F G
Sbjct  75   VNSIGAAFQLVYIILFITYTEKDKKVRMLGLLLAVIGIFSIIVAVSLQIVNPFSRQMFVG  134

Query  514  FAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVY  687
               L CAA+  M+ SPL +I +V++TKSVEFMPF L+ S  L +T++L +G++  DPF+Y
Sbjct  135  L--LSCAALISMFASPLFIINLVIQTKSVEFMPFYLSLSTFLMSTSFLAYGIMNWDPFIY  192

Query  688  VPNAVGCGVGVLQLILYAIYSEKT  759
            VPN +G  +G++QL LY  Y E +
Sbjct  193  VPNGIGTILGIVQLALYFNYKETS  216



>ref|XP_006467564.1| PREDICTED: bidirectional sugar transporter SWEET2a-like isoform 
X2 [Citrus sinensis]
Length=219

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 140/202 (69%), Gaps = 0/202 (0%)
 Frame = +1

Query  154  ANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTT  333
             N  AF +F++PI TF+RI++ +STE+FSG PY+ + L+C++  WYG+P VSP  ILV T
Sbjct  5    GNIFAFVLFVSPIPTFRRILRNKSTEQFSGLPYICSLLNCLITLWYGMPLVSPGIILVAT  64

Query  334  IDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQLFCG  513
            ++ +G V +L +V IFI +A K  K KI  LLI V  +F+A+   S+ VF    R+LF G
Sbjct  65   VNSVGAVFQLIYVSIFISYAEKAIKLKISGLLIAVFLVFLAIVFTSMEVFDSNGRRLFVG  124

Query  514  FAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFVYVP  693
            + ++     M+ SPL +I++V+KT+SVEFMPF L+ S  L + ++L +GL + DPF+YVP
Sbjct  125  YLSVASLISMFASPLFIIKLVIKTRSVEFMPFYLSLSNFLMSLSFLAYGLFKDDPFIYVP  184

Query  694  NAVGCGVGVLQLILYAIYSEKT  759
            N +G  +G+ Q++LY+ YS K+
Sbjct  185  NGIGTLLGIAQVMLYSYYSTKS  206



>ref|XP_011045549.1| PREDICTED: bidirectional sugar transporter SWEET2 [Populus euphratica]
 ref|XP_011045550.1| PREDICTED: bidirectional sugar transporter SWEET2 [Populus euphratica]
 ref|XP_011045551.1| PREDICTED: bidirectional sugar transporter SWEET2 [Populus euphratica]
 ref|XP_011045552.1| PREDICTED: bidirectional sugar transporter SWEET2 [Populus euphratica]
Length=235

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 144/208 (69%), Gaps = 0/208 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +F++PI T++RII+ RSTE+FSG PY+   ++C++  WYG+P VS +N
Sbjct  16   AAGIAGNIFAFGLFVSPIPTYRRIIRNRSTEQFSGLPYIYALMNCLICMWYGMPLVSADN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LV T++  GTV +LA++++FI++A +  K  +   L++V+G+F  + + S+ +    IR
Sbjct  76   LLVVTVNSFGTVFQLAYIILFIIYAERKIKVSMLASLLVVLGLFTIIVVGSLQIHDQMIR  135

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
             +  G   ++    M+ SPL +I +V++TKSVEFMPF L+ S  L +T++L++G+L  D 
Sbjct  136  WISVGSLTVVSLISMFASPLFIINLVIRTKSVEFMPFYLSLSTFLMSTSFLLYGVLNFDA  195

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKTI  762
            F+YVPN +G  +G++QL+LY  Y +K+I
Sbjct  196  FIYVPNGIGTILGIIQLMLYFHYKKKSI  223



>ref|XP_004488982.1| PREDICTED: bidirectional sugar transporter SWEET2-like isoform 
X1 [Cicer arietinum]
 ref|XP_004488983.1| PREDICTED: bidirectional sugar transporter SWEET2-like isoform 
X2 [Cicer arietinum]
Length=239

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 145/209 (69%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RII+  STE FSG PY+ + ++C++  WYG P +S +N
Sbjct  16   AAGVAGNIFAFGLFVSPIPTFRRIIRNGSTEMFSGLPYIYSLMNCLICMWYGTPLISHDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVTT++ IG + +  ++++F++ A K +K K+ V L+  +G+F  +   S+ +    +R
Sbjct  76   LLVTTVNSIGAIFQFVYIILFMMSAEKEKKVKMLVWLMATIGVFAIILFGSLQIDDIVMR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            +LF GF  L CA++  M+ SPL +I++V++TKSVEFMPF L+ S  L +T++L++GLL  
Sbjct  136  RLFVGF--LSCASLISMFASPLFIIKLVIQTKSVEFMPFYLSLSTFLMSTSFLLYGLLSN  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D FVYVPN +G  +GV+QLILY  Y  K+
Sbjct  194  DVFVYVPNGIGTILGVIQLILYCHYESKS  222



>ref|XP_008810888.1| PREDICTED: bidirectional sugar transporter SWEET1a isoform X2 
[Phoenix dactylifera]
Length=206

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 121/208 (58%), Gaps = 40/208 (19%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FGIF NATA F+FL+PI TF RIIK +STE+FSG PY +T L+C L AWYGLPFVSP
Sbjct  5    HFLFGIFGNATALFLFLSPIVTFWRIIKHKSTEDFSGIPYNMTLLNCFLSAWYGLPFVSP  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NN+LV+TI+G GTVIEL +VVIFIV+AP+  + K      +VV I   VA +S+   HG 
Sbjct  65   NNLLVSTINGAGTVIELVYVVIFIVYAPRKVRTKTLCFFAIVVAISAIVAFVSLLALHGH  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+LFCGFAA I + +MY SPL                                      
Sbjct  125  ARKLFCGFAASIFSVVMYGSPL--------------------------------------  146

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEK  756
              F+ V N  G  +G +QLILYAIY   
Sbjct  147  --FIMVQNGCGSALGAVQLILYAIYRNH  172



>gb|KDO83583.1| hypothetical protein CISIN_1g025686mg [Citrus sinensis]
Length=157

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
            H  FG+F NATA F+FLAP  TF+RI++++STE+FSG PYV+T L+C+L AWYGLPFVS 
Sbjct  5    HFLFGVFGNATALFLFLAPTITFRRIVRRKSTEQFSGIPYVMTLLNCLLSAWYGLPFVSK  64

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNILV+TI+G G+ IE+ +V+IF++FAPK EK KI  L +LV+ +F AVAL+S+  FHG 
Sbjct  65   NNILVSTINGTGSAIEIIYVLIFLLFAPKKEKAKIFGLFMLVLTVFAAVALVSLLAFHGN  124

Query  493  IRQLFCGFAALICAAIMYFSPLSVI  567
             R++FCGFAA I + IMY SPLS++
Sbjct  125  ARKIFCGFAATIFSIIMYASPLSIM  149



>ref|XP_006597983.1| PREDICTED: bidirectional sugar transporter SWEET2 isoform X1 
[Glycine max]
Length=239

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 146/209 (70%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RII+  STE FSG PY+ + L+CM+  WYG P +SP+N
Sbjct  20   AAGVAGNIFAFGLFVSPIPTFRRIIRNGSTEMFSGLPYIYSLLNCMICLWYGTPLISPDN  79

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVTT++ IG   +L ++++F+++A K  K ++  LL+ V+GIFV + + S+ +    +R
Sbjct  80   LLVTTVNSIGAAFQLVYIILFLMYAEKARKVRMVGLLLAVLGIFVIILVGSLQIDDSAMR  139

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            ++F GF  L CA++  M+ SPL +I++V++TKS+EFMPF L+ S  L + ++ ++GLL  
Sbjct  140  RMFVGF--LSCASLISMFASPLFIIKLVIRTKSIEFMPFYLSLSTFLMSFSFFLYGLLSD  197

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D F+YVPN +G  +G++QL+LY  Y   +
Sbjct  198  DAFIYVPNGIGTVLGIIQLVLYFYYKGSS  226



>ref|XP_010926192.1| PREDICTED: bidirectional sugar transporter SWEET2a-like isoform 
X1 [Elaeis guineensis]
Length=236

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 139/207 (67%), Gaps = 0/207 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RI++ RSTE+FSG PY+ + L+C++  WYGLP V+   
Sbjct  17   AAGVAGNLFAFVLFVSPIPTFQRIVRNRSTEQFSGLPYIYSLLNCLICFWYGLPCVAHGV  76

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILV T++ IG + +  +V +FIV+A K  K ++  LLI V  +F  +  +S+ +  GR R
Sbjct  77   ILVATVNSIGAIFQSVYVTLFIVYAEKPMKLRMSGLLIAVFCVFALIICVSLELLDGRTR  136

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            Q+F G+ ++     M+ SPL ++ +V++T+SVEFMPF L+ S  L + ++  +G+L+ D 
Sbjct  137  QMFVGYLSVASLISMFASPLCIMNLVIRTRSVEFMPFYLSLSTFLMSISFFAYGMLKHDY  196

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKT  759
            FVYVPN +G  +GV+QL LYA Y  K+
Sbjct  197  FVYVPNGIGTILGVIQLFLYAYYRRKS  223



>ref|XP_006597984.1| PREDICTED: bidirectional sugar transporter SWEET2 isoform X2 
[Glycine max]
 gb|KHN25844.1| Bidirectional sugar transporter SWEET2 [Glycine soja]
Length=235

 Score =   167 bits (424),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 146/209 (70%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RII+  STE FSG PY+ + L+CM+  WYG P +SP+N
Sbjct  16   AAGVAGNIFAFGLFVSPIPTFRRIIRNGSTEMFSGLPYIYSLLNCMICLWYGTPLISPDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVTT++ IG   +L ++++F+++A K  K ++  LL+ V+GIFV + + S+ +    +R
Sbjct  76   LLVTTVNSIGAAFQLVYIILFLMYAEKARKVRMVGLLLAVLGIFVIILVGSLQIDDSAMR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            ++F GF  L CA++  M+ SPL +I++V++TKS+EFMPF L+ S  L + ++ ++GLL  
Sbjct  136  RMFVGF--LSCASLISMFASPLFIIKLVIRTKSIEFMPFYLSLSTFLMSFSFFLYGLLSD  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D F+YVPN +G  +G++QL+LY  Y   +
Sbjct  194  DAFIYVPNGIGTVLGIIQLVLYFYYKGSS  222



>ref|XP_006356121.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Solanum 
tuberosum]
Length=237

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 140/207 (68%), Gaps = 0/207 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +F++PI TF+RII+ +STE+FSG PY+   L+C++  WYG P VSP  
Sbjct  19   AAGIAGNLFAFVLFVSPIPTFRRIIRNKSTEQFSGLPYIYALLNCLICLWYGTPIVSPGI  78

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILV T++ +G V +LA+++IFIV+A + +K K+  LL  V   F AV  +S+ +F    R
Sbjct  79   ILVFTVNSVGAVFQLAYILIFIVYAERTKKLKMLGLLFGVFTAFAAVFSISICLFQPPNR  138

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            Q F G+ ++I    M+ SPL +I +V++T+SVE+MPF L+ +  L + ++  +G+ +KDP
Sbjct  139  QTFVGYLSVISLISMFASPLFIINLVIRTRSVEYMPFYLSLATFLMSLSFFAYGMFKKDP  198

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKT  759
            F+YVPN +G  +G++QL+LY  YS   
Sbjct  199  FIYVPNGIGGVLGIIQLVLYWRYSRPN  225



>ref|XP_010052122.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Eucalyptus 
grandis]
 gb|KCW75990.1| hypothetical protein EUGRSUZ_D00354 [Eucalyptus grandis]
Length=235

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 138/205 (67%), Gaps = 0/205 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  A  +F++PI TF+RI++ +STE+FSG PY+ T L+ ++  WYGLP VSP  
Sbjct  16   AAGIAGNVFALVLFMSPILTFRRIVRNQSTEQFSGSPYIYTLLNSLICLWYGLPLVSPGV  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            I+V T++G+G V +  ++ IFIV+A K  K K+  L I V+ +F+ + ++S+  F    R
Sbjct  76   IMVATVNGVGVVFQAVYITIFIVYASKARKLKMLGLSISVLVLFLVMVIISLQFFDSHSR  135

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            Q+F G+ ++     M+ SPL +I++V+KT+SVE+MPF L+FS  L + ++L +GL + DP
Sbjct  136  QIFVGYLSVASLISMFASPLFIIKLVIKTRSVEYMPFYLSFSTFLTSLSFLAYGLFKADP  195

Query  679  FVYVPNAVGCGVGVLQLILYAIYSE  753
            F+Y PN +G  +G++QL LY  Y  
Sbjct  196  FIYFPNGIGTILGIIQLALYFYYKN  220



>gb|EMT31247.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=227

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 118/156 (76%), Gaps = 0/156 (0%)
 Frame = +1

Query  289  YGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavall  468
            YGLPFVSPNNILVTTI+G G+VIE  +VVIF++FA +  K ++  LL +V  IF  V L+
Sbjct  16   YGLPFVSPNNILVTTINGAGSVIEAIYVVIFLIFAERKAKIRMLGLLSVVTTIFATVVLV  75

Query  469  svfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAW  648
            S+   HG+ R +FCG AA + +  MY SPLS++R+V+KTKSVE+MPFLL+ S+ LC T+W
Sbjct  76   SLLALHGKARTVFCGLAATVFSICMYASPLSIMRLVIKTKSVEYMPFLLSLSVFLCGTSW  135

Query  649  LIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
             I+GLL  DPF+Y+PN  G  +G++QLILYAIY + 
Sbjct  136  FIYGLLGLDPFIYIPNGCGSFLGLMQLILYAIYRKN  171



>ref|XP_010273402.1| PREDICTED: bidirectional sugar transporter SWEET2 [Nelumbo nucifera]
Length=235

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 139/207 (67%), Gaps = 0/207 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RI++ +STE+FSG PY+   L+C++  WYG+P V+P  
Sbjct  16   AAGVAGNLFAFVLFVSPIPTFRRIVRNQSTEQFSGLPYIYALLNCLICLWYGMPIVTPGI  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILV T++ +G V +L ++ IFI +A K +K K+  LL+ V  +F  + L S+ +F    R
Sbjct  76   ILVATVNSVGAVFQLIYISIFITYAEKAKKAKMVGLLLAVFSLFAVIVLASMKLFDSSTR  135

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
             +F G+ ++     M+ SPL +I +V++TKSVEFMPF L+ S  L + ++  +G+L+ DP
Sbjct  136  PIFVGYLSVASLISMFASPLFIINLVIRTKSVEFMPFYLSLSTFLMSISFFAYGMLKCDP  195

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKT  759
            F+YVPN +G  +G +QLILY  YS+ +
Sbjct  196  FIYVPNGIGTILGAVQLILYCYYSKTS  222



>ref|XP_008363645.1| PREDICTED: bidirectional sugar transporter SWEET2-like [Malus 
domestica]
Length=235

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 140/209 (67%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +F++PI TF+RI++ R+TEEFSG PY+   L+C++  WYG P +SP+N
Sbjct  16   AAGIAGNIFAFGLFVSPIHTFRRIMRNRATEEFSGLPYIYALLNCLISMWYGSPIISPDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            I+V T++ +G V +L ++ +FI++A + +K ++  LL  V G+   +   S+ +    +R
Sbjct  76   IMVMTVNSVGAVFQLVYITLFIIYAERTKKMRMLGLLAAVCGLIAIIVYGSLQIPDAALR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            +L  G   L CA++  M+ SPL +I +V++TKSVEFMPF L+ S  L +T++L++G+   
Sbjct  136  RLVVGL--LSCASLISMFASPLFIINLVIRTKSVEFMPFYLSLSTFLMSTSFLLYGIFNF  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D FVYVPN VG  +G++QL LY  Y + +
Sbjct  194  DLFVYVPNGVGTILGIVQLALYFHYKDSS  222



>ref|XP_004234244.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Solanum 
lycopersicum]
Length=237

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 140/207 (68%), Gaps = 0/207 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +F++PI TF+RII+ +STE+FSG PY+   L+C++  WYG P VSP  
Sbjct  19   AAGIAGNLCAFVLFISPIPTFRRIIRNKSTEQFSGLPYIYALLNCLICLWYGTPIVSPGI  78

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILV T++ +G V +LA+++IFI++A + +K K+  LL  V   F AV  +S+ +F    R
Sbjct  79   ILVFTVNSVGAVFQLAYILIFIIYAERTKKLKMLGLLFGVFAAFAAVVSISICLFQPPNR  138

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            Q F G+ ++I    M+ SPL +I +V++T+SVE+MPF L+ +  L + ++  +G+ ++DP
Sbjct  139  QTFVGYLSVISLISMFASPLFIINLVIRTRSVEYMPFYLSLATFLMSLSFFAYGMFKQDP  198

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKT  759
            F+Y+PN +G  +G++QL+LY  YS   
Sbjct  199  FIYIPNGIGGVLGIIQLVLYWRYSRPN  225



>emb|CDX86834.1| BnaA09g22240D [Brassica napus]
Length=249

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/242 (40%), Positives = 140/242 (58%), Gaps = 3/242 (1%)
 Frame = +1

Query  127  TLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFV  306
            T+    GI  NA A  +FL+P  TF+RI+KK+S EE+S  PY+ T ++C++   YGLP V
Sbjct  7    TIRKIVGIIGNAIALCLFLSPTPTFRRIVKKKSVEEYSPIPYLATLINCLVWVLYGLPMV  66

Query  307  SPNNILVTTIDGIGTVIELAFVVIFIVFA--PKNEKKKigvllilvvgifvavallsvfv  480
             P++ LV TI+G G +IE+ F+ IF VF+  PK       VL    + + +   L+    
Sbjct  67   HPDSTLVVTINGAGILIEVVFITIFFVFSGRPKQRLVIAAVLAGETLFVAILSVLVFTLQ  126

Query  481  fHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFG  660
               R R +  G    +   +MY SPLSV+++V++TKSVEFMPF L+ +  L A  W ++ 
Sbjct  127  HTTRERTMSVGIVCCVFNVMMYASPLSVMKMVIRTKSVEFMPFWLSLAAFLNAGVWTVYA  186

Query  661  LLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEK-KQ  837
            L+  DPF+ +PN +GC  G+ QLILYA Y + T  M  +R    G+  +      EK  Q
Sbjct  187  LMPLDPFIAIPNGIGCIFGLAQLILYATYYKSTKKMMAERQPMIGLSSVVVRIGSEKVAQ  246

Query  838  PS  843
            PS
Sbjct  247  PS  248



>ref|XP_010915676.1| PREDICTED: bidirectional sugar transporter SWEET3b [Elaeis guineensis]
Length=249

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 141/217 (65%), Gaps = 3/217 (1%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            +  T+H+  GI  NA +  ++ API TF+R+I+KRSTEEFS  PY+I  L+C L  WYGL
Sbjct  1    MGDTIHVVVGIMGNAASLLLYAAPILTFQRVIRKRSTEEFSCIPYIIALLNCFLYTWYGL  60

Query  298  PFVSP--NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavalls  471
            P VS    N  V TI+G+G ++E +F+ I+  FA   +KK + ++++ V+ +F   AL+S
Sbjct  61   PVVSHGWENFPVVTINGLGILLETSFIFIYGWFAMPEQKKFVSLMVVPVIVLFTMTALVS  120

Query  472  vfvfHGRI-RQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAW  648
             FV H    R++F G   L+ +  MY +PL  ++ V+KTKSVEFMPF L+F   L ++ W
Sbjct  121  SFVLHDHHHRKVFAGSVGLVASMSMYCAPLVAVKQVIKTKSVEFMPFYLSFFTFLSSSLW  180

Query  649  LIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            L +GLL +D  +  PN +GC +G+LQL+LY +Y +  
Sbjct  181  LAYGLLGRDLLLAAPNLLGCPIGLLQLVLYGMYRKSD  217



>ref|XP_010644065.1| PREDICTED: bidirectional sugar transporter SWEET2 [Vitis vinifera]
 emb|CBI20104.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 140/209 (67%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RI + RSTE FSG PY+   L+C++  WYG P VS NN
Sbjct  16   AAGVAGNIFAFGLFVSPIPTFRRIARNRSTESFSGLPYIYALLNCLVTLWYGTPLVSYNN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            I+VTT++ +G   +L ++++FI +  K +K ++  LL++ + +F+ + + S+ +    IR
Sbjct  76   IMVTTVNSMGAAFQLVYIILFITYTDKRKKVRMFGLLMVDIVLFLVIVVGSLEISDFTIR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            ++  GF  L CAA+  M+ SPL VI +V++T+SVEFMPF L+ S  L + ++L +G+L  
Sbjct  136  RMVVGF--LSCAALISMFASPLFVINLVIQTRSVEFMPFYLSLSTFLMSASFLAYGILNN  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            DPFVYVPN  G  +G++QL LY+ Y   +
Sbjct  194  DPFVYVPNGAGTVLGIVQLGLYSYYKRTS  222



>ref|XP_010542326.1| PREDICTED: bidirectional sugar transporter SWEET2 [Tarenaya hassleriana]
Length=246

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/205 (41%), Positives = 135/205 (66%), Gaps = 0/205 (0%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            GI  N  AF +F++P+ TF+RII+ RSTE+FSG PY+   L+C++  WYG PFVSPNN++
Sbjct  28   GIAGNIFAFGLFVSPMPTFRRIIRNRSTEQFSGLPYIYALLNCLICLWYGTPFVSPNNVM  87

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            V T++ IG + +L++ ++F+++A K  K ++  LL+ V  +F  +   S+ +     R  
Sbjct  88   VVTVNSIGAIFQLSYSILFVIYAEKKNKMRMLGLLLAVFSVFAVIVAGSLQIPDKLTRWF  147

Query  505  FCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFV  684
            F GF +      M+ SPL VI +V++TKSVEFMPF L+ S  L + ++ ++GL   D F+
Sbjct  148  FVGFLSCGSLVSMFASPLFVINLVIRTKSVEFMPFYLSLSTFLMSVSFFLYGLFNNDAFI  207

Query  685  YVPNAVGCGVGVLQLILYAIYSEKT  759
            ++PN +G  +G++QL+LY  Y  K+
Sbjct  208  FMPNGIGTVLGIVQLVLYFHYHGKS  232



>gb|KDP35070.1| hypothetical protein JCGZ_11040 [Jatropha curcas]
Length=235

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 138/207 (67%), Gaps = 0/207 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  A  +FL+PI TFKRII+ RSTE+FS  PY+   L+C++ +WYG PF+S +N
Sbjct  16   AAGVAGNIFALGLFLSPISTFKRIIRNRSTEQFSVSPYIYALLNCLICSWYGSPFISTDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ++V T++  G V +L ++++FIV+A K  K  +  LL+ V  +F A  + S+ +  G IR
Sbjct  76   VMVMTVNSTGAVFQLVYIILFIVYAEKAIKVTVFGLLLAVFVLFAATVVGSLQIADGNIR  135

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            +L  G  + +    M+ SPL +I +V++TKSV+FMPF L+ S  L +T++L++G+L  D 
Sbjct  136  RLSIGLLSGVSLISMFASPLFIINLVIRTKSVQFMPFYLSLSTFLMSTSFLLYGILNYDA  195

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKT  759
            F+YVPN +G  +G+ QL+LY  Y  ++
Sbjct  196  FIYVPNGIGSILGITQLVLYCHYKGQS  222



>ref|XP_004244297.1| PREDICTED: bidirectional sugar transporter SWEET2 [Solanum lycopersicum]
 ref|XP_010324406.1| PREDICTED: bidirectional sugar transporter SWEET2 [Solanum lycopersicum]
Length=235

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 146/209 (70%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +FL+P+ TF RI++ +STE+FSG PY+   L+C++ AWYG P VSP+N
Sbjct  16   AAGIAGNIFAFGLFLSPMPTFMRIMRNQSTEQFSGLPYIYGLLNCLICAWYGTPLVSPDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVT+++ +G V +LA++V+++ +  K +K ++   ++ V G+FV + L S+F+    +R
Sbjct  76   LLVTSVNSVGAVFQLAYIVLYVTYTEKEKKFRMFGWILTVFGLFVIIVLGSLFILDLELR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            ++  G  +L CA++  M+ SPL +I +V++T+SVEFMPF L+ S  L + ++L++G+   
Sbjct  136  RIIIG--SLSCASLISMFASPLLIINLVIRTRSVEFMPFCLSLSTFLMSASFLLYGIFSS  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            DPF+YVPN +G  +GV QL+L+A Y   +
Sbjct  194  DPFIYVPNGIGTLLGVTQLLLFAHYRNSS  222



>ref|XP_003540515.1| PREDICTED: bidirectional sugar transporter SWEET2 isoform X1 
[Glycine max]
 gb|KHN19476.1| Bidirectional sugar transporter SWEET2 [Glycine soja]
Length=235

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 145/209 (69%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RII+  STE FSG PY+ + L+C++  WYG P +S +N
Sbjct  16   AAGVAGNVFAFGLFVSPIPTFRRIIRNGSTEMFSGLPYIYSLLNCLICMWYGTPLISADN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVTT++ IG V +  + +IF+++A K +K ++  LL+ V+G+F  V + S+ +    +R
Sbjct  76   LLVTTVNSIGAVFQFVYTIIFLMYAEKAKKVRMVGLLLAVLGMFAIVLVGSLQIDDVIMR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            + F GF  L CA++  M+ SPL +I++V++TKSVEFMPF L+ S  L +T++L++GL   
Sbjct  136  RFFVGF--LSCASLISMFASPLFIIKLVIQTKSVEFMPFYLSLSTFLMSTSFLLYGLFND  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D F+YVPN +G  +G++QLILY  +  K+
Sbjct  194  DAFIYVPNGIGTILGMIQLILYFYFESKS  222



>ref|NP_001146103.1| hypothetical protein [Zea mays]
 gb|ACL53236.1| unknown [Zea mays]
 gb|ACN25376.1| unknown [Zea mays]
 gb|ACR34022.1| unknown [Zea mays]
 gb|ACR37740.1| unknown [Zea mays]
 gb|ACR38273.1| unknown [Zea mays]
 gb|AFW80873.1| hypothetical protein ZEAMMB73_876910 [Zea mays]
Length=243

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 137/199 (69%), Gaps = 0/199 (0%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            GI  NA AF +F++P+ TFKRI++  STE+FS  PY+ + L+C++  WYGLPFVS   +L
Sbjct  26   GIAGNAFAFVLFVSPLPTFKRIVRNGSTEQFSCTPYIYSLLNCLICMWYGLPFVSYGVVL  85

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            V T++ IG V +LA+  +FI FA   ++ K+  LL  V  +F  +  +S+ +   + RQ+
Sbjct  86   VATVNSIGAVFQLAYTAVFIAFADAKQRLKVSALLAAVFLVFGLIVFVSLALLDHKARQV  145

Query  505  FCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFV  684
            F G+ ++     M+ SP+S++ +V++TKSVE+MPF L+ SM L + +++I+G+L  D F+
Sbjct  146  FVGYLSVASLVCMFASPMSIVNLVIRTKSVEYMPFYLSLSMFLMSASFVIYGVLLGDGFI  205

Query  685  YVPNAVGCGVGVLQLILYA  741
            Y+PN +G  +G++QL+LYA
Sbjct  206  YIPNGIGTILGIVQLLLYA  224



>ref|XP_011082807.1| PREDICTED: bidirectional sugar transporter SWEET2 [Sesamum indicum]
Length=235

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 146/209 (70%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +FL+P+ TF+RII+  STE+FSG PY+   L+C++ AWYGLP +S +N
Sbjct  16   AAGIAGNIFAFGLFLSPVPTFRRIIRNESTEQFSGLPYIYALLNCLITAWYGLPMISSDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVTT++ +G V ++ ++++FI +A K ++ ++  LL++V G+F  +A+ S+ +     R
Sbjct  76   LLVTTVNSVGAVFQMVYIIMFIRYAEKAKRLRMLGLLLMVFGLFAVIAIGSLLIVDFEAR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             L  GF +  CA++  M+ SPL +I +V++T+SVE+MPF L+ S  L +T++L++G+   
Sbjct  136  HLTIGFIS--CASLISMFASPLFIINLVIRTRSVEYMPFHLSLSTFLMSTSFLLYGIFNF  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            DPFVYVPN +G  +G++QL LY+ Y   +
Sbjct  194  DPFVYVPNGIGTLLGIIQLFLYSYYKRSS  222



>ref|XP_010261514.1| PREDICTED: bidirectional sugar transporter SWEET3-like [Nelumbo 
nucifera]
 ref|XP_010261515.1| PREDICTED: bidirectional sugar transporter SWEET3-like [Nelumbo 
nucifera]
Length=250

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 151/252 (60%), Gaps = 6/252 (2%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            +  TL LA G+  NA +  ++ API TFKR+I+KRSTEEFS  PY+I  L+C+L  WYGL
Sbjct  1    MGDTLRLAVGVMGNAASLLLYAAPILTFKRVIRKRSTEEFSCIPYIIALLNCLLYTWYGL  60

Query  298  PFVSP--NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavalls  471
            P VS    N  V TI+G+G ++E +F++I+  FA    KK I ++ + ++ +F A+AL+S
Sbjct  61   PVVSHRWENFPVVTINGVGILLESSFIIIYFWFASARGKKTICLMEVPMIMMFCAIALVS  120

Query  472  vfvfHG-RIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAW  648
             F  H    R++  G   L+ +  MY SPL  ++ V++TKSVEFMPF L+    L ++ W
Sbjct  121  TFALHDHHHRKVVVGSIGLVVSVAMYGSPLVAVKKVIQTKSVEFMPFYLSLFSFLASSLW  180

Query  649  LIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHE  828
            + +GLL  D F+  PN +G  +G LQL+LY IY ++ I +          L+ N+     
Sbjct  181  MAYGLLSHDLFLASPNLLGSPLGALQLLLYCIYRKRKINVEEPSKID---LEKNSGKSKP  237

Query  829  KKQPSITSSKYD  864
             ++P I  +  +
Sbjct  238  HQEPMINGTNVE  249



>ref|XP_006593345.1| PREDICTED: uncharacterized protein LOC100305842 isoform X1 [Glycine 
max]
 ref|XP_006593346.1| PREDICTED: uncharacterized protein LOC100305842 isoform X2 [Glycine 
max]
Length=235

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 145/209 (69%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RII+  STE FSG PY+ + L+C++  WYG P +S +N
Sbjct  16   AAGVAGNVFAFGLFVSPIPTFRRIIRNGSTEMFSGLPYIYSLLNCLICMWYGTPLISADN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVTT++ IG V +  +++IF+++A K +K ++  L + V+GIF  + + S+ +    +R
Sbjct  76   LLVTTVNSIGAVFQFVYIIIFLMYAEKAKKVRMIGLSLAVLGIFAIILVGSLQIDDIIMR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            + F GF  L CA++  M+ SPL +I++V++TKSVEFMPF L+ S  L +T++L++GL   
Sbjct  136  RFFVGF--LSCASLISMFASPLFIIKLVIQTKSVEFMPFYLSLSTFLMSTSFLLYGLFND  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D F+YVPN +G  +G++QLILY  +  K+
Sbjct  194  DAFIYVPNGIGTILGLIQLILYFYFEGKS  222



>gb|EYU28153.1| hypothetical protein MIMGU_mgv1a012941mg [Erythranthe guttata]
Length=235

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 145/218 (67%), Gaps = 3/218 (1%)
 Frame = +1

Query  115  GLARTLHL---AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGA  285
            GL  T  L   A G   N  AF +F++PI TF+RI++ +STE+FSG PY+   L+C++  
Sbjct  5    GLFSTYSLCSDAAGFAGNLFAFVLFVSPIPTFRRIVRNKSTEQFSGSPYIYGLLNCLICL  64

Query  286  WYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvaval  465
            WYGLP V    I V T++ +G V +L +++IF+++A K+++ K+  L++ V  +F  +  
Sbjct  65   WYGLPIVCSGIIFVATVNSVGAVFQLVYIIIFVIYADKDKRLKMLGLVLAVFSVFAVIVF  124

Query  466  lsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATA  645
            +S+ VF    RQLF G+ ++     M+ SPL +I +V+KTKSVE+MPF L+ + +L + +
Sbjct  125  VSIRVFEPPNRQLFVGYLSVFSLISMFASPLFIINLVIKTKSVEYMPFYLSLATLLMSIS  184

Query  646  WLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            +  +G+L+KDPF+YVPN +G  +G++QL+LY  YS  +
Sbjct  185  FFAYGMLKKDPFIYVPNGIGAILGIVQLVLYFNYSRNS  222



>gb|EPS71278.1| hypothetical protein M569_03483, partial [Genlisea aurea]
Length=226

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 144/213 (68%), Gaps = 4/213 (2%)
 Frame = +1

Query  127  TLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFV  306
            T   A G+  N  AF +FL+P  TF+RII+  STE+FSG PY+   L+C++ AWYGLP +
Sbjct  6    TCRDAAGVAGNIFAFGLFLSPTPTFRRIIRNESTEQFSGSPYIYALLNCLITAWYGLPII  65

Query  307  SPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfH  486
            S +N++VTT++ IG + +L ++ IFI +A +++K K+  L+ +V  +F  ++  S+ +  
Sbjct  66   SDHNLMVTTVNSIGALFQLVYLAIFINYADRSKKLKMLGLVFMVFVLFGIISFGSLSMSD  125

Query  487  GRIRQLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFG  660
              +R L  GF +  CA++  M+ SPL +I +V++T+SVEFMPF L+ S  L + ++L++G
Sbjct  126  FGVRHLTVGFIS--CASLISMFASPLFIINLVIRTRSVEFMPFYLSLSTFLMSISFLLYG  183

Query  661  LLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            +   DPFVYVPN +G  +G +QL+L+A Y + +
Sbjct  184  VFNGDPFVYVPNGIGTILGTIQLLLFAYYRKPS  216



>ref|XP_007022013.1| Nodulin MtN3 family protein isoform 2 [Theobroma cacao]
 gb|EOY13538.1| Nodulin MtN3 family protein isoform 2 [Theobroma cacao]
Length=235

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 139/210 (66%), Gaps = 4/210 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +F++PI TF+RII+ +STE+FSG PYV   L+CM+  WYG P +S NN
Sbjct  16   AAGIAGNIFAFGLFVSPIPTFRRIIRNQSTEQFSGLPYVYALLNCMICTWYGTPLISHNN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            + V T++ IG V +LA++++FIV+A K +K ++  LL+ V G+   +   S+ +     R
Sbjct  76   VPVMTVNSIGAVFQLAYIILFIVYADKEKKMRMLGLLLGVFGLLAIIVAGSMQIVDREAR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             +F G   L C ++  M+ SPL +I +V++TKSVE+MPF L+ S  L +T++ ++G+   
Sbjct  136  WIFVGL--LSCGSLISMFASPLFIINLVIQTKSVEYMPFYLSLSTFLMSTSFFLYGIFNF  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTI  762
            D F+YVPN +G  +G++QL LY  Y  K++
Sbjct  194  DAFIYVPNGIGTILGIVQLALYFYYKRKSV  223



>sp|Q5NAZ9.2|SWT3B_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET3b; Short=OsSWEET3b 
[Oryza sativa Japonica Group]
Length=252

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 140/216 (65%), Gaps = 3/216 (1%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            ++ T+ +A GI  NA +  ++ API TF+R+IKK S EEFS  PY++   +C+L  WYGL
Sbjct  2    VSNTIRVAVGILGNAASMLLYAAPILTFRRVIKKGSVEEFSCVPYILALFNCLLYTWYGL  61

Query  298  PFVSP--NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavalls  471
            P VS    N  V++I+G+G ++E+AF+ I+  FAP+  KK +  +++ V+  F   A+ S
Sbjct  62   PVVSSGWENSTVSSINGLGILLEIAFISIYTWFAPRERKKFVLRMVLPVLAFFALTAIFS  121

Query  472  vfvfHGR-IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAW  648
             F+FH   +R++F G   L+ +  MY SP+   + V+ TKSVEFMPF L+    L +  W
Sbjct  122  SFLFHTHGLRKVFVGSIGLVASISMYSSPMVAAKQVITTKSVEFMPFYLSLFSFLSSALW  181

Query  649  LIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            +I+GLL KD F+  PN +GC +G+LQL+LY IY + 
Sbjct  182  MIYGLLGKDLFIASPNFIGCPMGILQLVLYCIYRKS  217



>ref|XP_009108217.1| PREDICTED: bidirectional sugar transporter SWEET7-like [Brassica 
rapa]
Length=249

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 140/242 (58%), Gaps = 3/242 (1%)
 Frame = +1

Query  127  TLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFV  306
            T+    GI  NA A  +FL+P  TF+RI+KK+S EE+S  PY+ T ++C++   YGLP V
Sbjct  7    TIRKIVGIIGNAIALCLFLSPTPTFRRIVKKKSVEEYSPIPYLATLINCLVWVLYGLPMV  66

Query  307  SPNNILVTTIDGIGTVIELAFVVIFIVFA--PKNEKKKigvllilvvgifvavallsvfv  480
             P++ LV TI+G G +IE+ F+ IF VF+  PK       VL    + + +   L+    
Sbjct  67   HPDSTLVVTINGAGILIEVVFITIFFVFSGRPKQRLVIAAVLAGETLFVAILSVLVFTLQ  126

Query  481  fHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFG  660
               + R +  G    +   +MY SPLSV+++V++TKSVEFMPF L+ +  L A  W ++ 
Sbjct  127  HTTKERTMSVGIVCCVFNVMMYASPLSVMKMVIRTKSVEFMPFWLSLAAFLNAGVWTVYA  186

Query  661  LLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEK-KQ  837
            L+  DPF+ +PN +GC  G+ QLILYA Y + T  M  +R    G+  +      EK  Q
Sbjct  187  LMPLDPFIAIPNGIGCIFGLAQLILYATYYKSTKKMMAERQPMIGLSSVVVRIGSEKVAQ  246

Query  838  PS  843
            PS
Sbjct  247  PS  248



>ref|XP_003638394.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
Length=236

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 144/209 (69%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RII+  STE FSG PY+ + ++C++  WYG P +S +N
Sbjct  16   AAGVAGNIFAFGLFVSPIPTFRRIIRNGSTEMFSGLPYIYSLMNCLICMWYGTPLISHDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILVTT++ IG V +  ++++F++ A K +K K+   L+ V+GIF  + + S+ +    +R
Sbjct  76   ILVTTVNSIGAVFQFVYIILFMMSAEKEKKVKMLAWLMGVLGIFAIILIGSLQIDDIVMR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            +LF G   L CA++  M+ SPL +I++V++TKSVEFMPF L+ S  L +T++L++GLL  
Sbjct  136  RLFVGI--LSCASLISMFASPLFIIKLVIQTKSVEFMPFYLSLSTFLMSTSFLVYGLLSD  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D F+YVPN +G  +G+ QLILY  Y  K+
Sbjct  194  DIFIYVPNGIGTILGMTQLILYFYYESKS  222



>gb|AFK41273.1| unknown [Medicago truncatula]
Length=236

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 144/209 (69%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RII+  STE FSG PY+ + ++C++  WYG P +S +N
Sbjct  16   AAGVAGNIFAFGLFVSPIPTFRRIIRNGSTEMFSGLPYIYSLMNCLICMWYGTPLISHDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILVTT++ IG V +  ++++F++ A K +K K+   L+ V+GIF  + + S+ +    +R
Sbjct  76   ILVTTVNSIGAVFQFVYIILFMMSAEKEKKVKMLAWLMGVLGIFAIILIGSLQIDDIVMR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            +LF G   L CA++  M+ SPL +I++V++TKSVEFMPF L+ S  L +T++L++GLL  
Sbjct  136  RLFVGI--LSCASLISMFASPLFIIKLVIQTKSVEFMPFYLSLSTFLMSTSFLVYGLLSD  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D F+YVPN +G  +G+ QLILY  Y  K+
Sbjct  194  DIFIYVPNEIGTILGMTQLILYFYYESKS  222



>emb|CDP06059.1| unnamed protein product [Coffea canephora]
Length=235

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 141/209 (67%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G   N  AF +F++PI TF+RII+ ++TE+FSG PY+   L+C++ AWYG P +S +N
Sbjct  16   AAGGAGNIFAFGLFVSPIPTFQRIIRNKTTEQFSGLPYIYALLNCLICAWYGSPLISLDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILVTT++ +G V +  ++V+FI +A K +K ++  LL+ V   F  + L S+ +    +R
Sbjct  76   ILVTTVNSVGAVFQAVYIVLFIAYAEKAKKLRMLGLLLAVCSAFAVIVLCSLLIVDFEVR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            ++  GF  L CA++  M+ SPL VI +V++T+SVEFMPF L+ S  L +T++ ++G+   
Sbjct  136  RIAIGF--LSCASLISMFASPLFVINLVIRTRSVEFMPFYLSLSTFLMSTSFFLYGIFNF  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            DPFVYVPN +G  +G +QL+LYA Y   +
Sbjct  194  DPFVYVPNGIGAFLGTVQLVLYAYYKSAS  222



>gb|AFK48838.1| unknown [Lotus japonicus]
Length=235

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 144/209 (69%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +FL+PI TF+RI +  STE FSG PY+ + ++C +  WYG P VS +N
Sbjct  16   AAGIAGNIFAFGLFLSPIPTFRRITRNGSTEMFSGLPYIYSLMNCFICLWYGTPLVSRDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVTT++ IG V +  ++++F+++A K +K ++  LL+ V+GIF  + + S+ +    +R
Sbjct  76   LLVTTVNSIGAVFQSVYIILFLMYAEKEKKVRLLGLLLAVLGIFAIILIGSLQIPDIEMR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            + F GF  L CA++  M+ SPL +I++V++TKS+EFMPF L+ S  L +T++L++GL   
Sbjct  136  RDFVGF--LSCASLISMFASPLFIIKLVIQTKSIEFMPFYLSLSTFLMSTSFLLYGLFND  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D F+YVPN +G  +GV+QLILY  Y  K+
Sbjct  194  DAFIYVPNGIGTILGVVQLILYFYYESKS  222



>ref|NP_001237496.1| uncharacterized protein LOC100305842 [Glycine max]
 gb|ACU13719.1| unknown [Glycine max]
Length=235

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 144/209 (69%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RII+  STE FSG PY+ + L+C++  WYG P +S +N
Sbjct  16   AAGVAGNVFAFGLFVSPIPTFRRIIRNGSTEMFSGLPYIYSLLNCLICMWYGTPLISADN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVTT++ IG V +  ++ IF+++A K +K ++  L + V+GIF  + + S+ +    +R
Sbjct  76   LLVTTVNSIGAVFQFVYITIFLMYAEKAKKVRMIGLSLAVLGIFAIILVGSLQIDDIIMR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            + F GF  L CA++  M+ SPL +I++V++TKSVEFMPF L+ S  L +T++L++GL   
Sbjct  136  RFFVGF--LSCASLISMFASPLFIIKLVIQTKSVEFMPFYLSLSTFLMSTSFLLYGLFND  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D F+YVPN +G  +G++QLILY  +  K+
Sbjct  194  DAFIYVPNGIGTILGLIQLILYFYFEGKS  222



>ref|XP_009376722.1| PREDICTED: bidirectional sugar transporter SWEET2-like [Pyrus 
x bretschneideri]
Length=235

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 139/209 (67%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++P  TF+RII+  +TEEFSG PY+   L+C++  WYG P VS +N
Sbjct  16   AAGVAGNIFAFGLFVSPAHTFRRIIRNHATEEFSGLPYIYALLNCLICTWYGSPVVSSDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILV T++ +G V +L ++ +FI++A K +K ++  LL +V G+   + L S+ +     R
Sbjct  76   ILVMTVNSVGAVFQLVYITLFIIYAEKTKKVRMLGLLAVVCGLIAIIVLGSLQITDAATR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            +L  G   L CA++  M+ SPL +I +V++T+SVEFMPF L+ S  L +T++L++G+   
Sbjct  136  RLVVGL--LSCASLISMFASPLFIINLVIQTQSVEFMPFYLSLSTFLMSTSFLLYGIFNF  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            DPFVYVPN VG  +G++QL LY  Y + +
Sbjct  194  DPFVYVPNGVGTILGIVQLALYFYYKDSS  222



>ref|XP_006377713.1| hypothetical protein POPTR_0011s10470g [Populus trichocarpa]
 gb|ERP55510.1| hypothetical protein POPTR_0011s10470g [Populus trichocarpa]
Length=235

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 140/207 (68%), Gaps = 0/207 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +F++PI T++RII+ RSTE+FSG PY+   ++C++  WYG P VS +N
Sbjct  16   AAGIAGNIFAFGLFVSPIPTYRRIIRNRSTEQFSGLPYIYALMNCLICMWYGTPLVSADN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +L+ T++  G V +LA++++F ++A +  K +    L++V+G+F  +A+ S+ +    IR
Sbjct  76   LLLVTVNSFGAVFQLAYIILFTIYAERRIKVRTLASLLVVLGLFAIIAVGSLQITDRMIR  135

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
             L  G   ++    M+ SPL +I +V++TKSVEFMPF L+ S  L +T+++++GLL  D 
Sbjct  136  WLSVGSLTVVSLISMFASPLFIINLVIRTKSVEFMPFYLSLSTFLMSTSFMLYGLLNFDA  195

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKT  759
            FVYVPN +G  +G++QL LY  Y +K+
Sbjct  196  FVYVPNGIGAILGIIQLALYVHYKKKS  222



>ref|XP_007133301.1| hypothetical protein PHAVU_011G168100g [Phaseolus vulgaris]
 gb|ESW05295.1| hypothetical protein PHAVU_011G168100g [Phaseolus vulgaris]
Length=235

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 142/205 (69%), Gaps = 4/205 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +FL+PI TF+RII+  STE FSG PYV + L+C++  WYG P +SP+N
Sbjct  16   AAGVAGNIFAFGLFLSPIPTFRRIIRNGSTEMFSGLPYVYSLLNCLICLWYGTPLISPHN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVTT++ IG   +L ++++F+++A K  K ++  LL+ V+GIFV +   S+ +    +R
Sbjct  76   LLVTTVNTIGAAFQLVYIILFLIYAEKARKVRMLGLLLAVLGIFVIILAGSLQIDDSAMR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            ++F GF  L CA++  M+ SPL +I++V++TKSVEFMPF L+ S  L + ++ ++G L  
Sbjct  136  RMFVGF--LSCASLISMFASPLFIIKLVIRTKSVEFMPFYLSLSTFLMSISFFLYGFLSH  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIY  747
            D F+ VPN +G  +G++QLILY  Y
Sbjct  194  DAFISVPNGIGTVLGIVQLILYFYY  218



>ref|XP_007022012.1| Nodulin MtN3 family protein isoform 1 [Theobroma cacao]
 gb|EOY13537.1| Nodulin MtN3 family protein isoform 1 [Theobroma cacao]
Length=287

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 139/210 (66%), Gaps = 4/210 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +F++PI TF+RII+ +STE+FSG PYV   L+CM+  WYG P +S NN
Sbjct  16   AAGIAGNIFAFGLFVSPIPTFRRIIRNQSTEQFSGLPYVYALLNCMICTWYGTPLISHNN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            + V T++ IG V +LA++++FIV+A K +K ++  LL+ V G+   +   S+ +     R
Sbjct  76   VPVMTVNSIGAVFQLAYIILFIVYADKEKKMRMLGLLLGVFGLLAIIVAGSMQIVDREAR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             +F G   L C ++  M+ SPL +I +V++TKSVE+MPF L+ S  L +T++ ++G+   
Sbjct  136  WIFVGL--LSCGSLISMFASPLFIINLVIQTKSVEYMPFYLSLSTFLMSTSFFLYGIFNF  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTI  762
            D F+YVPN +G  +G++QL LY  Y  K++
Sbjct  194  DAFIYVPNGIGTILGIVQLALYFYYKRKSV  223



>ref|XP_011096465.1| PREDICTED: bidirectional sugar transporter SWEET2-like isoform 
X5 [Sesamum indicum]
Length=237

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 140/208 (67%), Gaps = 0/208 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RII+ +STE+FSG PY+   L+C++  WYG+P VS   
Sbjct  18   AAGVAGNLLAFVLFVSPIPTFRRIIRSQSTEQFSGLPYIYALLNCLICLWYGMPIVSSGI  77

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            IL+ T++ +G V +L +++IFI++A K  K K+  LL+ V  +F  V  +S+ VF    R
Sbjct  78   ILIATVNSVGAVFQLVYIIIFIIYADKERKVKMLGLLLAVFSVFAVVVFVSIRVFEPPQR  137

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            QLF G+ ++     M+ SPL +I +V++TKSVE+MPF L+ +  L + ++  +G+L+KD 
Sbjct  138  QLFVGYLSVFSLISMFASPLFIINLVIRTKSVEYMPFYLSLATFLMSLSFFAYGMLKKDG  197

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKTI  762
            F+ VPN +G  +G++QL+LY  YS  ++
Sbjct  198  FISVPNGIGAILGIIQLVLYFWYSRSSV  225



>ref|XP_004968893.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Setaria 
italica]
Length=243

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 135/205 (66%), Gaps = 0/205 (0%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            GI  N  AF +F++P+ TF+RI++  STE+FS  PY+ + L+C++  WYGLPFVS   +L
Sbjct  26   GIAGNVFAFVLFISPLPTFRRIVRNGSTEQFSAMPYIYSLLNCLICMWYGLPFVSYGVVL  85

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            V T++ IG   +LA+  +FI FA   E+ K+  LL  V  +F  +  +S+ +     RQ 
Sbjct  86   VVTVNSIGAAFQLAYTAVFIAFANAKERLKVSGLLAAVFVVFGMIMYVSLALLDHNTRQT  145

Query  505  FCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFV  684
            F G+ ++     M+ SPLS+I +V++TKSVE+MPF L+ SM L + ++ ++G+L  D F+
Sbjct  146  FVGYLSVASLIFMFASPLSIINLVIRTKSVEYMPFYLSLSMFLMSVSFFVYGVLLHDFFI  205

Query  685  YVPNAVGCGVGVLQLILYAIYSEKT  759
            Y+PN +G  +G++QL+LYA + + +
Sbjct  206  YIPNGIGTILGIIQLLLYAYFRKGS  230



>ref|XP_008226346.1| PREDICTED: bidirectional sugar transporter SWEET2 [Prunus mume]
Length=235

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/220 (39%), Positives = 138/220 (63%), Gaps = 0/220 (0%)
 Frame = +1

Query  100  FREMHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCML  279
            F   H +      A GI  N  AF +FL+PI T++RII+ RSTEEFSG PY+   L+C++
Sbjct  3    FSASHSVFIICRDAAGIAGNIFAFGLFLSPIHTYRRIIRNRSTEEFSGLPYIYALLNCLI  62

Query  280  GAWYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvav  459
              WYG P VS +N+L+ T++  G V +L ++ +FI++A K++K ++   L+   G+F  +
Sbjct  63   CTWYGSPLVSSDNLLIMTVNSAGAVFQLVYIALFIIYAEKSKKVRMLGFLLADFGLFAII  122

Query  460  allsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCA  639
               S+ +    +RQL  G  + +    M+ SP+ +I +V++TKSVEFMPF L+ S  L +
Sbjct  123  VFGSLQMTDLVMRQLIVGLLSCVSLISMFASPMFIINLVIRTKSVEFMPFYLSLSTFLMS  182

Query  640  TAWLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            T++ ++G+   D F+YVPN +G  +G++QL LY  Y + +
Sbjct  183  TSFFLYGIFNYDLFIYVPNGIGTILGIVQLALYFYYKDSS  222



>ref|XP_009382941.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 119/157 (76%), Gaps = 5/157 (3%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FGIF NATA F+FL+P+ TF+RII+KRSTE+FSG PY +T L+C+L AWYGLPFVSPNN+
Sbjct  8    FGIFGNATALFLFLSPLVTFQRIIRKRSTEDFSGVPYTMTLLNCLLSAWYGLPFVSPNNL  67

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQ  501
            LV+TI+G G+VIE  +V+IF+VFAPK E+ ++  L   V+ +F  +AL+S+    G+ R+
Sbjct  68   LVSTINGAGSVIEAVYVLIFLVFAPKKERARVAALFTFVLSVFAVIALVSLLALRGQRRK  127

Query  502  LFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFL  612
            +FCGFAA I +  MY SPLS++      +S++ +P L
Sbjct  128  IFCGFAAAIFSICMYASPLSIM-----VRSLDHLPLL  159



>ref|XP_009772066.1| PREDICTED: bidirectional sugar transporter SWEET2-like isoform 
X1 [Nicotiana sylvestris]
Length=235

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 144/209 (69%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +FL+PI TF+RI++ +STE+FSG PY+   L+C++ AWYG P VSP+N
Sbjct  16   AAGIAGNIFAFGLFLSPIPTFRRIMRNQSTEQFSGLPYIYGLLNCLICAWYGTPLVSPDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVTT++ +G V +LA++V+F++   K +K ++   ++ V G+F  + + S+ +   ++R
Sbjct  76   LLVTTVNSVGAVFQLAYIVLFVMHTEKEKKFRMLGCILTVFGLFAIIVIGSLLILDLQLR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            ++  G  +L CA++  M+ SPL +I +V++T+SVEFMPF L+ S  L + ++ ++G    
Sbjct  136  RIIIG--SLSCASLISMFASPLFIINLVIRTRSVEFMPFYLSLSTFLMSASFFLYGTFSF  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D F+YVPN +G  +GV+QL+L+A Y   +
Sbjct  194  DLFIYVPNGIGTLLGVVQLLLFAYYKNSS  222



>ref|XP_006348336.1| PREDICTED: bidirectional sugar transporter SWEET2-like [Solanum 
tuberosum]
Length=235

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 146/209 (70%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +FL+P+ TF RI++ +STE+FSG PY+   L+C++ AWYG P VSP+N
Sbjct  16   AAGMAGNIFAFGLFLSPMPTFMRIMRNQSTEQFSGLPYIYGLLNCLICAWYGTPLVSPDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVT+++ +G V +LA++V+++++  K +K ++   ++ V G+F  + + S+F+    +R
Sbjct  76   LLVTSVNSVGAVFQLAYIVLYVMYTEKEKKFRMFGWILTVFGLFAIIVIGSLFILDLELR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            ++  G   L CA++  M+ SPL +I +V++T+SVEFMPF L+ S  L + ++L++G+   
Sbjct  136  RVIIG--TLSCASLISMFASPLLIINLVIRTRSVEFMPFFLSLSSFLMSASFLLYGIFSF  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            DPF+YVPN +G  +GV+QL+L+A Y   +
Sbjct  194  DPFIYVPNGIGTLLGVVQLLLFAHYRNSS  222



>gb|KHG18550.1| Bidirectional sugar transporter SWEET2 -like protein [Gossypium 
arboreum]
Length=235

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 139/210 (66%), Gaps = 4/210 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  A  +F++PI TFKRII+ +STE FSG PY+   L+C++  WYG P VS +N
Sbjct  16   AAGIAGNIFALGLFISPIPTFKRIIRNQSTENFSGLPYIYALLNCLICTWYGTPLVSHDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            + V T++ IG V ++ ++V FIV+A K +K ++  +L+ V G+   +   S+ +     R
Sbjct  76   VPVMTVNSIGAVFQITYIVTFIVYADKEKKMRMLGMLLTVFGLLAIIVAGSLQIADRATR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             +F GF  L CA++  M+ SPL +I +V++T+SVEFMPF L+ S  L +T++L++G+   
Sbjct  136  WIFVGF--LSCASLISMFASPLFIINLVIRTRSVEFMPFYLSLSTFLMSTSFLLYGIFNF  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTI  762
            D F+YVPN +G  +G+LQL LY  Y +K++
Sbjct  194  DAFIYVPNGIGTILGILQLALYFRYQKKSM  223



>ref|XP_009630052.1| PREDICTED: bidirectional sugar transporter SWEET2-like isoform 
X1 [Nicotiana tomentosiformis]
Length=235

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 147/216 (68%), Gaps = 4/216 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +FL+PI TF+RI++ +STE+FSG PY+   L+C++ AWYG P VSP+N
Sbjct  16   AAGIAGNIFAFGLFLSPIPTFRRIMRNQSTEQFSGLPYIYGLLNCLICAWYGTPLVSPDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVTT++ +G V ++A++V+F+++  K +K +I   ++ V G+F  + + S+ +   ++R
Sbjct  76   LLVTTVNSVGAVFQIAYIVLFVMYTEKEKKFRILGWILTVFGLFAIIVIGSLLILELQLR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            ++  G  +L CA++  M+ SPL +I +V++T+SVEFMPF L+ S  L + ++ ++G    
Sbjct  136  RIIIG--SLSCASLISMFASPLFIINLVIRTRSVEFMPFYLSLSTFLMSASFFLYGTFSF  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKR  780
            D F+YVPN +G  +GV+QL+L+A Y       + +R
Sbjct  194  DLFIYVPNGIGTLLGVVQLLLFAYYKSSLTRDSTER  229



>ref|XP_006374131.1| hypothetical protein POPTR_0015s02300g [Populus trichocarpa]
 gb|ERP51928.1| hypothetical protein POPTR_0015s02300g [Populus trichocarpa]
Length=239

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 144/218 (66%), Gaps = 3/218 (1%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            +  TL LA G+  NA +  +F API TF R+I+K+STEEFS  PY I  L+C+L  WYGL
Sbjct  1    MGDTLRLAVGVMGNAASLLLFSAPILTFCRVIRKKSTEEFSCVPYTIALLNCLLYTWYGL  60

Query  298  PFVS--PNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavalls  471
            P +S       V TI+G+G + EL+F++I++ F+    K K+ + +I V+ +F   A +S
Sbjct  61   PVISYRWEKFPVVTINGLGILFELSFILIYLWFSSAKGKMKVAITVIPVILVFCITAAIS  120

Query  472  vfvfHGRI-RQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAW  648
            +F FH    R++F G  AL+ + +MY SPL V++ V+KTKSVE+MPF L+F   L ++ W
Sbjct  121  LFSFHDHHHRKIFVGSVALVASVVMYGSPLVVVKQVIKTKSVEYMPFNLSFFSFLSSSLW  180

Query  649  LIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTI  762
            +++GLL  DPF+  PN VG  +G+LQL+LY  Y ++ I
Sbjct  181  MVYGLLSHDPFLTFPNLVGIPLGILQLVLYCKYRKRGI  218



>ref|XP_002972407.1| hypothetical protein SELMODRAFT_97165, partial [Selaginella moellendorffii]
 gb|EFJ26493.1| hypothetical protein SELMODRAFT_97165, partial [Selaginella moellendorffii]
Length=254

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 138/205 (67%), Gaps = 4/205 (2%)
 Frame = +1

Query  154  ANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTT  333
             N  AF +F++P+ TF +II+ + TE+FSG PYV T L+C+L   YGLPFV+PN++LV T
Sbjct  1    GNVIAFGLFMSPLPTFYKIIRLKDTEQFSGVPYVATLLNCLLWTLYGLPFVTPNSLLVVT  60

Query  334  IDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfH-GRIRQLFC  510
            I+GIGT +E  ++ +++ +AP   + K+  +L +V+  F AVAL+ + + H  + RQL  
Sbjct  61   INGIGTALESTYLCVYLFYAPNKPRAKVLKMLAVVLTFFAAVALMVMTITHVHKTRQLIV  120

Query  511  GFAALICAAIMYFSPLSVI--RVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK-DPF  681
            G   +I    MY SP+SV+  ++V++TKSV++MPFLL+ +  L    W  +  L K DPF
Sbjct  121  GVLCVIVGTGMYASPMSVMVRKLVIQTKSVKYMPFLLSLTAFLNGLTWTAYAFLGKIDPF  180

Query  682  VYVPNAVGCGVGVLQLILYAIYSEK  756
            + VPNA+G  +   QLILYAIYS+K
Sbjct  181  IVVPNAIGTCLATTQLILYAIYSKK  205



>ref|XP_010095123.1| Bidirectional sugar transporter SWEET2a [Morus notabilis]
 gb|EXB58289.1| Bidirectional sugar transporter SWEET2a [Morus notabilis]
Length=243

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 138/207 (67%), Gaps = 0/207 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +FL+PI TF+RII+  STE+FSG PY+ +FL+C++  WYG P +SP  
Sbjct  24   AAGVAGNLLAFGLFLSPIPTFRRIIRNHSTEQFSGLPYIYSFLNCLICLWYGTPIISPGV  83

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILV T++ IG V +  +++IFI +A + +K K+  LLI +  +F  +  +SV V    +R
Sbjct  84   ILVATVNSIGAVFQFLYIIIFIFYAERVKKLKMTGLLIAIFALFAIIVFVSVKVLDSGVR  143

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            Q F G+ ++     M+ SPL +I++V+KT+SVEFMPF L+ S  L + ++  +G+L+ D 
Sbjct  144  QAFVGYLSVASLISMFASPLFIIKLVIKTRSVEFMPFYLSLSTFLMSLSFFAYGMLKYDG  203

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKT  759
            F+YVPN +G  +G++QL LY  +S  +
Sbjct  204  FIYVPNGIGSILGLVQLALYYYFSGTS  230



>ref|XP_010916112.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Elaeis 
guineensis]
 ref|XP_010916113.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Elaeis 
guineensis]
Length=236

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 136/207 (66%), Gaps = 0/207 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TFKRI K  STE+FSG PY+ + L+C++  WYGLP V+   
Sbjct  17   AAGVAGNLFAFVLFISPIPTFKRIAKNHSTEQFSGLPYIYSLLNCLICFWYGLPCVAHGV  76

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILV T++ IG + +L +V +FI +A K +K K+  LLI V   F  V  +S+ +     R
Sbjct  77   ILVATVNSIGAIFQLVYVALFIKYADKTKKLKMAGLLIAVFCAFALVICVSLELLDDGRR  136

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            Q+F G+ ++     M+ SPL +I +V++T SVEFMPF L+ S  L + ++  +G+L+ D 
Sbjct  137  QMFVGYLSVASLISMFASPLFIINLVIRTGSVEFMPFYLSLSTFLMSISFFAYGMLKHDF  196

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKT  759
            F+YVPN +G  +GV+QL+LYA YS K+
Sbjct  197  FIYVPNGIGTILGVIQLLLYAYYSRKS  223



>ref|XP_004980179.1| PREDICTED: bidirectional sugar transporter SWEET3b-like [Setaria 
italica]
Length=258

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 98/252 (39%), Positives = 147/252 (58%), Gaps = 11/252 (4%)
 Frame = +1

Query  124  RTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPF  303
             T+ +A GI  NA +  ++ API TF+R++KK + EEFS  PY++   +C+L  WYGLP 
Sbjct  4    NTVRVAVGILGNAASMLLYAAPILTFRRVVKKGNVEEFSCVPYILALFNCLLYTWYGLPV  63

Query  304  VSP--NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvf  477
            VS    N  V+TI+G+G ++E+ F+ I+I FAP  +K+    L+I  V +F   A  S F
Sbjct  64   VSSGWENFPVSTINGVGILLEITFISIYIWFAPSKKKRFALQLVIPAVTLFGLTAFFSSF  123

Query  478  vfH-GRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
            + H  R+R++F G   L+ +  MY SP+   + V+ TKSVEFMPF L+    L +  W+I
Sbjct  124  MVHTHRMRKVFVGSVGLVASISMYSSPMVAAKQVITTKSVEFMPFYLSLFSFLSSALWMI  183

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEKK  834
            +GLL KD F+  PN VG  +G+LQL+LY IY         +   + G L   A+ Q +  
Sbjct  184  YGLLGKDLFIASPNFVGVPMGILQLVLYCIYR--------RSDGAAGKLHATAIDQEKGL  235

Query  835  QPSITSSKYDEL  870
            +  + +    EL
Sbjct  236  KAVVVAMHPQEL  247



>ref|XP_008366018.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Malus 
domestica]
Length=238

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/218 (42%), Positives = 140/218 (64%), Gaps = 0/218 (0%)
 Frame = +1

Query  106  EMHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGA  285
            E+  + +T   A G+  N  AF ++L+P+ TF RII+ RSTE+FSG PY+   L+C++  
Sbjct  5    ELSSVYQTFTDAAGVLGNLFAFGLYLSPMSTFNRIIRNRSTEQFSGMPYIYGLLNCLICC  64

Query  286  WYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvaval  465
            WYG+P V    ILV T++ +GTV +L ++ IFI +A +  K ++  LLI V  IF ++  
Sbjct  65   WYGMPIVKSGIILVATVNSVGTVFQLVYLSIFISYAERAVKIRMLALLIAVFVIFASIVF  124

Query  466  lsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATA  645
            +S+  F    RQLF G+ ++     MY SPL VI +V+KTKSVEFMPF L+F+  L + +
Sbjct  125  VSLSCFDYNGRQLFVGYLSIASLIFMYGSPLIVINLVIKTKSVEFMPFNLSFATFLVSFS  184

Query  646  WLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            +  +G+ + DPF+Y+PN +G  +  +QLILY  Y+  +
Sbjct  185  FTTYGVFKMDPFLYMPNGIGTLLAFVQLILYCHYNNSS  222



>gb|KHN36937.1| Bidirectional sugar transporter SWEET2 [Glycine soja]
Length=256

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 142/202 (70%), Gaps = 4/202 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RII+  STE FSG PY+ + L+C++  WYG P +S +N
Sbjct  16   AAGVAGNVFAFGLFVSPIPTFRRIIRNGSTEMFSGLPYIYSLLNCLICMWYGTPLISADN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVTT++ IG V +  +++IF+++A K +K ++  L + V+GIF  + + S+ +    +R
Sbjct  76   LLVTTVNSIGAVFQFVYIIIFLMYAEKAKKVRMIGLSLAVLGIFAIILVGSLQIDDIIMR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            + F GF  L CA++  M+ SPL +I++V++TKSVEFMPF L+ S  L +T++L++GL   
Sbjct  136  RFFVGF--LSCASLISMFASPLFIIKLVIQTKSVEFMPFYLSLSTFLMSTSFLLYGLFND  193

Query  673  DPFVYVPNAVGCGVGVLQLILY  738
            D F+YVPN +G  +G++QLILY
Sbjct  194  DAFIYVPNGIGTILGLIQLILY  215



>ref|XP_008784375.1| PREDICTED: bidirectional sugar transporter SWEET2a-like isoform 
X2 [Phoenix dactylifera]
Length=236

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 139/207 (67%), Gaps = 0/207 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  A  +F++PI TFKRI K RSTE+FSG PYV + L+C++  WYGLP V+   
Sbjct  17   AAGVAGNLFALGLFISPIPTFKRIAKNRSTEQFSGLPYVYSLLNCLICFWYGLPCVAHGV  76

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            IL+ T++ IG + +L +VV+FI +A K  K K+  LLILV   FV +  +S+ +F    R
Sbjct  77   ILIATVNSIGAIFQLVYVVLFIKYADKTNKLKMAGLLILVFCAFVLIICVSLELFDNGRR  136

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            Q+F G+  +     M+ SPL +I +V++T+SVEFMPF L+ S  L + ++  +G+L+ D 
Sbjct  137  QMFVGYLNVASLISMFASPLFIINLVIRTRSVEFMPFYLSLSTFLMSISFFAYGMLKHDF  196

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKT  759
            F+Y+PN +G  +GV+QL+LYA YS K+
Sbjct  197  FIYMPNGIGTILGVIQLLLYAYYSRKS  223



>emb|CDY40867.1| BnaC09g25980D [Brassica napus]
Length=249

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 144/242 (60%), Gaps = 3/242 (1%)
 Frame = +1

Query  127  TLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFV  306
            T+    GI  NA A  +FL+P  TF+RI+KK+S EE+S  PY+ T ++C++   YGLP V
Sbjct  7    TIRKIVGIIGNAIALCLFLSPTPTFRRIVKKKSVEEYSPIPYLATLINCLVWVLYGLPMV  66

Query  307  SPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfH  486
             P++ LV TI+G G +IE+ F+ IF VF+ + +++ +   ++    +FVA+  + VF   
Sbjct  67   HPDSTLVVTINGAGILIEVVFITIFFVFSGRPKQRLVIAAVLAGETLFVAILAVLVFTLQ  126

Query  487  GRI--RQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFG  660
                 R +  G    +   +MY SPLSV+++V++TKSVEFMPF L+ +  L A  W ++ 
Sbjct  127  HTTTERTMSVGIVCCVFNVMMYASPLSVMKMVIRTKSVEFMPFWLSLAAFLNAGVWTVYA  186

Query  661  LLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIKRSFSHGMLQINAMPQHEK-KQ  837
            L+  DPF+ +PN +GC  G+ QLILYA Y + T  M  +R    G+         EK  Q
Sbjct  187  LMPLDPFIAIPNGIGCIFGLAQLILYAAYYKSTKKMMAERQPMIGLSSAVVRIGSEKVAQ  246

Query  838  PS  843
            PS
Sbjct  247  PS  248



>ref|XP_007149509.1| hypothetical protein PHAVU_005G076300g [Phaseolus vulgaris]
 ref|XP_007149510.1| hypothetical protein PHAVU_005G076300g [Phaseolus vulgaris]
 gb|ESW21503.1| hypothetical protein PHAVU_005G076300g [Phaseolus vulgaris]
 gb|ESW21504.1| hypothetical protein PHAVU_005G076300g [Phaseolus vulgaris]
Length=235

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 87/209 (42%), Positives = 145/209 (69%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RII+  STE FSG PY+ + L+C++  WYG P +S +N
Sbjct  16   AAGVAGNVFAFGLFVSPIPTFRRIIRNGSTEMFSGLPYIYSLLNCLICMWYGTPLISADN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +L+TT++ IG + +  ++++F+++A K +K ++ VLL+ V+G+F  + + S+ +    +R
Sbjct  76   LLITTVNSIGAIFQFVYIILFLIYAEKAKKVRMIVLLVAVLGVFAIILVGSLQIDDILMR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            + F GF  L CA++  M+ SP+ +I++V++TKSVEFMPF L+ S  L +T++ ++GL  +
Sbjct  136  RFFVGF--LSCASLISMFASPMFIIKLVIQTKSVEFMPFYLSLSTFLMSTSFFLYGLFNE  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D F+Y PN +G  +GV QLILY  Y  K+
Sbjct  194  DVFIYGPNGIGTVLGVTQLILYFYYENKS  222



>ref|XP_006643923.1| PREDICTED: bidirectional sugar transporter SWEET3b-like [Oryza 
brachyantha]
Length=252

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 139/215 (65%), Gaps = 3/215 (1%)
 Frame = +1

Query  118  LARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGL  297
            ++  + +A GI  NA +  ++ API TF+R++KK S EEFS  PY++   +C+L  WYGL
Sbjct  2    VSNAVRVAVGILGNAASMLLYAAPILTFRRVVKKGSVEEFSCVPYILALFNCLLYTWYGL  61

Query  298  PFVSP--NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavalls  471
            P VS    N  V++I+G+G ++E+ F+ I+  FAPK +KK +  +++ V+  F   A+ S
Sbjct  62   PVVSSGWENSTVSSINGLGILLEITFISIYTWFAPKEKKKFVLQMVLPVITFFGLTAVFS  121

Query  472  vfvfHGR-IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAW  648
             F+FH   +R++F G   L+ +  MY SP+   + V+ TKSVEFMPF L+    L +  W
Sbjct  122  SFLFHKHGMRKVFVGSIGLVASISMYSSPMVAAKQVITTKSVEFMPFYLSLFSFLSSALW  181

Query  649  LIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSE  753
            +I+GLL KD F+  PN +GC +G+LQL+LY IY +
Sbjct  182  MIYGLLGKDLFISSPNFIGCPMGILQLVLYCIYRK  216



>ref|XP_007212900.1| hypothetical protein PRUPE_ppa021855mg, partial [Prunus persica]
 gb|EMJ14099.1| hypothetical protein PRUPE_ppa021855mg, partial [Prunus persica]
Length=241

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 138/220 (63%), Gaps = 0/220 (0%)
 Frame = +1

Query  100  FREMHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCML  279
            F   H +      A GI  N  AF +FL+PI T++RII+ RSTEEFSG PY+   L+C++
Sbjct  9    FSASHSVFIICRDAAGIAGNIFAFGLFLSPIHTYRRIIRNRSTEEFSGLPYIYALLNCLI  68

Query  280  GAWYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvav  459
              WYG P VS +N+L+ T++  G V +L ++ +FI++A K++K ++   L+   G+F  +
Sbjct  69   CTWYGSPLVSSDNLLIMTVNSAGAVFQLVYIALFIIYAEKSKKVRMLGFLLADFGLFAII  128

Query  460  allsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCA  639
               S+ +    +R+L  G  + +    M+ SP+ +I +V++TKSVEFMPF L+ S  L +
Sbjct  129  VFGSLQMTDLVMRRLIVGLLSCVSLISMFASPMFIINLVIRTKSVEFMPFYLSLSTFLMS  188

Query  640  TAWLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            T++ ++G+   D F+YVPN +G  +G++QL LY  Y + +
Sbjct  189  TSFFLYGIFNYDLFIYVPNGIGTILGIIQLALYFYYKDSS  228



>ref|XP_009786515.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Nicotiana 
sylvestris]
Length=240

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 144/217 (66%), Gaps = 0/217 (0%)
 Frame = +1

Query  106  EMHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGA  285
            E+H +      A GI  N  AF +F++PI TF+RII+ +STE+FSG PY+   ++C++  
Sbjct  11   ELHSVYSICSFAAGIAGNLFAFVLFVSPIPTFRRIIRSKSTEQFSGLPYIYALINCLICL  70

Query  286  WYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvaval  465
            WYG P VSP  ILV T++ IG V +L ++ IFI+ A +++K K+  LL+ V  +F A+  
Sbjct  71   WYGTPIVSPGIILVFTVNSIGAVFQLVYITIFIINAERSKKLKMLGLLLGVFAVFAAIIA  130

Query  466  lsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATA  645
            +S+++F    RQ F G+ ++I    M+ SPL +I +V+KTKSVE+MPF L+ +  L + +
Sbjct  131  ISIYLFEPPSRQTFVGYLSVISLISMFASPLFIINLVIKTKSVEYMPFYLSLATFLMSVS  190

Query  646  WLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            +  +G+ + DPF+ VPN +G  +G++QL+LY  YS+ 
Sbjct  191  FFAYGMFKNDPFISVPNGIGAILGIIQLVLYFRYSKS  227



>ref|XP_002971884.1| hypothetical protein SELMODRAFT_36361, partial [Selaginella moellendorffii]
 gb|EFJ26801.1| hypothetical protein SELMODRAFT_36361, partial [Selaginella moellendorffii]
Length=202

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 135/202 (67%), Gaps = 4/202 (2%)
 Frame = +1

Query  154  ANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNILVTT  333
             N  AF +F++P+ TF ++I+ + TE+FSG PYV T L+C+L   YGLPFV+PN++LV T
Sbjct  1    GNVIAFGLFMSPLPTFYKVIRLKDTEQFSGVPYVATLLNCLLWTLYGLPFVTPNSLLVVT  60

Query  334  IDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfH-GRIRQLFC  510
            I+GIGT +E  ++ +++ +AP   + K+  +L +V+  F AVAL+ + + H  + RQL  
Sbjct  61   INGIGTALESTYLCVYLFYAPNKPRAKVLKMLAVVLTFFAAVALMVMTITHVHKTRQLIV  120

Query  511  GFAALICAAIMYFSPLSVI--RVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK-DPF  681
            G   +I    MY SP+SV+  ++V++TKSV++MPFLL+ +  L    W  +  L K DPF
Sbjct  121  GVLCVIVGTAMYASPMSVMVRKLVIQTKSVKYMPFLLSLTAFLNGLTWTAYAFLGKIDPF  180

Query  682  VYVPNAVGCGVGVLQLILYAIY  747
            + VPNA+G  +   QLILYAIY
Sbjct  181  IVVPNAIGTCLATTQLILYAIY  202



>ref|XP_008775459.1| PREDICTED: bidirectional sugar transporter SWEET2a-like isoform 
X2 [Phoenix dactylifera]
Length=233

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 136/207 (66%), Gaps = 0/207 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +F++PI TFKRI++ +S E+FSG PYV + L+C++  WYGLP VS   
Sbjct  15   AAGIAGNLFAFVLFVSPIPTFKRIVRNKSIEQFSGLPYVYSLLNCLICMWYGLPCVSYGV  74

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILV T++ IG   +L +V +FI++A    + K+  LLI V  +F  +  +S+ +F  + R
Sbjct  75   ILVATVNSIGAAFQLVYVTLFIIYADTTRRMKMSGLLIAVFCVFSLIIYVSLELFDHQAR  134

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            Q   G+ ++     M+ SPL +I +V++T+SVEFMPF L+ +  L + ++  +G+L  D 
Sbjct  135  QTLVGYLSVASLISMFASPLFIIHLVIQTRSVEFMPFYLSLATFLMSVSFFAYGMLLHDF  194

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKT  759
            F+Y+PN VG  +GV+QL+LYA YS K+
Sbjct  195  FIYIPNGVGTVLGVIQLLLYAYYSRKS  221



>ref|XP_010104291.1| Bidirectional sugar transporter SWEET1 [Morus notabilis]
 gb|EXB99576.1| Bidirectional sugar transporter SWEET1 [Morus notabilis]
Length=214

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 135/236 (57%), Gaps = 45/236 (19%)
 Frame = +1

Query  133  HLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSP  312
             L F  F N  A F+FLAP  TFKRI+ K+STE+FSG PYV+T L+C+L AWYGLPFVSP
Sbjct  17   KLCFLGFWNVFALFLFLAPTITFKRIVTKKSTEQFSGIPYVMTLLNCLLSAWYGLPFVSP  76

Query  313  NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGR  492
            NNILV+TI+G G VIE  +V++FI+++PK EK KI  L   V+ +F  VAL+S+F  HG+
Sbjct  77   NNILVSTINGTGAVIETVYVLVFIIYSPKREKLKISGLFAFVITVFAIVALVSLFALHGK  136

Query  493  IRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
             R+L CG AA I + +MY SPLS++                                   
Sbjct  137  GRKLLCGLAATIFSIVMYASPLSIM-----------------------------------  161

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEK-TIFMTIKRSFSHGMLQINAMPQHEKKQ  837
                 VPN  GCG+G  QL+LY IY ++ +   T + S   G+    + P    KQ
Sbjct  162  -----VPNGFGCGLGATQLVLYFIYRDRGSKKPTPEESIEMGL----SKPNQNNKQ  208



>ref|XP_008775458.1| PREDICTED: bidirectional sugar transporter SWEET2a-like isoform 
X1 [Phoenix dactylifera]
Length=234

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 136/207 (66%), Gaps = 0/207 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +F++PI TFKRI++ +S E+FSG PYV + L+C++  WYGLP VS   
Sbjct  15   AAGIAGNLFAFVLFVSPIPTFKRIVRNKSIEQFSGLPYVYSLLNCLICMWYGLPCVSYGV  74

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILV T++ IG   +L +V +FI++A    + K+  LLI V  +F  +  +S+ +F  + R
Sbjct  75   ILVATVNSIGAAFQLVYVTLFIIYADTTRRMKMSGLLIAVFCVFSLIIYVSLELFDHQAR  134

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            Q   G+ ++     M+ SPL +I +V++T+SVEFMPF L+ +  L + ++  +G+L  D 
Sbjct  135  QTLVGYLSVASLISMFASPLFIIHLVIQTRSVEFMPFYLSLATFLMSVSFFAYGMLLHDF  194

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKT  759
            F+Y+PN VG  +GV+QL+LYA YS K+
Sbjct  195  FIYIPNGVGTVLGVIQLLLYAYYSRKS  221



>ref|XP_011006813.1| PREDICTED: bidirectional sugar transporter SWEET2-like [Populus 
euphratica]
Length=235

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 141/213 (66%), Gaps = 0/213 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +F++PI T++RII+ RSTE+FSG PY+   ++C++  WYG P VS +N
Sbjct  16   AAGIAGNIFAFGLFVSPIPTYRRIIRNRSTEQFSGLPYIYALMNCLICMWYGTPLVSADN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +L+ T++  G   +LA++++FI++A +  K +    L+ V+G+F  +A+ S+ +    IR
Sbjct  76   LLLVTVNSFGAAFQLAYIILFIIYAERRIKVRTLASLLGVLGLFAVIAVGSLQITDRMIR  135

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
             L  G   ++    M+ SPL +I +V++T+SVEFMPF L+ S  L + +++++GLL  D 
Sbjct  136  WLSVGSLTVVSLISMFASPLFIINLVIRTRSVEFMPFYLSLSTFLMSASFMLYGLLNFDA  195

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEKTIFMTIK  777
            FVYVPN +G  +G++QL LY  Y +K+   +I+
Sbjct  196  FVYVPNGIGAILGIIQLALYVHYKKKSTQDSIE  228



>ref|XP_004508856.1| PREDICTED: bidirectional sugar transporter SWEET5-like isoform 
X1 [Cicer arietinum]
Length=230

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 140/214 (65%), Gaps = 1/214 (0%)
 Frame = +1

Query  121  ARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLP  300
              T+  A G+  N  +F +F++P+ TF +I K +S ++F   PYV+T L+C + A+YGLP
Sbjct  4    TDTIRTAIGVIGNVISFCLFMSPLPTFIKIWKAKSVQDFKPDPYVVTVLNCAMWAFYGLP  63

Query  301  FVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfv  480
            FV+ NN LV TI+  G VIE+ + ++F VF+  +++KKI +++++ +   V V  L +++
Sbjct  64   FVTENNTLVITINSFGLVIEIIYTLVFFVFSDWSKRKKILLIILVELVFLVLVIFLVMYL  123

Query  481  fHG-RIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIF  657
                + R+L  G   +I   +MYF+PL+V+R V++TKSV++MPFLL+ +  L    W I+
Sbjct  124  VSAHKDRRLIVGCICVIFNVLMYFAPLTVMRQVIRTKSVKYMPFLLSVANFLNGVVWTIY  183

Query  658  GLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
             LL+ DPF+ +PN +G   G+LQLILY IY   T
Sbjct  184  ALLKWDPFIVIPNGLGTLSGLLQLILYGIYYRTT  217



>ref|XP_003635940.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
 gb|AFK43000.1| unknown [Medicago truncatula]
 gb|KEH19191.1| bidirectional sugar transporter [Medicago truncatula]
Length=235

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 144/209 (69%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +F++PI TF+RI++  STE FSG PY+ + L+C++  WYG P +S +N
Sbjct  16   AAGIAGNIFAFGLFVSPIPTFRRIMRNGSTELFSGLPYIYSLLNCLICLWYGTPLISCDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            +LVTT++ IG   +L ++ +F+++A K +K ++  LL+ V+GIFV + + S+ +    IR
Sbjct  76   LLVTTVNSIGAAFQLVYIFLFLIYAEKPKKVRMFGLLLAVLGIFVIILVGSLKITDSSIR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            ++  G   L CA++  M+ SPL +I++V++TKSVEFMPF L+FS  L + ++ ++GLL  
Sbjct  136  RILVG--CLSCASLISMFASPLFIIKLVIRTKSVEFMPFYLSFSTFLMSISFFLYGLLSD  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D F+YVPN +G  +G++QLILY  Y   +
Sbjct  194  DAFIYVPNGIGTVLGMIQLILYFYYKRSS  222



>gb|ACJ85342.1| unknown [Medicago truncatula]
 gb|AFK35657.1| unknown [Medicago truncatula]
 gb|AFK46738.1| unknown [Medicago truncatula]
Length=236

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 142/209 (68%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A G+  N  AF +F++PI TF+RII+  STE F G PY+ +  +C++  WYG P +S +N
Sbjct  16   AAGVAGNIFAFGLFVSPIPTFRRIIRNGSTEMFLGLPYIYSLTNCLICMWYGTPLISHDN  75

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILVTT++ IG V +  ++++F++ A K +K K+   L+ V+GIF  + + S+ +    +R
Sbjct  76   ILVTTVNSIGAVFQFVYIILFMMSAEKEKKVKMLAWLMGVLGIFAIILIGSLQIDDIVMR  135

Query  499  QLFCGFAALICAAI--MYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEK  672
            +LF G   L CA++  M+ SPL +I++V++TKSVEFMPF L+ S  L +T++L++GLL  
Sbjct  136  RLFVGI--LSCASLISMFASPLFIIKLVIQTKSVEFMPFYLSLSTFLMSTSFLVYGLLSD  193

Query  673  DPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            D F+YVPN +G  +G+ QLILY  Y  K+
Sbjct  194  DIFIYVPNGIGTILGMTQLILYFYYESKS  222



>ref|XP_009360807.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Pyrus 
x bretschneideri]
Length=238

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 140/218 (64%), Gaps = 0/218 (0%)
 Frame = +1

Query  106  EMHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGA  285
            E+  + +T   A G+  N  AF ++L+P+ TF RII+ RSTE+FSG PY+   ++C++  
Sbjct  5    ELSSVYQTFTDAAGVLGNLFAFGLYLSPMSTFNRIIRNRSTEQFSGMPYIYGLMNCLICC  64

Query  286  WYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvaval  465
            WYG+P V    ILV T++ +GTV +L ++ IFI +A +  K ++  LLI V  IF ++  
Sbjct  65   WYGMPIVKSGIILVATVNSVGTVFQLVYLSIFISYAERAIKIRMLALLIAVFVIFASIVF  124

Query  466  lsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATA  645
            +S+  F    RQ F G+ ++     MY SPL VI +V+KTKSVEFMPF L+F+  L + +
Sbjct  125  VSLSCFDYNGRQFFVGYLSIASLIFMYGSPLIVINLVIKTKSVEFMPFNLSFATFLVSFS  184

Query  646  WLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            +  +G+ + DPF+Y+PN +G  + ++QLILY  Y+  +
Sbjct  185  FTTYGVFKMDPFLYMPNGIGTLLALVQLILYCHYNNSS  222



>ref|XP_008371546.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Malus 
domestica]
Length=239

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 142/218 (65%), Gaps = 0/218 (0%)
 Frame = +1

Query  106  EMHGLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGA  285
            E+  + ++     G+  N  AF ++L+P+ TF RII+ RSTE+FSG PY+   L+C++  
Sbjct  5    ELSSVYQSFCDGAGVLGNIFAFGLYLSPLSTFNRIIRNRSTEQFSGMPYIYGLLNCLICC  64

Query  286  WYGLPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvaval  465
            WYG+P V    ILV T++ +GTV +L ++ IFI +A +  K K+  LLI V  +FV++ +
Sbjct  65   WYGMPIVKNGIILVATVNSVGTVFQLVYLXIFISYAERALKMKMLALLIAVFVLFVSIVV  124

Query  466  lsvfvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATA  645
            +S+ +F    RQLF G+ ++     MY SPL VI +V+KTKSVEFMPF L+F+  L + +
Sbjct  125  VSLSLFDYNGRQLFVGYLSIASLIFMYGSPLIVINLVIKTKSVEFMPFNLSFATFLVSFS  184

Query  646  WLIFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            +  +G+ + DPF+Y+PN +G  + ++QL+LY  Y   +
Sbjct  185  FTAYGVFKMDPFLYMPNGIGTMLALVQLVLYCRYKNPS  222



>gb|EAY74427.1| hypothetical protein OsI_02317 [Oryza sativa Indica Group]
 gb|EAZ12250.1| hypothetical protein OsJ_02136 [Oryza sativa Japonica Group]
Length=242

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 137/205 (67%), Gaps = 0/205 (0%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            GI  N  A  +F++P+ TFKRI++  STE+FS  PY+ + L+C++  WYGLPFVS   +L
Sbjct  26   GIAGNIFALVLFISPLPTFKRIVRNGSTEQFSAMPYIYSLLNCLICLWYGLPFVSYGVVL  85

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            V T++ IG + +LA+   FI FA    + K+  LL++V G+F  +  +S+ +F  + RQL
Sbjct  86   VATVNSIGALFQLAYTATFIAFADAKNRVKVSSLLVMVFGVFALIVYVSLALFDHQTRQL  145

Query  505  FCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFV  684
            F G+ ++     M+ SPLS+I +V++TKSVE+MPF L+ SM L + ++  +G+L  D F+
Sbjct  146  FVGYLSVASLIFMFASPLSIINLVIRTKSVEYMPFYLSLSMFLMSVSFFAYGVLLHDFFI  205

Query  685  YVPNAVGCGVGVLQLILYAIYSEKT  759
            Y+PN +G  +GV+QL+LY  + + +
Sbjct  206  YIPNGIGTVLGVIQLVLYGYFRKGS  230



>ref|NP_001043270.1| Os01g0541800 [Oryza sativa Japonica Group]
 sp|Q5JJY5.1|SWT2A_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET2a; Short=OsSWEET2a; 
Flags: Precursor [Oryza sativa Japonica Group]
 sp|A2WR31.2|SWT2A_ORYSI RecName: Full=Bidirectional sugar transporter SWEET2a; Short=OsSWEET2a; 
Flags: Precursor [Oryza sativa Indica Group]
 dbj|BAD88223.1| putative MtN3 [Oryza sativa Japonica Group]
 dbj|BAF05184.1| Os01g0541800 [Oryza sativa Japonica Group]
 dbj|BAG96450.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89875.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96548.1| unnamed protein product [Oryza sativa Japonica Group]
Length=243

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 137/205 (67%), Gaps = 0/205 (0%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            GI  N  A  +F++P+ TFKRI++  STE+FS  PY+ + L+C++  WYGLPFVS   +L
Sbjct  27   GIAGNIFALVLFISPLPTFKRIVRNGSTEQFSAMPYIYSLLNCLICLWYGLPFVSYGVVL  86

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            V T++ IG + +LA+   FI FA    + K+  LL++V G+F  +  +S+ +F  + RQL
Sbjct  87   VATVNSIGALFQLAYTATFIAFADAKNRVKVSSLLVMVFGVFALIVYVSLALFDHQTRQL  146

Query  505  FCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFV  684
            F G+ ++     M+ SPLS+I +V++TKSVE+MPF L+ SM L + ++  +G+L  D F+
Sbjct  147  FVGYLSVASLIFMFASPLSIINLVIRTKSVEYMPFYLSLSMFLMSVSFFAYGVLLHDFFI  206

Query  685  YVPNAVGCGVGVLQLILYAIYSEKT  759
            Y+PN +G  +GV+QL+LY  + + +
Sbjct  207  YIPNGIGTVLGVIQLVLYGYFRKGS  231



>ref|XP_006644291.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Oryza 
brachyantha]
Length=245

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 138/205 (67%), Gaps = 0/205 (0%)
 Frame = +1

Query  145  GIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNIL  324
            GI  N  A  +F++P+ TFKRI++  STE+FS  PY+ + L+C++  WYGLPFVS   +L
Sbjct  29   GIAGNIFALVLFVSPLPTFKRIVRNGSTEQFSAMPYIYSLLNCLICLWYGLPFVSYGVVL  88

Query  325  VTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQL  504
            V T++ IG V +LA+   F+ FA   ++ K+  LL++V G+F  +   S+ +F  + RQL
Sbjct  89   VATVNSIGAVFQLAYTATFVAFADAKQRVKVSSLLVMVFGVFALIVYASLVLFDHQTRQL  148

Query  505  FCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPFV  684
            F G+ ++     M+ SPLS+I +V++T+SVE+MPF L+ SM L + ++  +G+L  D F+
Sbjct  149  FVGYLSVASLIFMFASPLSIINLVIRTRSVEYMPFYLSLSMFLMSISFFAYGVLLHDFFI  208

Query  685  YVPNAVGCGVGVLQLILYAIYSEKT  759
            Y+PN +G  +G++QL+LY+ + + +
Sbjct  209  YIPNGIGTVLGIIQLVLYSYFRKGS  233



>ref|XP_002960314.1| hypothetical protein SELMODRAFT_437420 [Selaginella moellendorffii]
 gb|EFJ37853.1| hypothetical protein SELMODRAFT_437420 [Selaginella moellendorffii]
Length=239

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 137/211 (65%), Gaps = 2/211 (1%)
 Frame = +1

Query  130  LHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVS  309
            L LAFGI  N  +  +FL+PI TF RI K++ST +FS  PY +T L+C+L  WYGLP+V 
Sbjct  4    LSLAFGILGNLISICLFLSPIPTFWRIHKEKSTRDFSWLPYAVTLLNCLLWTWYGLPWVQ  63

Query  310  PNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHG  489
             N I V TI+  G +++L +V+I++ +    +K KI   LI+V      + L++VF    
Sbjct  64   IN-IPVITINISGAILQLTYVLIYLRYTTAKKKMKIVASLIIVPLFVAVILLVTVFAMTQ  122

Query  490  RI-RQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLL  666
            +  R+LF G   +I    M  +PLSV+R+V++T+SVEFMPF L+  + +   AWL++GLL
Sbjct  123  KTQRKLFVGILCVIFTTGMNVAPLSVMRMVIRTRSVEFMPFYLSLFVFINGCAWLVYGLL  182

Query  667  EKDPFVYVPNAVGCGVGVLQLILYAIYSEKT  759
              D FV +PNA+G  +G +QLILYAIYS  T
Sbjct  183  TSDVFVLIPNALGAFLGAMQLILYAIYSRAT  213



>ref|XP_008347233.1| PREDICTED: bidirectional sugar transporter SWEET1-like isoform 
X2 [Malus domestica]
Length=203

 Score =   159 bits (403),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 125/205 (61%), Gaps = 40/205 (20%)
 Frame = +1

Query  142  FGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNNI  321
            FG+  N TAFF+FL+P  TFKRI++K+ TE+FSG PYV+T L+C+L AWYGLPFVS NN 
Sbjct  8    FGVLGNGTAFFLFLSPTITFKRIMRKKCTEQFSGIPYVMTMLNCLLYAWYGLPFVSANNF  67

Query  322  LVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIRQ  501
            LV+T++G G  +EL +V++FI+FAPK EK KI  L   V+ +F AVAL+S+F  H + R+
Sbjct  68   LVSTVNGTGAAMELIYVLVFIIFAPKREKAKILGLFTAVLALFSAVALVSLFALHDKTRK  127

Query  502  LFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDPF  681
            LFCG AA + A IM+ SPLS++                                      
Sbjct  128  LFCGLAATVFAIIMFSSPLSIM--------------------------------------  149

Query  682  VYVPNAVGCGVGVLQLILYAIYSEK  756
              +PN  G G+G LQLILY IY + 
Sbjct  150  --IPNGCGSGLGALQLILYFIYRDN  172



>ref|XP_006355568.1| PREDICTED: bidirectional sugar transporter SWEET2a-like [Solanum 
tuberosum]
Length=232

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 140/214 (65%), Gaps = 0/214 (0%)
 Frame = +1

Query  115  GLARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYG  294
            GL      A GI  N  AF +F++PI TF+RII+ +STE+FSG PY+   L+C++  WYG
Sbjct  6    GLYSICSFAAGIAGNLFAFVLFVSPIPTFRRIIRSKSTEQFSGLPYIYALLNCLICLWYG  65

Query  295  LPFVSPNNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
             P VSP  ILV T++ IG V +L ++ IFI+ A  ++K K+  L++ V  +F A+ ++S+
Sbjct  66   TPIVSPGIILVFTVNSIGAVFQLVYITIFIIHAEGSKKLKMLGLVLGVFAVFAAIVVISL  125

Query  475  fvfHGRIRQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLI  654
            ++F    RQ F G+ ++     M+ SPL +I +V+KT+SVE+MPF L+ +  L + ++  
Sbjct  126  YLFEPASRQTFVGYLSVFSLICMFASPLFIINLVIKTRSVEYMPFYLSLATFLMSLSFFA  185

Query  655  FGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSEK  756
            +G+ + DPF+ VPN +G  +GV+QL+LY  YS  
Sbjct  186  YGMFKNDPFISVPNGIGGVLGVIQLVLYFRYSNS  219



>ref|XP_004294170.1| PREDICTED: bidirectional sugar transporter SWEET2-like [Fragaria 
vesca subsp. vesca]
Length=235

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 138/208 (66%), Gaps = 0/208 (0%)
 Frame = +1

Query  136  LAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPN  315
            +A GI  N  AF +F++P+ TFKRII+  STEEFSG PY+   L+CM+  WYG P +S +
Sbjct  15   VAAGIAGNFFAFGLFVSPMHTFKRIIRNGSTEEFSGLPYIYALLNCMISMWYGSPLISSD  74

Query  316  NILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRI  495
            NIL+ T++ +G V +LA++ +FI++A K +K  +  LL+ V G+F  +A+ S+ +    +
Sbjct  75   NILILTVNSVGAVFQLAYITLFIIYAEKPKKVWMMGLLVAVFGLFAIIAIGSLQISDLFL  134

Query  496  RQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKD  675
            R+   G  +      M+ SPL +I +V++TKSVEFMPF L+ S  L +T++L++G+   D
Sbjct  135  RRTIVGLLSCFSLISMFASPLFIINLVIRTKSVEFMPFYLSLSTFLMSTSFLLYGIFNFD  194

Query  676  PFVYVPNAVGCGVGVLQLILYAIYSEKT  759
            P+VYVPN +G  +G++QL LY  Y   +
Sbjct  195  PYVYVPNGIGTILGIVQLALYFHYHRSS  222



>ref|XP_010521381.1| PREDICTED: bidirectional sugar transporter SWEET3 [Tarenaya hassleriana]
Length=262

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 134/214 (63%), Gaps = 3/214 (1%)
 Frame = +1

Query  121  ARTLHLAFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLP  300
            + +L LA GI  NA +  ++ API TF R+I+KRSTEEFS  PYVIT L+C++  WYGLP
Sbjct  3    STSLRLAVGIMGNAASLLLYTAPILTFSRVIRKRSTEEFSCLPYVITLLNCLIYTWYGLP  62

Query  301  FVSP--NNILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsv  474
             VS    N LV TI+GIG  ++  F++I+  FA    K ++    + V+  F   A +S 
Sbjct  63   VVSHLWENFLVVTINGIGIFLQSIFILIYFWFASLKGKIRVCATFVPVMVAFAVTAAVST  122

Query  475  fvfHGRI-RQLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWL  651
             VFH    R+++ G   L+ +  MY SPL  ++ V++T+SVE+MPF L+F   L ++ W+
Sbjct  123  AVFHDHHHRKIYVGSVGLVASVAMYGSPLVAVKKVIETESVEYMPFHLSFFSFLASSLWM  182

Query  652  IFGLLEKDPFVYVPNAVGCGVGVLQLILYAIYSE  753
             +GLL  D F+  PN VGC +G++QL+LY  Y  
Sbjct  183  AYGLLSHDLFLASPNLVGCPLGIIQLLLYFKYKN  216



>ref|XP_009416883.1| PREDICTED: bidirectional sugar transporter SWEET2a-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=240

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 137/206 (67%), Gaps = 0/206 (0%)
 Frame = +1

Query  139  AFGIFANATAFFIFLAPIGTFKRIIKKRSTEEFSGFPYVITFLSCMLGAWYGLPFVSPNN  318
            A GI  N  AF +F++P+ TFKRI++ +STE+FSG PY+ + L+C++  WYGLP+VS   
Sbjct  23   AAGIAGNVFAFVLFVSPMPTFKRIVRNKSTEQFSGLPYIYSLLNCLICMWYGLPWVSYGV  82

Query  319  ILVTTIDGIGTVIELAFVVIFIVFAPKNEKKKigvllilvvgifvavallsvfvfHGRIR  498
            ILV T++ IG   +LA+V +FI FA   ++ ++  LLI V  +F  +   S+ +     R
Sbjct  83   ILVATVNSIGAAFQLAYVSLFIRFADSAKRLRMSGLLIGVFSVFALIIYASLELCDHPTR  142

Query  499  QLFCGFAALICAAIMYFSPLSVIRVVMKTKSVEFMPFLLTFSMVLCATAWLIFGLLEKDP  678
            Q+F G+ ++     M+ SPL +I +V++T+SVEFMPF L+ +  L + ++  +G+L  D 
Sbjct  143  QIFVGYLSVASLISMFASPLFIINLVIRTRSVEFMPFYLSLATFLMSISFFAYGMLLHDF  202

Query  679  FVYVPNAVGCGVGVLQLILYAIYSEK  756
            F+Y+PN +G  +GV+QL+LYA YS+ 
Sbjct  203  FIYIPNGIGTVLGVVQLLLYAYYSKS  228



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2679187295344