BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19401_g1_i4 len=1474 path=[2267:0-234 130:235-292 188:293-316
212:317-488 2671:489-1473]

Length=1474
                                                                      Score     E

ref|XP_004143435.1|  PREDICTED: protein BRICK 1-like isoform 2        86.7    1e-18   
ref|XP_004143434.1|  PREDICTED: protein BRICK 1-like isoform 1        85.5    3e-18   
ref|XP_002527222.1|  Protein BRICK1, putative                         85.1    4e-18   Ricinus communis
gb|KDP32167.1|  hypothetical protein JCGZ_12628                       83.6    6e-18   
gb|KHG01536.1|  Protein BRICK 1 -like protein                         83.6    7e-18   
ref|XP_004289391.1|  PREDICTED: oligopeptidase A-like                 85.1    8e-18   
ref|XP_008236619.1|  PREDICTED: protein BRICK 1                       86.3    9e-18   
ref|XP_010105126.1|  hypothetical protein L484_016117                 83.2    1e-17   
ref|XP_009772388.1|  PREDICTED: protein BRICK 1                       84.3    1e-17   
ref|XP_004234637.1|  PREDICTED: protein BRICK 1                       84.3    1e-17   
ref|XP_009605386.1|  PREDICTED: protein BRICK 1                       84.3    1e-17   
ref|XP_010646397.1|  PREDICTED: protein BRICK 1                       82.4    2e-17   
ref|XP_003517200.1|  PREDICTED: protein BRICK 1 isoformX1             83.6    2e-17   
ref|XP_003612953.1|  Oligopeptidase A                                 83.6    3e-17   
ref|XP_008342688.1|  PREDICTED: protein BRICK 1-like                  88.2    3e-17   
ref|XP_007207525.1|  hypothetical protein PRUPE_ppa014091mg           84.3    3e-17   
ref|XP_008385246.1|  PREDICTED: protein BRICK 1                       84.0    4e-17   
ref|XP_007047707.1|  Brick 1                                          81.3    5e-17   
emb|CDP02686.1|  unnamed protein product                              83.2    5e-17   
ref|XP_010683051.1|  PREDICTED: protein BRICK 1                       83.2    6e-17   
ref|XP_010254626.1|  PREDICTED: protein BRICK 1                       82.0    8e-17   
ref|XP_006426215.1|  hypothetical protein CICLE_v10027006mg           82.4    1e-16   
ref|XP_003534258.1|  PREDICTED: protein BRICK 1                       80.9    1e-16   
ref|XP_006856618.1|  hypothetical protein AMTR_s00046p00225220        79.3    2e-16   
ref|XP_002878627.1|  hypothetical protein ARALYDRAFT_343817           81.6    4e-16   
ref|XP_010531342.1|  PREDICTED: protein BRICK 1                       81.6    5e-16   
gb|KCW54648.1|  hypothetical protein EUGRSUZ_I00598                   84.7    7e-16   
ref|NP_179849.2|  protein BRICK 1                                     80.9    7e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011073637.1|  PREDICTED: protein BRICK 1                       80.9    9e-16   
ref|XP_010935480.1|  PREDICTED: protein BRICK 1                       79.0    1e-15   
ref|XP_010555424.1|  PREDICTED: protein BRICK 1-like                  81.3    1e-15   
ref|XP_009396152.1|  PREDICTED: protein BRICK 1                       81.6    1e-15   
ref|XP_010027986.1|  PREDICTED: protein BRICK 1                       82.0    2e-15   
gb|EYU41348.1|  hypothetical protein MIMGU_mgv1a017260mg              79.3    3e-15   
gb|AAD15572.1|  unknown protein                                       81.3    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803777.1|  PREDICTED: protein BRICK 1                       78.6    8e-15   
ref|XP_009418655.1|  PREDICTED: protein BRICK1-like                   80.1    1e-14   
ref|XP_010244689.1|  PREDICTED: protein BRICK 1-like                  80.1    1e-14   
ref|XP_009140374.1|  PREDICTED: protein BRICK 1                       76.3    1e-14   
ref|XP_010429193.1|  PREDICTED: protein BRICK 1-like                  79.0    3e-14   
emb|CDY13739.1|  BnaA09g42410D                                        77.0    1e-13   
ref|XP_003563735.1|  PREDICTED: probable protein BRICK1               71.6    2e-13   
ref|NP_001105190.1|  protein BRICK1                                   73.2    2e-13   Zea mays [maize]
ref|XP_004954506.1|  PREDICTED: protein BRICK1-like                   72.8    3e-13   
gb|EEE58106.1|  hypothetical protein OsJ_08984                        70.9    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048610.1|  Os02g0829900                                     70.9    5e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454840.1|  hypothetical protein SORBIDRAFT_04g038300        73.2    5e-13   Sorghum bicolor [broomcorn]
ref|XP_006648169.1|  PREDICTED: probable protein BRICK1-like          70.9    1e-12   
ref|XP_009606293.1|  PREDICTED: transcription factor GTE2-like        80.5    1e-12   
gb|EMS63713.1|  hypothetical protein TRIUR3_10832                     70.9    1e-12   
dbj|BAJ92386.1|  predicted protein                                    71.2    1e-12   
ref|XP_002319999.2|  hypothetical protein POPTR_0014s01030g           72.8    6e-12   Populus trichocarpa [western balsam poplar]
ref|XP_009784115.1|  PREDICTED: transcription factor GTE7-like        76.3    2e-11   
gb|ABR17532.1|  unknown                                               69.7    6e-11   Picea sitchensis
ref|XP_006357759.1|  PREDICTED: transcription factor GTE7-like is...  69.3    3e-09   
emb|CDY08771.1|  BnaA06g24530D                                        66.6    1e-08   
ref|XP_009150652.1|  PREDICTED: transcription factor GTE7             67.0    2e-08   
ref|XP_006357758.1|  PREDICTED: transcription factor GTE7-like is...  67.0    2e-08   
ref|XP_006394005.1|  hypothetical protein EUTSA_v10003870mg           65.5    5e-08   
emb|CDY65645.1|  BnaAnng20870D                                        65.5    5e-08   
ref|XP_006394006.1|  hypothetical protein EUTSA_v10003870mg           65.5    7e-08   
ref|XP_010463416.1|  PREDICTED: transcription factor GTE7-like        64.7    1e-07   
ref|XP_010444571.1|  PREDICTED: transcription factor GTE7             64.7    1e-07   
ref|XP_002866683.1|  hypothetical protein ARALYDRAFT_919899           64.7    1e-07   
gb|KFK28231.1|  hypothetical protein AALP_AA8G489400                  64.7    1e-07   
ref|XP_010484396.1|  PREDICTED: transcription factor GTE7-like is...  64.7    1e-07   
ref|XP_010484395.1|  PREDICTED: transcription factor GTE7-like is...  64.7    1e-07   
ref|NP_201366.3|  global transcription factor group E7                64.3    1e-07   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA98182.1|  unnamed protein product                              64.3    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010105120.1|  Transcription factor GTE7                        63.9    2e-07   
ref|XP_006281511.1|  hypothetical protein CARUB_v10027609mg           63.5    2e-07   
gb|ACG38184.1|  hypothetical protein                                  57.8    6e-07   Zea mays [maize]
gb|KDO67980.1|  hypothetical protein CISIN_1g009417mg                 60.8    2e-06   
gb|KFK25327.1|  hypothetical protein AALP_AA8G098400                  60.1    3e-06   
ref|XP_006286650.1|  hypothetical protein CARUB_v10002520mg           60.1    3e-06   
ref|XP_010422833.1|  PREDICTED: transcription factor GTE2-like        58.9    6e-06   
ref|XP_004147512.1|  PREDICTED: transcription factor GTE7-like        58.5    8e-06   
ref|XP_008454445.1|  PREDICTED: transcription factor GTE7             58.5    8e-06   
gb|KDO67983.1|  hypothetical protein CISIN_1g009417mg                 58.2    8e-06   
ref|XP_010491731.1|  PREDICTED: transcription factor GTE2-like        58.5    1e-05   
ref|XP_002518322.1|  bromodomain-containing protein, putative         58.5    1e-05   Ricinus communis
emb|CDX78390.1|  BnaA03g03020D                                        56.6    1e-05   
emb|CDX70356.1|  BnaC03g04400D                                        56.6    1e-05   
ref|XP_006422658.1|  hypothetical protein CICLE_v10028177mg           57.8    1e-05   
ref|XP_006486782.1|  PREDICTED: transcription factor GTE7-like        57.8    1e-05   
ref|XP_006422656.1|  hypothetical protein CICLE_v10028177mg           57.8    1e-05   
ref|XP_001759003.1|  predicted protein                                53.9    2e-05   
ref|XP_010648048.1|  PREDICTED: transcription factor GTE7-like        57.0    3e-05   
ref|XP_004231975.1|  PREDICTED: transcription factor GTE7 isoform X2  57.0    3e-05   
gb|KHG12834.1|  Transcription factor GTE4 -like protein               57.0    3e-05   
emb|CBI35445.3|  unnamed protein product                              57.0    3e-05   
ref|XP_010529112.1|  PREDICTED: transcription factor GTE2-like        56.2    3e-05   
ref|XP_009131170.1|  PREDICTED: transcription factor GTE2             56.6    4e-05   
ref|XP_007042774.1|  Global transcription factor group E2, putati...  56.2    4e-05   
ref|XP_007042770.1|  Global transcription factor group E2, putati...  56.2    5e-05   
sp|Q9LXA7.2|GTE2_ARATH  RecName: Full=Transcription factor GTE2; ...  56.2    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196617.1|  global transcription factor group E2                56.2    5e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KHG18778.1|  Transcription factor GTE7 -like protein               55.5    9e-05   
ref|XP_007200701.1|  hypothetical protein PRUPE_ppa003935m2g          52.0    1e-04   
gb|KDP35948.1|  hypothetical protein JCGZ_09920                       54.7    1e-04   
ref|XP_006399553.1|  hypothetical protein EUTSA_v10012974mg           53.9    3e-04   
ref|XP_010316055.1|  PREDICTED: transcription factor GTE7 isoform X1  53.9    3e-04   
ref|XP_004289817.1|  PREDICTED: transcription factor GTE7-like is...  53.5    3e-04   
ref|XP_010646991.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  53.1    5e-04   
ref|XP_002973853.1|  hypothetical protein SELMODRAFT_9224             48.1    5e-04   
ref|XP_011002956.1|  PREDICTED: transcription factor GTE7-like        52.8    5e-04   
ref|XP_006379135.1|  hypothetical protein POPTR_0009s08350g           52.8    6e-04   
ref|XP_002313212.2|  hypothetical protein POPTR_0009s08350g           52.8    6e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006379136.1|  hypothetical protein POPTR_0009s08350g           52.8    6e-04   
ref|XP_010244682.1|  PREDICTED: transcription factor GTE7-like        52.8    7e-04   
ref|XP_010254641.1|  PREDICTED: transcription factor GTE7-like        52.4    8e-04   
ref|XP_010027994.1|  PREDICTED: transcription factor GTE2             52.4    8e-04   
gb|KCW54654.1|  hypothetical protein EUGRSUZ_I00604                   52.4    8e-04   
gb|AGW80641.1|  BRK1                                                  48.1    9e-04   
gb|AGW80631.1|  BRK1                                                  48.1    9e-04   



>ref|XP_004143435.1| PREDICTED: protein BRICK 1-like isoform 2 [Cucumis sativus]
 ref|XP_004160121.1| PREDICTED: protein BRICK 1-like isoform 2 [Cucumis sativus]
Length=76

 Score = 86.7 bits (213),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI +N+R LFDFL+HF
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISINVRRLFDFLVHF  44


 Score = 35.8 bits (81),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL TL+RR
Sbjct  45   EATTKSKLASLNEKLDTLERR  65



>ref|XP_004143434.1| PREDICTED: protein BRICK 1-like isoform 1 [Cucumis sativus]
 ref|XP_004160120.1| PREDICTED: protein BRICK 1-like isoform 1 [Cucumis sativus]
 ref|XP_008440511.1| PREDICTED: protein BRICK 1 [Cucumis melo]
 gb|KGN48680.1| Protein BRICK1 [Cucumis sativus]
Length=85

 Score = 85.5 bits (210),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI +N+R LFDFL+HF
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISINVRRLFDFLVHF  44


 Score = 35.8 bits (81),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL TL+RR
Sbjct  45   EATTKSKLASLNEKLDTLERR  65



>ref|XP_002527222.1| Protein BRICK1, putative [Ricinus communis]
 gb|EEF35148.1| Protein BRICK1, putative [Ricinus communis]
Length=85

 Score = 85.1 bits (209),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 39/44 (89%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFLL F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLLQF  44


 Score = 35.4 bits (80),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL TL+RR
Sbjct  45   EATTKSKLASLNEKLDTLERR  65



>gb|KDP32167.1| hypothetical protein JCGZ_12628 [Jatropha curcas]
Length=85

 Score = 83.6 bits (205),  Expect(2) = 6e-18, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LF+FLL F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLLQF  44


 Score = 36.6 bits (83),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KLSSLNEKL TL+RR
Sbjct  45   EATTKSKLSSLNEKLDTLERR  65



>gb|KHG01536.1| Protein BRICK 1 -like protein [Gossypium arboreum]
Length=154

 Score = 83.6 bits (205),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LF+FLL F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLLQF  44


 Score = 36.2 bits (82),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL TL+RR
Sbjct  45   EATTKSKLASLNEKLDTLERR  65



>ref|XP_004289391.1| PREDICTED: oligopeptidase A-like [Fragaria vesca subsp. vesca]
Length=933

 Score = 85.1 bits (209),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  86   ELEAGKMARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            E E+  MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ F
Sbjct  841  EGESRTMARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQF  890


 Score = 34.3 bits (77),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL TL+R+
Sbjct  891  EATTKSKLASLNEKLDTLERK  911



>ref|XP_008236619.1| PREDICTED: protein BRICK 1 [Prunus mume]
Length=117

 Score = 86.3 bits (212),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  101  KMARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            KMARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ F
Sbjct  30   KMARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQF  74


 Score = 33.1 bits (74),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL  L+R+
Sbjct  75   EATTKSKLASLNEKLDVLERK  95



>ref|XP_010105126.1| hypothetical protein L484_016117 [Morus notabilis]
 gb|EXC03911.1| hypothetical protein L484_016117 [Morus notabilis]
Length=85

 Score = 83.2 bits (204),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQF  44


 Score = 35.8 bits (81),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL TL+RR
Sbjct  45   EATTKSKLASLNEKLDTLERR  65



>ref|XP_009772388.1| PREDICTED: protein BRICK 1 [Nicotiana sylvestris]
Length=85

 Score = 84.3 bits (207),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRKLFDFLVQF  44


 Score = 34.7 bits (78),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL++LNEKL TL+RR
Sbjct  45   EATTKSKLATLNEKLDTLERR  65



>ref|XP_004234637.1| PREDICTED: protein BRICK 1 [Solanum lycopersicum]
 ref|XP_006364014.1| PREDICTED: protein BRICK 1-like [Solanum tuberosum]
 ref|XP_010317765.1| PREDICTED: protein BRICK 1 [Solanum lycopersicum]
 ref|XP_010317766.1| PREDICTED: protein BRICK 1 [Solanum lycopersicum]
 ref|XP_010317767.1| PREDICTED: protein BRICK 1 [Solanum lycopersicum]
 ref|XP_010317768.1| PREDICTED: protein BRICK 1 [Solanum lycopersicum]
 ref|XP_010317769.1| PREDICTED: protein BRICK 1 [Solanum lycopersicum]
Length=85

 Score = 84.3 bits (207),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRKLFDFLVQF  44


 Score = 34.7 bits (78),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL++LNEKL TL+RR
Sbjct  45   EATTKSKLATLNEKLDTLERR  65



>ref|XP_009605386.1| PREDICTED: protein BRICK 1 [Nicotiana tomentosiformis]
Length=85

 Score = 84.3 bits (207),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRKLFDFLVQF  44


 Score = 34.7 bits (78),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL++LNEKL TL+RR
Sbjct  45   EATTKSKLATLNEKLDTLERR  65



>ref|XP_010646397.1| PREDICTED: protein BRICK 1 [Vitis vinifera]
 emb|CAN62795.1| hypothetical protein VITISV_026838 [Vitis vinifera]
Length=85

 Score = 82.4 bits (202),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LNIR LF+FL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNIRRLFEFLVQF  44


 Score = 35.8 bits (81),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL TL+RR
Sbjct  45   EATTKSKLASLNEKLDTLERR  65



>ref|XP_003517200.1| PREDICTED: protein BRICK 1 isoformX1 [Glycine max]
 ref|XP_004512552.1| PREDICTED: protein BRICK 1-like [Cicer arietinum]
 ref|XP_006572988.1| PREDICTED: protein BRICK 1 isoform X2 [Glycine max]
 ref|XP_006572989.1| PREDICTED: protein BRICK 1 isoform X3 [Glycine max]
 ref|XP_007158330.1| hypothetical protein PHAVU_002G143500g [Phaseolus vulgaris]
 gb|ABY48140.1| BRICK1 [Medicago truncatula]
 gb|AFK43675.1| unknown [Medicago truncatula]
 gb|ESW30324.1| hypothetical protein PHAVU_002G143500g [Phaseolus vulgaris]
 gb|KEH27724.1| BRICK1, putative [Medicago truncatula]
 gb|KHN04897.1| Protein BRICK 1 [Glycine soja]
 gb|KHN38903.1| Protein BRICK 1 [Glycine soja]
Length=85

 Score = 83.6 bits (205),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQF  44


 Score = 34.7 bits (78),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL  L+RR
Sbjct  45   EATTKSKLASLNEKLDVLERR  65



>ref|XP_003612953.1| Oligopeptidase A [Medicago truncatula]
Length=971

 Score = 83.6 bits (205),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ F
Sbjct  887  MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQF  930


 Score = 34.3 bits (77),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL  L+RR
Sbjct  931  EATTKSKLASLNEKLDVLERR  951



>ref|XP_008342688.1| PREDICTED: protein BRICK 1-like [Malus domestica]
Length=109

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  101  KMARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHFGNFQ  247
            +MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ FGNF 
Sbjct  24   EMARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQFGNFN  72



>ref|XP_007207525.1| hypothetical protein PRUPE_ppa014091mg [Prunus persica]
 ref|XP_009364792.1| PREDICTED: protein BRICK 1 [Pyrus x bretschneideri]
 ref|XP_009371348.1| PREDICTED: protein BRICK 1 [Pyrus x bretschneideri]
 ref|XP_009345859.1| PREDICTED: protein BRICK 1 [Pyrus x bretschneideri]
 gb|EMJ08724.1| hypothetical protein PRUPE_ppa014091mg [Prunus persica]
Length=87

 Score = 84.3 bits (207),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQF  44


 Score = 33.1 bits (74),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL  L+R+
Sbjct  45   EATTKSKLASLNEKLDVLERK  65



>ref|XP_008385246.1| PREDICTED: protein BRICK 1 [Malus domestica]
Length=111

 Score = 84.0 bits (206),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  101  KMARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            +MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ F
Sbjct  24   EMARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQF  68


 Score = 33.1 bits (74),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL  L+R+
Sbjct  69   EATTKSKLASLNEKLDVLERK  89



>ref|XP_007047707.1| Brick 1 [Theobroma cacao]
 gb|EOX91864.1| Brick 1 [Theobroma cacao]
Length=101

 Score = 81.3 bits (199),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  101  KMARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            +MARAGGITNAVNVGIAVQADW +REFISHI LN+R LF+FLL F
Sbjct  13   EMARAGGITNAVNVGIAVQADWGNREFISHISLNVRRLFEFLLQF  57


 Score = 35.8 bits (81),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL TL+RR
Sbjct  58   EATTKSKLASLNEKLDTLERR  78



>emb|CDP02686.1| unnamed protein product [Coffea canephora]
Length=86

 Score = 83.2 bits (204),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQF  44


 Score = 33.5 bits (75),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL++LN+KL TL+RR
Sbjct  45   EATTKSKLATLNQKLDTLERR  65



>ref|XP_010683051.1| PREDICTED: protein BRICK 1 [Beta vulgaris subsp. vulgaris]
Length=84

 Score = 83.2 bits (204),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MA+AGGITNAVNVGIAVQADWE+REFISHI LNIR LFDFL+ F
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNIRRLFDFLVQF  44


 Score = 33.5 bits (75),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            E+TTK+KL++LNEKL TL+RR
Sbjct  45   ESTTKSKLAALNEKLDTLERR  65



>ref|XP_010254626.1| PREDICTED: protein BRICK 1 [Nelumbo nucifera]
 ref|XP_010254627.1| PREDICTED: protein BRICK 1 [Nelumbo nucifera]
Length=84

 Score = 82.0 bits (201),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LF+FL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQF  44


 Score = 34.3 bits (77),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL  L+RR
Sbjct  45   EATTKSKLASLNEKLDMLERR  65



>ref|XP_006426215.1| hypothetical protein CICLE_v10027006mg [Citrus clementina]
 ref|XP_006466356.1| PREDICTED: protein BRICK 1-like [Citrus sinensis]
 gb|ESR39455.1| hypothetical protein CICLE_v10027006mg [Citrus clementina]
 gb|KDO78697.1| hypothetical protein CISIN_1g034753mg [Citrus sinensis]
Length=85

 Score = 82.4 bits (202),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LF+FL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQF  44


 Score = 32.7 bits (73),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+ LNEKL TL+RR
Sbjct  45   EATTKSKLALLNEKLDTLERR  65



>ref|XP_003534258.1| PREDICTED: protein BRICK 1 [Glycine max]
 gb|ACU15650.1| unknown [Glycine max]
Length=85

 Score = 80.9 bits (198),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+  LFDFL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVHRLFDFLVQF  44


 Score = 34.3 bits (77),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL  L+RR
Sbjct  45   EATTKSKLASLNEKLDVLERR  65



>ref|XP_006856618.1| hypothetical protein AMTR_s00046p00225220 [Amborella trichopoda]
 gb|ERN18085.1| hypothetical protein AMTR_s00046p00225220 [Amborella trichopoda]
Length=91

 Score = 79.3 bits (194),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFIS+I LN+R LF+FL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFEFLIKF  44


 Score = 35.8 bits (81),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL TL+RR
Sbjct  45   EATTKSKLASLNEKLDTLERR  65



>ref|XP_002878627.1| hypothetical protein ARALYDRAFT_343817 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54886.1| hypothetical protein ARALYDRAFT_343817 [Arabidopsis lyrata subsp. 
lyrata]
Length=920

 Score = 81.6 bits (200),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MA+AGGITNAVNVGIAVQADWE+REFISHI LN+R LF+FL+ F
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQF  44


 Score = 32.0 bits (71),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            E+TTK+KL+SLNEKL  L+RR
Sbjct  45   ESTTKSKLASLNEKLDLLERR  65



>ref|XP_010531342.1| PREDICTED: protein BRICK 1 [Tarenaya hassleriana]
Length=85

 Score = 81.6 bits (200),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MA+AGGITNAVNVGIAVQADWE+REFISHI LN+R LF+FL+ F
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQF  44


 Score = 32.0 bits (71),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL +LNEKL  L+RR
Sbjct  45   EATTKSKLGTLNEKLDLLERR  65



>gb|KCW54648.1| hypothetical protein EUGRSUZ_I00598, partial [Eucalyptus grandis]
Length=130

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ F
Sbjct  46   MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQF  89



>ref|NP_179849.2| protein BRICK 1 [Arabidopsis thaliana]
 ref|XP_006295338.1| hypothetical protein CARUB_v10024428mg [Capsella rubella]
 ref|XP_006404726.1| hypothetical protein EUTSA_v10000402mg [Eutrema salsugineum]
 ref|XP_010417024.1| PREDICTED: protein BRICK 1 [Camelina sativa]
 ref|XP_010472257.1| PREDICTED: protein BRICK 1 [Camelina sativa]
 sp|Q94JY4.1|BRK1_ARATH RecName: Full=Protein BRICK 1; Short=AtBRK1 [Arabidopsis thaliana]
 gb|AAK48957.1|AF370530_1 Unknown protein [Arabidopsis thaliana]
 gb|AAM62865.1| unknown [Arabidopsis thaliana]
 gb|AAN15336.1| Unknown protein [Arabidopsis thaliana]
 gb|AEC07332.1| protein BRICK 1 [Arabidopsis thaliana]
 gb|EOA28236.1| hypothetical protein CARUB_v10024428mg [Capsella rubella]
 gb|ESQ46179.1| hypothetical protein EUTSA_v10000402mg [Eutrema salsugineum]
Length=85

 Score = 80.9 bits (198),  Expect(2) = 7e-16, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MA+AGGITNAVNVGIAVQADWE+REFISHI LN+R LF+FL+ F
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQF  44


 Score = 32.3 bits (72),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            E+TTK+KL+SLNEKL  L+RR
Sbjct  45   ESTTKSKLASLNEKLDLLERR  65



>ref|XP_011073637.1| PREDICTED: protein BRICK 1 [Sesamum indicum]
Length=86

 Score = 80.9 bits (198),  Expect(2) = 9e-16, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFIS I LN+R LFDFL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISQISLNVRRLFDFLVQF  44


 Score = 32.0 bits (71),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            E+TTK KL+ LNEKL TL+RR
Sbjct  45   ESTTKNKLAKLNEKLDTLERR  65



>ref|XP_010935480.1| PREDICTED: protein BRICK 1 [Elaeis guineensis]
Length=84

 Score = 79.0 bits (193),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            M+RAGGITNAVNVGIAVQADWE+REFIS+I LN+R LF+FLL F
Sbjct  1    MSRAGGITNAVNVGIAVQADWENREFISNISLNVRRLFEFLLQF  44


 Score = 33.1 bits (74),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL++LNEKL  L+RR
Sbjct  45   EATTKSKLAALNEKLDILERR  65



>ref|XP_010555424.1| PREDICTED: protein BRICK 1-like [Tarenaya hassleriana]
Length=85

 Score = 81.3 bits (199),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MA+AGGITNAVNVGIAVQADWE+REFISHI LN+R LF+FL+ F
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQF  44


 Score = 30.8 bits (68),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATT++KL +LNEKL  L+RR
Sbjct  45   EATTRSKLGTLNEKLDLLERR  65



>ref|XP_009396152.1| PREDICTED: protein BRICK 1 [Musa acuminata subsp. malaccensis]
Length=84

 Score = 81.6 bits (200),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFIS+I LN+R LFDFLL F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLLQF  44


 Score = 30.4 bits (67),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL++LNEKL  L+ R
Sbjct  45   EATTKSKLAALNEKLDILEHR  65



>ref|XP_010027986.1| PREDICTED: protein BRICK 1 [Eucalyptus grandis]
 ref|XP_010027987.1| PREDICTED: protein BRICK 1 [Eucalyptus grandis]
 gb|KCW54649.1| hypothetical protein EUGRSUZ_I00599 [Eucalyptus grandis]
Length=85

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/44 (86%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LFDFL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFDFLVQF  44



>gb|EYU41348.1| hypothetical protein MIMGU_mgv1a017260mg [Erythranthe guttata]
Length=86

 Score = 79.3 bits (194),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 35/44 (80%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MAR GGIT+AVNVGIAVQADWE+REF+SHI LN+R LFDFL+ F
Sbjct  1    MARVGGITSAVNVGIAVQADWENREFVSHISLNVRRLFDFLVQF  44


 Score = 32.0 bits (71),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            E+TTK KL+ LNEKL TL+RR
Sbjct  45   ESTTKNKLAKLNEKLDTLERR  65



>gb|AAD15572.1| unknown protein [Arabidopsis thaliana]
Length=61

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHFGN  241
            MA+AGGITNAVNVGIAVQADWE+REFISHI LN+R LF+FL+ FG 
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQFGK  46



>ref|XP_008803777.1| PREDICTED: protein BRICK 1 [Phoenix dactylifera]
Length=84

 Score = 78.6 bits (192),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            M+RAGGITNAVNVGIAVQADWE+REFIS+I LN+R LF+FLL F
Sbjct  1    MSRAGGITNAVNVGIAVQADWENREFISNISLNVRRLFEFLLQF  44


 Score = 30.4 bits (67),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL++LNEKL  L+ R
Sbjct  45   EATTKSKLAALNEKLDILEHR  65



>ref|XP_009418655.1| PREDICTED: protein BRICK1-like [Musa acuminata subsp. malaccensis]
Length=84

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGG+TNAVNVGIAVQADWE+REFI++I LNIR LFDFLL F
Sbjct  1    MARAGGMTNAVNVGIAVQADWENREFIANISLNIRRLFDFLLQF  44



>ref|XP_010244689.1| PREDICTED: protein BRICK 1-like [Nelumbo nucifera]
Length=84

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGGITNAVNVGIAVQADWE+REFISHI LN+R LF+FL+ F
Sbjct  1    MARAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLIQF  44



>ref|XP_009140374.1| PREDICTED: protein BRICK 1 [Brassica rapa]
 emb|CDY25614.1| BnaA04g13060D [Brassica napus]
 emb|CDX89497.1| BnaC04g35160D [Brassica napus]
Length=86

 Score = 76.3 bits (186),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 1/45 (2%)
 Frame = +2

Query  104  MARAGG-ITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MA+AGG ITNAVNVGIAVQADWE+REFISHI LN+R LF+FL+ F
Sbjct  1    MAKAGGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQF  45


 Score = 32.3 bits (72),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            E+TTK+KL+SLNEKL  L+RR
Sbjct  46   ESTTKSKLASLNEKLDLLERR  66



>ref|XP_010429193.1| PREDICTED: protein BRICK 1-like [Camelina sativa]
Length=85

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MA+AGGITNAVNVGIAVQADWE+REFISHI LN+R LF+FL+ F
Sbjct  1    MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQF  44



>emb|CDY13739.1| BnaA09g42410D [Brassica napus]
Length=80

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 2/46 (4%)
 Frame = +2

Query  104  MARAGG--ITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MA+AGG  ITNAVNVGIAVQADWE+REFISHI LN+R LF+FLL F
Sbjct  1    MAKAGGGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLLQF  46



>ref|XP_003563735.1| PREDICTED: probable protein BRICK1 [Brachypodium distachyon]
 ref|XP_010227729.1| PREDICTED: probable protein BRICK1 [Brachypodium distachyon]
Length=85

 Score = 71.6 bits (174),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = +2

Query  104  MARAGG-ITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGG + +AVNVGIAVQADWE+REFIS+I LN+R LFDFLL F
Sbjct  1    MARAGGGMGSAVNVGIAVQADWENREFISNISLNVRRLFDFLLRF  45


 Score = 33.5 bits (75),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL +L+R+
Sbjct  46   EATTKSKLASLNEKLDSLERK  66



>ref|NP_001105190.1| protein BRICK1 [Zea mays]
 sp|Q8RW98.1|BRK1_MAIZE RecName: Full=Protein BRICK1 [Zea mays]
 gb|AAM18794.1| BRICK1 [Zea mays]
 gb|ACG24817.1| protein BRICK1 [Zea mays]
 gb|ACG32442.1| protein BRICK1 [Zea mays]
 gb|ACG33165.1| protein BRICK1 [Zea mays]
 gb|ACG37453.1| protein BRICK1 [Zea mays]
 gb|ACG45161.1| protein BRICK1 [Zea mays]
 gb|AFW74145.1| brick1 [Zea mays]
Length=84

 Score = 73.2 bits (178),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            M R GG+ N VNVGIAVQADWE+REFIS+I LN+R LFDFLL F
Sbjct  1    MGRGGGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRF  44


 Score = 31.6 bits (70),  Expect(2) = 2e-13, Method: Composition-based stats.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL  L+R+
Sbjct  45   EATTKSKLASLNEKLDILERK  65



>ref|XP_004954506.1| PREDICTED: protein BRICK1-like [Setaria italica]
Length=84

 Score = 72.8 bits (177),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            M R GG+ N VNVGIAVQADWE+REFIS+I LN+R LFDFLL F
Sbjct  1    MGRGGGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRF  44


 Score = 31.2 bits (69),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRRlqllelqvaaaaanpalFN  437
            EATTK+KL+SLNEKL  L+R+L++LE+QV++A  NP++FN
Sbjct  45   EATTKSKLASLNEKLDILERKLEVLEVQVSSATTNPSVFN  84



>gb|EEE58106.1| hypothetical protein OsJ_08984 [Oryza sativa Japonica Group]
Length=336

 Score = 70.9 bits (172),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 2/46 (4%)
 Frame = +2

Query  104  MARAGG--ITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGG  + N VNVGIAVQADWE+REFIS+I LN+R LFDFLL F
Sbjct  1    MARAGGHGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRF  46


 Score = 33.1 bits (74),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL  L+R+
Sbjct  47   EATTKSKLASLNEKLDILERK  67



>ref|NP_001048610.1| Os02g0829900 [Oryza sativa Japonica Group]
 sp|Q84VA7.1|BRK1_ORYSJ RecName: Full=Probable protein BRICK1 [Oryza sativa Japonica 
Group]
 gb|AAO72702.1| unknown [Oryza sativa Japonica Group]
 dbj|BAD22945.1| putative BRICK1 [Oryza sativa Japonica Group]
 dbj|BAF10524.1| Os02g0829900 [Oryza sativa Japonica Group]
 gb|EEC74297.1| hypothetical protein OsI_09549 [Oryza sativa Indica Group]
Length=86

 Score = 70.9 bits (172),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 2/46 (4%)
 Frame = +2

Query  104  MARAGG--ITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGG  + N VNVGIAVQADWE+REFIS+I LN+R LFDFLL F
Sbjct  1    MARAGGHGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRF  46


 Score = 32.7 bits (73),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL+SLNEKL  L+R+
Sbjct  47   EATTKSKLASLNEKLDILERK  67



>ref|XP_002454840.1| hypothetical protein SORBIDRAFT_04g038300 [Sorghum bicolor]
 gb|EES07816.1| hypothetical protein SORBIDRAFT_04g038300 [Sorghum bicolor]
Length=84

 Score = 73.2 bits (178),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            M R GG+ N VNVGIAVQADWE+REFIS+I LN+R LFDFLL F
Sbjct  1    MGRGGGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRF  44


 Score = 30.0 bits (66),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRRlqllelqvaaaaanpalFN  437
            EATTK+KL++LNEKL  L+R+L++LE+QV++A  NP++FN
Sbjct  45   EATTKSKLATLNEKLDILERKLEVLEVQVSSATTNPSVFN  84



>ref|XP_006648169.1| PREDICTED: probable protein BRICK1-like [Oryza brachyantha]
Length=86

 Score = 70.9 bits (172),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 2/46 (4%)
 Frame = +2

Query  104  MARAGG--ITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGG  + N VNVGIAVQADWE+REFIS+I LN+R LFDFLL F
Sbjct  1    MARAGGHGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRF  46


 Score = 31.2 bits (69),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            EATTK+KL++LNEKL  L+R+
Sbjct  47   EATTKSKLATLNEKLDILERK  67



>ref|XP_009606293.1| PREDICTED: transcription factor GTE2-like [Nicotiana tomentosiformis]
Length=605

 Score = 80.5 bits (197),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV   + ALS +  Q +++DV+    NK     P P++ +QK  KG  GE
Sbjct  474   DNETLWELDRFVSYHRKALSAMQRQGITEDVAATQLNKSPEKAPTPEHAMQKNKKGDIGE  533

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGE+IP  + P V IEKD
Sbjct  534   EDVDIGEEIPVENFPPVQIEKD  555



>gb|EMS63713.1| hypothetical protein TRIUR3_10832 [Triticum urartu]
Length=88

 Score = 70.9 bits (172),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 3/47 (6%)
 Frame = +2

Query  104  MARAG---GITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAG   G+ +AVNVGIAVQADWE+REFIS+I LN+R LFDFLL F
Sbjct  1    MARAGQGGGMGSAVNVGIAVQADWENREFISNISLNVRRLFDFLLRF  47


 Score = 31.2 bits (69),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRRlqllelqvaaaaanpalFN  437
            EATTK+KL+SLNEKL +L+R+L++LE+QV++A  NP++FN
Sbjct  48   EATTKSKLASLNEKLDSLERKLEVLEVQVSSATTNPSVFN  87



>dbj|BAJ92386.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=88

 Score = 71.2 bits (173),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 3/47 (6%)
 Frame = +2

Query  104  MARAG---GITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAG   G+ +AVNVGIAVQADWE+REFIS+I LN+R LFDFLL F
Sbjct  1    MARAGQGGGMGSAVNVGIAVQADWENREFISNISLNVRRLFDFLLRF  47


 Score = 30.8 bits (68),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRRlqllelqvaaaaanpalFN  437
            EATTK+KL+SLNEKL  L+R+L++LE+QV++A  NP++FN
Sbjct  48   EATTKSKLASLNEKLDGLERKLEVLEVQVSSATTNPSVFN  87



>ref|XP_002319999.2| hypothetical protein POPTR_0014s01030g [Populus trichocarpa]
 ref|XP_011011725.1| PREDICTED: protein BRICK 1 [Populus euphratica]
 gb|ABK96282.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE98314.2| hypothetical protein POPTR_0014s01030g [Populus trichocarpa]
Length=98

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 41/51 (80%), Gaps = 7/51 (14%)
 Frame = +2

Query  104  MARAGG-------ITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MARAGG       ITNAVNVGIAVQADWE+REFISHI LNIR LFDFL+ F
Sbjct  1    MARAGGGGGGGGGITNAVNVGIAVQADWENREFISHISLNIRRLFDFLIQF  51



>ref|XP_009784115.1| PREDICTED: transcription factor GTE7-like [Nicotiana sylvestris]
Length=597

 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV   K ALS +  Q +++DV     NK     P P++ + K  KG  GE
Sbjct  466   DNETLWELDRFVSYHKKALSAMQRQEITEDVVATQLNKSPEKAPTPEHAMLKNKKGDIGE  525

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGE+IP  + P V IEKD
Sbjct  526   EDVDIGEEIPVENFPPVQIEKD  547



>gb|ABR17532.1| unknown [Picea sitchensis]
Length=83

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            MA++GGI+NAVNVGIAVQ DW++REF S + LN+R LF+FLL F
Sbjct  1    MAKSGGISNAVNVGIAVQTDWDNREFSSALALNVRRLFEFLLQF  44



>ref|XP_006357759.1| PREDICTED: transcription factor GTE7-like isoform X2 [Solanum 
tuberosum]
Length=592

 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 73/120 (61%), Gaps = 0/120 (0%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL T+V S K A+S +    ++++ +    NK     P P++ + +I K    E
Sbjct  466   DNETLWELDTYVISHKEAMSKIERPGVTENAAAVLLNKSPEKAPTPEHAMPEIKKVDVVE  525

Query  1293  EDVDIGEDIPNSDIPLVVIEKDIsgtssssasssssdssssgsssgsdSEDTVQSPYVEA  1114
             EDVDIGE+IP  + P V I+KD S +S SS+ S SS   S  SS     ED+VQSPYVEA
Sbjct  526   EDVDIGEEIPGENFPPVQIDKDPSSSSGSSSGSGSSSGDSGSSSGSDSDEDSVQSPYVEA  585



>emb|CDY08771.1| BnaA06g24530D [Brassica napus]
Length=354

 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q    +VS     +  A+E    +  ++  KG AGE
Sbjct  216   DNETLWELDRFVTNYKKMASKIKRQGFILNVSTPPAARHMASEAEMGSAEKRTRKGDAGE  275

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  276   EDVDIGEDIPIEDYPSVEIERD  297



>ref|XP_009150652.1| PREDICTED: transcription factor GTE7 [Brassica rapa]
Length=545

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q    +VS     +  A+E    +  ++  KG AGE
Sbjct  409   DNETLWELDRFVTNYKKMASKIKRQGFIHNVSTPPAARHMASEAEMGSAEKRTRKGDAGE  468

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  469   EDVDIGEDIPIEDYPSVEIERD  490



>ref|XP_006357758.1| PREDICTED: transcription factor GTE7-like isoform X1 [Solanum 
tuberosum]
Length=619

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL T+V S K A+S +    ++++ +    NK     P P++ + +I K    E
Sbjct  466   DNETLWELDTYVISHKEAMSKIERPGVTENAAAVLLNKSPEKAPTPEHAMPEIKKVDVVE  525

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGE+IP  + P V I+KD
Sbjct  526   EDVDIGEEIPGENFPPVQIDKD  547



>ref|XP_006394005.1| hypothetical protein EUTSA_v10003870mg [Eutrema salsugineum]
 gb|ESQ31291.1| hypothetical protein EUTSA_v10003870mg [Eutrema salsugineum]
Length=568

 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++ S   P  +T+      +  ++  KG AGE
Sbjct  432   DNETLWELDRFVTNYKKMASKIKRQGFIRNASTP-PRNMTSVAAEMGSAEKRTRKGDAGE  490

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  491   EDVDIGEDIPIEDYPSVEIERD  512



>emb|CDY65645.1| BnaAnng20870D [Brassica napus]
Length=509

 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q    +VS     +  A++    +  ++  KG AGE
Sbjct  371   DNETLWELDRFVTNYKKMASKIKRQGFIHNVSTPPAARHMASDAEIGSAEKRTRKGDAGE  430

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  431   EDVDIGEDIPIEDYPSVEIERD  452



>ref|XP_006394006.1| hypothetical protein EUTSA_v10003870mg [Eutrema salsugineum]
 gb|ESQ31292.1| hypothetical protein EUTSA_v10003870mg [Eutrema salsugineum]
Length=597

 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++ S   P  +T+      +  ++  KG AGE
Sbjct  461   DNETLWELDRFVTNYKKMASKIKRQGFIRNASTP-PRNMTSVAAEMGSAEKRTRKGDAGE  519

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  520   EDVDIGEDIPIEDYPSVEIERD  541



>ref|XP_010463416.1| PREDICTED: transcription factor GTE7-like [Camelina sativa]
Length=584

 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++V+   P  +T+   +  +  ++  KG AGE
Sbjct  450   DNETLWELDRFVTNYKKMASKIKRQGFIRNVTTP-PRNMTSMAEM-GSAEKRTRKGDAGE  507

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  508   EDVDIGEDIPIEDYPSVEIERD  529



>ref|XP_010444571.1| PREDICTED: transcription factor GTE7 [Camelina sativa]
Length=589

 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++V+   P  +T+   +  +  ++  KG AGE
Sbjct  456   DNETLWELDRFVTNYKKMASKIKRQGFIRNVTTP-PRNMTSMAEM-GSAEKRTRKGDAGE  513

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  514   EDVDIGEDIPIEDYPSVEIERD  535



>ref|XP_002866683.1| hypothetical protein ARALYDRAFT_919899 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42942.1| hypothetical protein ARALYDRAFT_919899 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++VS   P  +T+   +  +  ++  +G AGE
Sbjct  444   DNETLWELDRFVTNYKKMASKIKRQGFIRNVSTP-PRNMTSVAEM-GSAEKRTRRGDAGE  501

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  502   EDVDIGEDIPIEDYPSVEIERD  523



>gb|KFK28231.1| hypothetical protein AALP_AA8G489400 [Arabis alpina]
Length=583

 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++VS   P  +T+   +  +  ++  KG AGE
Sbjct  447   DNETLWELDRFVTNYKKMASKIKRQGFIRNVSTP-PRNITSLTEM-GSAEKRTRKGDAGE  504

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  505   EDVDIGEDIPIEDYPSVEIERD  526



>ref|XP_010484396.1| PREDICTED: transcription factor GTE7-like isoform X2 [Camelina 
sativa]
Length=586

 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++V+   P  +T+   +  +  ++  KG AGE
Sbjct  454   DNETLWELDRFVTNYKKMASKIKRQGFIRNVTTP-PRNMTSMAEM-GSAEKRTRKGDAGE  511

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  512   EDVDIGEDIPIEDYPSVEIERD  533



>ref|XP_010484395.1| PREDICTED: transcription factor GTE7-like isoform X1 [Camelina 
sativa]
Length=588

 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++V+   P  +T+   +  +  ++  KG AGE
Sbjct  454   DNETLWELDRFVTNYKKMASKIKRQGFIRNVTTP-PRNMTSMAEM-GSAEKRTRKGDAGE  511

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  512   EDVDIGEDIPIEDYPSVEIERD  533



>ref|NP_201366.3| global transcription factor group E7 [Arabidopsis thaliana]
 sp|Q7Y214.1|GTE7_ARATH RecName: Full=Transcription factor GTE7; AltName: Full=Bromodomain-containing 
protein GTE7; AltName: Full=Protein GLOBAL 
TRANSCRIPTION FACTOR GROUP E7 [Arabidopsis thaliana]
 gb|AAP40447.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98957.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABO38781.1| At5g65630 [Arabidopsis thaliana]
 gb|AED98079.1| global transcription factor group E7 [Arabidopsis thaliana]
Length=590

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++VS   P +  A+     +  ++  +G AGE
Sbjct  453   DNETLWELDRFVTNYKKMASKIKRQGFIRNVST--PPRNMASVAEMGSAEKRTRRGDAGE  510

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  511   EDVDIGEDIPIEDYPSVEIERD  532



>dbj|BAA98182.1| unnamed protein product [Arabidopsis thaliana]
Length=643

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++VS   P +  A+     +  ++  +G AGE
Sbjct  508   DNETLWELDRFVTNYKKMASKIKRQGFIRNVST--PPRNMASVAEMGSAEKRTRRGDAGE  565

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  566   EDVDIGEDIPIEDYPSVEIERD  587



>ref|XP_010105120.1| Transcription factor GTE7 [Morus notabilis]
 gb|EXC03905.1| Transcription factor GTE7 [Morus notabilis]
Length=605

 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 47/99 (47%), Gaps = 27/99 (27%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQN------------  1330
             D ETLWEL  FVG+ K  +S +  Q +           + A  P PQN            
Sbjct  467   DTETLWELDRFVGNYKKMVSKMKRQAL-----------MQAQNPAPQNTDRNTSLESDPA  515

Query  1329  ----VVQKINKGHAGEEDVDIGEDIPNSDIPLVVIEKDI  1225
                 VV+      A EEDVDIGEDIP  D P VVIEKD+
Sbjct  516   DAAAVVKSKKVDAAAEEDVDIGEDIPMGDFPPVVIEKDV  554



>ref|XP_006281511.1| hypothetical protein CARUB_v10027609mg [Capsella rubella]
 gb|EOA14409.1| hypothetical protein CARUB_v10027609mg [Capsella rubella]
Length=587

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 48/82 (59%), Gaps = 2/82 (2%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++V+   P  +T+   I  +  ++  KG  GE
Sbjct  452   DNETLWELDRFVTNYKKMASKIKRQGFIRNVTTP-PRNMTSLAEI-GSAEKRTRKGDGGE  509

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  510   EDVDIGEDIPIEDYPSVEIERD  531



>gb|ACG38184.1| hypothetical protein [Zea mays]
 gb|ACG39111.1| hypothetical protein [Zea mays]
Length=65

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  104  MARAGGITNAVNVGIAVQADWESREFISHIYLNIR  208
            M R GG+ N VNVGIAVQADWE+REFIS+I LN+R
Sbjct  1    MGRGGGMGNPVNVGIAVQADWENREFISNISLNVR  35



>gb|KDO67980.1| hypothetical protein CISIN_1g009417mg [Citrus sinensis]
Length=534

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMS--KDVSGGYPNKLTANEPIPQNV-VQKINKGH  1303
             D ETLWEL  FV + K  +S +  Q +    +VS    N++   E I      +K  KG 
Sbjct  405   DTETLWELDRFVTNYKKMVSKIKRQALMGINNVSSADANRVPMAEKIEVATDAKKAKKGE  464

Query  1302  AGEEDVDIGEDIPNSDIPLVVIEKD  1228
             AG+EDVDIG++IP S  P V IEKD
Sbjct  465   AGDEDVDIGDEIPMSSFPPVEIEKD  489



>gb|KFK25327.1| hypothetical protein AALP_AA8G098400 [Arabis alpina]
Length=560

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKG-HAG  1297
             DNETLWEL  FV + K   S +  Q   ++VS   P  ++    I  +  +K+ KG  AG
Sbjct  426   DNETLWELDRFVTNYKKMASKIKRQGFIQNVSTP-PRDMSLVTEI-GSAEKKVRKGGDAG  483

Query  1296  EEDVDIGEDIPNSDIPLVVIEKD  1228
             EEDVDIGEDIP  D P V IE+D
Sbjct  484   EEDVDIGEDIPIEDYPSVEIERD  506



>ref|XP_006286650.1| hypothetical protein CARUB_v10002520mg [Capsella rubella]
 gb|EOA19548.1| hypothetical protein CARUB_v10002520mg [Capsella rubella]
Length=580

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 44/82 (54%), Gaps = 1/82 (1%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++VS   P  L     +     +    G AGE
Sbjct  447   DNETLWELDRFVTNYKKMASKIKRQGFIQNVSTP-PRNLPLMTEMGSAEKRGRKGGEAGE  505

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  506   EDVDIGEDIPIEDYPSVEIERD  527



>ref|XP_010422833.1| PREDICTED: transcription factor GTE2-like [Camelina sativa]
Length=583

 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++ S   P  L     +     +    G AGE
Sbjct  450   DNETLWELERFVTNYKKMASKIKRQGFIQNASTP-PRNLPMVTEMGSAEKRGRKGGEAGE  508

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  509   EDVDIGEDIPIEDYPSVEIERD  530



>ref|XP_004147512.1| PREDICTED: transcription factor GTE7-like [Cucumis sativus]
 ref|XP_004163939.1| PREDICTED: transcription factor GTE7-like [Cucumis sativus]
 gb|KGN53881.1| hypothetical protein Csa_4G179160 [Cucumis sativus]
Length=533

 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 48/87 (55%), Gaps = 9/87 (10%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNV-----VQKINK  1309
             D ETLWEL   V + K  +S +  Q +    S   PN +    P P+ +      +K  K
Sbjct  408   DTETLWELDRLVTNWKKMMSKIKRQALITAASMK-PNGVM---PTPEKIEVGSETKKQRK  463

Query  1308  GHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
             G AGEEDVDIG+++P S+ P V IEKD
Sbjct  464   GEAGEEDVDIGDEMPASNFPPVEIEKD  490



>ref|XP_008454445.1| PREDICTED: transcription factor GTE7 [Cucumis melo]
Length=533

 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 48/87 (55%), Gaps = 9/87 (10%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNV-----VQKINK  1309
             D ETLWEL   V + K  +S +  Q +    S   PN +    P P+ +      +K  K
Sbjct  408   DTETLWELDRLVTNWKKMMSKIKRQALITAASM-KPNGVM---PTPEKIEVGSETKKQRK  463

Query  1308  GHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
             G AGEEDVDIG+++P S+ P V IEKD
Sbjct  464   GEAGEEDVDIGDEMPASNFPPVEIEKD  490



>gb|KDO67983.1| hypothetical protein CISIN_1g009417mg [Citrus sinensis]
Length=382

 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 49/89 (55%), Gaps = 10/89 (11%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMS--KDVSGGYPNKLTANEPIPQNV-----VQKI  1315
             D ETLWEL  FV + K  +S +  Q +    +VS    N+     P+ + +      +K 
Sbjct  252   DTETLWELDRFVTNYKKMVSKIKRQALMGINNVSSADANREV---PMAEKIEVATDAKKA  308

Query  1314  NKGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
              KG AG+EDVDIG++IP S  P V IEKD
Sbjct  309   KKGEAGDEDVDIGDEIPMSSFPPVEIEKD  337



>ref|XP_010491731.1| PREDICTED: transcription factor GTE2-like [Camelina sativa]
Length=579

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++ S   P  L     +     +    G AGE
Sbjct  446   DNETLWELDRFVTNYKKMASKIKRQGFIQNASTP-PRNLPMVTEMGSAEKRGRKGGEAGE  504

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  505   EDVDIGEDIPIEDYPSVEIERD  526



>ref|XP_002518322.1| bromodomain-containing protein, putative [Ricinus communis]
 gb|EEF44082.1| bromodomain-containing protein, putative [Ricinus communis]
Length=634

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 50/89 (56%), Gaps = 9/89 (10%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCM------SKDVSGGYPNK-LTANEPIPQNVVQKI  1315
             D ETLWEL  FV + K  +S +  Q +         VS G  NK ++ NE I     +K 
Sbjct  509   DTETLWELDRFVTNYKKMVSKIKRQALMGIAPTGNAVSEG--NKDVSVNERIDITEAKKP  566

Query  1314  NKGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
              KG AG+EDVDIG+++P S  P V IEKD
Sbjct  567   KKGDAGDEDVDIGDEMPMSSFPPVEIEKD  595



>emb|CDX78390.1| BnaA03g03020D [Brassica napus]
Length=239

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 46/83 (55%), Gaps = 3/83 (4%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKG-HAG  1297
             DNETLWEL  FV + K   S +  Q   +++S    N     E    +  +++ KG   G
Sbjct  110   DNETLWELDRFVTNYKKMASKIKRQGFIQNLSTPTRNMPPVMEM--GSAEKRVRKGGDGG  167

Query  1296  EEDVDIGEDIPNSDIPLVVIEKD  1228
             EEDVDIGEDIP  D P V IE+D
Sbjct  168   EEDVDIGEDIPIEDYPSVEIERD  190



>emb|CDX70356.1| BnaC03g04400D [Brassica napus]
Length=247

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 46/83 (55%), Gaps = 3/83 (4%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKG-HAG  1297
             DNETLWEL  FV + K   S +  Q   +++S    N     E    +  +++ KG   G
Sbjct  118   DNETLWELDRFVTNYKKMASKIKRQGFIQNLSTPTRNMPPVMEM--GSAEKRVRKGGDGG  175

Query  1296  EEDVDIGEDIPNSDIPLVVIEKD  1228
             EEDVDIGEDIP  D P V IE+D
Sbjct  176   EEDVDIGEDIPIEDYPSVEIERD  198



>ref|XP_006422658.1| hypothetical protein CICLE_v10028177mg [Citrus clementina]
 ref|XP_006422659.1| hypothetical protein CICLE_v10028177mg [Citrus clementina]
 gb|ESR35898.1| hypothetical protein CICLE_v10028177mg [Citrus clementina]
 gb|ESR35899.1| hypothetical protein CICLE_v10028177mg [Citrus clementina]
 gb|KDO67978.1| hypothetical protein CISIN_1g009417mg [Citrus sinensis]
 gb|KDO67979.1| hypothetical protein CISIN_1g009417mg [Citrus sinensis]
Length=535

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 49/89 (55%), Gaps = 10/89 (11%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMS--KDVSGGYPNKLTANEPIPQNV-----VQKI  1315
             D ETLWEL  FV + K  +S +  Q +    +VS    N+     P+ + +      +K 
Sbjct  405   DTETLWELDRFVTNYKKMVSKIKRQALMGINNVSSADANREV---PMAEKIEVATDAKKA  461

Query  1314  NKGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
              KG AG+EDVDIG++IP S  P V IEKD
Sbjct  462   KKGEAGDEDVDIGDEIPMSSFPPVEIEKD  490



>ref|XP_006486782.1| PREDICTED: transcription factor GTE7-like [Citrus sinensis]
Length=535

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 49/89 (55%), Gaps = 10/89 (11%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMS--KDVSGGYPNKLTANEPIPQNV-----VQKI  1315
             D ETLWEL  FV + K  +S +  Q +    +VS    N+     P+ + +      +K 
Sbjct  405   DTETLWELDRFVTNYKKMVSKIKRQALMGINNVSSADANREV---PMAEKIEVATDAKKA  461

Query  1314  NKGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
              KG AG+EDVDIG++IP S  P V IEKD
Sbjct  462   KKGEAGDEDVDIGDEIPMSSFPPVEIEKD  490



>ref|XP_006422656.1| hypothetical protein CICLE_v10028177mg [Citrus clementina]
 ref|XP_006422657.1| hypothetical protein CICLE_v10028177mg [Citrus clementina]
 gb|ESR35896.1| hypothetical protein CICLE_v10028177mg [Citrus clementina]
 gb|ESR35897.1| hypothetical protein CICLE_v10028177mg [Citrus clementina]
 gb|KDO67981.1| hypothetical protein CISIN_1g009417mg [Citrus sinensis]
 gb|KDO67982.1| hypothetical protein CISIN_1g009417mg [Citrus sinensis]
Length=523

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 49/89 (55%), Gaps = 10/89 (11%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMS--KDVSGGYPNKLTANEPIPQNV-----VQKI  1315
             D ETLWEL  FV + K  +S +  Q +    +VS    N+     P+ + +      +K 
Sbjct  405   DTETLWELDRFVTNYKKMVSKIKRQALMGINNVSSADANREV---PMAEKIEVATDAKKA  461

Query  1314  NKGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
              KG AG+EDVDIG++IP S  P V IEKD
Sbjct  462   KKGEAGDEDVDIGDEIPMSSFPPVEIEKD  490



>ref|XP_001759003.1| predicted protein [Physcomitrella patens]
 gb|ABF67493.1| BRICK1/HSPC300 [Physcomitrella patens]
 gb|EDQ76072.1| predicted protein [Physcomitrella patens]
Length=79

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  119  GITNAVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            GI N+V VGIAVQ+DW++R F S + LN+R LF+FLL F
Sbjct  5    GINNSVAVGIAVQSDWDNRHFSSSLSLNVRRLFEFLLQF  43



>ref|XP_010648048.1| PREDICTED: transcription factor GTE7-like [Vitis vinifera]
Length=568

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 6/88 (7%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCM--SKDVSGGYPNKLTANE----PIPQNVVQKIN  1312
             D ETLWEL   V + K  +S +  Q +  + + +    N+ + NE     +   + +K  
Sbjct  438   DTETLWELDRLVTNWKKMVSKIKRQALMVNNNTAATEVNRSSMNERTEPSLAPAMAKKPK  497

Query  1311  KGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
             KG AGEEDVDIG++IP +  P V IEKD
Sbjct  498   KGEAGEEDVDIGDEIPTATFPPVEIEKD  525



>ref|XP_004231975.1| PREDICTED: transcription factor GTE7 isoform X2 [Solanum lycopersicum]
Length=588

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 74/122 (61%), Gaps = 0/122 (0%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL+ +V S K ++S +    ++++ +    NK     P P++   +IN+    E
Sbjct  462   DNETLWELYRYVISDKESMSKIERSGVTENAAAVLLNKSPEKAPTPEHAKPEINEVDVVE  521

Query  1293  EDVDIGEDIPNSDIPLVVIEKDIsgtssssasssssdssssgsssgsdSEDTVQSPYVEA  1114
             EDVDIGE+IP  + P V I+KD S +S SS+ S SS   S  SS     ED+VQSPYVEA
Sbjct  522   EDVDIGEEIPGENFPPVHIDKDPSSSSGSSSGSDSSSGDSGSSSESDSDEDSVQSPYVEA  581

Query  1113  *K  1108
              K
Sbjct  582   AK  583



>gb|KHG12834.1| Transcription factor GTE4 -like protein [Gossypium arboreum]
Length=560

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 3/85 (4%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQC-MSKDVSGGYPNKL-TANEPIPQNV-VQKINKGH  1303
             D ETLWEL  FV + K  +S +  Q  M+ +V+    N+  T  E +   + ++K  KG 
Sbjct  435   DTETLWELDRFVTNYKKMVSKIKRQALMANNVASNDSNRRETTVEKMDAAMEMKKPKKGD  494

Query  1302  AGEEDVDIGEDIPNSDIPLVVIEKD  1228
             AG+EDVDIG+++P S  P V IEKD
Sbjct  495   AGDEDVDIGDEMPMSSFPPVEIEKD  519



>emb|CBI35445.3| unnamed protein product [Vitis vinifera]
Length=564

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 6/88 (7%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCM--SKDVSGGYPNKLTANE----PIPQNVVQKIN  1312
             D ETLWEL   V + K  +S +  Q +  + + +    N+ + NE     +   + +K  
Sbjct  434   DTETLWELDRLVTNWKKMVSKIKRQALMVNNNTAATEVNRSSMNERTEPSLAPAMAKKPK  493

Query  1311  KGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
             KG AGEEDVDIG++IP +  P V IEKD
Sbjct  494   KGEAGEEDVDIGDEIPTATFPPVEIEKD  521



>ref|XP_010529112.1| PREDICTED: transcription factor GTE2-like, partial [Tarenaya 
hassleriana]
Length=400

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKD-VSGGYPNKLTANEPIPQ--NVVQKINKGH  1303
             DNETLWEL  FV + K  +S +  Q   ++ VS    N L    P+ +  +  +K  KG 
Sbjct  266   DNETLWELDRFVTNYKKMVSKIKRQGFIRNNVSTPPRNNLP---PVTEMGSAEKKGKKGD  322

Query  1302  AGEEDVDIGEDIPNSDIPLVVIEKD  1228
             AGE++VDIGEDIP  + P V IEKD
Sbjct  323   AGEDEVDIGEDIPIENYPSVEIEKD  347



>ref|XP_009131170.1| PREDICTED: transcription factor GTE2 [Brassica rapa]
Length=530

 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 46/83 (55%), Gaps = 3/83 (4%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKG-HAG  1297
             DNETLWEL  FV + K   S +  Q   +++S    N     E    +  +++ KG   G
Sbjct  401   DNETLWELDRFVTNYKKMASKIKRQGFIQNLSTPTRNMPPVMEM--GSAEKRVRKGGDGG  458

Query  1296  EEDVDIGEDIPNSDIPLVVIEKD  1228
             EEDVDIGEDIP  D P V IE+D
Sbjct  459   EEDVDIGEDIPIEDYPSVEIERD  481



>ref|XP_007042774.1| Global transcription factor group E2, putative isoform 5, partial 
[Theobroma cacao]
 gb|EOX98605.1| Global transcription factor group E2, putative isoform 5, partial 
[Theobroma cacao]
Length=547

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQC-MSKDVSGGYPNK--LTANEPIPQNVVQKINKGH  1303
             D ETLWEL  FV + K  +S +  Q  M+ +V     N+  +T  +      ++K  KG 
Sbjct  441   DTETLWELDRFVTNYKKMVSKIKRQALMANNVVSNDSNREEVTVEKIEVAMEMKKPKKGD  500

Query  1302  AGEEDVDIGEDIPNSDIPLVVIEKD  1228
             AGEEDVDIG+++P S  P V IEKD
Sbjct  501   AGEEDVDIGDEMPMSSFPPVEIEKD  525



>ref|XP_007042770.1| Global transcription factor group E2, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007042771.1| Global transcription factor group E2, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007042772.1| Global transcription factor group E2, putative isoform 1 [Theobroma 
cacao]
 gb|EOX98601.1| Global transcription factor group E2, putative isoform 1 [Theobroma 
cacao]
 gb|EOX98602.1| Global transcription factor group E2, putative isoform 1 [Theobroma 
cacao]
 gb|EOX98603.1| Global transcription factor group E2, putative isoform 1 [Theobroma 
cacao]
Length=566

 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQC-MSKDVSGGYPNK--LTANEPIPQNVVQKINKGH  1303
             D ETLWEL  FV + K  +S +  Q  M+ +V     N+  +T  +      ++K  KG 
Sbjct  441   DTETLWELDRFVTNYKKMVSKIKRQALMANNVVSNDSNREEVTVEKIEVAMEMKKPKKGD  500

Query  1302  AGEEDVDIGEDIPNSDIPLVVIEKD  1228
             AGEEDVDIG+++P S  P V IEKD
Sbjct  501   AGEEDVDIGDEMPMSSFPPVEIEKD  525



>sp|Q9LXA7.2|GTE2_ARATH RecName: Full=Transcription factor GTE2; AltName: Full=Bromodomain-containing 
protein GTE2; AltName: Full=Protein GLOBAL 
TRANSCRIPTION FACTOR GROUP E2 [Arabidopsis thaliana]
Length=581

 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + +   S +  Q   ++VS   P  +     +     +    G AGE
Sbjct  448   DNETLWELDRFVTNYRKMASKIKRQGFIQNVSTP-PRNMPPVTEMGSAEKRGRKGGEAGE  506

Query  1293  EDVDIGEDIPNSDIPLVVIEK  1231
             EDVDIGEDIP  D P V IE+
Sbjct  507   EDVDIGEDIPVEDYPSVEIER  527



>ref|NP_196617.1| global transcription factor group E2 [Arabidopsis thaliana]
 emb|CAB89388.1| bromodomain protein-like [Arabidopsis thaliana]
 gb|AED91562.1| global transcription factor group E2 [Arabidopsis thaliana]
Length=678

 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + +   S +  Q   ++VS   P  +     +     +    G AGE
Sbjct  523   DNETLWELDRFVTNYRKMASKIKRQGFIQNVSTP-PRNMPPVTEMGSAEKRGRKGGEAGE  581

Query  1293  EDVDIGEDIPNSDIPLVVIEK  1231
             EDVDIGEDIP  D P V IE+
Sbjct  582   EDVDIGEDIPVEDYPSVEIER  602



>gb|KHG18778.1| Transcription factor GTE7 -like protein [Gossypium arboreum]
Length=570

 Score = 55.5 bits (132),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKD--VSGGYPNKLTANEPIPQNV-VQKINKGH  1303
             D ETLWEL  FV + K  +S +  Q +  +  VS     +    E I   + ++K  KG 
Sbjct  445   DTETLWELDRFVTNYKKMVSKIKRQALMANNAVSNDSHREEATVEKIEVPMEMKKPKKGD  504

Query  1302  AGEEDVDIGEDIPNSDIPLVVIEKD  1228
             AGEEDVDIG+++P S  P V IEKD
Sbjct  505   AGEEDVDIGDEMPMSSFPPVEIEKD  529



>ref|XP_007200701.1| hypothetical protein PRUPE_ppa003935m2g, partial [Prunus persica]
 gb|EMJ01900.1| hypothetical protein PRUPE_ppa003935m2g, partial [Prunus persica]
Length=150

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 50/95 (53%), Gaps = 13/95 (14%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCM---------SKDVSGGYPNKLTANEPIPQNVV-  1324
             D ETLWEL   V + K  +S +  Q +         +   + G+  +L A+E +      
Sbjct  14    DTETLWELDRLVTNWKKMVSKIKRQALMGNNSNSNSNIASNRGH-EELPASEKVDVAATT  72

Query  1323  --QKINKGHAGEEDVDIGEDIPNSDIPLVVIEKDI  1225
               ++  KG AG+EDVDIG+D+P S  P V IEKD+
Sbjct  73    EPKRAKKGEAGDEDVDIGDDMPMSSFPPVEIEKDV  107



>gb|KDP35948.1| hypothetical protein JCGZ_09920 [Jatropha curcas]
Length=555

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 49/89 (55%), Gaps = 8/89 (9%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCM------SKDVSGGYPNKLTANEPIP-QNVVQKI  1315
             D ETLWEL  FV + K  +S +  Q +      +  VS G    +  NE I   N  +K 
Sbjct  429   DTETLWELDRFVTNYKKMVSKIKRQALMGINNAATAVSDGNKEAI-GNERIDVANEAKKP  487

Query  1314  NKGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
              KG AG+E+VDIG+++P S  P V IEKD
Sbjct  488   KKGDAGDEEVDIGDEMPMSSFPPVEIEKD  516



>ref|XP_006399553.1| hypothetical protein EUTSA_v10012974mg [Eutrema salsugineum]
 gb|ESQ41006.1| hypothetical protein EUTSA_v10012974mg [Eutrema salsugineum]
Length=622

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 42/82 (51%), Gaps = 4/82 (5%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL  FV + K   S +  Q   ++     P  +     +     +    G AGE
Sbjct  492   DNETLWELDRFVTNYKKMASKIKRQGFIQNP----PENMHPVSEMASAEKKGRKGGDAGE  547

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGEDIP  D P V IE+D
Sbjct  548   EDVDIGEDIPIEDYPSVEIERD  569



>ref|XP_010316055.1| PREDICTED: transcription factor GTE7 isoform X1 [Solanum lycopersicum]
Length=590

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKDVSGGYPNKLTANEPIPQNVVQKINKGHAGE  1294
             DNETLWEL+ +V S K ++S +    ++++ +    NK     P P++   +IN+    E
Sbjct  462   DNETLWELYRYVISDKESMSKIERSGVTENAAAVLLNKSPEKAPTPEHAKPEINEVDVVE  521

Query  1293  EDVDIGEDIPNSDIPLVVIEKD  1228
             EDVDIGE+IP  + P V I+KD
Sbjct  522   EDVDIGEEIPGENFPPVHIDKD  543



>ref|XP_004289817.1| PREDICTED: transcription factor GTE7-like isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004289818.1| PREDICTED: transcription factor GTE7-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=579

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 49/93 (53%), Gaps = 10/93 (11%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCM--------SKDVSGGYPNKLTANEPIPQNVVQ-  1321
             D ETLWEL   V + K  +S +  Q +        +   + G   +L A+E I  +  + 
Sbjct  444   DTETLWELDRLVTNYKKMVSKIKRQALMGNNNSNSNIASNRGSQEELPASEKIDVSATEP  503

Query  1320  -KINKGHAGEEDVDIGEDIPNSDIPLVVIEKDI  1225
              +  KG  G+EDVDIG+D+P S  P V IEKD+
Sbjct  504   KRPKKGEVGDEDVDIGDDMPMSSFPPVEIEKDV  536



>ref|XP_010646991.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor GTE7-like 
[Vitis vinifera]
Length=619

 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 46/84 (55%), Gaps = 5/84 (6%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQ--CMSKDVSGGYPNKLTANEPIPQNVVQKINKGHA  1300
             D ETLWEL  FV + K   S +  Q   M++ ++         + P   +V QK  KG  
Sbjct  487   DIETLWELDRFVSNYKKMESKIRRQGLIMNQTLATQLNKSPVTDNP---DVGQKNKKGEI  543

Query  1299  GEEDVDIGEDIPNSDIPLVVIEKD  1228
             GEEDVDIGE++P S  P V I+KD
Sbjct  544   GEEDVDIGEEMPVSHFPPVEIDKD  567



>ref|XP_002973853.1| hypothetical protein SELMODRAFT_9224, partial [Selaginella moellendorffii]
 ref|XP_002983539.1| hypothetical protein SELMODRAFT_9227, partial [Selaginella moellendorffii]
 gb|EFJ15440.1| hypothetical protein SELMODRAFT_9227, partial [Selaginella moellendorffii]
 gb|EFJ24808.1| hypothetical protein SELMODRAFT_9224, partial [Selaginella moellendorffii]
Length=74

 Score = 48.1 bits (113),  Expect(2) = 5e-04, Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  131  AVNVGIAVQADWESREFISHIYLNIRCLFDFLLHF  235
            + N+G AVQADWE+R+F   + LN+R LF+F+L F
Sbjct  5    SANLGAAVQADWENRQFTGALALNVRKLFEFVLQF  39


 Score = 24.6 bits (52),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 10/21 (48%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +3

Query  318  EATTKTKLSSLNEKLHTLDRR  380
            E+TT+ K++ LN+KL  L+R+
Sbjct  40   ESTTRNKIAILNDKLTALERK  60



>ref|XP_011002956.1| PREDICTED: transcription factor GTE7-like [Populus euphratica]
Length=547

 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 9/91 (10%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCM--------SKDVSGGYPNKLTANEPIPQ-NVVQ  1321
             D ETLWEL  FV + K  +S +  Q +        +  +S G    +  N+ +   N  +
Sbjct  418   DTETLWELDRFVTNYKKMVSKIKRQALMGINRNAGAAAISEGNNKDVPGNDRMEVVNEAK  477

Query  1320  KINKGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
             K  KG  G+EDVDIG+++P S  P V IEKD
Sbjct  478   KPKKGDVGDEDVDIGDEMPMSSFPPVEIEKD  508



>ref|XP_006379135.1| hypothetical protein POPTR_0009s08350g [Populus trichocarpa]
 gb|ERP56932.1| hypothetical protein POPTR_0009s08350g [Populus trichocarpa]
Length=541

 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 9/91 (10%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCM--------SKDVSGGYPNKLTANEPIPQ-NVVQ  1321
             D ETLWEL  FV + K  +S +  Q +        +  +S G    +  N+ +   N  +
Sbjct  418   DTETLWELDRFVTNYKKMVSKIKRQALMGINTNAGATAISEGNNKDVPGNDRMEVVNEAK  477

Query  1320  KINKGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
             K  KG  G+EDVDIG+++P S  P V IEKD
Sbjct  478   KPKKGDVGDEDVDIGDEMPMSSFPPVEIEKD  508



>ref|XP_002313212.2| hypothetical protein POPTR_0009s08350g [Populus trichocarpa]
 gb|EEE87167.2| hypothetical protein POPTR_0009s08350g [Populus trichocarpa]
Length=546

 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 9/91 (10%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCM--------SKDVSGGYPNKLTANEPIPQ-NVVQ  1321
             D ETLWEL  FV + K  +S +  Q +        +  +S G    +  N+ +   N  +
Sbjct  418   DTETLWELDRFVTNYKKMVSKIKRQALMGINTNAGATAISEGNNKDVPGNDRMEVVNEAK  477

Query  1320  KINKGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
             K  KG  G+EDVDIG+++P S  P V IEKD
Sbjct  478   KPKKGDVGDEDVDIGDEMPMSSFPPVEIEKD  508



>ref|XP_006379136.1| hypothetical protein POPTR_0009s08350g [Populus trichocarpa]
 ref|XP_006379137.1| hypothetical protein POPTR_0009s08350g [Populus trichocarpa]
 gb|ERP56933.1| hypothetical protein POPTR_0009s08350g [Populus trichocarpa]
 gb|ERP56934.1| hypothetical protein POPTR_0009s08350g [Populus trichocarpa]
Length=547

 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 9/91 (10%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCM--------SKDVSGGYPNKLTANEPIPQ-NVVQ  1321
             D ETLWEL  FV + K  +S +  Q +        +  +S G    +  N+ +   N  +
Sbjct  418   DTETLWELDRFVTNYKKMVSKIKRQALMGINTNAGATAISEGNNKDVPGNDRMEVVNEAK  477

Query  1320  KINKGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
             K  KG  G+EDVDIG+++P S  P V IEKD
Sbjct  478   KPKKGDVGDEDVDIGDEMPMSSFPPVEIEKD  508



>ref|XP_010244682.1| PREDICTED: transcription factor GTE7-like [Nelumbo nucifera]
Length=636

 Score = 52.8 bits (125),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 48/93 (52%), Gaps = 11/93 (12%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCMSKD-VSGGYPNKLTANEPI----------PQNV  1327
             D ETLWEL  FV + K  +S +  Q ++ + +S    ++   +E                
Sbjct  490   DTETLWELDRFVFNFKKVMSKIKRQSIATNPLSVAQDSQALVDEKTEAAAAAAAAPMSAS  549

Query  1326  VQKINKGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
              +K+ KG   EEDVDIGEDIP ++ P V IEKD
Sbjct  550   AKKVKKGETVEEDVDIGEDIPTNNFPPVEIEKD  582



>ref|XP_010254641.1| PREDICTED: transcription factor GTE7-like [Nelumbo nucifera]
Length=621

 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 51/105 (49%), Gaps = 23/105 (22%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCM-SKDVSGGYPNKLTA---NEPIPQ---------  1333
             D ETLWEL  FV + K  +S +  Q + S  +S      + +   +  +P+         
Sbjct  465   DTETLWELDRFVYNCKKLMSKIKRQAIASNHISAAQEQDIKSPIQDHEMPEAGASERTEA  524

Query  1332  ----------NVVQKINKGHAGEEDVDIGEDIPNSDIPLVVIEKD  1228
                       +  +K+ KG A +EDVDIGEDIP S+ P V IEKD
Sbjct  525   ATAAEAQTSASSARKVKKGEAVDEDVDIGEDIPTSNFPPVEIEKD  569



>ref|XP_010027994.1| PREDICTED: transcription factor GTE2 [Eucalyptus grandis]
 gb|KCW54655.1| hypothetical protein EUGRSUZ_I00604 [Eucalyptus grandis]
Length=600

 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 49/89 (55%), Gaps = 11/89 (12%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCM------SKDVSGGYPNKLTANEPIPQNVVQKIN  1312
             D ETLWEL  FV + K   S +  Q +      + +++   P++  +   +P     K  
Sbjct  467   DTETLWELDRFVCNYKKLASKIKRQGLIHNQVAASEITNKSPDREVSEAVVPH----KGR  522

Query  1311  KGHAG-EEDVDIGEDIPNSDIPLVVIEKD  1228
             +G AG EEDVDIG+++P S+ P V IE+D
Sbjct  523   RGEAGGEEDVDIGDEMPMSNYPPVEIERD  551



>gb|KCW54654.1| hypothetical protein EUGRSUZ_I00604 [Eucalyptus grandis]
Length=637

 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 49/89 (55%), Gaps = 11/89 (12%)
 Frame = -2

Query  1473  DNETLWELHTFVGSQKNALSNVSMQCM------SKDVSGGYPNKLTANEPIPQNVVQKIN  1312
             D ETLWEL  FV + K   S +  Q +      + +++   P++  +   +P     K  
Sbjct  467   DTETLWELDRFVCNYKKLASKIKRQGLIHNQVAASEITNKSPDREVSEAVVPH----KGR  522

Query  1311  KGHAG-EEDVDIGEDIPNSDIPLVVIEKD  1228
             +G AG EEDVDIG+++P S+ P V IE+D
Sbjct  523   RGEAGGEEDVDIGDEMPMSNYPPVEIERD  551



>gb|AGW80641.1| BRK1, partial [Physcomitrium pyriforme]
Length=53

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  140  VGIAVQADWESREFISHIYLNIRCLFDFLLHFGNFQISLLPPSTSPIT  283
            VGIAVQ+DW++R F S + LN+R LF+FLL F +   S L      +T
Sbjct  1    VGIAVQSDWDNRHFSSSLSLNVRRLFEFLLQFESSTRSKLATLNEKLT  48



>gb|AGW80631.1| BRK1, partial [Physcomitrium collenchymatum]
 gb|AGW80632.1| BRK1, partial [Physcomitrium collenchymatum]
 gb|AGW80633.1| BRK1, partial [Physcomitrium eurystomum]
 gb|AGW80634.1| BRK1, partial [Physcomitrium eurystomum]
 gb|AGW80635.1| BRK1, partial [Physcomitrium eurystomum]
 gb|AGW80640.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80642.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80643.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80644.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80646.1| BRK1, partial [Physcomitrium eurystomum]
 gb|AGW80647.1| BRK1, partial [Physcomitrium eurystomum]
 gb|AGW80648.1| BRK1, partial [Physcomitrium eurystomum]
 gb|AGW80650.1| BRK1, partial [Physcomitrium collenchymatum]
 gb|AGW80652.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80653.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80654.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80655.1| BRK1, partial [Physcomitrium pyriforme]
 gb|AGW80656.1| BRK1, partial [Physcomitrium pyriforme]
Length=54

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  140  VGIAVQADWESREFISHIYLNIRCLFDFLLHFGNFQISLLPPSTSPIT  283
            VGIAVQ+DW++R F S + LN+R LF+FLL F +   S L      +T
Sbjct  1    VGIAVQSDWDNRHFSSSLSLNVRRLFEFLLQFESSTRSKLATLNEKLT  48



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4018413329892