BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19373_g2_i2 len=3588 path=[1031:0-222 1254:223-1485 2517:1486-3587]

Length=3588
                                                                      Score     E

ref|XP_009773366.1|  PREDICTED: LRR receptor-like serine/threonin...   1459   0.0      
ref|XP_009593374.1|  PREDICTED: LRR receptor-like serine/threonin...   1459   0.0      
ref|XP_006363236.1|  PREDICTED: LRR receptor-like serine/threonin...   1439   0.0      
gb|AAT40539.2|  Leucine Rich Repeat family protein                     1425   0.0      Solanum demissum
ref|XP_004239381.1|  PREDICTED: LRR receptor-like serine/threonin...   1418   0.0      
ref|XP_011096866.1|  PREDICTED: LRR receptor-like serine/threonin...   1369   0.0      
ref|XP_011008219.1|  PREDICTED: LRR receptor-like serine/threonin...   1309   0.0      
ref|XP_002299384.1|  leucine-rich repeat transmembrane protein ki...   1305   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002530120.1|  Leucine-rich repeat receptor protein kinase ...   1303   0.0      Ricinus communis
ref|XP_009363367.1|  PREDICTED: LRR receptor-like serine/threonin...   1286   0.0      
ref|XP_004295530.1|  PREDICTED: LRR receptor-like serine/threonin...   1286   0.0      
ref|XP_004145215.1|  PREDICTED: LRR receptor-like serine/threonin...   1281   0.0      
ref|XP_004154011.1|  PREDICTED: LRR receptor-like serine/threonin...   1280   0.0      
ref|XP_011022302.1|  PREDICTED: LRR receptor-like serine/threonin...   1279   0.0      
ref|XP_002303717.1|  leucine-rich repeat transmembrane protein ki...   1271   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006468654.1|  PREDICTED: LRR receptor-like serine/threonin...   1270   0.0      
ref|NP_193747.2|  LRR receptor-like serine/threonine-protein kina...   1268   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008440179.1|  PREDICTED: LRR receptor-like serine/threonin...   1266   0.0      
ref|XP_006448579.1|  hypothetical protein CICLE_v10014061mg            1265   0.0      
ref|XP_008358557.1|  PREDICTED: LRR receptor-like serine/threonin...   1263   0.0      
ref|XP_008225938.1|  PREDICTED: LRR receptor-like serine/threonin...   1262   0.0      
ref|XP_010434316.1|  PREDICTED: LRR receptor-like serine/threonin...   1261   0.0      
ref|XP_002265191.2|  PREDICTED: LRR receptor-like serine/threonin...   1260   0.0      Vitis vinifera
ref|XP_010439612.1|  PREDICTED: LRR receptor-like serine/threonin...   1259   0.0      
ref|XP_006285037.1|  hypothetical protein CARUB_v10006344mg            1259   0.0      
ref|XP_010449218.1|  PREDICTED: LRR receptor-like serine/threonin...   1256   0.0      
ref|XP_002869946.1|  hypothetical protein ARALYDRAFT_354732            1253   0.0      
ref|XP_010051801.1|  PREDICTED: LRR receptor-like serine/threonin...   1252   0.0      
ref|XP_007040985.1|  Leucine-rich repeat transmembrane protein ki...   1252   0.0      
emb|CAA18239.1|  leucine rich repeat-like protein                      1251   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009368631.1|  PREDICTED: LRR receptor-like serine/threonin...   1250   0.0      
ref|XP_006413897.1|  hypothetical protein EUTSA_v10027256mg            1246   0.0      
ref|XP_003524132.2|  PREDICTED: LRR receptor-like serine/threonin...   1244   0.0      
ref|XP_009133495.1|  PREDICTED: LRR receptor-like serine/threonin...   1230   0.0      
ref|XP_007158852.1|  hypothetical protein PHAVU_002G187300g            1228   0.0      
gb|KHN28913.1|  LRR receptor-like serine/threonine-protein kinase...   1228   0.0      
ref|XP_010260807.1|  PREDICTED: LRR receptor-like serine/threonin...   1227   0.0      
ref|XP_003532673.2|  PREDICTED: LRR receptor-like serine/threonin...   1224   0.0      
ref|XP_010537057.1|  PREDICTED: LRR receptor-like serine/threonin...   1219   0.0      
ref|XP_010653998.1|  PREDICTED: LRR receptor-like serine/threonin...   1216   0.0      
gb|KEH31437.1|  LRR receptor-like kinase family protein                1212   0.0      
ref|NP_199283.1|  LRR receptor-like serine/threonine-protein kina...   1210   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010100604.1|  LRR receptor-like serine/threonine-protein k...   1207   0.0      
ref|XP_006279730.1|  hypothetical protein CARUB_v10027518mg            1201   0.0      
ref|XP_004504632.1|  PREDICTED: LRR receptor-like serine/threonin...   1196   0.0      
ref|XP_010494516.1|  PREDICTED: LRR receptor-like serine/threonin...   1192   0.0      
dbj|BAB08823.1|  receptor-like protein kinase                          1192   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHG25582.1|  LRR receptor-like serine/threonine-protein kinase...   1190   0.0      
ref|XP_010688659.1|  PREDICTED: LRR receptor-like serine/threonin...   1188   0.0      
ref|XP_002863549.1|  predicted protein                                 1188   0.0      
ref|XP_010481721.1|  PREDICTED: LRR receptor-like serine/threonin...   1183   0.0      
ref|XP_010445856.1|  PREDICTED: LRR receptor-like serine/threonin...   1182   0.0      
ref|XP_009123608.1|  PREDICTED: LRR receptor-like serine/threonin...   1174   0.0      
emb|CDY14942.1|  BnaA02g22840D                                         1173   0.0      
ref|XP_003533521.2|  PREDICTED: LRR receptor-like serine/threonin...   1167   0.0      
gb|KHN26588.1|  LRR receptor-like serine/threonine-protein kinase...   1160   0.0      
emb|CDX96976.1|  BnaC02g31140D                                         1155   0.0      
ref|XP_004488225.1|  PREDICTED: LRR receptor-like serine/threonin...   1155   0.0      
gb|KFK31615.1|  hypothetical protein AALP_AA6G136200                   1154   0.0      
ref|XP_006398094.1|  hypothetical protein EUTSA_v10000741mg            1153   0.0      
ref|XP_003547404.2|  PREDICTED: LRR receptor-like serine/threonin...   1149   0.0      
gb|KHN47744.1|  LRR receptor-like serine/threonine-protein kinase...   1115   0.0      
ref|XP_009101649.1|  PREDICTED: LRR receptor-like serine/threonin...   1114   0.0      
gb|KFK28656.1|  hypothetical protein AALP_AA7G028000                   1108   0.0      
emb|CDP04099.1|  unnamed protein product                               1095   0.0      
ref|XP_008795782.1|  PREDICTED: LRR receptor-like serine/threonin...   1077   0.0      
ref|XP_010928757.1|  PREDICTED: LRR receptor-like serine/threonin...   1061   0.0      
gb|EPS61003.1|  hypothetical protein M569_13794                        1057   0.0      
ref|XP_009413356.1|  PREDICTED: LRR receptor-like serine/threonin...   1051   0.0      
ref|XP_009412457.1|  PREDICTED: LRR receptor-like serine/threonin...   1005   0.0      
ref|XP_009417199.1|  PREDICTED: LRR receptor-like serine/threonin...   1004   0.0      
ref|XP_004957750.1|  PREDICTED: LRR receptor-like serine/threonin...    988   0.0      
ref|XP_002460722.1|  hypothetical protein SORBIDRAFT_02g033810          964   0.0      Sorghum bicolor [broomcorn]
tpg|DAA62772.1|  TPA: putative leucine-rich repeat receptor-like ...    961   0.0      
dbj|BAJ92367.1|  predicted protein                                      958   0.0      
gb|EAZ03961.1|  hypothetical protein OsI_26097                          957   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001059710.2|  Os07g0498400                                       954   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAC07048.1|  putative receptor protein kinase                       953   0.0      Oryza sativa Japonica Group [Japonica rice]
tpg|DAA40884.1|  TPA: putative leucine-rich repeat receptor-like ...    951   0.0      
ref|XP_003563067.1|  PREDICTED: LRR receptor-like serine/threonin...    940   0.0      
ref|XP_007214067.1|  hypothetical protein PRUPE_ppa017621mg             936   0.0      
ref|XP_006853528.1|  hypothetical protein AMTR_s00032p00226460          926   0.0      
gb|KEH37336.1|  LRR receptor-like kinase family protein                 899   0.0      
gb|EYU43620.1|  hypothetical protein MIMGU_mgv1a020174mg                874   0.0      
ref|NP_001168291.1|  uncharacterized protein LOC100382055               848   0.0      Zea mays [maize]
gb|EMT29923.1|  LRR receptor-like serine/threonine-protein kinase...    845   0.0      
ref|XP_007138872.1|  hypothetical protein PHAVU_009G244600g             824   0.0      
emb|CDX78976.1|  BnaA01g10430D                                          743   0.0      
ref|XP_002978200.1|  hypothetical protein SELMODRAFT_50240              721   0.0      
ref|XP_010656224.1|  PREDICTED: LRR receptor-like serine/threonin...    694   0.0      
ref|XP_002966360.1|  hypothetical protein SELMODRAFT_60230              714   0.0      
emb|CDY50061.1|  BnaCnng18680D                                          701   0.0      
ref|XP_006658581.1|  PREDICTED: LRR receptor-like serine/threonin...    690   0.0      
ref|XP_006476817.1|  PREDICTED: LRR receptor-like serine/threonin...    647   0.0      
gb|KDO69577.1|  hypothetical protein CISIN_1g036729mg                   647   0.0      
ref|XP_006439859.1|  hypothetical protein CICLE_v10024596mg             644   0.0      
gb|KHN34330.1|  LRR receptor-like serine/threonine-protein kinase...    644   0.0      
ref|XP_003525510.2|  PREDICTED: LRR receptor-like serine/threonin...    644   0.0      
gb|KEH31821.1|  LRR receptor-like kinase                                640   0.0      
gb|KHN18441.1|  LRR receptor-like serine/threonine-protein kinase...    638   0.0      
ref|XP_009622846.1|  PREDICTED: LRR receptor-like serine/threonin...    639   0.0      
emb|CDY39388.1|  BnaAnng05190D                                          635   0.0      
ref|XP_008796001.1|  PREDICTED: LRR receptor-like serine/threonin...    637   0.0      
ref|XP_003550728.2|  PREDICTED: LRR receptor-like serine/threonin...    637   0.0      
ref|XP_007036300.1|  Leucine-rich repeat transmembrane protein ki...    635   0.0      
ref|XP_010037542.1|  PREDICTED: LRR receptor-like serine/threonin...    634   0.0      
ref|XP_003522390.2|  PREDICTED: LRR receptor-like serine/threonin...    634   0.0      
ref|XP_003568840.1|  PREDICTED: LRR receptor-like serine/threonin...    632   0.0      
ref|XP_002318086.2|  hypothetical protein POPTR_0012s09070g             631   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010678806.1|  PREDICTED: LRR receptor-like serine/threonin...    630   0.0      
ref|XP_010248553.1|  PREDICTED: LRR receptor-like serine/threonin...    627   0.0      
ref|XP_007155446.1|  hypothetical protein PHAVU_003G202100g             628   0.0      
ref|XP_010248552.1|  PREDICTED: LRR receptor-like serine/threonin...    627   0.0      
ref|XP_002511369.1|  serine-threonine protein kinase, plant-type,...    627   0.0      Ricinus communis
ref|XP_008245003.1|  PREDICTED: LRR receptor-like serine/threonin...    624   0.0      
ref|XP_011040472.1|  PREDICTED: LRR receptor-like serine/threonin...    624   0.0      
ref|XP_006344512.1|  PREDICTED: LRR receptor-like serine/threonin...    623   0.0      
gb|KHN30928.1|  LRR receptor-like serine/threonine-protein kinase...    613   0.0      
ref|XP_002439362.1|  hypothetical protein SORBIDRAFT_09g005150          618   0.0      Sorghum bicolor [broomcorn]
ref|XP_004236228.1|  PREDICTED: LRR receptor-like serine/threonin...    618   0.0      
dbj|BAJ85489.1|  predicted protein                                      612   0.0      
ref|XP_010555502.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    614   0.0      
emb|CDP16927.1|  unnamed protein product                                613   0.0      
ref|XP_007138043.1|  hypothetical protein PHAVU_009G176400g             612   0.0      
ref|XP_008438602.1|  PREDICTED: LRR receptor-like serine/threonin...    611   0.0      
ref|XP_004976158.1|  PREDICTED: probable leucine-rich repeat rece...    616   0.0      
ref|XP_009763846.1|  PREDICTED: LRR receptor-like serine/threonin...    612   0.0      
ref|XP_004157832.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    610   0.0      
ref|XP_004152560.1|  PREDICTED: LRR receptor-like serine/threonin...    610   0.0      
ref|XP_006841024.1|  hypothetical protein AMTR_s00085p00116630          610   0.0      
ref|XP_006476818.1|  PREDICTED: LRR receptor-like serine/threonin...    603   0.0      
ref|XP_008393009.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...    609   0.0      
ref|XP_010069084.1|  PREDICTED: probable leucine-rich repeat rece...    613   0.0      
ref|XP_008649415.1|  PREDICTED: LRR receptor-like serine/threonin...    608   0.0      
ref|XP_010656659.1|  PREDICTED: probable leucine-rich repeat rece...    616   0.0      
ref|XP_010940144.1|  PREDICTED: LRR receptor-like serine/threonin...    607   0.0      
gb|EMT16678.1|  LRR receptor-like serine/threonine-protein kinase...    607   0.0      
ref|XP_004298963.1|  PREDICTED: LRR receptor-like serine/threonin...    605   0.0      
ref|XP_004960812.1|  PREDICTED: LRR receptor-like serine/threonin...    605   0.0      
ref|XP_010248554.1|  PREDICTED: LRR receptor-like serine/threonin...    603   0.0      
ref|XP_009404764.1|  PREDICTED: LRR receptor-like serine/threonin...    604   0.0      
gb|EYU22147.1|  hypothetical protein MIMGU_mgv1a000819mg                601   0.0      
emb|CDY49822.1|  BnaCnng18190D                                          602   0.0      
ref|XP_011071901.1|  PREDICTED: LRR receptor-like serine/threonin...    601   0.0      
dbj|BAF79945.1|  receptor-like kinase                                   609   0.0      Marchantia polymorpha
ref|XP_009362981.1|  PREDICTED: LRR receptor-like serine/threonin...    598   0.0      
tpg|DAA37041.1|  TPA: putative leucine-rich repeat receptor prote...    601   0.0      
ref|XP_002278672.1|  PREDICTED: LRR receptor-like serine/threonin...    597   0.0      Vitis vinifera
emb|CAD41180.1|  OSJNBb0002J11.4                                        601   0.0      Oryza sativa [red rice]
ref|XP_007210387.1|  hypothetical protein PRUPE_ppa000993mg             596   0.0      
ref|XP_010264019.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    601   0.0      
ref|XP_006653582.1|  PREDICTED: probable leucine-rich repeat rece...    599   0.0      
ref|XP_004514026.1|  PREDICTED: probable leucine-rich repeat rece...    599   0.0      
ref|XP_006492135.1|  PREDICTED: probable leucine-rich repeat rece...    598   0.0      
ref|XP_009398051.1|  PREDICTED: probable leucine-rich repeat rece...    597   0.0      
ref|XP_010245658.1|  PREDICTED: probable leucine-rich repeat rece...    597   0.0      
ref|XP_009141291.1|  PREDICTED: probable leucine-rich repeat rece...    594   0.0      
ref|XP_006420529.1|  hypothetical protein CICLE_v10004196mg             595   0.0      
ref|XP_006854255.1|  hypothetical protein AMTR_s00039p00029750          594   0.0      
ref|XP_006442219.1|  hypothetical protein CICLE_v10018604mg             593   0.0      
gb|KHN36480.1|  Putative leucine-rich repeat receptor-like protei...    592   0.0      
ref|XP_010102525.1|  LRR receptor-like serine/threonine-protein k...    588   0.0      
ref|XP_003535237.1|  PREDICTED: probable leucine-rich repeat rece...    592   0.0      
gb|KDO44090.1|  hypothetical protein CISIN_1g001274mg                   592   0.0      
ref|XP_010933136.1|  PREDICTED: probable leucine-rich repeat rece...    591   0.0      
emb|CDY23764.1|  BnaC04g43580D                                          590   0.0      
ref|XP_006478014.1|  PREDICTED: leucine-rich repeat receptor-like...    591   0.0      
gb|KEH41270.1|  LRR receptor-like kinase family protein                 591   0.0      
gb|KHN20812.1|  Putative leucine-rich repeat receptor-like protei...    591   0.0      
ref|XP_004247815.1|  PREDICTED: probable leucine-rich repeat rece...    590   0.0      
ref|XP_004309755.1|  PREDICTED: probable leucine-rich repeat rece...    590   0.0      
ref|XP_009411375.1|  PREDICTED: probable leucine-rich repeat rece...    587   0.0      
ref|XP_007145234.1|  hypothetical protein PHAVU_007G221800g             589   0.0      
gb|KDP33381.1|  hypothetical protein JCGZ_12930                         588   0.0      
emb|CBI14999.3|  unnamed protein product                                581   0.0      
ref|XP_008667904.1|  PREDICTED: cytokinin-O-glucosyltransferase 3...    600   0.0      
ref|XP_009411373.1|  PREDICTED: probable leucine-rich repeat rece...    587   0.0      
ref|XP_009362057.1|  PREDICTED: probable leucine-rich repeat rece...    587   0.0      
ref|XP_008804749.1|  PREDICTED: probable leucine-rich repeat rece...    586   0.0      
gb|AAU44328.1|  unknown protein                                         583   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010413906.1|  PREDICTED: probable leucine-rich repeat rece...    586   0.0      
ref|NP_001054768.2|  Os05g0170300                                       582   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002263001.1|  PREDICTED: leucine-rich repeat receptor-like...    585   0.0      Vitis vinifera
ref|XP_010096917.1|  putative leucine-rich repeat receptor-like p...    585   0.0      
ref|XP_002283031.3|  PREDICTED: probable leucine-rich repeat rece...    585   0.0      Vitis vinifera
ref|XP_008809658.1|  PREDICTED: probable leucine-rich repeat rece...    582   0.0      
ref|XP_010469512.1|  PREDICTED: probable leucine-rich repeat rece...    585   0.0      
ref|XP_010062723.1|  PREDICTED: leucine-rich repeat receptor-like...    585   0.0      
ref|XP_010666186.1|  PREDICTED: probable leucine-rich repeat rece...    584   0.0      
ref|XP_006478984.1|  PREDICTED: probable leucine-rich repeat rece...    584   0.0      
ref|XP_008809657.1|  PREDICTED: probable leucine-rich repeat rece...    583   0.0      
gb|KDO52509.1|  hypothetical protein CISIN_1g001253mg                   583   0.0      
ref|XP_010509921.1|  PREDICTED: probable leucine-rich repeat rece...    583   0.0      
ref|XP_002303809.1|  leucine-rich repeat transmembrane protein ki...    583   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006443295.1|  hypothetical protein CICLE_v10018603mg             583   0.0      
gb|KDP23756.1|  hypothetical protein JCGZ_23589                         583   0.0      
ref|XP_009390137.1|  PREDICTED: probable leucine-rich repeat rece...    582   0.0      
ref|XP_010262428.1|  PREDICTED: probable LRR receptor-like serine...    585   0.0      
gb|EAY96704.1|  hypothetical protein OsI_18626                          582   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_008361714.1|  PREDICTED: probable leucine-rich repeat rece...    582   0.0      
ref|XP_006293587.1|  hypothetical protein CARUB_v10022534mg             582   0.0      
gb|KCW69856.1|  hypothetical protein EUGRSUZ_F03195                     578   0.0      
ref|XP_010043323.1|  PREDICTED: probable leucine-rich repeat rece...    581   0.0      
emb|CAN70971.1|  hypothetical protein VITISV_009202                     585   0.0      Vitis vinifera
ref|XP_002881266.1|  hypothetical protein ARALYDRAFT_482252             581   0.0      
ref|XP_007034487.1|  Leucine-rich repeat receptor-like protein ki...    580   0.0      
ref|XP_010918847.1|  PREDICTED: probable leucine-rich repeat rece...    580   0.0      
ref|XP_004243198.1|  PREDICTED: leucine-rich repeat receptor-like...    579   0.0      
ref|XP_010314766.1|  PREDICTED: probable leucine-rich repeat rece...    578   0.0      
ref|XP_002319129.1|  putative leucine-rich repeat transmembrane p...    578   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010522433.1|  PREDICTED: probable leucine-rich repeat rece...    578   0.0      
ref|XP_009780958.1|  PREDICTED: probable leucine-rich repeat rece...    577   0.0      
gb|KHN26789.1|  Leucine-rich repeat receptor-like serine/threonin...    577   0.0      
ref|XP_006585436.1|  PREDICTED: leucine-rich repeat receptor-like...    577   0.0      
ref|NP_180875.1|  putative leucine-rich repeat receptor-like prot...    577   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007030293.1|  Leucine-rich repeat protein kinase family pr...    577   0.0      
ref|XP_006655040.1|  PREDICTED: LRR receptor-like serine/threonin...    574   0.0      
ref|NP_201198.1|  leucine-rich repeat protein kinase-like protein       575   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004295705.1|  PREDICTED: leucine-rich repeat receptor-like...    575   0.0      
ref|XP_006836369.1|  hypothetical protein AMTR_s00092p00117150          575   0.0      
ref|XP_002522030.1|  Leucine-rich repeat receptor protein kinase ...    575   0.0      Ricinus communis
ref|XP_010245135.1|  PREDICTED: leucine-rich repeat receptor-like...    576   0.0      
gb|EPS68268.1|  hypothetical protein M569_06502                         574   0.0      
ref|XP_006366775.1|  PREDICTED: leucine-rich repeat receptor-like...    573   0.0      
emb|CDP06118.1|  unnamed protein product                                572   2e-180   
ref|XP_008226273.1|  PREDICTED: leucine-rich repeat receptor-like...    572   3e-180   
ref|XP_006410453.1|  hypothetical protein EUTSA_v10016163mg             572   3e-180   
ref|XP_008390699.1|  PREDICTED: leucine-rich repeat receptor-like...    572   4e-180   
ref|XP_010476866.1|  PREDICTED: leucine-rich repeat receptor-like...    572   6e-180   
ref|XP_002518162.1|  BRASSINOSTEROID INSENSITIVE 1 precursor, put...    572   6e-180   Ricinus communis
ref|XP_002864877.1|  hypothetical protein ARALYDRAFT_496585             571   7e-180   
ref|XP_010476867.1|  PREDICTED: leucine-rich repeat receptor-like...    570   1e-179   
ref|XP_011002013.1|  PREDICTED: probable leucine-rich repeat rece...    570   2e-179   
gb|KHG09386.1|  hypothetical protein F383_11973                         570   2e-179   
ref|XP_006489781.1|  PREDICTED: probable leucine-rich repeat rece...    577   3e-179   
ref|XP_007213717.1|  hypothetical protein PRUPE_ppa000550mg             569   3e-179   
ref|XP_002986115.1|  hypothetical protein SELMODRAFT_40409              567   5e-179   
ref|XP_004508880.1|  PREDICTED: LRR receptor-like serine/threonin...    563   9e-179   
ref|XP_002317600.1|  leucine-rich repeat family protein                 568   9e-179   Populus trichocarpa [western balsam poplar]
ref|XP_008218374.1|  PREDICTED: probable leucine-rich repeat rece...    568   1e-178   
ref|XP_010484156.1|  PREDICTED: probable leucine-rich repeat rece...    567   1e-178   
ref|XP_006279918.1|  hypothetical protein CARUB_v10025776mg             567   2e-178   
ref|XP_010459295.1|  PREDICTED: leucine-rich repeat receptor-like...    567   2e-178   
gb|EEE62487.1|  hypothetical protein OsJ_17284                          561   3e-178   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006598177.1|  PREDICTED: leucine-rich repeat receptor-like...    565   5e-178   
ref|XP_010498068.1|  PREDICTED: leucine-rich repeat receptor-like...    566   6e-178   
ref|XP_010461166.1|  PREDICTED: probable leucine-rich repeat rece...    566   7e-178   
ref|XP_009149171.1|  PREDICTED: leucine-rich repeat receptor-like...    566   8e-178   
ref|XP_002325367.2|  putative leucine-rich repeat transmembrane p...    565   9e-178   Populus trichocarpa [western balsam poplar]
ref|XP_010923813.1|  PREDICTED: leucine-rich repeat receptor-like...    565   1e-177   
ref|XP_010923812.1|  PREDICTED: leucine-rich repeat receptor-like...    565   1e-177   
ref|XP_010923807.1|  PREDICTED: leucine-rich repeat receptor-like...    565   1e-177   
ref|XP_010923809.1|  PREDICTED: leucine-rich repeat receptor-like...    565   2e-177   
ref|XP_002989666.1|  hypothetical protein SELMODRAFT_40410              563   2e-177   
ref|XP_006306625.1|  hypothetical protein CARUB_v10008143mg             565   2e-177   
ref|XP_009149170.1|  PREDICTED: leucine-rich repeat receptor-like...    566   2e-177   
ref|XP_002890213.1|  leucine-rich repeat family protein                 564   4e-177   
ref|XP_006416726.1|  hypothetical protein EUTSA_v10006611mg             565   4e-177   
emb|CDY26259.1|  BnaA06g11580D                                          563   4e-177   
gb|KHN27763.1|  Leucine-rich repeat receptor-like serine/threonin...    564   5e-177   
ref|XP_011030777.1|  PREDICTED: leucine-rich repeat receptor-like...    563   8e-177   
ref|XP_011038444.1|  PREDICTED: probable leucine-rich repeat rece...    563   8e-177   
ref|XP_011020706.1|  PREDICTED: probable leucine-rich repeat rece...    563   1e-176   
ref|XP_001776887.1|  CLL6 clavata1-like receptor S/T protein kina...    563   1e-176   
ref|NP_173166.2|  leucine-rich receptor-like protein kinase             562   2e-176   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009599479.1|  PREDICTED: probable leucine-rich repeat rece...    561   3e-176   
gb|KFK43917.1|  hypothetical protein AALP_AA1G191100                    561   3e-176   
gb|AAD50027.1|AC007651_22  Similar to leucine-rich receptor-like ...    561   6e-176   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007225422.1|  hypothetical protein PRUPE_ppa000499mg             561   8e-176   
ref|XP_010540115.1|  PREDICTED: leucine-rich repeat receptor-like...    560   1e-175   
ref|XP_008460723.1|  PREDICTED: probable leucine-rich repeat rece...    560   1e-175   
ref|XP_002461464.1|  hypothetical protein SORBIDRAFT_02g003080          563   2e-175   Sorghum bicolor [broomcorn]
ref|XP_004955463.1|  PREDICTED: leucine-rich repeat receptor-like...    559   2e-175   
ref|XP_010030336.1|  PREDICTED: probable leucine-rich repeat rece...    563   3e-175   
ref|XP_011012222.1|  PREDICTED: probable leucine-rich repeat rece...    559   4e-175   
ref|XP_010265040.1|  PREDICTED: probable LRR receptor-like serine...    562   4e-175   
ref|XP_009618083.1|  PREDICTED: probable leucine-rich repeat rece...    557   1e-174   
ref|XP_009762780.1|  PREDICTED: probable leucine-rich repeat rece...    557   2e-174   
ref|XP_003581400.2|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    570   2e-174   
ref|XP_009626861.1|  PREDICTED: leucine-rich repeat receptor-like...    557   2e-174   
emb|CDY48481.1|  BnaC05g13410D                                          556   5e-174   
ref|XP_006349975.1|  PREDICTED: probable leucine-rich repeat rece...    555   6e-174   
ref|XP_011002164.1|  PREDICTED: probable leucine-rich repeat rece...    555   7e-174   
ref|XP_008223994.1|  PREDICTED: probable leucine-rich repeat rece...    555   1e-173   
ref|XP_010446261.1|  PREDICTED: probable leucine-rich repeat rece...    563   2e-173   
ref|XP_002299290.2|  leucine-rich repeat transmembrane protein ki...    554   3e-173   
ref|XP_009128461.1|  PREDICTED: probable leucine-rich repeat rece...    553   3e-173   
emb|CDP18620.1|  unnamed protein product                                555   4e-173   
ref|XP_007149249.1|  hypothetical protein PHAVU_005G054300g             554   4e-173   
ref|XP_006857483.1|  hypothetical protein AMTR_s00067p00199640          555   8e-173   
ref|XP_007213080.1|  hypothetical protein PRUPE_ppa021211mg             558   8e-173   
ref|XP_001774556.1|  predicted protein                                  553   1e-172   
ref|XP_011082828.1|  PREDICTED: leucine-rich repeat receptor-like...    552   1e-172   
ref|XP_010087155.1|  Leucine-rich repeat receptor-like serine/thr...    552   1e-172   
ref|XP_004150344.1|  PREDICTED: probable leucine-rich repeat rece...    551   2e-172   
gb|EYU38215.1|  hypothetical protein MIMGU_mgv1a000518mg                551   3e-172   
ref|XP_010659133.1|  PREDICTED: probable leucine-rich repeat rece...    561   3e-172   
ref|XP_009804334.1|  PREDICTED: leucine-rich repeat receptor-like...    551   3e-172   
ref|XP_011083054.1|  PREDICTED: probable LRR receptor-like serine...    554   5e-172   
ref|XP_008390700.1|  PREDICTED: leucine-rich repeat receptor-like...    548   9e-172   
ref|XP_004488711.1|  PREDICTED: leucine-rich repeat receptor-like...    548   4e-171   
ref|XP_003557650.1|  PREDICTED: leucine-rich repeat receptor-like...    548   4e-171   
ref|XP_006492136.1|  PREDICTED: probable leucine-rich repeat rece...    543   4e-171   
gb|KHN07496.1|  Putative leucine-rich repeat receptor-like protei...    547   2e-170   
gb|KCW48747.1|  hypothetical protein EUGRSUZ_K02386                     551   3e-170   
gb|KEH38374.1|  LRR receptor-like kinase                                545   5e-170   
emb|CDO99397.1|  unnamed protein product                                543   9e-170   
ref|XP_002964682.1|  hypothetical protein SELMODRAFT_81961              544   1e-169   
gb|EPS63883.1|  hypothetical protein M569_10899                         543   2e-169   
ref|XP_002966436.1|  hypothetical protein SELMODRAFT_86330              543   2e-169   
ref|XP_004488712.1|  PREDICTED: leucine-rich repeat receptor-like...    543   3e-169   
gb|KDP43119.1|  hypothetical protein JCGZ_26652                         521   5e-169   
emb|CAN66422.1|  hypothetical protein VITISV_007982                     536   6e-169   
gb|AES60034.2|  LRR receptor-like kinase family protein                 543   6e-169   
ref|XP_009354816.1|  PREDICTED: leucine-rich repeat receptor-like...    537   8e-169   
ref|XP_003589783.1|  Receptor protein kinase-like protein               543   9e-169   
ref|XP_006443765.1|  hypothetical protein CICLE_v10018554mg             545   1e-168   
ref|XP_010909661.1|  PREDICTED: probable leucine-rich repeat rece...    539   2e-168   
ref|XP_006442652.1|  hypothetical protein CICLE_v10023370mg             538   2e-168   
ref|XP_010658126.1|  PREDICTED: probable leucine-rich repeat rece...    549   3e-168   
ref|XP_010656626.1|  PREDICTED: probable leucine-rich repeat rece...    546   4e-168   
ref|XP_010039042.1|  PREDICTED: probable leucine-rich repeat rece...    552   6e-168   
ref|XP_009387280.1|  PREDICTED: probable leucine-rich repeat rece...    550   8e-168   
emb|CDP20759.1|  unnamed protein product                                553   1e-167   
ref|XP_006443767.1|  hypothetical protein CICLE_v10018560mg             541   2e-167   
gb|EMT22712.1|  Putative LRR receptor-like serine/threonine-prote...    538   5e-167   
ref|XP_006364873.1|  PREDICTED: probable leucine-rich repeat rece...    538   6e-167   
ref|XP_009400940.1|  PREDICTED: probable leucine-rich repeat rece...    536   9e-167   
gb|EMT15641.1|  Putative LRR receptor-like serine/threonine-prote...    538   1e-166   
ref|XP_007207229.1|  hypothetical protein PRUPE_ppa000976mg             530   3e-166   
emb|CBI27385.3|  unnamed protein product                                528   5e-166   
ref|XP_009588086.1|  PREDICTED: probable LRR receptor-like serine...    538   6e-166   
ref|XP_006576954.1|  PREDICTED: probable leucine-rich repeat rece...    537   8e-166   
ref|XP_006424103.1|  hypothetical protein CICLE_v10027723mg             532   1e-165   
ref|XP_003553506.1|  PREDICTED: probable leucine-rich repeat rece...    536   3e-165   
ref|XP_010656627.1|  PREDICTED: probable leucine-rich repeat rece...    530   3e-165   
gb|EMS65536.1|  LRR receptor-like serine/threonine-protein kinase...    530   3e-165   
ref|XP_010920309.1|  PREDICTED: probable LRR receptor-like serine...    534   9e-165   
gb|AES60036.2|  LRR receptor-like kinase family protein                 532   1e-164   
ref|XP_010262426.1|  PREDICTED: probable LRR receptor-like serine...    534   1e-164   
ref|XP_010684678.1|  PREDICTED: probable LRR receptor-like serine...    534   2e-164   
ref|XP_002891200.1|  hypothetical protein ARALYDRAFT_473694             531   2e-164   
ref|XP_010557548.1|  PREDICTED: probable LRR receptor-like serine...    532   4e-164   
ref|XP_003589785.1|  Receptor-like protein kinase                       531   4e-164   
gb|EMT22713.1|  Putative LRR receptor-like serine/threonine-prote...    529   4e-164   
ref|XP_010557549.1|  PREDICTED: probable LRR receptor-like serine...    529   5e-164   
ref|XP_010933233.1|  PREDICTED: probable LRR receptor-like serine...    529   5e-164   
ref|XP_008235612.1|  PREDICTED: probable LRR receptor-like serine...    532   6e-164   
ref|XP_006858452.1|  hypothetical protein AMTR_s00071p00089840          528   8e-164   
ref|XP_006602874.1|  PREDICTED: probable LRR receptor-like serine...    525   9e-164   
gb|KCW48759.1|  hypothetical protein EUGRSUZ_K02402                     532   1e-163   
ref|XP_006479462.1|  PREDICTED: probable LRR receptor-like serine...    525   2e-163   
ref|XP_003589790.1|  Receptor-like protein kinase                       529   2e-163   
ref|XP_006480080.1|  PREDICTED: probable LRR receptor-like serine...    528   3e-163   
ref|XP_002450353.1|  hypothetical protein SORBIDRAFT_05g004115          525   4e-163   
ref|XP_006443766.1|  hypothetical protein CICLE_v10024479mg             531   4e-163   
ref|XP_007162586.1|  hypothetical protein PHAVU_001G163700g             530   5e-163   
gb|KHN10771.1|  Putative LRR receptor-like serine/threonine-prote...    530   5e-163   
ref|XP_006602873.1|  PREDICTED: probable LRR receptor-like serine...    526   6e-163   
ref|XP_006605735.1|  PREDICTED: probable leucine-rich repeat rece...    526   6e-163   
gb|KHN40546.1|  Putative LRR receptor-like serine/threonine-prote...    525   6e-163   
ref|XP_009387281.1|  PREDICTED: probable leucine-rich repeat rece...    521   1e-162   
ref|XP_010519386.1|  PREDICTED: LRR receptor-like serine/threonin...    525   1e-162   
ref|XP_007010909.1|  Leucine-rich repeat receptor-like protein ki...    527   1e-162   
ref|XP_006494332.1|  PREDICTED: probable leucine-rich repeat rece...    525   2e-162   
ref|XP_006279184.1|  hypothetical protein CARUB_v100079171mg            525   2e-162   
gb|EMT26720.1|  Putative LRR receptor-like serine/threonine-prote...    530   2e-162   
ref|XP_009763266.1|  PREDICTED: receptor-like protein kinase 2          526   2e-162   
ref|XP_003589757.1|  Leucine-rich repeat receptor-like protein ki...    525   3e-162   
ref|XP_008353647.1|  PREDICTED: probable leucine-rich repeat rece...    527   4e-162   
ref|XP_009387595.1|  PREDICTED: probable leucine-rich repeat rece...    521   4e-162   
gb|KCW79842.1|  hypothetical protein EUGRSUZ_C01182                     524   1e-161   
ref|XP_003520610.2|  PREDICTED: probable leucine-rich repeat rece...    526   1e-161   
gb|EMT15790.1|  Putative LRR receptor-like serine/threonine-prote...    521   2e-161   
ref|XP_008438397.1|  PREDICTED: receptor-like protein kinase 2          523   3e-161   
ref|XP_007162587.1|  hypothetical protein PHAVU_001G163800g             524   3e-161   
ref|XP_007216482.1|  hypothetical protein PRUPE_ppa024750mg             526   4e-161   
ref|XP_009369424.1|  PREDICTED: probable LRR receptor-like serine...    524   6e-161   
gb|KEH15982.1|  LRR receptor-like kinase family protein                 522   6e-161   
ref|XP_010068524.1|  PREDICTED: probable LRR receptor-like serine...    523   1e-160   
ref|XP_007050194.1|  Leucine-rich repeat receptor-like protein ki...    523   1e-160   
ref|NP_001176030.1|  Os10g0155733                                       521   2e-160   
ref|XP_006662192.1|  PREDICTED: leucine-rich repeat receptor-like...    518   2e-160   
gb|EMT05957.1|  Receptor-like protein kinase 2                          534   2e-160   
ref|XP_003589777.1|  Receptor protein kinase-like protein               520   3e-160   
ref|XP_002962926.1|  hypothetical protein SELMODRAFT_78663              518   4e-160   
ref|XP_006354069.1|  PREDICTED: probable LRR receptor-like serine...    518   4e-160   
gb|EMT03820.1|  Putative LRR receptor-like serine/threonine-prote...    523   5e-160   
ref|XP_010684703.1|  PREDICTED: probable LRR receptor-like serine...    521   5e-160   
ref|XP_002526561.1|  receptor protein kinase, putative                  521   6e-160   
gb|KHN10767.1|  Putative LRR receptor-like serine/threonine-prote...    517   7e-160   
ref|XP_003589782.1|  Receptor protein kinase-like protein               520   8e-160   
dbj|BAF79936.1|  receptor-like kinase                                   518   9e-160   
ref|XP_010657639.1|  PREDICTED: probable leucine-rich repeat rece...    520   1e-159   
ref|XP_008664894.1|  PREDICTED: probable LRR receptor-like serine...    521   1e-159   
ref|XP_006602866.1|  PREDICTED: probable LRR receptor-like serine...    516   1e-159   
gb|KHN40544.1|  Putative LRR receptor-like serine/threonine-prote...    516   1e-159   
gb|KFK39720.1|  hypothetical protein AALP_AA3G279800                    518   2e-159   
gb|KHN42229.1|  Putative LRR receptor-like serine/threonine-prote...    520   2e-159   
gb|EAY77742.1|  hypothetical protein OsI_32785                          518   2e-159   
ref|XP_010652404.1|  PREDICTED: probable LRR receptor-like serine...    518   2e-159   
ref|XP_008798997.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    516   3e-159   
gb|EAY77539.1|  hypothetical protein OsI_32579                          516   3e-159   
ref|XP_002320620.1|  putative leucine-rich repeat transmembrane p...    519   4e-159   
gb|AAL31654.1|AC079179_9  Putative protein kinase                       516   5e-159   
ref|XP_010550838.1|  PREDICTED: receptor-like protein kinase 2          517   5e-159   
ref|XP_008245495.1|  PREDICTED: probable LRR receptor-like serine...    520   5e-159   
ref|XP_009627596.1|  PREDICTED: receptor-like protein kinase 2 is...    516   5e-159   
ref|XP_007011921.1|  Leucine-rich repeat receptor-like protein ki...    517   6e-159   
ref|XP_004157716.1|  PREDICTED: receptor-like protein kinase 2-like     516   7e-159   
emb|CDP03782.1|  unnamed protein product                                516   7e-159   
ref|XP_010065134.1|  PREDICTED: probable leucine-rich repeat rece...    516   8e-159   
ref|XP_002271388.1|  PREDICTED: leucine-rich repeat receptor-like...    516   9e-159   
ref|XP_006662428.1|  PREDICTED: probable leucine-rich repeat rece...    516   1e-158   
ref|NP_001064062.2|  Os10g0119200                                       514   1e-158   
ref|XP_004134385.1|  PREDICTED: receptor-like protein kinase 2-like     516   1e-158   
ref|XP_009398856.1|  PREDICTED: probable LRR receptor-like serine...    514   2e-158   
gb|KDO46595.1|  hypothetical protein CISIN_1g001440mg                   513   2e-158   
ref|XP_002305701.2|  FLAGELLIN-SENSITIVE 2 family protein               516   2e-158   
ref|XP_008810064.1|  PREDICTED: probable leucine-rich repeat rece...    517   2e-158   
ref|XP_008792766.1|  PREDICTED: probable leucine-rich repeat rece...    513   2e-158   
ref|XP_001774136.1|  predicted protein                                  517   3e-158   
ref|XP_004247501.1|  PREDICTED: probable LRR receptor-like serine...    517   3e-158   
ref|XP_008644796.1|  PREDICTED: probable LRR receptor-like serine...    517   3e-158   
ref|XP_002980098.1|  hypothetical protein SELMODRAFT_30384              512   5e-158   
ref|XP_006602649.1|  PREDICTED: probable LRR receptor-like serine...    515   5e-158   
ref|XP_010039044.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    518   5e-158   
ref|XP_004293509.1|  PREDICTED: LRR receptor-like serine/threonin...    514   5e-158   
gb|AAL75740.1|AC091724_13  Putative receptor-like protein kinase        514   5e-158   
ref|XP_008644797.1|  PREDICTED: probable LRR receptor-like serine...    516   6e-158   
ref|XP_008810065.1|  PREDICTED: probable leucine-rich repeat rece...    515   7e-158   
ref|XP_010320170.1|  PREDICTED: probable leucine-rich repeat rece...    508   7e-158   
ref|XP_010911812.1|  PREDICTED: receptor-like protein kinase 2          512   8e-158   
dbj|BAJ97017.1|  predicted protein                                      516   8e-158   
ref|XP_004292236.1|  PREDICTED: probable LRR receptor-like serine...    516   8e-158   
emb|CDP18619.1|  unnamed protein product                                513   1e-157   
dbj|BAJ86808.1|  predicted protein                                      515   2e-157   
ref|XP_006607007.1|  PREDICTED: probable leucine-rich repeat rece...    514   2e-157   
ref|XP_004238525.1|  PREDICTED: probable LRR receptor-like serine...    510   2e-157   
ref|XP_003590907.1|  Pentatricopeptide repeat-containing protein        529   3e-157   
ref|XP_010093090.1|  putative LRR receptor-like serine/threonine-...    516   3e-157   
gb|EEE50590.1|  hypothetical protein OsJ_30765                          511   4e-157   
ref|XP_010039084.1|  PREDICTED: probable leucine-rich repeat rece...    512   4e-157   
gb|EMT09043.1|  Putative LRR receptor-like serine/threonine-prote...    510   5e-157   
gb|KCW48952.1|  hypothetical protein EUGRSUZ_K02562                     512   6e-157   
ref|XP_006494898.1|  PREDICTED: probable leucine-rich repeat rece...    509   6e-157   
ref|XP_010039051.1|  PREDICTED: probable leucine-rich repeat rece...    512   6e-157   
ref|XP_007143380.1|  hypothetical protein PHAVU_007G067700g             515   7e-157   
ref|XP_007019426.1|  Leucine-rich repeat receptor-like protein ki...    505   7e-157   
ref|XP_002885607.1|  hypothetical protein ARALYDRAFT_479903             511   8e-157   
ref|XP_009624374.1|  PREDICTED: probable LRR receptor-like serine...    509   8e-157   
ref|XP_010048149.1|  PREDICTED: probable LRR receptor-like serine...    513   1e-156   
ref|XP_003571653.1|  PREDICTED: leucine-rich repeat receptor-like...    511   1e-156   
gb|AES61158.2|  LRR receptor-like kinase                                508   1e-156   
ref|XP_007150834.1|  hypothetical protein PHAVU_005G184700g             509   1e-156   
ref|XP_007019425.1|  Leucine-rich repeat receptor-like protein ki...    509   1e-156   
ref|XP_009372116.1|  PREDICTED: probable LRR receptor-like serine...    512   2e-156   
ref|XP_009800234.1|  PREDICTED: LRR receptor-like serine/threonin...    508   2e-156   
gb|KHN27325.1|  Putative leucine-rich repeat receptor-like protei...    509   2e-156   
ref|XP_010038996.1|  PREDICTED: probable LRR receptor-like serine...    515   2e-156   
ref|XP_003553507.1|  PREDICTED: probable leucine-rich repeat rece...    512   2e-156   
ref|XP_011024454.1|  PREDICTED: probable LRR receptor-like serine...    512   3e-156   
gb|KCW89014.1|  hypothetical protein EUGRSUZ_A01339                     511   3e-156   
ref|XP_010910120.1|  PREDICTED: probable leucine-rich repeat rece...    505   3e-156   
gb|KDO41685.1|  hypothetical protein CISIN_1g001494mg                   507   4e-156   
ref|XP_003574033.1|  PREDICTED: probable leucine-rich repeat rece...    511   5e-156   
ref|XP_009780740.1|  PREDICTED: probable leucine-rich repeat rece...    507   6e-156   
ref|XP_006481544.1|  PREDICTED: probable leucine-rich repeat rece...    505   6e-156   
ref|XP_009337416.1|  PREDICTED: probable leucine-rich repeat rece...    509   7e-156   
ref|XP_006358417.1|  PREDICTED: probable LRR receptor-like serine...    510   7e-156   
ref|XP_002962352.1|  hypothetical protein SELMODRAFT_78200              506   8e-156   
gb|KDP22307.1|  hypothetical protein JCGZ_26138                         511   1e-155   
ref|XP_002278001.2|  PREDICTED: LRR receptor-like serine/threonin...    506   2e-155   
ref|XP_009122355.1|  PREDICTED: leucine-rich repeat receptor prot...    509   2e-155   
gb|EMT00756.1|  Putative LRR receptor-like serine/threonine-prote...    508   2e-155   
gb|KEH41002.1|  LRR receptor-like kinase family protein                 525   2e-155   
ref|XP_009362085.1|  PREDICTED: probable LRR receptor-like serine...    506   2e-155   
ref|XP_006399210.1|  hypothetical protein EUTSA_v10012465mg             510   2e-155   
ref|XP_002992683.1|  hypothetical protein SELMODRAFT_40400              504   3e-155   
ref|XP_001761366.1|  predicted protein                                  508   3e-155   
ref|XP_011002327.1|  PREDICTED: probable LRR receptor-like serine...    509   3e-155   
ref|XP_002992868.1|  hypothetical protein SELMODRAFT_136102             506   3e-155   
ref|XP_007212588.1|  hypothetical protein PRUPE_ppa015971mg             504   3e-155   
gb|KHN10868.1|  Putative LRR receptor-like serine/threonine-prote...    503   3e-155   
emb|CAD79350.1|  LRR receptor-like kinase 2                             506   3e-155   
gb|EMT08219.1|  Receptor-like protein kinase                            504   3e-155   
emb|CDX85146.1|  BnaC07g07600D                                          506   4e-155   
ref|XP_011002328.1|  PREDICTED: probable LRR receptor-like serine...    508   4e-155   
ref|XP_010466767.1|  PREDICTED: receptor-like protein kinase 2          506   4e-155   
ref|NP_189066.1|  receptor-like protein kinase 2                        506   5e-155   
ref|XP_002311912.2|  leucine-rich repeat transmembrane protein ki...    505   6e-155   
gb|KDP30760.1|  hypothetical protein JCGZ_15189                         505   7e-155   
ref|XP_006434422.1|  hypothetical protein CICLE_v10000110mg             504   9e-155   
ref|XP_010658080.1|  PREDICTED: probable leucine-rich repeat rece...    507   1e-154   
ref|XP_002969057.1|  hypothetical protein SELMODRAFT_90370              504   1e-154   
ref|XP_009801818.1|  PREDICTED: LRR receptor-like serine/threonin...    506   1e-154   
ref|XP_004983379.1|  PREDICTED: probable leucine-rich repeat rece...    505   2e-154   
ref|NP_174809.1|  putative leucine-rich repeat receptor-like prot...    504   2e-154   
ref|XP_010278009.1|  PREDICTED: probable leucine-rich repeat rece...    505   2e-154   
ref|XP_002303118.2|  hypothetical protein POPTR_0002s25980g             506   3e-154   



>ref|XP_009773366.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana sylvestris]
Length=1260

 Score =  1459 bits (3778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 846/1119 (76%), Positives = 958/1119 (86%), Gaps = 17/1119 (2%)
 Frame = +1

Query  274   GYVRCQN----TSSTLRVLLEVKRSFVL----QLQGWSEKNPNYCSWQGVSC-DGslkvv  426
             GYV C+N    +SSTL++LLE+K+SFV      L+ WSE NPNYC W+GVSC   S++VV
Sbjct  23    GYVFCKNETESSSSTLKILLEIKKSFVDGPENVLRDWSENNPNYCKWRGVSCARNSVQVV  82

Query  427   slnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGP  606
             SLNLSDSSL GSISPS+GLL  LL LDLSSN LSGPIPP LSNL+SLESLLLFSN+L GP
Sbjct  83    SLNLSDSSLSGSISPSIGLLHDLLQLDLSSNLLSGPIPPTLSNLTSLESLLLFSNQLTGP  142

Query  607   IPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlq  786
             IP ++GLL NLQ LRIGDNGLTG IPT+FG+L NLVTLGLA+C L G IP +LG+L+QL+
Sbjct  143   IPIEIGLLKNLQVLRIGDNGLTGTIPTTFGDLENLVTLGLATCNLGGKIPSELGKLSQLE  202

Query  787   nlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGE  966
             NLNLQ+N LEGP+P EI N SSL AFS A+N+LNG+IP+EL  LK+L +LN ANN+L+G+
Sbjct  203   NLNLQENQLEGPIPAEIGNCSSLVAFSVAVNNLNGTIPEELANLKNLQVLNFANNSLSGQ  262

Query  967   IPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQ  1146
             IP +L  M+ L+YLNLLGN L GSIPKSLAKL+NLQ+LDLSGNRL+GE+PGEFG+M QL 
Sbjct  263   IPAELVGMNQLLYLNLLGNHLEGSIPKSLAKLSNLQNLDLSGNRLSGEIPGEFGNMDQLL  322

Query  1147  FLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNG  1326
             FL LTSNNLSG+IPKS+CS+A++L+ +MLSE  LSGEIP EL  CR L+QLDLSNNTL+G
Sbjct  323   FLVLTSNNLSGSIPKSICSSASSLEHMMLSENQLSGEIPVELRDCRSLKQLDLSNNTLSG  382

Query  1327  SIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDL  1506
             SIP EL EL +LTDL+LNNNTL G+ISP +ANLTNLQTL+L HNNL G +P+EIGMLG+L
Sbjct  383   SIPVELSELVELTDLLLNNNTLVGSISPWIANLTNLQTLALSHNNLRGNIPKEIGMLGNL  442

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
             +I+FLYEN  SGEIP+E GNCSSLQ IDFYGNQFTG IPIT+GRLK L F+ LR+NDLSG
Sbjct  443   EILFLYENQLSGEIPMETGNCSSLQMIDFYGNQFTGNIPITIGRLKQLNFIDLRQNDLSG  502

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL  1866
             EIPASLGNCHQL TLDLADN LSG+IP TFGYLRAL +LMLYNNS EG+LPD+L N+ NL
Sbjct  503   EIPASLGNCHQLKTLDLADNRLSGSIPTTFGYLRALEQLMLYNNSFEGNLPDELINVSNL  562

Query  1867  TRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
             TRINLSHN  +GSIA +C+S SFLSFDVTNNAFD +IP  LG SP L+RLRLG+NRFTGK
Sbjct  563   TRINLSHNKLNGSIAALCSSTSFLSFDVTNNAFDHDIPPHLGYSPFLERLRLGNNRFTGK  622

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             IP TLGL RELSLLDLSGN+L+G IP QLSL RKLTHLDLNNNLLSG IP WLG LPLLG
Sbjct  623   IPWTLGLNRELSLLDLSGNELTGSIPAQLSLSRKLTHLDLNNNLLSGSIPTWLGNLPLLG  682

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             ELKL+SN+FSG LP ELFNCSKLLVLSLE+NSLNGT+P EIG L SLNVLNLD NQL G 
Sbjct  683   ELKLASNKFSGPLPRELFNCSKLLVLSLEDNSLNGTIPLEIGMLNSLNVLNLDRNQLSGP  742

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IP+TIG L KLY LRLS N F+GEIP EVGQLK+LQS+LD S+NNLTG+IPPS+GTLSKL
Sbjct  743   IPTTIGNLSKLYILRLSGNTFTGEIPSEVGQLKNLQSILDLSFNNLTGQIPPSVGTLSKL  802

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSP  2766
             E+LDLSHN L GE+PPQV EMSSLG+LNLS N L G+LDK+YAHWP D+F GN HLCGSP
Sbjct  803   EALDLSHNQLIGEVPPQVGEMSSLGKLNLSYNNLHGKLDKQYAHWPADAFTGN-HLCGSP  861

Query  2767  LGSCRDKGSRNK-----GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENY  2931
             L +C D  S N+      S VV+IS +S TVAIILLL+GAA FFK  REA+ RR    NY
Sbjct  862   LQNCEDSKSNNQDPGLSNSTVVIISVISTTVAIILLLLGAALFFKQRREAF-RRESSVNY  920

Query  2932  AsssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGE  3111
             A  SSSSSQ Q++PLFG+ A KRDIRWDDIM+ATNNLS EFIIGSGG  TVYKAELFNGE
Sbjct  921   A-YSSSSSQGQKRPLFGSVAAKRDIRWDDIMDATNNLSTEFIIGSGGSGTVYKAELFNGE  979

Query  3112  TVAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGS  3291
              VAIKRIP KDDL LDKSFAREIKTLWRIRHRHLVRLMGYC+N+GEGSN+LIYEYMENGS
Sbjct  980   IVAIKRIPSKDDLLLDKSFAREIKTLWRIRHRHLVRLMGYCNNRGEGSNLLIYEYMENGS  1039

Query  3292  VWDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSN  3471
             VWDWLH QPANNK+KK LDWEARLKIA+GLAQG+EYLHHDCVPKIIHRDIKSSN+LLDSN
Sbjct  1040  VWDWLHKQPANNKTKKCLDWEARLKIAVGLAQGIEYLHHDCVPKIIHRDIKSSNILLDSN  1099

Query  3472  MEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             MEAHLGDFGLAKA+ DNYDS NTESN WFAGSYGYIAPE
Sbjct  1100  MEAHLGDFGLAKAIKDNYDSFNTESNMWFAGSYGYIAPE  1138



>ref|XP_009593374.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana tomentosiformis]
Length=1258

 Score =  1459 bits (3776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 842/1119 (75%), Positives = 956/1119 (85%), Gaps = 17/1119 (2%)
 Frame = +1

Query  274   GYVRCQN----TSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-DGslkvv  426
             GYV C+N    +SSTL++LLE+K+S V      L+ WSE NPN+C W+GVSC   SLKVV
Sbjct  21    GYVFCKNETESSSSTLKILLEIKKSLVDDPENVLRDWSENNPNFCKWRGVSCARNSLKVV  80

Query  427   slnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGP  606
             SLNLS SSL GSISPS+G L  LL LDLSSN LSGP+ P LSNL+SLESLLLFSN+L GP
Sbjct  81    SLNLSGSSLSGSISPSIGFLHDLLQLDLSSNLLSGPLQPTLSNLTSLESLLLFSNQLTGP  140

Query  607   IPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlq  786
             IP+++GLL NLQ LRIGDNGLTG IPT+FG+L  LVTLGLA+C L G IP +LGRL++++
Sbjct  141   IPTEIGLLKNLQVLRIGDNGLTGTIPTTFGDLEKLVTLGLATCNLGGKIPSELGRLSKIE  200

Query  787   nlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGE  966
             NLNLQ+N LEGP+P EI N SSL AFS A+N+LNGSIP+EL  LK+L +LN ANN+L+G+
Sbjct  201   NLNLQENQLEGPIPAEIGNCSSLVAFSLAVNNLNGSIPEELANLKNLQVLNFANNSLSGQ  260

Query  967   IPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQ  1146
             IP +L  M+ L+YLNLLGNQL GSIPKSLAKL+NLQ+LDLSGN+L GE+PGEFG+MGQL 
Sbjct  261   IPAELVGMNQLLYLNLLGNQLQGSIPKSLAKLSNLQNLDLSGNKLTGEIPGEFGNMGQLL  320

Query  1147  FLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNG  1326
             FL LTSNNLSG+IPKS+CSNA++L+ +MLSE  LSGEIP EL  CR L+QLDLSNNTL+G
Sbjct  321   FLVLTSNNLSGSIPKSICSNASSLEHMMLSENQLSGEIPVELRDCRSLKQLDLSNNTLSG  380

Query  1327  SIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDL  1506
             SIP ELYEL +LTDL+LNNNTL G+ISPS+ANLTNLQTL+L HNNL G +P+EIGMLG+L
Sbjct  381   SIPAELYELVELTDLLLNNNTLVGSISPSIANLTNLQTLALSHNNLRGNIPKEIGMLGNL  440

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
             +I+FLYEN  SGEIP+EIGNCSSLQ IDFYGNQFTG IPIT+GRLK L F+ LR+NDLSG
Sbjct  441   EILFLYENQLSGEIPMEIGNCSSLQMIDFYGNQFTGNIPITIGRLKQLNFIDLRQNDLSG  500

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL  1866
             EIPASLGNCHQL TLDLADN LSG+IP TFGYLRAL +LMLYNNS EG+LPD+L N+ NL
Sbjct  501   EIPASLGNCHQLKTLDLADNRLSGSIPTTFGYLRALEQLMLYNNSFEGNLPDELINVSNL  560

Query  1867  TRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
             TRINLSHN  +GSIA +C+S SFLSFDVTNNAFD +IP  LG SP  +RLRLG+NRFTGK
Sbjct  561   TRINLSHNKLNGSIAALCSSTSFLSFDVTNNAFDHDIPPHLGYSPFFERLRLGNNRFTGK  620

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             IP TLGLIRELSLLDLSGN+L+G IP QLSL RKLTHLDLNNNLL G IP WLG LPLLG
Sbjct  621   IPWTLGLIRELSLLDLSGNELTGSIPAQLSLSRKLTHLDLNNNLLYGSIPTWLGNLPLLG  680

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             ELKLSSN+FSG LP ELFNCSKLLVLSLE+NSLNGT+P EIG L SLNVLNLD NQL G 
Sbjct  681   ELKLSSNKFSGPLPRELFNCSKLLVLSLEDNSLNGTIPLEIGKLNSLNVLNLDRNQLSGP  740

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IP+TIG L KLY LRLS N F+GEIP E+GQLK+LQS+LD S+NNLTG+IPPS+GTLSKL
Sbjct  741   IPTTIGNLSKLYILRLSGNTFTGEIPSELGQLKNLQSILDLSFNNLTGQIPPSVGTLSKL  800

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSP  2766
             E+LDLSHN L GE+PPQV EMSSLG+LNLS N+L G+LDK+YAHWP D+F GN HLCGSP
Sbjct  801   EALDLSHNQLIGEVPPQVGEMSSLGKLNLSYNKLHGKLDKQYAHWPADAFTGN-HLCGSP  859

Query  2767  LGSCRDKGSRNK-----GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENY  2931
             L +C++  S N+      S VV+IS +S TVAIILLL+GAA FFK  REA+RR     NY
Sbjct  860   LQNCKESKSNNQDPGLSNSTVVIISVISTTVAIILLLLGAALFFKQRREAFRRASSI-NY  918

Query  2932  AsssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGE  3111
             A  SSSSS  Q++ LFG+ A KRDI WDDIMEATNNLS EFIIGSGG  TVYKAELFNGE
Sbjct  919   A-YSSSSSHGQKRALFGSVAAKRDITWDDIMEATNNLSTEFIIGSGGSGTVYKAELFNGE  977

Query  3112  TVAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGS  3291
              VAIKRIP KDDL LDKSFAREIKTLWRIRHRHLVRLMGYC+N+GEGSN+LIYEYMENGS
Sbjct  978   IVAIKRIPSKDDLLLDKSFAREIKTLWRIRHRHLVRLMGYCNNRGEGSNLLIYEYMENGS  1037

Query  3292  VWDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSN  3471
             VWDWLH QPANNK+KK LDWEARLKIA+GLAQG+EYLHHDCVPKIIHRDIKSSN+LLDSN
Sbjct  1038  VWDWLHKQPANNKTKKCLDWEARLKIAVGLAQGIEYLHHDCVPKIIHRDIKSSNILLDSN  1097

Query  3472  MEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             MEAHLGDFGLAKA+ DNYDS NTESN WFAGSYGYIAPE
Sbjct  1098  MEAHLGDFGLAKAIKDNYDSFNTESNMWFAGSYGYIAPE  1136



>ref|XP_006363236.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Solanum tuberosum]
Length=1255

 Score =  1439 bits (3724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 819/1119 (73%), Positives = 944/1119 (84%), Gaps = 19/1119 (2%)
 Frame = +1

Query  274   GYVRCQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSCD-Gslkvvslnl  438
             GYV  +   + L VLLE+K+SF+      L  WS+KN N+C W GVSC+  +LKVV LNL
Sbjct  20    GYVFSE---TELEVLLEIKKSFLDDPENVLSNWSDKNQNFCQWSGVSCEEDTLKVVRLNL  76

Query  439   sdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQ  618
             SD S+ GSISPS G L  LLHLDLSSN LSGPIPP LSNLSSL+SLLL+SN+L GPIP++
Sbjct  77    SDCSISGSISPSFGFLHDLLHLDLSSNLLSGPIPPTLSNLSSLQSLLLYSNQLTGPIPNE  136

Query  619   LGLLTNLQALRIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnln  795
             +GLL NLQ LRIGDN GLTG IP+S G+L NLVTLGLASC LSG+IPP+LG+L +++N+N
Sbjct  137   IGLLKNLQVLRIGDNVGLTGLIPSSIGDLENLVTLGLASCSLSGMIPPELGKLGRVENMN  196

Query  796   lqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPG  975
             LQ+N LE  +P EI N SSL AFS A+N+LNGSIP+EL  LK+L ++NLANN+L+G+IP 
Sbjct  197   LQENNLENGIPAEIGNCSSLVAFSVAVNNLNGSIPEELSMLKNLQVMNLANNSLSGQIPT  256

Query  976   QLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLA  1155
             QLGEM+ L YLNLLGNQL GSIPKSLAKL+N+++LDLSGNRL GE+PGEFG+M QLQFL 
Sbjct  257   QLGEMNELQYLNLLGNQLEGSIPKSLAKLSNVRNLDLSGNRLTGEIPGEFGNMDQLQFLV  316

Query  1156  LTSNNLSGTIPKSLCSNATN--LQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGS  1329
             LTSNNLSG+IPK++CS+  N  L+ +MLSE  LSGEIP EL +C  L+QLDLSNNTLNGS
Sbjct  317   LTSNNLSGSIPKTICSSNRNSSLEHMMLSENQLSGEIPVELKECISLKQLDLSNNTLNGS  376

Query  1330  IPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQ  1509
             IP ELYEL +LTDL+LNNNTL G++SP +ANLTNLQTL+L HNN HG +P+EIGM+ +L+
Sbjct  377   IPVELYELVELTDLLLNNNTLVGSVSPLIANLTNLQTLALSHNNFHGNIPKEIGMVENLE  436

Query  1510  IIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGE  1689
             I+FLYEN FSGEIP+EIGNCS LQ IDFYGN F+G+IPIT+G LK L F+  R+NDLSGE
Sbjct  437   ILFLYENQFSGEIPMEIGNCSRLQMIDFYGNAFSGRIPITIGGLKELNFIDFRQNDLSGE  496

Query  1690  IPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLT  1869
             IPASLGNCHQL  LDLADN LSG++PATFGYLRAL +LMLYNNSLEG+LPD+L NL NLT
Sbjct  497   IPASLGNCHQLKILDLADNRLSGSVPATFGYLRALEQLMLYNNSLEGNLPDELINLSNLT  556

Query  1870  RINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKI  2049
             RIN SHN  +GSI  +C+S SFLSFDVTNNAFD E+P  LG SP L+RLRLG+NRFTG+I
Sbjct  557   RINFSHNKLNGSIVSLCSSTSFLSFDVTNNAFDHEVPPHLGYSPFLERLRLGNNRFTGEI  616

Query  2050  PMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllge  2229
             P TLGLIRELSLLDLSGN+L G IPPQLSLCRKLTHLDLNNN L G IP WLG LPLLGE
Sbjct  617   PWTLGLIRELSLLDLSGNELIGLIPPQLSLCRKLTHLDLNNNRLYGSIPSWLGNLPLLGE  676

Query  2230  lklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSI  2409
             LKLSSN+FSG LP ELFNCSKLLVLSLE NSLNGTLP EIG LKSLN+LN + NQL G I
Sbjct  677   LKLSSNKFSGPLPRELFNCSKLLVLSLEENSLNGTLPLEIGELKSLNILNFNKNQLSGPI  736

Query  2410  PSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLE  2589
             PSTIG L KLY LRLS N  +GEIP E+G+LK+LQS+LD S+NN+ G+IPPS+GTL+KLE
Sbjct  737   PSTIGNLSKLYILRLSGNNLTGEIPSELGELKNLQSILDLSFNNIIGQIPPSVGTLTKLE  796

Query  2590  SLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPL  2769
             +LDLSHN LTGE+PPQV EMSSLG+LNLS N L+G+LDK+YAHWP D+F GN HLCGSPL
Sbjct  797   TLDLSHNHLTGEVPPQVGEMSSLGKLNLSYNNLQGKLDKQYAHWPADAFTGNPHLCGSPL  856

Query  2770  GSCRDKGSRNKG-----SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYA  2934
              +C    S N+G     S VV+IS +S TVAIIL+L+GAA FFK  REA+  RRG E  +
Sbjct  857   QNCEVSKSNNRGSGLSNSTVVIISVISTTVAIILMLLGAALFFKQRREAF--RRGSEVNS  914

Query  2935  sssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGET  3114
             + SSSSSQ Q++PLF + A KRDIRWDDIMEATNNLS++FIIGSGG  TVYKAELFNGE 
Sbjct  915   AYSSSSSQGQKRPLFASVAAKRDIRWDDIMEATNNLSNDFIIGSGGSGTVYKAELFNGEI  974

Query  3115  VAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSV  3294
             VAIKRIP KDDL LDKSFAREIKTLWRIRHRHLVRL+GYC+N GEGSNVLIYEYMENGSV
Sbjct  975   VAIKRIPSKDDLLLDKSFAREIKTLWRIRHRHLVRLLGYCNNSGEGSNVLIYEYMENGSV  1034

Query  3295  WDWLHNQPANNKSKKS-LDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSN  3471
             WDWLH QPANN  +K+ LDWEARLKIA+GLAQGVEYLHHDCVPKIIHRDIKSSN+LLDSN
Sbjct  1035  WDWLHKQPANNNKRKTCLDWEARLKIAVGLAQGVEYLHHDCVPKIIHRDIKSSNILLDSN  1094

Query  3472  MEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             MEAHLGDFGLAKA+ DNY+S NTESN W AGS+GYIAPE
Sbjct  1095  MEAHLGDFGLAKAVHDNYNSYNTESNLWLAGSFGYIAPE  1133



>gb|AAT40539.2| Leucine Rich Repeat family protein [Solanum demissum]
Length=1248

 Score =  1425 bits (3690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 814/1119 (73%), Positives = 942/1119 (84%), Gaps = 21/1119 (2%)
 Frame = +1

Query  274   GYVRCQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSCD-Gslkvvslnl  438
             GYV  +   +   VLLE+K+SF+      L  WS+KN N+C W GVSC+  +LKVV LNL
Sbjct  18    GYVFSE---TEFEVLLEIKKSFLDDPENVLSNWSDKNQNFCQWSGVSCEEDTLKVVRLNL  74

Query  439   sdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQ  618
             SD S+ GSISPS+G L  LLHLDLSSN LSGPIPP LSNLSSL+SLLL+SN+L GPIP++
Sbjct  75    SDCSISGSISPSIGFLHDLLHLDLSSNLLSGPIPPTLSNLSSLQSLLLYSNQLTGPIPNE  134

Query  619   LGLLTNLQALRIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnln  795
             +GLL NLQ LRIGDN GLTG IP+S G+L NLVTLGLASC LSG+IPP+LG+L +++N+N
Sbjct  135   IGLLKNLQVLRIGDNVGLTGLIPSSLGDLENLVTLGLASCSLSGMIPPELGKLGRIENMN  194

Query  796   lqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPG  975
             LQ+N LE  +P EI N SSL AFS A+N+LNGSIP+EL  LK+L ++NLANN+++G+IP 
Sbjct  195   LQENQLENEIPSEIGNCSSLVAFSVAVNNLNGSIPEELSMLKNLQVMNLANNSISGQIPT  254

Query  976   QLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLA  1155
             QLGEM  L YLNLLGNQL GSIP SLAKL+N+++LDLSGNRL GE+PGEFG+M QLQ L 
Sbjct  255   QLGEMIELQYLNLLGNQLEGSIPMSLAKLSNVRNLDLSGNRLTGEIPGEFGNMDQLQVLV  314

Query  1156  LTSNNLSGTIPKSLCSNATN--LQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGS  1329
             LTSNNLSG IPK++CS+  N  L+ +MLSE  LSGEIP EL +C  L+QLDLSNNTLNGS
Sbjct  315   LTSNNLSGGIPKTICSSNGNSSLEHMMLSENQLSGEIPVELRECISLKQLDLSNNTLNGS  374

Query  1330  IPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQ  1509
             IP ELYEL +LTDL+LNNNTL G++SP +ANLTNLQTL+L HN+LHG +P+EIGM+ +L+
Sbjct  375   IPVELYELVELTDLLLNNNTLVGSVSPLIANLTNLQTLALSHNSLHGNIPKEIGMVENLE  434

Query  1510  IIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGE  1689
             I+FLYEN FSGEIP+EIGNCS LQ IDFYGN F+G+IPIT+G LK L F+  R+NDLSGE
Sbjct  435   ILFLYENQFSGEIPMEIGNCSRLQMIDFYGNAFSGRIPITIGGLKELNFIDFRQNDLSGE  494

Query  1690  IPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLT  1869
             IPAS+GNCHQL  LDLADN LSG++PATFGYLRAL +LMLYNNSLEG+LPD+L NL NLT
Sbjct  495   IPASVGNCHQLKILDLADNRLSGSVPATFGYLRALEQLMLYNNSLEGNLPDELINLSNLT  554

Query  1870  RINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKI  2049
             RIN SHN  +GSIA +C+S SFLSFDVTNNAFD E+P  LG SP L+RLRLG+NRFTG+I
Sbjct  555   RINFSHNKLNGSIASLCSSTSFLSFDVTNNAFDHEVPPHLGYSPFLERLRLGNNRFTGEI  614

Query  2050  PMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllge  2229
             P TLGLIRELSLLDLSGN+L+G IPPQLSLCRKLTHLDLNNN L G IP WLG LPLLGE
Sbjct  615   PWTLGLIRELSLLDLSGNELTGLIPPQLSLCRKLTHLDLNNNRLYGSIPFWLGNLPLLGE  674

Query  2230  lklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSI  2409
             LKLSSN+FSG LP ELFNCSKLLVLSLE+NS+NGTLP EIG LKSLN+LN D NQL G I
Sbjct  675   LKLSSNKFSGPLPRELFNCSKLLVLSLEDNSINGTLPLEIGELKSLNILNFDKNQLSGPI  734

Query  2410  PSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLE  2589
             PSTIG L KLY LRLS N  +GEIP E+GQLK+LQS+LD S+NN++G+IPPS+GTL+KLE
Sbjct  735   PSTIGNLSKLYILRLSGNSLTGEIPSELGQLKNLQSILDLSFNNISGQIPPSVGTLTKLE  794

Query  2590  SLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPL  2769
             +LDLSHN LTGE+PPQV EMSSLG+LNLS N L+G+LDK+YAHWP D+F GN  LCGSPL
Sbjct  795   TLDLSHNHLTGEVPPQVGEMSSLGKLNLSYNNLQGKLDKQYAHWPADAFTGNPRLCGSPL  854

Query  2770  GSCRDKGSRNKG-----SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYA  2934
              +C    S N+G     S VV+IS +S TVAIIL+L+GAA FFK  REA+R     E  +
Sbjct  855   QNCEVSKSNNRGSGLSNSTVVIISVISTTVAIILMLLGAALFFKQRREAFR----SEVNS  910

Query  2935  sssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGET  3114
             + SSSSSQ Q+KPLF + A KRDIRWDDIMEATNNLS++FIIGSGG  TVYKAELF GE 
Sbjct  911   AYSSSSSQGQKKPLFASVAAKRDIRWDDIMEATNNLSNDFIIGSGGSGTVYKAELFIGEI  970

Query  3115  VAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSV  3294
             VAIKRIP KDDL LDKSFAREIKTLWRIRHRHLVRL+GYC+N GEGSNVLIYEYMENGSV
Sbjct  971   VAIKRIPSKDDLLLDKSFAREIKTLWRIRHRHLVRLLGYCNNSGEGSNVLIYEYMENGSV  1030

Query  3295  WDWLHNQPANNKSKKS-LDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSN  3471
             WDWLH QPANN  +K+ LDWEARLKIA+GLAQGVEYLHHDCVPKIIHRDIKSSN+LLDSN
Sbjct  1031  WDWLHKQPANNNKRKTCLDWEARLKIAVGLAQGVEYLHHDCVPKIIHRDIKSSNILLDSN  1090

Query  3472  MEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             MEAHLGDFGLAKA+ DNY+S NTESN WFAGS+GYIAPE
Sbjct  1091  MEAHLGDFGLAKAVHDNYNSYNTESNLWFAGSFGYIAPE  1129



>ref|XP_004239381.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Solanum lycopersicum]
Length=1250

 Score =  1418 bits (3671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 806/1117 (72%), Positives = 932/1117 (83%), Gaps = 17/1117 (2%)
 Frame = +1

Query  274   GYVRCQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSCD-Gslkvvslnl  438
             GYV  +   +    LLE+K+S V      L  WS++N N+C W+GVSCD  +LKVV LNL
Sbjct  20    GYVFSE---TEFEALLEIKKSLVDDPENVLSNWSDENKNFCQWRGVSCDEDTLKVVGLNL  76

Query  439   sdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQ  618
             SD S+ GSISPS+G L HLLHLDLSSN LSGPIPPALSNLSSL+SLLL+SN+L GPIP++
Sbjct  77    SDCSISGSISPSIGFLHHLLHLDLSSNLLSGPIPPALSNLSSLQSLLLYSNQLTGPIPNE  136

Query  619   LGLLTNLQALRIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnln  795
             +GLL NLQ +RIGDN GLTG IP+SFG+L NLVTLGLASC L G IPP+LG+L +++ +N
Sbjct  137   IGLLKNLQVIRIGDNVGLTGPIPSSFGDLENLVTLGLASCSLIGAIPPELGKLKRVETMN  196

Query  796   lqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPG  975
             LQ+N LE  +P EI N SSL AFS A+N+LNGSIP+EL  LK++ ++NLANN+ +G+IP 
Sbjct  197   LQENQLENEIPVEIGNCSSLVAFSVAVNNLNGSIPEELSMLKNVQVMNLANNSFSGQIPT  256

Query  976   QLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLA  1155
             QLGEM+ L YLNLLGNQL G IPKSLAKL+N+Q+LDLSGNRL GE+PGEFG+M  L+FL 
Sbjct  257   QLGEMNELRYLNLLGNQLEGLIPKSLAKLSNVQNLDLSGNRLTGEIPGEFGNMEGLRFLV  316

Query  1156  LTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIP  1335
             LTSNNLSG+IPK+LCS  ++L+ +MLSE  LSGEIP EL +C  L+ LDLSNNTLNGSIP
Sbjct  317   LTSNNLSGSIPKTLCSGKSSLEHMMLSENLLSGEIPVELRECVSLKVLDLSNNTLNGSIP  376

Query  1336  EELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQII  1515
              ELYEL +LTDL+LNNNTL G++SP +ANLTNLQTL+L HN+ HG +P+EIGML  L+I+
Sbjct  377   FELYELVELTDLLLNNNTLVGSVSPLIANLTNLQTLALSHNSFHGNIPKEIGMLASLEIL  436

Query  1516  FLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIP  1695
             FLYEN FSGEIP+EIGNCSSLQ ID YGN F+G+IPIT+G LK L F+  R+NDLSGEIP
Sbjct  437   FLYENQFSGEIPMEIGNCSSLQMIDLYGNAFSGRIPITIGGLKELNFVDFRQNDLSGEIP  496

Query  1696  ASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRI  1875
             ASLGNCHQL  LDLADN LSG +PATFGYLRAL +LMLYNNSLEG+LPD+L NL NLTRI
Sbjct  497   ASLGNCHQLKILDLADNRLSGNVPATFGYLRALEQLMLYNNSLEGNLPDELINLANLTRI  556

Query  1876  NLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPM  2055
             N SHN  +GSI  +C+S SFLSFDVTNNAFD E+P  LG SP L+RLRLG+NRF G+IP 
Sbjct  557   NFSHNKLNGSIVSLCSSTSFLSFDVTNNAFDHEVPPHLGYSPFLERLRLGNNRFIGEIPW  616

Query  2056  TLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelk  2235
             TLGLIRELSLLDLSGN+L+G IPPQLSLCRKLTHLDLNNN   G IP WLG LPLLGELK
Sbjct  617   TLGLIRELSLLDLSGNELTGLIPPQLSLCRKLTHLDLNNNRFYGSIPSWLGNLPLLGELK  676

Query  2236  lSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPS  2415
             LSSN+FSG LP ELFNCSKLLVLSLE+N++NGTLP EIG LKSLNVLN D NQL G IPS
Sbjct  677   LSSNKFSGPLPRELFNCSKLLVLSLEHNAINGTLPLEIGELKSLNVLNFDKNQLSGPIPS  736

Query  2416  TIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESL  2595
             TIG L KLY LRLS N  +GEIP  +G+LK+LQS+LD S+NN TG+IPPS+GTL+KLE+L
Sbjct  737   TIGNLSKLYILRLSGNSLTGEIPSALGELKNLQSILDLSFNNFTGQIPPSVGTLTKLETL  796

Query  2596  DLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGS  2775
             DLSHN LTGE+PPQV EMSSLG+LNLS N L+G+LDK+YAHWP D+F GN  LCGSPL +
Sbjct  797   DLSHNHLTGEVPPQVGEMSSLGKLNLSYNNLQGKLDKQYAHWPADAFTGNPRLCGSPLQN  856

Query  2776  CRDKGSRNKG-----SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAss  2940
             C    S N+      S VV+IS +S TVAIIL+L+GAA FFK  REA+  RRG E  ++ 
Sbjct  857   CEVSKSNNRSSGLSNSTVVIISVISTTVAIILMLLGAALFFKQRREAF--RRGSEVNSAY  914

Query  2941  sssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVA  3120
             SSSSSQ Q++PLF + A KRDIRWDDIMEATNNLS++FIIGSGG  TVYKAELFNGE VA
Sbjct  915   SSSSSQGQKRPLFASVAAKRDIRWDDIMEATNNLSNDFIIGSGGSGTVYKAELFNGEIVA  974

Query  3121  IKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWD  3300
             IKRIP KDDL LDK FAREIKTLWRIRHRHLVRL+GYC+N GEGSNVLIYEYMENGSVWD
Sbjct  975   IKRIPSKDDLLLDKCFAREIKTLWRIRHRHLVRLLGYCNNSGEGSNVLIYEYMENGSVWD  1034

Query  3301  WLHNQPANNKSKKS-LDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNME  3477
             WLH QP NN  +K+ LDWEARLKIA+GLAQGVEYLHHDCVPKIIHRDIKSSN+LLDSNME
Sbjct  1035  WLHKQPDNNNKRKTCLDWEARLKIAVGLAQGVEYLHHDCVPKIIHRDIKSSNILLDSNME  1094

Query  3478  AHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             AHLGDFGLAKA+ DNY+S NTESN W AGS+GYIAPE
Sbjct  1095  AHLGDFGLAKAVHDNYNSYNTESNLWLAGSFGYIAPE  1131



>ref|XP_011096866.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Sesamum indicum]
Length=1252

 Score =  1369 bits (3544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 809/1111 (73%), Positives = 927/1111 (83%), Gaps = 17/1111 (2%)
 Frame = +1

Query  301   STLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSCDGslkvv------slnlsdss  450
             S + +L+EVK+SFV      LQ WS  NPN+CSW+G+SC  +          +L+LS+SS
Sbjct  22    SIINILMEVKKSFVQDPLNVLQDWSPHNPNFCSWRGLSCSPTSSASLQPQLLALDLSNSS  81

Query  451   lggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLL  630
             L GS+SP+L LL +LL L+LSSN LSGPIPPALSNLSSLESLLLFSN+L GPIP QLG L
Sbjct  82    LRGSLSPALALLPNLLLLNLSSNQLSGPIPPALSNLSSLESLLLFSNQLSGPIPPQLGSL  141

Query  631   TNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnl  810
              NLQ LRIGDN LTG IP SFGNL NLVTLGLASC L+G IPP+LGRL QLQNL LQQN 
Sbjct  142   LNLQVLRIGDNYLTGPIPPSFGNLQNLVTLGLASCSLTGRIPPELGRLGQLQNLVLQQNQ  201

Query  811   lEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEM  990
             L GP+P E+AN SSL  F+AALN LNGSIP EL GL +L  LNLANNTL+G IP QLGEM
Sbjct  202   LLGPIPQELANCSSLIVFTAALNRLNGSIPSELAGLNNLRTLNLANNTLSGGIPTQLGEM  261

Query  991   SSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNN  1170
             S L YLNLLGNQL G+IPKSLA L NLQSLDLSGNRL+GE+PGE GSMGQL +L L+SNN
Sbjct  262   SQLRYLNLLGNQLQGTIPKSLANLINLQSLDLSGNRLSGEIPGELGSMGQLVYLVLSSNN  321

Query  1171  LSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYE  1350
             L+G IP+ +CSN T+L+ LML++  LSG IP ELS C+ L+QLDLSNNTL+G IPEELYE
Sbjct  322   LTGNIPRGICSNTTSLEYLMLAQNQLSGRIPTELSDCKSLKQLDLSNNTLDGFIPEELYE  381

Query  1351  LTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYEN  1530
             L QLTDL+LNNNTL G+ISP +ANLTNLQTL+L+ N L G +P+EIGMLG LQI+++Y+N
Sbjct  382   LHQLTDLLLNNNTLSGSISPFIANLTNLQTLALYQNYLRGNLPKEIGMLGKLQILYVYDN  441

Query  1531  HFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGN  1710
               SGEIPVEIGNCSSLQ +DF+GNQFTG+IPIT+GRLK L FLHLR+NDLSGEIP+SLGN
Sbjct  442   QLSGEIPVEIGNCSSLQMVDFFGNQFTGQIPITIGRLKQLNFLHLRQNDLSGEIPSSLGN  501

Query  1711  CHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHN  1890
             CHQL  LDLADN LSG IPATFG+L+AL +LMLYNNSL+G+LPD+L +L NLTRINLSHN
Sbjct  502   CHQLAILDLADNRLSGRIPATFGHLQALEQLMLYNNSLQGNLPDELSSLTNLTRINLSHN  561

Query  1891  NFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLI  2070
               +GSIAP+CTS +FLSFDVTNN FD EIP  +GNSP+L+RLRLG+N FTG+IP TLGL+
Sbjct  562   KLNGSIAPLCTSRNFLSFDVTNNGFDHEIPRQIGNSPALERLRLGNNLFTGQIPWTLGLL  621

Query  2071  RELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQ  2250
             ++LSLLDLS N L+G IP QLSLC +LTHLDL++NLLSGPIP W+GRLPLLGELKLS+N 
Sbjct  622   QQLSLLDLSRNLLTGQIPVQLSLCNRLTHLDLDHNLLSGPIPFWIGRLPLLGELKLSANN  681

Query  2251  FSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGL  2430
              SGSLP ELFNCS LLVLSLE NSLNGTLPPE+G LKSLNVL+L+ NQL G +P TIG L
Sbjct  682   LSGSLPQELFNCSNLLVLSLEANSLNGTLPPEVGKLKSLNVLDLNRNQLSGPLPPTIGQL  741

Query  2431  GKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHN  2610
              KLYELRLS N FSGEIP E+GQL++LQSVLD SYNNL+G IP SIG LSKLE+LDLSHN
Sbjct  742   SKLYELRLSLNSFSGEIPAEIGQLQNLQSVLDLSYNNLSGHIPSSIGRLSKLEALDLSHN  801

Query  2611  DLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKG  2790
              L GEIPPQV+EMSSLGRLNLS N L+G+LDKRYA WP  SF GN +LCGSPL +C+D  
Sbjct  802   ALVGEIPPQVSEMSSLGRLNLSFNHLQGKLDKRYARWPATSFDGNLNLCGSPLQNCKDIK  861

Query  2791  SRN-----KGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssss  2955
             S N       S VV+ISA+S T A+ILLL+GAA FFKH REA RR  G +  ++ SSSSS
Sbjct  862   SANGEPGLSESSVVIISAISTTFAVILLLLGAALFFKHRREALRRGSGLD--STYSSSSS  919

Query  2956  QAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIP  3135
             QAQR+PLF NAA K D RW DIMEATNNLS+EFIIGSGG  T+YKAELF GETVAIKRI 
Sbjct  920   QAQRRPLFDNAAAKNDFRWIDIMEATNNLSEEFIIGSGGSGTIYKAELFTGETVAIKRIV  979

Query  3136  RKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQ  3315
             RKDD  LD+SFAREIKTL RIRHRHLVRL+GYC N   GSN+LIYEYMENGSVWDWLH Q
Sbjct  980   RKDDPMLDRSFAREIKTLGRIRHRHLVRLLGYCCNIRAGSNLLIYEYMENGSVWDWLHKQ  1039

Query  3316  PANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDF  3495
             P + K K+ LDWEARLKIA+GLAQG+EYLH+DC PKI+HRD+KSSNVLLD+NMEAHLGDF
Sbjct  1040  PMDEKRKRILDWEARLKIAVGLAQGLEYLHYDCAPKILHRDVKSSNVLLDANMEAHLGDF  1099

Query  3496  GLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             GLAK +TDN+DS+NTESN WFAGSYGYIAPE
Sbjct  1100  GLAKPVTDNHDSVNTESNLWFAGSYGYIAPE  1130



>ref|XP_011008219.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Populus euphratica]
Length=1254

 Score =  1309 bits (3388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 768/1117 (69%), Positives = 903/1117 (81%), Gaps = 17/1117 (2%)
 Frame = +1

Query  274   GYVRCQNTSSTLRVLLEVKRSFV----LQLQGWSEKNPNYCSWQGVSC-----DGslkvv  426
             G+V CQN    L VLLEVK+SF       L  W+E NPN C+W GV+C     DGS++VV
Sbjct  21    GFVLCQNQE--LSVLLEVKKSFEGDPEKVLHDWNESNPNSCTWTGVTCGLNSVDGSVQVV  78

Query  427   slnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGP  606
             SLNLSDSSL GSISPSLG L +LLHLDLSSN L+GPIP  LSNLSSLE+LLLFSN+L GP
Sbjct  79    SLNLSDSSLSGSISPSLGSLKYLLHLDLSSNSLTGPIPATLSNLSSLETLLLFSNQLTGP  138

Query  607   IPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlq  786
             IP QLG +T+L  +RIGDNGL+G +P SFGNL NLVTLGLASC L+G IP QLG+L+Q+Q
Sbjct  139   IPIQLGSITSLLVMRIGDNGLSGPVPASFGNLVNLVTLGLASCSLTGPIPSQLGQLSQVQ  198

Query  787   nlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGE  966
             NL LQQN LEG +P E+ N SSLT F+ ALN+LNGSIP ELG L++L ILNLANN+L+GE
Sbjct  199   NLILQQNQLEGLIPAELGNCSSLTVFTVALNNLNGSIPGELGRLQNLQILNLANNSLSGE  258

Query  967   IPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQ  1146
             IP QLGEMS LVYLN +GNQLGGSIPKSLAK+ +LQ+LDLS N L G +P E GSM QL 
Sbjct  259   IPTQLGEMSQLVYLNFMGNQLGGSIPKSLAKMGSLQNLDLSMNMLTGGVPEELGSMAQLV  318

Query  1147  FLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNG  1326
             FL L++NN+SG IP+SLCSN TNL+ L+LSE  LSG IP EL  C  L QLDLSNN+LNG
Sbjct  319   FLVLSNNNISGVIPRSLCSNNTNLESLILSEIQLSGPIPKELRLCPSLMQLDLSNNSLNG  378

Query  1327  SIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDL  1506
             SIP+E+YE  QLT L L+NN+L G+ISP +ANL+NL+ L+L+HNNL G +P+EIGMLG+L
Sbjct  379   SIPDEIYESVQLTHLYLHNNSLVGSISPLIANLSNLKELALYHNNLLGNLPKEIGMLGNL  438

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
             ++++LY+N  SGEIP+EIG CS+LQ IDFYGN F+G+IP+T+GRLK L  LHLR+N+L G
Sbjct  439   EVLYLYDNLISGEIPMEIGYCSNLQMIDFYGNHFSGEIPVTIGRLKGLNLLHLRQNELFG  498

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL  1866
              IPA+LGNCHQL  LDLADN LSG IP TFG+L AL +LMLYNNSLEG+LPD L NL NL
Sbjct  499   HIPATLGNCHQLTILDLADNGLSGGIPPTFGFLHALEQLMLYNNSLEGNLPDSLTNLRNL  558

Query  1867  TRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
             TRINLS N F+G IA +C S SFLSFDVT+N F  EIP+ LGNSPSL+RLRLG+NRF GK
Sbjct  559   TRINLSKNRFNGGIAALCGSSSFLSFDVTSNTFGNEIPALLGNSPSLERLRLGNNRFNGK  618

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             IP TLG IRELSLLDLSGN L+G IP QL LC+KL H+DLNNNLL G +P WLG LPLLG
Sbjct  619   IPWTLGQIRELSLLDLSGNLLTGQIPAQLMLCKKLAHIDLNNNLLYGSVPSWLGNLPLLG  678

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             ELKL SNQF+GSLP ELFNCSKLLVLSL+ N LNGTLP E+GNL+SLNVLNL+ NQL GS
Sbjct  679   ELKLFSNQFTGSLPRELFNCSKLLVLSLDANLLNGTLPVEVGNLESLNVLNLNQNQLSGS  738

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IP  +G L KLYELRLS N F GEIP E+GQL++LQS+LD S NNL G+IPPSIGTLSKL
Sbjct  739   IPPALGKLSKLYELRLSNNSFGGEIPSELGQLQNLQSILDLSCNNLGGQIPPSIGTLSKL  798

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSP  2766
             E+LDLSHN L G +PP+V  +SSLG+LNLS N+L+G+LDK+++HWP ++F GN  LCG P
Sbjct  799   EALDLSHNCLVGAVPPEVGSLSSLGKLNLSFNKLQGKLDKQFSHWPPEAFEGNLQLCGIP  858

Query  2767  LGSC---RDKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAs  2937
             L  C    D+ S      VV+ISA+++  A+ LL  G   FFK  RE  +R    E   +
Sbjct  859   LNRCSILSDQQSGLSELSVVIISAITSLAAVALLAFGLVLFFKRRREFLKRV--SEGNCT  916

Query  2938  ssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETV  3117
              SSSSSQAQRK  F     KRD RWDD+MEATNNLSDEFIIGSGG  T+Y+AE  +GETV
Sbjct  917   YSSSSSQAQRKTPFLKGTAKRDYRWDDLMEATNNLSDEFIIGSGGSGTIYRAEFQSGETV  976

Query  3118  AIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVW  3297
             A+K+I  KD+  L+KSFARE+KTL RIRHR+LV+L+GYCSNKG G N+LIYEYMENGS+W
Sbjct  977   AVKKILWKDEFLLNKSFAREVKTLGRIRHRNLVKLLGYCSNKGAGCNLLIYEYMENGSLW  1036

Query  3298  DWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNME  3477
             DWLH QP NNK ++SLDWEARLKI +GLAQGVEYLHHDCVPKI+HRD+KSSNVLLDSNME
Sbjct  1037  DWLHQQPVNNKQRQSLDWEARLKIGVGLAQGVEYLHHDCVPKIMHRDVKSSNVLLDSNME  1096

Query  3478  AHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             AHLGDFGLAKAL ++YDS NTES++WFAGSYGYIAPE
Sbjct  1097  AHLGDFGLAKALEEDYDS-NTESHSWFAGSYGYIAPE  1132



>ref|XP_002299384.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE84189.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1253

 Score =  1305 bits (3377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 775/1117 (69%), Positives = 906/1117 (81%), Gaps = 17/1117 (2%)
 Frame = +1

Query  274   GYVRCQNTSSTLRVLLEVKRSFV----LQLQGWSEKNPNYCSWQGVSC-----DGslkvv  426
             G+V CQN    L VLLEVK+SF       L  W+E NPN C+W GV+C     DGS++VV
Sbjct  21    GFVLCQNQE--LSVLLEVKKSFEGDPEKVLHDWNESNPNSCTWTGVTCGLNSVDGSVQVV  78

Query  427   slnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGP  606
             SLNLSDSSL GSISPSLG L +LLHLDLSSN L+GPIP  LSNLSSLE+LLLFSN+L GP
Sbjct  79    SLNLSDSSLSGSISPSLGSLKYLLHLDLSSNSLTGPIPTTLSNLSSLETLLLFSNQLTGP  138

Query  607   IPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlq  786
             IP QLG +T+L  +RIGDNGL+G +P SFGNL NLVTLGLASC L+G IPPQLG+L+Q+Q
Sbjct  139   IPIQLGSITSLLVMRIGDNGLSGPVPASFGNLVNLVTLGLASCSLTGPIPPQLGQLSQVQ  198

Query  787   nlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGE  966
             NL LQQN LEG +P E+ N SSLT F+ ALN+LNGSIP ELG L++L ILNLANN+L+GE
Sbjct  199   NLILQQNQLEGLIPAELGNCSSLTVFTVALNNLNGSIPGELGRLQNLQILNLANNSLSGE  258

Query  967   IPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQ  1146
             IP QLGEMS LVYLN +GN LGGSIPKSLAK+ +LQ+LDLS N L G +P E G M QL 
Sbjct  259   IPTQLGEMSQLVYLNFMGNHLGGSIPKSLAKMGSLQNLDLSMNMLTGGVPEELGRMAQLV  318

Query  1147  FLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNG  1326
             FL L++NNLSG IP SLCSN TNL+ L+LSE  LSG IP EL  C  L QLDLSNN+LNG
Sbjct  319   FLVLSNNNLSGVIPTSLCSNNTNLESLILSEIQLSGPIPKELRLCPSLMQLDLSNNSLNG  378

Query  1327  SIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDL  1506
             SIP E+YE  QLT L L+NN+L G+ISP +ANL+NL+ L+L+HNNL G +P+EIGMLG+L
Sbjct  379   SIPNEIYESVQLTHLYLHNNSLVGSISPLIANLSNLKELALYHNNLLGNLPKEIGMLGNL  438

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
             ++++LY+N  SGEIP+EIGNCS+LQ IDFYGN F+G+IP+T+GRLK L  LHLR+N+L G
Sbjct  439   EVLYLYDNLLSGEIPMEIGNCSNLQMIDFYGNHFSGEIPVTIGRLKGLNLLHLRQNELFG  498

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL  1866
              IPA+LGNCHQL  LDLADN LSG IP TFG+L AL +LMLYNNSLEG+LPD L NL NL
Sbjct  499   HIPATLGNCHQLTILDLADNGLSGGIPVTFGFLHALEQLMLYNNSLEGNLPDSLTNLRNL  558

Query  1867  TRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
             TRINLS N  +GSI+ +C S SFLSFDVT+NAF  EIP+ LGNSPSL+RLRLG+NRFTGK
Sbjct  559   TRINLSKNRINGSISALCGSSSFLSFDVTSNAFGNEIPALLGNSPSLERLRLGNNRFTGK  618

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             IP TLG IRELSLLDLSGN L+G IP QL LC+KL H+DLNNNLL G +P WLG LP LG
Sbjct  619   IPWTLGQIRELSLLDLSGNLLTGQIPAQLMLCKKLEHVDLNNNLLYGSVPSWLGNLPQLG  678

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             ELKL SNQF+GSLP ELFNCSKLLVLSL+ N LNGTLP E+GNL+SLNVLNL+ NQL GS
Sbjct  679   ELKLFSNQFTGSLPRELFNCSKLLVLSLDANFLNGTLPVEVGNLESLNVLNLNQNQLSGS  738

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IP ++G L KLYELRLS N FSGEIP E+GQL++LQS+LD SYNNL G+IPPSIGTLSKL
Sbjct  739   IPLSLGKLSKLYELRLSNNSFSGEIPSELGQLQNLQSILDLSYNNLGGQIPPSIGTLSKL  798

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSP  2766
             E+LDLSHN L G +PP+V  +SSLG+LNLS N L+G+LDK+++HWP ++F GN  LCG+P
Sbjct  799   EALDLSHNCLVGAVPPEVGSLSSLGKLNLSFNNLQGKLDKQFSHWPPEAFEGNLQLCGNP  858

Query  2767  LGSC---RDKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAs  2937
             L  C    D+ S      VVVISA+++  AI LL +G A FFK  RE  +R    E    
Sbjct  859   LNRCSILSDQQSGLSELSVVVISAITSLAAIALLALGLALFFKRRREFLKRV--SEGNCI  916

Query  2938  ssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETV  3117
              SSSSSQAQRK  F     KRD RWDD+MEATNNLSDEFIIGSGG  T+Y+AE  +GETV
Sbjct  917   CSSSSSQAQRKTPFLRGTAKRDYRWDDLMEATNNLSDEFIIGSGGSGTIYRAEFQSGETV  976

Query  3118  AIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVW  3297
             A+K+I  KD+  L+KSFARE+KTL RIRHR+LV+L+GYCSNKG G N+LIYEYMENGS+W
Sbjct  977   AVKKILWKDEFLLNKSFAREVKTLGRIRHRNLVKLIGYCSNKGAGCNLLIYEYMENGSLW  1036

Query  3298  DWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNME  3477
             DWLH QP N+K ++SLDWEARLKI +GLAQGVEYLHHDCVPKI+HRDIKSSNVLLDSNME
Sbjct  1037  DWLHQQPVNSKQRQSLDWEARLKIGVGLAQGVEYLHHDCVPKIMHRDIKSSNVLLDSNME  1096

Query  3478  AHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             AHLGDFGLAKAL +NYDS NTES++WFAGSYGYIAPE
Sbjct  1097  AHLGDFGLAKALEENYDS-NTESHSWFAGSYGYIAPE  1132



>ref|XP_002530120.1| Leucine-rich repeat receptor protein kinase EXS precursor, putative 
[Ricinus communis]
 gb|EEF32264.1| Leucine-rich repeat receptor protein kinase EXS precursor, putative 
[Ricinus communis]
Length=1257

 Score =  1303 bits (3373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 769/1115 (69%), Positives = 914/1115 (82%), Gaps = 19/1115 (2%)
 Frame = +1

Query  286   CQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-----DGslkvvslnl  438
             CQ  +  L VLLEVK+SF+      L  W+E NPN+C+W+GV+C     DGS+ +VSLNL
Sbjct  25    CQ--THDLSVLLEVKKSFIDDPENILHDWNESNPNFCTWRGVTCGLNSGDGSVHLVSLNL  82

Query  439   sdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQ  618
             SDSSL GS+SP LG L +L+HLDLSSN L+GPIP  LSNLS LESLLLFSN L G IP+Q
Sbjct  83    SDSSLSGSVSPFLGRLHNLIHLDLSSNSLTGPIPTTLSNLSLLESLLLFSNELTGSIPTQ  142

Query  619   LGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnl  798
             LG L +L+ +RIGDN LTG IP SF NL +LVTLGLASC L+G IPPQLGRL +++NL L
Sbjct  143   LGSLASLRVMRIGDNALTGPIPASFANLAHLVTLGLASCSLTGPIPPQLGRLGRVENLIL  202

Query  799   qqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQ  978
             QQN LEGP+P E+ N SSLT F+AA+N+LNGSIP ELG L++L ILNLANN+L+G IP Q
Sbjct  203   QQNQLEGPIPAELGNCSSLTVFTAAVNNLNGSIPGELGRLQNLQILNLANNSLSGYIPSQ  262

Query  979   LGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLAL  1158
             + EM+ L+Y+NLLGNQ+ G IP SLAKL NLQ+LDLS NRLAG +P EFG+M QL +L L
Sbjct  263   VSEMTQLIYMNLLGNQIEGPIPGSLAKLANLQNLDLSMNRLAGSIPEEFGNMDQLVYLVL  322

Query  1159  TSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPE  1338
             ++NNLSG IP+S+CSNATNL  L+LSET LSG IP EL QC  LQQLDLSNNTLNGS+P 
Sbjct  323   SNNNLSGVIPRSICSNATNLVSLILSETQLSGPIPKELRQCPSLQQLDLSNNTLNGSLPN  382

Query  1339  ELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIF  1518
             E++E+TQLT L L+NN+L G+I P +ANL+NL+ L+L+HNNL G +P+EIGMLG+L+I++
Sbjct  383   EIFEMTQLTHLYLHNNSLVGSIPPLIANLSNLKELALYHNNLQGNLPKEIGMLGNLEILY  442

Query  1519  LYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPA  1698
             LY+N FSGEIP+EI NCSSLQ +DF+GN F+G+IP  +GRLK L  LHLR+N+L GEIPA
Sbjct  443   LYDNQFSGEIPMEIVNCSSLQMVDFFGNHFSGEIPFAIGRLKGLNLLHLRQNELVGEIPA  502

Query  1699  SLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRIN  1878
             SLGNCHQL  LDLADNHLSG IPATFG+L++L +LMLYNNSLEG++PD L NL NLTRIN
Sbjct  503   SLGNCHQLTILDLADNHLSGGIPATFGFLQSLEQLMLYNNSLEGNIPDSLTNLRNLTRIN  562

Query  1879  LSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMT  2058
             LS N  +GSIA +C+S SFLSFDVT+NAFDQEIP  LGNSPSL+RLRLG+N+FTGKIP  
Sbjct  563   LSRNRLNGSIAALCSSSSFLSFDVTDNAFDQEIPPQLGNSPSLERLRLGNNKFTGKIPWA  622

Query  2059  LGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelkl  2238
             LG IR+LSLLDLSGN L+G IP +L LC++LTH+DLN+NLLSGPIP+WLGRL  LGELKL
Sbjct  623   LGKIRQLSLLDLSGNMLTGPIPAELMLCKRLTHIDLNSNLLSGPIPLWLGRLSQLGELKL  682

Query  2239  SSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPST  2418
             SSNQF GSLPP+L NCSKLLVLSL+ NSLNGTLP EIG L+SLNVLNL+ NQL G IP  
Sbjct  683   SSNQFLGSLPPQLCNCSKLLVLSLDRNSLNGTLPVEIGKLESLNVLNLERNQLSGPIPHD  742

Query  2419  IGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLD  2598
             +G L KLYELRLS N FS EIP E+GQL++LQS+L+ SYNNLTG IP SIGTLSKLE+LD
Sbjct  743   VGKLSKLYELRLSDNSFSSEIPFELGQLQNLQSMLNLSYNNLTGPIPSSIGTLSKLEALD  802

Query  2599  LSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC  2778
             LSHN L GE+PPQV  MSSLG+LNLS N L+G+L K++ HWP D+F GN  LCGSPL +C
Sbjct  803   LSHNQLEGEVPPQVGSMSSLGKLNLSYNNLQGKLGKQFLHWPADAFEGNLKLCGSPLDNC  862

Query  2779  RDKGSRNK-----GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsss  2943
                GS NK      SMVVV+SA++  VA+ LL    A F K+ REA +R    E     S
Sbjct  863   NGYGSENKRSGLSESMVVVVSAVTTLVALSLLAAVLALFLKYKREALKRE--NELNLIYS  920

Query  2944  ssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAI  3123
             SSSS+AQRKPLF N   K+D RW+DIM+AT+NLSD FIIGSGG  T+Y+AEL  GETVA+
Sbjct  921   SSSSKAQRKPLFQNGVAKKDFRWEDIMKATDNLSDAFIIGSGGSGTIYRAELHTGETVAV  980

Query  3124  KRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDW  3303
             KRI  KDD  L+KSF RE+KTL RIRHRHLV+L+GYC+N+G GSN+LIYEYMENGSVWDW
Sbjct  981   KRILWKDDYLLNKSFTREVKTLGRIRHRHLVKLLGYCTNRGAGSNLLIYEYMENGSVWDW  1040

Query  3304  LHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAH  3483
             LH +P N+K KKSL+WEARLKIA+GLAQGVEYLHHDCVP +IHRDIKSSNVLLDSNMEAH
Sbjct  1041  LHQKPVNSKMKKSLEWEARLKIAVGLAQGVEYLHHDCVPMLIHRDIKSSNVLLDSNMEAH  1100

Query  3484  LGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             LGDFGLAKA+ ++++S NTESN+WFAGSYGYIAPE
Sbjct  1101  LGDFGLAKAMVEDFES-NTESNSWFAGSYGYIAPE  1134



>ref|XP_009363367.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
Length=1257

 Score =  1286 bits (3328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/1119 (67%), Positives = 901/1119 (81%), Gaps = 19/1119 (2%)
 Frame = +1

Query  274   GYVRCQ---NTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-----DGsl  417
             G + C+   + ++TL VLLEVKR+ V      L GWSE + N+C W+GV+C     D S+
Sbjct  22    GLMSCEGKLDGNTTLSVLLEVKRAIVEDPENVLHGWSESDQNFCKWRGVTCGFDSVDNSV  81

Query  418   kvvslnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrl  597
             +VV LNLSDSSL GSISPSLG L +LLHLDLSSN LSGPIPP ++NL+SL SLLLFSN+L
Sbjct  82    QVVGLNLSDSSLAGSISPSLGSLQNLLHLDLSSNGLSGPIPPTIANLTSLVSLLLFSNQL  141

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
              GPIP+QLG LT+L+ +RIGDNGL G IP + GNL NLVTLGLASC L+G IPPQLGRL 
Sbjct  142   NGPIPTQLGSLTSLRVMRIGDNGLAGSIPATLGNLVNLVTLGLASCNLNGPIPPQLGRLG  201

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
              L+NL LQ N LEGP+P E+ N SSLT F+AA N+LNG+IP ELG L +L +LN  NN+L
Sbjct  202   LLENLILQLNQLEGPIPAELGNCSSLTVFTAANNTLNGTIPAELGRLSNLELLNFGNNSL  261

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             TG+IP QLGE+S L Y+N +GNQL G +PKS+++L NLQSLDLS N+L G +P  FG+M 
Sbjct  262   TGQIPSQLGELSQLEYMNFMGNQLEGPVPKSISQLANLQSLDLSMNKLTGGIPDVFGTMS  321

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
             QL  L L++NNLSG IP++LCSN T+L+ LM+S++G+ GEIP EL QCR ++QLDLSNN 
Sbjct  322   QLATLVLSNNNLSGVIPRNLCSNTTSLEHLMISDSGIFGEIPAELGQCRSMKQLDLSNNL  381

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
             LNGSIP+E+Y L +LTDL+L+NN+L G+ISP ++NL+NLQ+L L+HNNL G +P EIGML
Sbjct  382   LNGSIPDEIYGLVELTDLLLHNNSLLGSISPMISNLSNLQSLVLYHNNLVGPLPNEIGML  441

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
             G+L+I++LY+N  SGEIP+EIGNCSS+Q IDF+GN+F+G+IPIT+GRLK L FLH+R+N+
Sbjct  442   GELEILYLYDNQLSGEIPMEIGNCSSMQMIDFFGNRFSGEIPITIGRLKDLNFLHIRQNE  501

Query  1678  LSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNL  1857
             L GEIPA+LGNCH+L  LDLADN LSG IP TFG L+A+ + MLYNNSLEG+LPD L ++
Sbjct  502   LVGEIPATLGNCHKLTILDLADNRLSGGIPITFGSLQAMEQFMLYNNSLEGNLPDTLAHM  561

Query  1858  GNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRF  2037
              NLTR+NLS N  +GSIA +C S SFLSFDVT+NAFD EIPS LGNS SL+RLRLG N+F
Sbjct  562   ANLTRVNLSRNKLNGSIAALCGSRSFLSFDVTDNAFDHEIPSRLGNSKSLERLRLGKNQF  621

Query  2038  TGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlp  2217
             TGKIP  LG I ELSLLD+SGN L+G IP +LS C+KL+H+DLN+NLLSG +P W G LP
Sbjct  622   TGKIPHALGNISELSLLDVSGNSLTGSIPDELSSCKKLSHIDLNDNLLSGTVPRWFGGLP  681

Query  2218  llgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQL  2397
              LGELKLSSN+F+G LP ELFNCSKLLVLS+  NSLNGTLP  IGNL+ LNVLNLD NQ 
Sbjct  682   QLGELKLSSNRFTGPLPNELFNCSKLLVLSMSENSLNGTLPARIGNLELLNVLNLDHNQF  741

Query  2398  CGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTL  2577
              G IP  IG LGKLYEL+LS+NRF G+IP E+GQL++LQS+LD SYNNL+G+IP SIG+L
Sbjct  742   SGPIPPAIGKLGKLYELQLSQNRFDGDIPYELGQLQNLQSILDLSYNNLSGQIPASIGSL  801

Query  2578  SKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLC  2757
             SKLE+LDLSHN L GE+P  V  M SLG+LNLS N L+G+L K+ +HWP D+F GN HLC
Sbjct  802   SKLEALDLSHNQLVGEVPSPVGGMISLGKLNLSYNNLQGKLSKQLSHWPADAFTGNFHLC  861

Query  2758  GSPLGSC--RDKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENY  2931
             GSPLGSC  R K +  + S+VV I+A+    AI LL+ GAA   KH REA+  R+  +  
Sbjct  862   GSPLGSCIGRKKQTGPRESVVVAIAAICTLSAIALLIFGAASLLKHKREAF--RKASDMN  919

Query  2932  AsssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGE  3111
                S+SSS AQR+ LF N + K DI+W DIM+AT NLS+EF+IGSGG   +YKAEL  GE
Sbjct  920   CLYSTSSSHAQRRLLFSNGSVKPDIKWKDIMDATKNLSNEFVIGSGGSGVIYKAELRTGE  979

Query  3112  TVAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGS  3291
             TVA+K+I  KDDL  +KSF  EIKTL RIRHRHLV+LMGYCS+KG GSN+LIYEYMENGS
Sbjct  980   TVAVKKILYKDDLMANKSFTTEIKTLGRIRHRHLVKLMGYCSDKGAGSNLLIYEYMENGS  1039

Query  3292  VWDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSN  3471
             V+DW+H Q +N   KKSLDWEARLKIA+GLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSN
Sbjct  1040  VYDWIHQQQSN--KKKSLDWEARLKIAVGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSN  1097

Query  3472  MEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             MEAHLGDFGLAK L + Y+S NTESNTWFAGSYGYIAPE
Sbjct  1098  MEAHLGDFGLAKTLNETYES-NTESNTWFAGSYGYIAPE  1135



>ref|XP_004295530.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Fragaria vesca subsp. vesca]
Length=1261

 Score =  1286 bits (3328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/1114 (67%), Positives = 889/1114 (80%), Gaps = 21/1114 (2%)
 Frame = +1

Query  292   NTSSTLRVLLEVKRSFV------LQLQGWSEKNPNYCSWQGVSCDGslkvvslnlsdssl  453
             ++++TL+VLL+VK+SF+        L GWSE NPN+C+W+GV+C       SL ++  +L
Sbjct  33    DSNTTLKVLLKVKKSFLEDPTSETALHGWSESNPNFCTWRGVTCGSDSVGDSLQVTGLNL  92

Query  454   ggsispslgllthllhldl-----ssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQ  618
               S               L     SSN L GPIPPALSNLSSLESLLLFSN+L GPIPS+
Sbjct  93    SDSSLGGSISPQLGSLKYLLHLDLSSNGLKGPIPPALSNLSSLESLLLFSNQLGGPIPSE  152

Query  619   LGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnl  798
             LG LT+L+ +RIGDN LTG IP SFGNL NLVTLGLASC LSG IPPQLGRL QL+NL L
Sbjct  153   LGSLTSLRVMRIGDNELTGSIPASFGNLVNLVTLGLASCGLSGPIPPQLGRLDQLENLIL  212

Query  799   qqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQ  978
             Q N LEGP+P E+ N +SLT F+AA N LN SIP+ELG L +L +LNL NN+L+GEIP Q
Sbjct  213   QLNQLEGPIPAELGNCTSLTVFTAAQNKLNSSIPRELGQLTNLQLLNLVNNSLSGEIPSQ  272

Query  979   LGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLAL  1158
             LG MS L YLNL+GNQL G+IPKSLA+L NLQ+LDLS N+L G +P E G+M QL +L L
Sbjct  273   LGGMSQLEYLNLMGNQLEGAIPKSLAQLGNLQNLDLSVNKLTGGIPEELGNMSQLVYLVL  332

Query  1159  TSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPE  1338
             ++NNLSG +PK++CSNAT+L+ LM+S+  + GEIP  LSQC+ L+QLDLSNN++NGSIP 
Sbjct  333   SNNNLSGVVPKTICSNATSLEHLMISDAQIFGEIPAGLSQCQSLKQLDLSNNSMNGSIPL  392

Query  1339  ELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIF  1518
             ELY L +LTDL+L+NN+L G+ISP + NL+NL +L L+HNNL G +P+EIGMLG L+I++
Sbjct  393   ELYSLVELTDLLLHNNSLVGSISPYIGNLSNLLSLVLYHNNLQGPLPKEIGMLGQLEILY  452

Query  1519  LYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPA  1698
             LY+N  SGEIP+EIGNCSSLQ IDFYGN+F+G+IPIT+GRLK L FLH+R+N+L GE+PA
Sbjct  453   LYDNQLSGEIPIEIGNCSSLQMIDFYGNKFSGEIPITIGRLKDLNFLHIRQNELVGELPA  512

Query  1699  SLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRIN  1878
             +LGNCHQL  LDLADNHLSG IP TFG L+A+ + MLYNNSLEG+LP+ L N+ NLTR+N
Sbjct  513   TLGNCHQLTILDLADNHLSGGIPITFGSLQAMEQFMLYNNSLEGNLPETLVNMVNLTRVN  572

Query  1879  LSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMT  2058
             LS N  +GSIA +C+S+SFLSFDVT+NAFD EIP  LGNS SL+RLRLG+N+FTG IP+T
Sbjct  573   LSKNKLNGSIAALCSSNSFLSFDVTDNAFDGEIPPHLGNSTSLERLRLGNNQFTGPIPVT  632

Query  2059  LGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelkl  2238
             LG I ELSLLD+SGN L+G +P + S C+KL+H DLNNNLLSG IPVWLG LP LGELKL
Sbjct  633   LGKISELSLLDVSGNSLTGSVPAEFSSCKKLSHFDLNNNLLSGTIPVWLGSLPQLGELKL  692

Query  2239  SSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPST  2418
             SSN F+G+LP ELFNCSKLLVLSL +N LNGTLP EIGNL SLNVLNL+ NQ  G IP  
Sbjct  693   SSNHFTGTLPQELFNCSKLLVLSLNDNLLNGTLPAEIGNLDSLNVLNLNHNQFSGPIPPA  752

Query  2419  IGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLD  2598
             IG LG LYEL+LS+N F G+IP EVGQL++LQS+LD SYN L+G+IP SIGTLSKLE+LD
Sbjct  753   IGKLGNLYELKLSQNSFDGDIPYEVGQLQNLQSMLDLSYNKLSGQIPASIGTLSKLEALD  812

Query  2599  LSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC  2778
             LSHN L GE+P  +  MSSLG+LNL+ N LEG+L K+ +HWP ++FVGN HLCG+PLGSC
Sbjct  813   LSHNQLNGEVPSTIGAMSSLGKLNLTYNNLEGKLSKQLSHWPAEAFVGNLHLCGNPLGSC  872

Query  2779  RDKGSRNKG----SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAssss  2946
                GS+N+     + VVVISAL    AI LL+ GAA F KH REA+R+   + NY   SS
Sbjct  873   N--GSKNQSGPNEATVVVISALCTLAAIALLIFGAASFLKHKREAFRKSS-EVNYV-YSS  928

Query  2947  sssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIK  3126
             SSS  +R+ LF N + K D +W DIM+ATNNLS EF+IGSGG   VY+AEL  GE VA+K
Sbjct  929   SSSHTKRRLLFSNGSVKPDFKWKDIMDATNNLSKEFVIGSGGSGVVYRAELATGEIVAVK  988

Query  3127  RIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWL  3306
             +I  KDDL  +KSF REIKTL RIRHRHLV+LMGYCSNKG GSN+LIYEYMENGSVWDW+
Sbjct  989   KILYKDDLMSNKSFTREIKTLGRIRHRHLVKLMGYCSNKGAGSNLLIYEYMENGSVWDWI  1048

Query  3307  HNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHL  3486
             H +  N+K KKSLDWEARLKIA+GLAQGVEYLHHDC PKIIHRDIKSSNVLLDSNMEAHL
Sbjct  1049  HQEQVNSK-KKSLDWEARLKIAVGLAQGVEYLHHDCAPKIIHRDIKSSNVLLDSNMEAHL  1107

Query  3487  GDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             GDFGLAK L DN++S NTESNTWFAGSYGYIAPE
Sbjct  1108  GDFGLAKTLDDNFES-NTESNTWFAGSYGYIAPE  1140



>ref|XP_004145215.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Cucumis sativus]
 ref|XP_004169926.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Cucumis sativus]
 gb|KGN64445.1| hypothetical protein Csa_1G051820 [Cucumis sativus]
Length=1261

 Score =  1281 bits (3315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 733/1118 (66%), Positives = 901/1118 (81%), Gaps = 17/1118 (2%)
 Frame = +1

Query  274   GYVRCQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-----DGslkvv  426
             G V C +  S L VLLE+++SFV      L+ WSE NPN+C W+GVSC      GS+ VV
Sbjct  25    GVVFCDDGLS-LNVLLEIRKSFVDDPENVLEDWSESNPNFCKWRGVSCVSDSAGGSVSVV  83

Query  427   slnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGP  606
              LNLSDSSLGGSISP+LG L +LLHLDLSSN L GPIP  LS L SLESLLLFSN+L G 
Sbjct  84    GLNLSDSSLGGSISPALGRLHNLLHLDLSSNGLMGPIPTNLSQLHSLESLLLFSNQLNGS  143

Query  607   IPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlq  786
             IP++LG +++L+ +RIGDNGLTG IP+SFGNL NLVTLGLASC LSGLIPP+LG+L++++
Sbjct  144   IPTELGSMSSLRVMRIGDNGLTGPIPSSFGNLVNLVTLGLASCSLSGLIPPELGQLSRVE  203

Query  787   nlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGE  966
             ++ LQQN LEGP+P E+ N SSL  F+AA NSLNGSIPK+LG L++L ILNLANNTL+GE
Sbjct  204   DMVLQQNQLEGPVPGELGNCSSLVVFTAAGNSLNGSIPKQLGRLENLQILNLANNTLSGE  263

Query  967   IPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQ  1146
             IP +LGE+  L+YLNL+GNQL GSIP SLA+L NLQ+LDLS N+L G +P E G+MG L+
Sbjct  264   IPVELGELGQLLYLNLMGNQLKGSIPVSLAQLGNLQNLDLSMNKLTGGIPEELGNMGSLE  323

Query  1147  FLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNG  1326
             FL L++N LSG IP  LCSNA++LQ L++S+  +SGEIP EL QCR L Q+DLSNN+LNG
Sbjct  324   FLVLSNNPLSGVIPSKLCSNASSLQHLLISQIQISGEIPVELIQCRALTQMDLSNNSLNG  383

Query  1327  SIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDL  1506
             SIP+E YEL  LTD++L+NN+L G+ISPS+ANL+NL+TL+L+HNNL G++PREIGMLG+L
Sbjct  384   SIPDEFYELRSLTDILLHNNSLVGSISPSIANLSNLKTLALYHNNLQGDLPREIGMLGEL  443

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
             +I++LY+N FSG+IP E+GNCS LQ IDF+GN+F+G+IP++LGRLK L F+HLR+N+L G
Sbjct  444   EILYLYDNQFSGKIPFELGNCSKLQMIDFFGNRFSGEIPVSLGRLKELNFIHLRQNELEG  503

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL  1866
             +IPA+LGNC +L TLDLADN LSG IP+TFG+L AL  LMLYNNSLEG+LP  L NL  L
Sbjct  504   KIPATLGNCRKLTTLDLADNRLSGVIPSTFGFLGALELLMLYNNSLEGNLPRSLINLAKL  563

Query  1867  TRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
              RINLS N  +GSIAP+C S  FLSFD+TNN FD EIP  LGNS SL+RLRLG+N+F G+
Sbjct  564   QRINLSKNRLNGSIAPLCASPFFLSFDITNNRFDGEIPPQLGNSSSLERLRLGNNQFFGE  623

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             IP  LG IRELSLLDLSGN L+G IP +LSLC+KLTHLDLNNN  SG +P+WLG LP LG
Sbjct  624   IPPALGKIRELSLLDLSGNSLTGSIPAELSLCKKLTHLDLNNNNFSGSLPMWLGGLPQLG  683

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             E+KLS NQF+G LP ELFNCSKL+VLSL  N LNGTLP EIGNL+SLN+LNLD N+  G 
Sbjct  684   EIKLSFNQFTGPLPLELFNCSKLIVLSLNENLLNGTLPMEIGNLRSLNILNLDANRFSGP  743

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IPSTIG + KL+ELR+SRN   GEIP E+ QL++LQSVLD SYNNLTGEIP  I  LSKL
Sbjct  744   IPSTIGTISKLFELRMSRNGLDGEIPAEISQLQNLQSVLDLSYNNLTGEIPSFIALLSKL  803

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSP  2766
             E+LDLSHN+L+GE+P  +++MSSLG+LNL+ N+LEG+L+K ++HWP+  F GN  LCG P
Sbjct  804   EALDLSHNELSGEVPSDISKMSSLGKLNLAYNKLEGKLEKEFSHWPISVFQGNLQLCGGP  863

Query  2767  LGSCR----DKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYA  2934
             L  C      + S    + V+ ISA+S    + +L++     +KH  E + +R G+ N  
Sbjct  864   LDRCNEASSSESSSLSEAAVIAISAVSTLAGMAILVLTVTLLYKHKLETF-KRWGEVN-C  921

Query  2935  sssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGET  3114
               SSSSSQAQR+PLF N    RD  W++IME TNNLSD+FIIGSGG  T+Y+AEL  GET
Sbjct  922   VYSSSSSQAQRRPLFHNPGGNRDFHWEEIMEVTNNLSDDFIIGSGGSGTIYRAELLTGET  981

Query  3115  VAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSV  3294
             VA+K+I  KDDL  ++SF RE+KTL RI+HRHLV+L+GYC N+G+GSN+LIY+YMENGSV
Sbjct  982   VAVKKISCKDDLLSNRSFIREVKTLGRIKHRHLVKLLGYCMNRGDGSNLLIYDYMENGSV  1041

Query  3295  WDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNM  3474
             WDWLH QP N K KK LDWEAR +IA+GLAQG+EYLHHDC+PKI+HRDIK+SN+LLDSNM
Sbjct  1042  WDWLHQQPINGKKKKKLDWEARFRIAVGLAQGLEYLHHDCLPKIVHRDIKTSNILLDSNM  1101

Query  3475  EAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             EAHLGDFGLAKAL +NYD+ +TES TWFAGSYGYIAPE
Sbjct  1102  EAHLGDFGLAKALVENYDT-DTESKTWFAGSYGYIAPE  1138



>ref|XP_004154011.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Cucumis sativus]
Length=1261

 Score =  1280 bits (3313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 733/1118 (66%), Positives = 901/1118 (81%), Gaps = 17/1118 (2%)
 Frame = +1

Query  274   GYVRCQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-----DGslkvv  426
             G V C +  S L VLLE+++SFV      L+ WSE NPN+C W+GVSC      GS+ VV
Sbjct  25    GVVFCDDGLS-LNVLLEIRKSFVDDPENVLEDWSESNPNFCKWRGVSCVSDSAGGSVSVV  83

Query  427   slnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGP  606
              LNLSDSSLGGSISP+LG L +LLHLDLSSN L GPIP  LS L SLESLLLFSN+L G 
Sbjct  84    GLNLSDSSLGGSISPALGRLHNLLHLDLSSNGLMGPIPTNLSQLHSLESLLLFSNQLNGS  143

Query  607   IPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlq  786
             IP++LG +++L+ +RIGDNGLTG IP+SFGNL NLVTLGLASC LSGLIPP+LG+L++++
Sbjct  144   IPTELGSMSSLRVMRIGDNGLTGPIPSSFGNLVNLVTLGLASCSLSGLIPPELGQLSRVE  203

Query  787   nlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGE  966
             ++ LQQN LEGP+P E+ N SSL  F+AA NSLNGSIPK+LG L++L ILNLANNTL+GE
Sbjct  204   DMVLQQNQLEGPVPGELGNCSSLVVFTAAGNSLNGSIPKQLGRLENLQILNLANNTLSGE  263

Query  967   IPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQ  1146
             IP +LGE+  L+YLNL+GNQL GSIP SLA+L NLQ+LDLS N+L G +P E G+MG L+
Sbjct  264   IPVELGELGQLLYLNLMGNQLKGSIPVSLAQLGNLQNLDLSMNKLTGGIPEELGNMGSLE  323

Query  1147  FLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNG  1326
             FL L++N LSG IP  LCSNA++LQ L++S+  +SGEIP EL QCR L Q+DLSNN+LNG
Sbjct  324   FLVLSNNPLSGVIPSKLCSNASSLQHLLISQIQISGEIPVELIQCRALTQMDLSNNSLNG  383

Query  1327  SIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDL  1506
             SIP+E YEL  LTD++L+NN+L G+ISPS+ANL+NL+TL+L+HNNL G++PREIGMLG+L
Sbjct  384   SIPDEFYELRSLTDILLHNNSLVGSISPSIANLSNLKTLALYHNNLQGDLPREIGMLGEL  443

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
             +I++LY+N FSG+IP E+GNCS LQ IDF+GN+F+G+IP++LGRLK L F+HLR+N+L G
Sbjct  444   EILYLYDNQFSGKIPFELGNCSKLQMIDFFGNRFSGEIPVSLGRLKELNFIHLRQNELEG  503

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL  1866
             +IPA+LGNC +L TLDLADN LSG IP+TFG+L AL  LMLYNNSLEG+LP  L NL  L
Sbjct  504   KIPATLGNCRKLTTLDLADNRLSGVIPSTFGFLGALELLMLYNNSLEGNLPRSLINLAKL  563

Query  1867  TRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
              RINLS N  +GSIAP+C S  FLSFD+TNN FD EIP  LGNS SL+RLRLG+N+F G+
Sbjct  564   QRINLSKNRLNGSIAPLCASPFFLSFDITNNRFDGEIPPQLGNSSSLERLRLGNNQFFGE  623

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             IP  LG IRELSLLDLSGN L+G IP +LSLC+KLTHLDLNNN  SG +P+WLG LP LG
Sbjct  624   IPPALGKIRELSLLDLSGNSLTGSIPAELSLCKKLTHLDLNNNNFSGSLPMWLGGLPQLG  683

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             E+KLS NQF+G LP ELFNCSKL+VLSL  N LNGTLP EIGNL+SLN+LNLD N+  G 
Sbjct  684   EIKLSFNQFTGPLPLELFNCSKLIVLSLNENLLNGTLPMEIGNLRSLNILNLDANRFSGP  743

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IPSTIG + KL+ELR+SRN   GEIP E+ QL++LQSVLD SYNNLTGEIP  I  LSKL
Sbjct  744   IPSTIGTISKLFELRMSRNGLDGEIPAEISQLQNLQSVLDLSYNNLTGEIPSFIALLSKL  803

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSP  2766
             E+LDLSHN+L+GE+P  +++MSSLG+LNL+ N+LEG+L+K ++HWP+  F GN  LCG P
Sbjct  804   EALDLSHNELSGEVPSDISKMSSLGKLNLAYNKLEGKLEKEFSHWPISVFQGNLQLCGGP  863

Query  2767  LGSCR----DKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYA  2934
             L  C      + S    + V+ ISA+S    + +L++     +KH  E + +R G+ N  
Sbjct  864   LDRCNEASSSESSSLSEAAVLAISAVSTLAGMAILVLTVTLLYKHKLETF-KRWGEVN-C  921

Query  2935  sssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGET  3114
               SSSSSQAQR+PLF N    RD  W++IME TNNLSD+FIIGSGG  T+Y+AEL  GET
Sbjct  922   VYSSSSSQAQRRPLFHNPGGNRDFHWEEIMEVTNNLSDDFIIGSGGSGTIYRAELLTGET  981

Query  3115  VAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSV  3294
             VA+K+I  KDDL  ++SF RE+KTL RI+HRHLV+L+GYC N+G+GSN+LIY+YMENGSV
Sbjct  982   VAVKKISCKDDLLSNRSFIREVKTLGRIKHRHLVKLLGYCMNRGDGSNLLIYDYMENGSV  1041

Query  3295  WDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNM  3474
             WDWLH QP N K KK LDWEAR +IA+GLAQG+EYLHHDC+PKI+HRDIK+SN+LLDSNM
Sbjct  1042  WDWLHQQPINGKKKKKLDWEARFRIAVGLAQGLEYLHHDCLPKIVHRDIKTSNILLDSNM  1101

Query  3475  EAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             EAHLGDFGLAKAL +NYD+ +TES TWFAGSYGYIAPE
Sbjct  1102  EAHLGDFGLAKALVENYDT-DTESKTWFAGSYGYIAPE  1138



>ref|XP_011022302.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Populus euphratica]
Length=1254

 Score =  1279 bits (3310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 756/1116 (68%), Positives = 897/1116 (80%), Gaps = 16/1116 (1%)
 Frame = +1

Query  274   GYVRCQNTSSTLRVLLEVKRSFV----LQLQGWSEKNPNYCSWQGVSC-----DGslkvv  426
             G+V CQN    L  LLEVK+SF       L  W+E NPN+C+W GV+C     DGS++VV
Sbjct  21    GFVLCQNQE--LSSLLEVKKSFEGDPEKVLLDWNESNPNFCTWTGVTCGLNSVDGSMQVV  78

Query  427   slnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGP  606
             SLNLS SSL GSISPSLG L  LL LDLSSN L+GP P  LSNLSSLESLLLFSN+L GP
Sbjct  79    SLNLSGSSLSGSISPSLGSLQKLLQLDLSSNSLTGPFPATLSNLSSLESLLLFSNQLTGP  138

Query  607   IPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlq  786
             IP+QLG L +LQ LRIGDNGL+G IP SFGNL NLVTLGLASC L+G IPPQLG+L+Q+Q
Sbjct  139   IPTQLGSLKSLQVLRIGDNGLSGPIPASFGNLVNLVTLGLASCSLTGPIPPQLGQLSQVQ  198

Query  787   nlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGE  966
             NL LQ+N LEGP+P E+ N SSLT F+ A+N+LNGSIP  LG L +L  LNLANN+L+GE
Sbjct  199   NLILQKNQLEGPIPAELGNCSSLTVFTVAVNNLNGSIPGALGRLLNLQTLNLANNSLSGE  258

Query  967   IPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQ  1146
             IP QLG++S LVYLN +GNQL G IPKSLAK+ NLQ LDLS N L G +P EFGSM Q+ 
Sbjct  259   IPSQLGDLSQLVYLNFMGNQLQGPIPKSLAKMRNLQDLDLSMNMLTGGVPEEFGSMNQIV  318

Query  1147  FLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNG  1326
             ++ L++NNLSG IP+SLC+N TNL+ L+LSET LSG IP EL  C  L QLDLSNN+LNG
Sbjct  319   YMVLSNNNLSGVIPRSLCTNNTNLESLILSETQLSGSIPIELRLCPSLMQLDLSNNSLNG  378

Query  1327  SIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDL  1506
             SIP+E+YE  QLT L L+NN+LEG+ISP +ANL+NL+ L+L+HN+L G +P+EIGMLG+L
Sbjct  379   SIPDEIYESIQLTHLYLHNNSLEGSISPLIANLSNLKELALYHNSLQGNLPKEIGMLGNL  438

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
             ++++LY+N  SGEIP+EIGNCS+LQ IDF+GN F+G+IP+T+GRLK L  LHLR+N+L G
Sbjct  439   EVLYLYDNQLSGEIPMEIGNCSNLQMIDFFGNHFSGEIPVTIGRLKGLNLLHLRQNELVG  498

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL  1866
              IPA+LGNCHQL  LDLADN LSG IP TFG+L+AL +LMLYNNSLEG+LP  L NL NL
Sbjct  499   HIPAALGNCHQLSILDLADNGLSGGIPVTFGFLQALEQLMLYNNSLEGNLPYSLTNLRNL  558

Query  1867  TRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
             TRINLS N F+GSIA +C+S SFLSFDVT+N+F  +IP+ LGNSPSL+RLRLG N+FTG 
Sbjct  559   TRINLSKNRFNGSIAALCSSSSFLSFDVTSNSFANDIPAQLGNSPSLERLRLGDNQFTGN  618

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             +P TLG IRELSLLDLSGN L+G IPPQL LC++LTH+DLNNN LSGP+P  LG L  LG
Sbjct  619   VPWTLGKIRELSLLDLSGNLLTGPIPPQLMLCKRLTHIDLNNNFLSGPLPSSLGNLSQLG  678

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             ELKLSSNQFSGSLPPELFNC+KLLVLSL  N LNGTLP EIG L+ LNVLNL+ NQL GS
Sbjct  679   ELKLSSNQFSGSLPPELFNCAKLLVLSLGGNLLNGTLPVEIGKLEFLNVLNLEQNQLSGS  738

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IP+ +G L KLYEL+LS N FSGEIP E+GQL++LQS+LD  YNNL+G+IP SIG LSKL
Sbjct  739   IPAALGKLSKLYELQLSHNNFSGEIPFELGQLQNLQSILDLGYNNLSGQIPSSIGKLSKL  798

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSP  2766
             E+LDLSHN L G +PP+V +MSSLG+LNLS N L+G+L ++++HWP ++F GN  LCGSP
Sbjct  799   EALDLSHNQLVGAVPPEVGDMSSLGKLNLSFNNLQGKLGEQFSHWPTEAFEGNLQLCGSP  858

Query  2767  LGSCRDKGSRN--KGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAss  2940
             L  C     R+    S VVVISA++  +A+ LL +G A F KH  E  RR    E     
Sbjct  859   LDHCSVSSQRSGLSESSVVVISAITTLIAVALLALGLALFVKHRLEFLRRV--SEVKCIY  916

Query  2941  sssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVA  3120
             S SSSQAQRKPLF     KRD RWDDIM ATNNLSDEFIIGSGG  T+Y+ E  +GETVA
Sbjct  917   SFSSSQAQRKPLFRKGTAKRDYRWDDIMAATNNLSDEFIIGSGGSGTIYRTEFQSGETVA  976

Query  3121  IKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWD  3300
             +K+I  KD+  L+KSF RE+KTL RIRHRHLV+L+GYCS++G G N+LIYEYMENGS+WD
Sbjct  977   VKKILWKDEFLLNKSFTREVKTLGRIRHRHLVKLIGYCSSEGAGCNLLIYEYMENGSLWD  1036

Query  3301  WLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEA  3480
             WLH QP N K ++SLDWE RLKI +GLAQGVEYLHHDCVPKIIHRDIKSSN+LLDS MEA
Sbjct  1037  WLHQQPMNIKKRQSLDWETRLKIGLGLAQGVEYLHHDCVPKIIHRDIKSSNILLDSTMEA  1096

Query  3481  HLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             HLGDFGLAKAL +NYDS NTES++WFAGSYGYIAPE
Sbjct  1097  HLGDFGLAKALEENYDS-NTESHSWFAGSYGYIAPE  1131



>ref|XP_002303717.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE78696.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=1254

 Score =  1271 bits (3290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 758/1116 (68%), Positives = 901/1116 (81%), Gaps = 16/1116 (1%)
 Frame = +1

Query  274   GYVRCQNTSSTLRVLLEVKRSFV----LQLQGWSEKNPNYCSWQGVSC-----DGslkvv  426
             G+V CQN    L  LLEVK+SF       L  W+E NPN+C+W GV C     DGS++VV
Sbjct  21    GFVLCQNQE--LSSLLEVKKSFEGDPEKVLLDWNESNPNFCTWTGVICGLNSVDGSVQVV  78

Query  427   slnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGP  606
             SLNLSDSSL GSI PSLG L  LL LDLSSN L+GPIP  LSNLSSLESLLLFSN+L GP
Sbjct  79    SLNLSDSSLSGSIPPSLGSLQKLLQLDLSSNSLTGPIPATLSNLSSLESLLLFSNQLTGP  138

Query  607   IPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlq  786
             IP+QLG L +LQ LRIGDNGL+G IP SFGNL NLVTLGLASC L+G IPPQLG+L+Q+Q
Sbjct  139   IPTQLGSLKSLQVLRIGDNGLSGPIPASFGNLVNLVTLGLASCSLTGPIPPQLGQLSQVQ  198

Query  787   nlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGE  966
             +L LQQN LEGP+P E+ N SSLT F+ A+N+LNGSIP  LG L++L  LNLANN+L+GE
Sbjct  199   SLILQQNQLEGPIPAELGNCSSLTVFTVAVNNLNGSIPGALGRLQNLQTLNLANNSLSGE  258

Query  967   IPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQ  1146
             IP QLGE+S LVYLN +GNQL G IPKSLAK++NLQ+LDLS N L G +P EFGSM QL 
Sbjct  259   IPSQLGELSQLVYLNFMGNQLQGPIPKSLAKMSNLQNLDLSMNMLTGGVPEEFGSMNQLL  318

Query  1147  FLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNG  1326
             ++ L++NNLSG IP+SLC+N TNL+ L+LSET LSG IP EL  C  L QLDLSNN+LNG
Sbjct  319   YMVLSNNNLSGVIPRSLCTNNTNLESLILSETQLSGPIPIELRLCPSLMQLDLSNNSLNG  378

Query  1327  SIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDL  1506
             SIP E+YE  QLT L L+NN+L G+ISP +ANL+NL+ L+L+HN+L G +P+EIGMLG+L
Sbjct  379   SIPTEIYESIQLTHLYLHNNSLVGSISPLIANLSNLKELALYHNSLQGNLPKEIGMLGNL  438

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
             ++++LY+N  SGEIP+EIGNCS+L+ +DF+GN F+G+IP+++GRLK L  LHLR+N+L G
Sbjct  439   EVLYLYDNQLSGEIPMEIGNCSNLKMVDFFGNHFSGEIPVSIGRLKGLNLLHLRQNELGG  498

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL  1866
              IPA+LGNCHQL  LDLADN LSG IP TFG+L+AL +LMLYNNSLEG+LP  L NL +L
Sbjct  499   HIPAALGNCHQLTILDLADNGLSGGIPVTFGFLQALEQLMLYNNSLEGNLPYSLTNLRHL  558

Query  1867  TRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
             TRINLS N F+GSIA +C+S SFLSFDVT+N+F  EIP+ LGNSPSL+RLRLG+N+FTG 
Sbjct  559   TRINLSKNRFNGSIAALCSSSSFLSFDVTSNSFANEIPAQLGNSPSLERLRLGNNQFTGN  618

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             +P TLG IRELSLLDLSGN L+G IPPQL LC+KLTH+DLNNNLLSGP+P  LG LP LG
Sbjct  619   VPWTLGKIRELSLLDLSGNLLTGPIPPQLMLCKKLTHIDLNNNLLSGPLPSSLGNLPQLG  678

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             ELKLSSNQFSGSLP ELFNCSKLLVLSL+ N LNGTLP E+G L+ LNVLNL+ NQL GS
Sbjct  679   ELKLSSNQFSGSLPSELFNCSKLLVLSLDGNLLNGTLPVEVGKLEFLNVLNLEQNQLSGS  738

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IP+ +G L KLYEL+LS N FSGEIP E+GQL++LQS+LD  YNNL+G+IP SIG LSKL
Sbjct  739   IPAALGKLSKLYELQLSHNSFSGEIPFELGQLQNLQSILDLGYNNLSGQIPSSIGKLSKL  798

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSP  2766
             E+LDLSHN L G +PP+V +MSSLG+LNLS N L+G+L ++++HWP ++F GN  LCGSP
Sbjct  799   EALDLSHNQLVGAVPPEVGDMSSLGKLNLSFNNLQGKLGEQFSHWPTEAFEGNLQLCGSP  858

Query  2767  LGSCRDKGSRN--KGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAss  2940
             L  C     R+    S VVVISA++   A+ LL +G A F KH  E  RR    E     
Sbjct  859   LDHCSVSSQRSGLSESSVVVISAITTLTAVALLALGLALFIKHRLEFLRRV--SEVKCIY  916

Query  2941  sssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVA  3120
             SSSSSQAQRKPLF     KRD RWDDIM ATNNLSDEFIIGSGG  T+Y+ E  +GETVA
Sbjct  917   SSSSSQAQRKPLFRKGTAKRDYRWDDIMAATNNLSDEFIIGSGGSGTIYRTEFQSGETVA  976

Query  3121  IKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWD  3300
             +K+I  KD+  L+KSFARE+KTL RIRHRHLV+L+GYCS++G G N+LIYEYMENGS+WD
Sbjct  977   VKKILWKDEFLLNKSFAREVKTLGRIRHRHLVKLIGYCSSEGAGCNLLIYEYMENGSLWD  1036

Query  3301  WLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEA  3480
             WL  QP N K ++SLDWE RLKI +GLAQGVEYLHHDCVPKIIHRDIKSSN+LLDS MEA
Sbjct  1037  WLRQQPVNIKKRQSLDWETRLKIGLGLAQGVEYLHHDCVPKIIHRDIKSSNILLDSTMEA  1096

Query  3481  HLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             HLGDFGLAKAL +NYDS NTES++WFAGSYGYIAPE
Sbjct  1097  HLGDFGLAKALEENYDS-NTESHSWFAGSYGYIAPE  1131



>ref|XP_006468654.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
 gb|KDO77187.1| hypothetical protein CISIN_1g000859mg [Citrus sinensis]
Length=1251

 Score =  1270 bits (3286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 738/1115 (66%), Positives = 883/1115 (79%), Gaps = 16/1115 (1%)
 Frame = +1

Query  274   GYVRCQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSCDGslkvvslnls  441
             G+V C++    L VLLE+K+SF       L  W++ N N C+W+G++C  S   V     
Sbjct  21    GFVLCKDEE--LSVLLEIKKSFTADPENVLHAWNQSNQNLCTWRGITCGSSSARVVSLNL  78

Query  442   dsslggsisp-slgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQ  618
                        SLG L  L+HLDLSSN L+GPIP ALSNLSSLESLLLFSN+L G IP+Q
Sbjct  79    SGLSLAGSISPSLGRLQSLIHLDLSSNSLTGPIPTALSNLSSLESLLLFSNQLAGTIPTQ  138

Query  619   LGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnl  798
             LG LT+L+ +RIGDN L+G IPTSFGNL NL TLGLASC LSG IPPQ G+L+QL+ L L
Sbjct  139   LGSLTSLRVMRIGDNWLSGSIPTSFGNLVNLGTLGLASCSLSGPIPPQFGQLSQLEELIL  198

Query  799   qqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQ  978
             QQN L+GP+P E+ N SSL+ F+AA N+LNGSIP  LG L++L +LNL NN+L+GEIP +
Sbjct  199   QQNQLQGPIPAELGNCSSLSIFTAAENNLNGSIPAALGRLQNLQLLNLGNNSLSGEIPSE  258

Query  979   LGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLAL  1158
             LGE+S L YLNL+GN+L G+IP+S AK+ NLQSLDLS NRL G +P EFG+MGQL FL L
Sbjct  259   LGELSQLGYLNLMGNRLEGAIPRSFAKMGNLQSLDLSMNRLTGGIPEEFGNMGQLVFLVL  318

Query  1159  TSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPE  1338
             ++NN+SG+IP+ +C+NAT+L+ L+L+E  LSGEIP ELSQC+ L+QLDLSNNTLNG+IP 
Sbjct  319   SNNNISGSIPRRICTNATSLEHLILAEIQLSGEIPVELSQCQSLKQLDLSNNTLNGTIPV  378

Query  1339  ELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIF  1518
             EL++L  LT L L+NN+L G+ISP VANL+NLQ L+L+HNN  G +PREIGML  L++++
Sbjct  379   ELFQLVALTHLYLHNNSLVGSISPFVANLSNLQELALYHNNFQGSLPREIGMLVKLELLY  438

Query  1519  LYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPA  1698
             LY+NH SG+IP E+GNCSSL++IDF+GN FTG+IP ++GRLK L FLHLR+N+L G+IPA
Sbjct  439   LYDNHLSGQIPSEVGNCSSLKWIDFFGNSFTGEIPTSIGRLKDLNFLHLRQNELVGQIPA  498

Query  1699  SLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRIN  1878
             SLGNCHQL  LDLADN LSG +PA+FG+L+AL +LMLYNNSLEG+LP  L NL NLTRIN
Sbjct  499   SLGNCHQLIILDLADNKLSGGVPASFGFLQALEQLMLYNNSLEGNLPGSLINLRNLTRIN  558

Query  1879  LSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMT  2058
              S N  +G IA +C+SHSFLSFDVTNN FD EIP  LGNSPSL+RLRLG+N+F GKIP T
Sbjct  559   FSKNRLNGRIATLCSSHSFLSFDVTNNEFDHEIPPQLGNSPSLERLRLGNNKFIGKIPWT  618

Query  2059  LGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelkl  2238
              G IRELSLLDLSGN L+G IP QL +C+KL+H+DLNNNLLSG +P WLG LP LGELKL
Sbjct  619   FGKIRELSLLDLSGNSLTGPIPTQLLMCKKLSHIDLNNNLLSGAVPSWLGTLPQLGELKL  678

Query  2239  SSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPST  2418
             S NQF G LP ELFNCSKLLVLSL+ N LNG+LP E+GNL SLNVL L  N L G IP  
Sbjct  679   SFNQFVGFLPRELFNCSKLLVLSLDGNMLNGSLPNEVGNLASLNVLTLSGNLLSGPIPPA  738

Query  2419  IGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLD  2598
             IG L KLYELRLS N  +G IP E+GQL++LQS+LD S+NN TG+IPPS+GTL+KLE L+
Sbjct  739   IGRLSKLYELRLSNNSLNGVIPLEIGQLQNLQSILDLSHNNFTGQIPPSMGTLAKLEVLN  798

Query  2599  LSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC  2778
             LSHN L GE+P Q+ EMSSLG+LNLS N+L+G+L K+++HWP ++F GN HLCGSPL  C
Sbjct  799   LSHNQLVGELPSQLGEMSSLGKLNLSYNDLQGKLSKQFSHWPAEAFEGNLHLCGSPLDHC  858

Query  2779  -----RDKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsss  2943
                      S    S+VV IS +S   AI LL+     F K  RE + R+  + NY  SS
Sbjct  859   NGLVSNQHQSTISVSLVVAISVISTLSAIALLIAVVTLFVKRKRE-FLRKSSQVNYT-SS  916

Query  2944  ssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAI  3123
             SSSSQAQR+ LF  AA KRD RW+DIM ATNNLSDEFIIGSGG  TVYKAEL NG TVA+
Sbjct  917   SSSSQAQRRLLF-QAAAKRDFRWEDIMGATNNLSDEFIIGSGGSGTVYKAELANGATVAV  975

Query  3124  KRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDW  3303
             K+I  KDD  L+KSF RE+KTL RIRHRHLV+LMG+C NKG GSN+LIYEYMENGSVWDW
Sbjct  976   KKISCKDDHLLNKSFTREVKTLGRIRHRHLVKLMGHCCNKGAGSNLLIYEYMENGSVWDW  1035

Query  3304  LHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAH  3483
             LH QP N K +KSLDWEARLKIA+GLAQGVEYLHHDCVPKI+HRDIKSSN+LLDSNMEAH
Sbjct  1036  LHKQPVNIKMRKSLDWEARLKIAVGLAQGVEYLHHDCVPKILHRDIKSSNILLDSNMEAH  1095

Query  3484  LGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             LGDFGLAKAL ++Y+S NTESNTWFAGSYGYIAPE
Sbjct  1096  LGDFGLAKALVEDYNS-NTESNTWFAGSYGYIAPE  1129



>ref|NP_193747.2| LRR receptor-like serine/threonine-protein kinase GSO1 [Arabidopsis 
thaliana]
 sp|C0LGQ5.1|GSO1_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
GSO1; AltName: Full=Protein GASSHO 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ACN59340.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE84279.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Arabidopsis 
thaliana]
Length=1249

 Score =  1268 bits (3282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 733/1108 (66%), Positives = 876/1108 (79%), Gaps = 15/1108 (1%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCD--Gslkvvslnlsdsslggs  462
             L+ LLEVK+S V        L+ W+  N NYCSW GV+CD  G  +V++LNL+   L GS
Sbjct  27    LQTLLEVKKSLVTNPQEDDPLRQWNSDNINYCSWTGVTCDNTGLFRVIALNLTGLGLTGS  86

Query  463   ispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQ  642
             ISP  G   +L+HLDLSSN+L GPIP ALSNL+SLESL LFSN+L G IPSQLG L N++
Sbjct  87    ISPWFGRFDNLIHLDLSSNNLVGPIPTALSNLTSLESLFLFSNQLTGEIPSQLGSLVNIR  146

Query  643   ALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGP  822
             +LRIGDN L G IP + GNL NL  L LASC L+G IP QLGRL ++Q+L LQ N LEGP
Sbjct  147   SLRIGDNELVGDIPETLGNLVNLQMLALASCRLTGPIPSQLGRLVRVQSLILQDNYLEGP  206

Query  823   LPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLV  1002
             +P E+ N S LT F+AA N LNG+IP ELG L++L ILNLANN+LTGEIP QLGEMS L 
Sbjct  207   IPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANNSLTGEIPSQLGEMSQLQ  266

Query  1003  YLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGT  1182
             YL+L+ NQL G IPKSLA L NLQ+LDLS N L GE+P EF +M QL  L L +N+LSG+
Sbjct  267   YLSLMANQLQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGS  326

Query  1183  IPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQL  1362
             +PKS+CSN TNL+ L+LS T LSGEIP ELS+C+ L+QLDLSNN+L GSIPE L+EL +L
Sbjct  327   LPKSICSNNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNSLAGSIPEALFELVEL  386

Query  1363  TDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSG  1542
             TDL L+NNTLEGT+SPS++NLTNLQ L L+HNNL G++P+EI  L  L+++FLYEN FSG
Sbjct  387   TDLYLHNNTLEGTLSPSISNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSG  446

Query  1543  EIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQL  1722
             EIP EIGNC+SL+ ID +GN F G+IP ++GRLK L  LHLR+N+L G +PASLGNCHQL
Sbjct  447   EIPQEIGNCTSLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQL  506

Query  1723  DTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSG  1902
             + LDLADN LSG+IP++FG+L+ L +LMLYNNSL+G+LPD L +L NLTRINLSHN  +G
Sbjct  507   NILDLADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNG  566

Query  1903  SIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELS  2082
             +I P+C S S+LSFDVTNN F+ EIP  LGNS +LDRLRLG N+ TGKIP TLG IRELS
Sbjct  567   TIHPLCGSSSYLSFDVTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELS  626

Query  2083  LLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGS  2262
             LLD+S N L+G IP QL LC+KLTH+DLNNN LSGPIP WLG+L  LGELKLSSNQF  S
Sbjct  627   LLDMSSNALTGTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVES  686

Query  2263  LPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLY  2442
             LP ELFNC+KLLVLSL+ NSLNG++P EIGNL +LNVLNLD NQ  GS+P  +G L KLY
Sbjct  687   LPTELFNCTKLLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLY  746

Query  2443  ELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTG  2622
             ELRLSRN  +GEIP E+GQL+DLQS LD SYNN TG+IP +IGTLSKLE+LDLSHN LTG
Sbjct  747   ELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTG  806

Query  2623  EIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNK  2802
             E+P  V +M SLG LN+S N L G+L K+++ WP DSF+GN+ LCGSPL  C    S NK
Sbjct  807   EVPGSVGDMKSLGYLNVSFNNLGGKLKKQFSRWPADSFLGNTGLCGSPLSRCNRVRSNNK  866

Query  2803  -----GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQR  2967
                     VV+ISA+SA  AI L+++  A FFK   + +++        +SSSSSSQA  
Sbjct  867   QQGLSARSVVIISAISALTAIGLMILVIALFFKQRHDFFKKVGHGSTAYTSSSSSSQATH  926

Query  2968  KPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDD  3147
             KPLF N A K DIRW+DIMEAT+NLS+EF+IGSGG   VYKAEL NGETVA+K+I  KDD
Sbjct  927   KPLFRNGASKSDIRWEDIMEATHNLSEEFMIGSGGSGKVYKAELENGETVAVKKILWKDD  986

Query  3148  LFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLH-NQPAN  3324
             L  +KSF+RE+KTL RIRHRHLV+LMGYCS+K EG N+LIYEYM+NGS+WDWLH ++P  
Sbjct  987   LMSNKSFSREVKTLGRIRHRHLVKLMGYCSSKSEGLNLLIYEYMKNGSIWDWLHEDKPVL  1046

Query  3325  NKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLA  3504
              K KK LDWEARL+IA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEAHLGDFGLA
Sbjct  1047  EKKKKLLDWEARLRIAVGLAQGVEYLHHDCVPPIVHRDIKSSNVLLDSNMEAHLGDFGLA  1106

Query  3505  KALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             K LT+N D+ NT+SNTWFA SYGYIAPE
Sbjct  1107  KVLTENCDT-NTDSNTWFACSYGYIAPE  1133



>ref|XP_008440179.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Cucumis melo]
Length=1261

 Score =  1266 bits (3275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 740/1118 (66%), Positives = 905/1118 (81%), Gaps = 17/1118 (2%)
 Frame = +1

Query  274   GYVRCQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSCD-----Gslkvv  426
             G V C +  S L VLLE+++SFV      L+ WSE NPN+C W+GVSC      GS+ VV
Sbjct  25    GVVLCDDGLS-LNVLLEIRKSFVDDPENVLEDWSESNPNFCKWRGVSCGSDSAGGSVSVV  83

Query  427   slnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGP  606
              LNLSDSSLGGSISP+LG L +LLHLDLSSN L GPIP  LS L SLESLLLFSN+L G 
Sbjct  84    GLNLSDSSLGGSISPALGRLQNLLHLDLSSNGLMGPIPTNLSQLHSLESLLLFSNQLNGT  143

Query  607   IPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlq  786
             IP++LG +++L+ +RIGDNGLTG IP+SFGNL NLVTLGLASC LSGLIPP+LGRL +++
Sbjct  144   IPTELGSMSSLRVMRIGDNGLTGPIPSSFGNLVNLVTLGLASCSLSGLIPPELGRLGRVE  203

Query  787   nlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGE  966
             ++ LQQN LEGP+P E+ N SSL  F+AA NSLNGSIPK+LG L++L ILNLANNTL+GE
Sbjct  204   DMVLQQNQLEGPVPSELGNCSSLVVFTAAGNSLNGSIPKQLGRLENLQILNLANNTLSGE  263

Query  967   IPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQ  1146
             IP +LGE+  L+YLNL+GNQL GSIP SLA+L+NLQ+LDLS N+L G +P E G+MG L+
Sbjct  264   IPVELGELGQLLYLNLMGNQLEGSIPVSLAELSNLQNLDLSMNKLTGGIPEELGNMGSLE  323

Query  1147  FLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNG  1326
             FL L++N LSG IP  LCSNA++LQ L+LS+  +SGEIP EL QCR L Q+DLSNN+LNG
Sbjct  324   FLVLSNNPLSGVIPGKLCSNASSLQHLLLSQIQISGEIPVELIQCRSLTQIDLSNNSLNG  383

Query  1327  SIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDL  1506
             SIP+E YEL  LTD++L+NN+L G+ISPS+ANL+NL+TL+L+HNNL G++PREIGMLG+L
Sbjct  384   SIPDEFYELRSLTDILLHNNSLVGSISPSIANLSNLKTLALYHNNLQGDLPREIGMLGEL  443

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
             +I++LY+N FSG+IP E+GNCS LQ IDF+GN+F+G+IP++LGRLK L F+HLR+N+L G
Sbjct  444   EILYLYDNQFSGKIPFELGNCSKLQMIDFFGNRFSGEIPVSLGRLKELNFIHLRQNELEG  503

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL  1866
             +IPA+LGNC +L TLDLADN LSG IP+TFG+L AL  LMLYNNSLEG+LP  L NL  L
Sbjct  504   KIPATLGNCRKLTTLDLADNRLSGVIPSTFGFLGALELLMLYNNSLEGNLPRSLINLAKL  563

Query  1867  TRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
              RINLS N  +GSIAP+C S  FLSFD+TNNAFD EIP  LGNS SL+RLRLG+N+F+G+
Sbjct  564   QRINLSKNRLNGSIAPLCASPFFLSFDITNNAFDGEIPPQLGNSSSLERLRLGNNQFSGE  623

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             IP  LG IRELSLLDLSGN L+G IP +LSLC+KLTHLDLNNN LSG +P+WLG LP LG
Sbjct  624   IPPALGKIRELSLLDLSGNSLTGSIPAELSLCKKLTHLDLNNNNLSGNLPMWLGGLPQLG  683

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             E+KLS NQF+G LP ELFNCSKL+VLSL  N LNGTLP EIGNL+SLN+LNLDDN+  GS
Sbjct  684   EIKLSFNQFTGPLPLELFNCSKLIVLSLNENFLNGTLPMEIGNLRSLNILNLDDNRFSGS  743

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IPS IG + KL+ELR+SRN   GEIP E+ QL++LQSVLD SYNNLTGEIP SI  LSKL
Sbjct  744   IPSAIGKISKLFELRMSRNGLDGEIPAEISQLQNLQSVLDLSYNNLTGEIPSSIALLSKL  803

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSP  2766
             E+LDLSHN+L+GE+P  +++MSSLG+LNL+ N+LEG+LDK ++HWP+  F GN  LCG P
Sbjct  804   EALDLSHNELSGEVPSDISKMSSLGKLNLAFNKLEGKLDKEFSHWPISVFQGNLQLCGGP  863

Query  2767  LGSCR----DKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYA  2934
             L  C      + S    + V+ ISA+S    + +L++     +KH  E + +R G+ N  
Sbjct  864   LDRCNEVSSSESSSLSEAAVIAISAVSTLAGMAILVLTVTLLYKHKLETF-KRWGEVN-C  921

Query  2935  sssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGET  3114
               SSSSSQAQR+PLF N    RD  W++IME TNNLSD+FIIGSGG  T+Y+AEL  GET
Sbjct  922   VYSSSSSQAQRRPLFHNPGGNRDFHWEEIMEVTNNLSDDFIIGSGGSGTIYRAELLTGET  981

Query  3115  VAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSV  3294
             VA+K+I  KDDL  ++SF RE+KTL RI+HRHLV+L+GYC N+G+GSN+LIY+YMENGSV
Sbjct  982   VAVKKILCKDDLLSNRSFTREVKTLGRIKHRHLVKLLGYCINRGDGSNLLIYDYMENGSV  1041

Query  3295  WDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNM  3474
             WDWLH Q  N K KK LDWEAR KIA+GLAQG+EYLHHDC+PKI+HRDIK+SN+LLDSNM
Sbjct  1042  WDWLHQQAINGKKKKKLDWEARFKIAVGLAQGLEYLHHDCLPKIVHRDIKTSNILLDSNM  1101

Query  3475  EAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             EAHLGDFGLAKAL +NYD+ +TES TWFAGSYGYIAPE
Sbjct  1102  EAHLGDFGLAKALVENYDT-DTESKTWFAGSYGYIAPE  1138



>ref|XP_006448579.1| hypothetical protein CICLE_v10014061mg [Citrus clementina]
 gb|ESR61819.1| hypothetical protein CICLE_v10014061mg [Citrus clementina]
Length=1254

 Score =  1265 bits (3274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 750/1115 (67%), Positives = 895/1115 (80%), Gaps = 16/1115 (1%)
 Frame = +1

Query  274   GYVRCQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-DGslkvvslnl  438
             G+V C++    L VLLE+K+SF       L  W++ N N C+W+G++C   S +VVSLNL
Sbjct  24    GFVLCKDEE--LSVLLEIKKSFTADPENVLHAWNQSNRNLCTWRGITCGSNSARVVSLNL  81

Query  439   sdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQ  618
             S  SL GSISPSLG L  L+HLDLSSN L+GPIP ALSNLSSLESLLLFSN+L G IP+Q
Sbjct  82    SGLSLAGSISPSLGRLQSLIHLDLSSNSLTGPIPTALSNLSSLESLLLFSNQLAGTIPTQ  141

Query  619   LGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnl  798
             LG LT+L+ +RIGDN L+G IPTSFGNL NL TLGLASC LSG IPPQ G+L+QL+ L L
Sbjct  142   LGSLTSLRVMRIGDNWLSGSIPTSFGNLVNLGTLGLASCSLSGPIPPQFGQLSQLEELIL  201

Query  799   qqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQ  978
             QQN L+GP+P E+ N SSL+ F+AA N+LNGSIP  LG L++L +LNL NN+L+GEIP +
Sbjct  202   QQNQLQGPIPTELGNCSSLSIFTAAENNLNGSIPAALGRLQNLQLLNLGNNSLSGEIPSE  261

Query  979   LGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLAL  1158
             LGE+S L YLNL+GN+L G+IP+S AK+ NLQSLDLS NRL G +P EFG+MGQL FL L
Sbjct  262   LGELSQLGYLNLMGNRLEGAIPRSFAKMGNLQSLDLSMNRLTGGIPEEFGNMGQLVFLVL  321

Query  1159  TSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPE  1338
             ++NN+SG+IP+ +C+NAT+L+ L+L+E  LSGEIP ELSQC+ L+QLDLSNNTLNG+IP 
Sbjct  322   SNNNISGSIPRRICTNATSLEHLILAEIQLSGEIPVELSQCQSLKQLDLSNNTLNGTIPV  381

Query  1339  ELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIF  1518
             EL++L  LT L L+NN+L G+ISP VANL+NLQ L+L+HNN  G +PREIGML  L++++
Sbjct  382   ELFQLVALTHLYLHNNSLVGSISPFVANLSNLQELALYHNNFQGSLPREIGMLVKLELLY  441

Query  1519  LYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPA  1698
             LY+NH SG+IP E+GNCSSL++IDF+GN FTG+IP ++GRLK L FLHLR+N+L G+IPA
Sbjct  442   LYDNHLSGQIPSEVGNCSSLKWIDFFGNSFTGEIPTSIGRLKDLNFLHLRQNELVGQIPA  501

Query  1699  SLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRIN  1878
             SLGNCHQL  LDLADN LSG +P +FG+L+AL +LMLYNNSLEG+LP  L NL NLTRIN
Sbjct  502   SLGNCHQLIILDLADNKLSGGVPGSFGFLQALEQLMLYNNSLEGNLPGSLINLRNLTRIN  561

Query  1879  LSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMT  2058
              S N  +G IA +C+SHSFLSFDVTNN FD EIP  LGNSPSL+RLRLG+N+F GKIP T
Sbjct  562   FSKNRLNGRIAALCSSHSFLSFDVTNNEFDHEIPPQLGNSPSLERLRLGNNKFIGKIPWT  621

Query  2059  LGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelkl  2238
              G IRELSLLDLSGN L+G IP QL +C+KL+H+DLNNNLLSG +P WLG LP LGELKL
Sbjct  622   FGKIRELSLLDLSGNSLTGPIPTQLLMCKKLSHIDLNNNLLSGAVPSWLGTLPQLGELKL  681

Query  2239  SSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPST  2418
             S NQF GSLP ELFNCSKLLVLSL+ N LNG+LP E+GNL SLNVL L  N L G IP  
Sbjct  682   SFNQFVGSLPRELFNCSKLLVLSLDGNMLNGSLPHEVGNLASLNVLTLSGNLLSGPIPPA  741

Query  2419  IGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLD  2598
             IG L KLYELRLS N  +G IP E+GQL++LQS+LD S+NN TG IPPS+GTL+KLE L+
Sbjct  742   IGRLSKLYELRLSNNSLNGVIPLEIGQLQNLQSILDLSHNNFTGHIPPSMGTLAKLEVLN  801

Query  2599  LSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC  2778
             LSHN L GE+P Q+ EMSSLG+LNLS N+L+G+L K+++HWP ++F GN HLCGSPL  C
Sbjct  802   LSHNQLVGELPSQLGEMSSLGKLNLSYNDLQGKLSKQFSHWPAEAFEGNLHLCGSPLDQC  861

Query  2779  -----RDKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsss  2943
                      S    S+VV IS +S   AI LL+     F K  RE + R   + NY  SS
Sbjct  862   NGLVSNQHQSTISVSLVVAISVISTLSAIALLIAVVTLFVKRKRE-FLRESSQVNYT-SS  919

Query  2944  ssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAI  3123
             SSSSQAQR+ LF  AA KRD RW+DIM ATNNLSDEFIIGSGG  TVYKAEL NG TVA+
Sbjct  920   SSSSQAQRRLLF-QAAAKRDFRWEDIMGATNNLSDEFIIGSGGSGTVYKAELANGATVAV  978

Query  3124  KRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDW  3303
             K+I  KDD  L+KSF RE+KTL RIRHRHLV+LMG+C NKG GSN+LIYEYMENGSVWDW
Sbjct  979   KKISCKDDHLLNKSFTREVKTLGRIRHRHLVKLMGHCCNKGAGSNLLIYEYMENGSVWDW  1038

Query  3304  LHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAH  3483
             L+ QP N K +KSLDWEARLKIA+GLAQGVEYLHHDCVPKI+HRDIKSSN+LLDSNMEAH
Sbjct  1039  LNKQPVNIKMRKSLDWEARLKIAVGLAQGVEYLHHDCVPKILHRDIKSSNILLDSNMEAH  1098

Query  3484  LGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             LGDFGLAKAL ++Y+S NTESNTWFAGSYGYIAPE
Sbjct  1099  LGDFGLAKALVEDYNS-NTESNTWFAGSYGYIAPE  1132



>ref|XP_008358557.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Malus domestica]
Length=1258

 Score =  1263 bits (3268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 751/1119 (67%), Positives = 903/1119 (81%), Gaps = 18/1119 (2%)
 Frame = +1

Query  274   GYVRCQ---NTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-----DGsl  417
             G++ C+   + ++TL VLLEVKR+ V      L GWSE +PN+C+W+GV+C     D S+
Sbjct  22    GFMFCEGKLDGNTTLSVLLEVKRAIVEDPENVLHGWSESDPNFCTWRGVTCALDSLDNSV  81

Query  418   kvvslnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrl  597
             + V LNLS SSL GSISPSLG L +LLHLDLSSN LSGPIPP LSNL+SLESLLLFSN+L
Sbjct  82    QAVGLNLSGSSLAGSISPSLGSLQNLLHLDLSSNRLSGPIPPTLSNLTSLESLLLFSNQL  141

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
              G IP+ L  LT+LQ +RIGDNGLTG IP +FG L NLVTLGLASC L+G IPPQLGRL 
Sbjct  142   TGDIPNHLSSLTSLQVMRIGDNGLTGSIPATFGKLVNLVTLGLASCSLNGPIPPQLGRLG  201

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
              L+NL LQ N LEG +P E+ N SSLT F+AA N+LNG+IP +LG L +L +LNL NN+L
Sbjct  202   LLENLILQLNQLEGLIPAELGNCSSLTIFTAANNTLNGTIPAQLGRLGNLQLLNLGNNSL  261

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             TG+IP QLG++S L Y+NL+GNQL G IPKS+++L NLQSLDLS N+L G +P EFG+M 
Sbjct  262   TGQIPSQLGKLSQLGYMNLMGNQLEGPIPKSISQLGNLQSLDLSVNKLTGGIPAEFGTMS  321

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
             QL  L L++N+LSG IP++LCSN T+L+LLM+S +GL GEIP ELSQCR ++QLDLSNN 
Sbjct  322   QLATLVLSNNSLSGVIPRNLCSNTTSLELLMISGSGLVGEIPAELSQCRSMKQLDLSNNL  381

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
             +NGSIP+E+Y L +LTDL+L+NN+L G+ISP ++NL+NLQ+L L+HNNL G +P EIGML
Sbjct  382   INGSIPDEIYGLVELTDLLLHNNSLVGSISPLISNLSNLQSLILYHNNLVGPLPSEIGML  441

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
             G+L+I++LY+N  SGEIP+EIGNCSSLQ IDF+GN+F+G+IP+T+GRLK L  LH+R+N+
Sbjct  442   GELEILYLYDNQLSGEIPMEIGNCSSLQMIDFFGNRFSGEIPVTIGRLKDLNLLHIRQNE  501

Query  1678  LSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNL  1857
             L GEIPA+LGNCH+L  LDLADN LSG IP TFG L A+ + MLYNNSLEG+LPD L N+
Sbjct  502   LVGEIPATLGNCHKLTILDLADNRLSGGIPITFGSLGAMEQFMLYNNSLEGNLPDTLANM  561

Query  1858  GNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRF  2037
              NLTR+NLS N  +GSIA +C+S SFLSFDVT+NAFD EIPS LGNS SL RLRLG+N+F
Sbjct  562   ANLTRVNLSGNKLNGSIAALCSSSSFLSFDVTDNAFDHEIPSQLGNSKSLQRLRLGNNQF  621

Query  2038  TGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlp  2217
             TGKIP TLG I ELSLLD+SGN L+G IP +LS C+KL+H+DLN+NLLSG IP W G LP
Sbjct  622   TGKIPHTLGNISELSLLDVSGNSLTGSIPDELSSCKKLSHIDLNDNLLSGTIPQWFGGLP  681

Query  2218  llgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQL  2397
              LGELKLSSN+F+G+LP ELFNCSKLLVLS+  NSL GTLP EIGNL+SLNVLNLD N  
Sbjct  682   QLGELKLSSNRFTGALPIELFNCSKLLVLSMSENSLIGTLPAEIGNLESLNVLNLDHNHF  741

Query  2398  CGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTL  2577
              G IP  IG LGKLYELRLS+NRF G++P E+GQL++LQS+LD SYNNL+G+IP SIGTL
Sbjct  742   SGPIPPAIGKLGKLYELRLSQNRFDGDLPYELGQLQNLQSILDLSYNNLSGQIPASIGTL  801

Query  2578  SKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLC  2757
             SKLE LDLSHN L GE+P  V  M SLG+LNLS N L+G+L K+ +HWP ++F GN  LC
Sbjct  802   SKLEVLDLSHNQLIGEVPSPVGGMISLGKLNLSYNNLQGKLSKQLSHWPAEAFEGNLDLC  861

Query  2758  GSPLGSC--RDKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENY  2931
             GSPLGSC  R + S      VV ++A+    AI LL+ GAA   KH REA+R+ R  E  
Sbjct  862   GSPLGSCIGRKQQSDPTELAVVALAAICTLSAIALLIFGAASLLKHKREAFRKAR--EMN  919

Query  2932  AsssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGE  3111
                SSSSS AQR+ LF N + K DI+W DIM+AT NLS+EF+IGSGG   +YKAEL  GE
Sbjct  920   FLYSSSSSHAQRRLLFSNGSVKPDIKWKDIMDATKNLSNEFVIGSGGSGVIYKAELRTGE  979

Query  3112  TVAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGS  3291
             TVA+K+I  KDDL  +K+F REIKTL RIRHRHLV+LMGYCSNKG GSN+LIYEYMENGS
Sbjct  980   TVAVKKILYKDDLMANKTFTREIKTLGRIRHRHLVKLMGYCSNKGAGSNLLIYEYMENGS  1039

Query  3292  VWDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSN  3471
             V+DW+H Q  +NK KKSLDWEARLKIA+GLAQGVEYLHHDCVPKIIHRDIKSSN+LLDSN
Sbjct  1040  VYDWIH-QEQSNKKKKSLDWEARLKIAVGLAQGVEYLHHDCVPKIIHRDIKSSNILLDSN  1098

Query  3472  MEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             MEAHLGDFGLAK L +N +S NTESNTWFAGSYGYIAPE
Sbjct  1099  MEAHLGDFGLAKTLNENNES-NTESNTWFAGSYGYIAPE  1136



>ref|XP_008225938.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Prunus mume]
Length=1260

 Score =  1262 bits (3266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 767/1107 (69%), Positives = 905/1107 (82%), Gaps = 15/1107 (1%)
 Frame = +1

Query  301   STLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-----DGslkvvslnlsdssl  453
             +TL VLLEVKRSFV      L  WSE NPN+C+W+GVSC     DGS++VV LNLSDSSL
Sbjct  35    TTLSVLLEVKRSFVEDPEKVLHAWSESNPNFCTWRGVSCGLDSVDGSVQVVGLNLSDSSL  94

Query  454   ggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLT  633
              GSISPSLG L +LLHLDLSSN L+GPIPPALSNLSSLESLLLFSN+L GPIP QLG L+
Sbjct  95    TGSISPSLGSLQNLLHLDLSSNGLTGPIPPALSNLSSLESLLLFSNQLSGPIPIQLGSLS  154

Query  634   NLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnll  813
             +L+ +RIGDN LTG IP SFGNL NLVTLGLASC L+G IPPQ+GRL QL+NL +Q N L
Sbjct  155   SLRVMRIGDNELTGHIPASFGNLVNLVTLGLASCSLNGPIPPQIGRLGQLENLIMQLNQL  214

Query  814   EGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMS  993
             EGP+P E+ N SSLT F+AA N LNGS+P+ELG L++L +LNL NN+L+GEIPGQLG +S
Sbjct  215   EGPIPAELGNCSSLTVFTAAQNHLNGSVPEELGLLQNLQLLNLGNNSLSGEIPGQLGRLS  274

Query  994   SLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNL  1173
              L YLNL+GNQL G +PKSLA+L NLQSLDLS N+L G +P E G+M QL +L L++NNL
Sbjct  275   QLGYLNLVGNQLEGPVPKSLAQLGNLQSLDLSMNKLTGGIPEEMGNMAQLVYLVLSNNNL  334

Query  1174  SGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYEL  1353
             SG IP++LCSN T+L+ LM+S+  + GEIP ELSQC+ ++QLDLSNN LNGSIP EL+EL
Sbjct  335   SGVIPRTLCSNTTSLEHLMISDAAIFGEIPVELSQCQSMKQLDLSNNLLNGSIPVELFEL  394

Query  1354  TQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENH  1533
               LTDL+L+NN+L G+ISP + NL+NLQTL L+HNNL G +PREIGMLG L+I++LY+N 
Sbjct  395   VGLTDLLLHNNSLVGSISPYLGNLSNLQTLVLYHNNLQGPLPREIGMLGKLEILYLYDNQ  454

Query  1534  FSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNC  1713
              SGEIP+EIGNCSSLQ IDF+GN+ +G+IPIT+GRLK L  LH+R+N+L GE+PA+LGNC
Sbjct  455   LSGEIPIEIGNCSSLQMIDFFGNRLSGEIPITIGRLKDLNLLHIRQNELVGELPATLGNC  514

Query  1714  HQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNN  1893
             HQL  LDLADN LSG IP TFG L+A+ + MLYNNSLEG+LPD L N+GNLTR+NLS N 
Sbjct  515   HQLTILDLADNSLSGGIPITFGSLQAMEQFMLYNNSLEGNLPDTLANMGNLTRVNLSRNK  574

Query  1894  FSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIR  2073
              +GSIA +C+S SFLSFDVT+NAFD EIP  LGNSPSL+RLRLG+N+FTG IP TLG I 
Sbjct  575   LNGSIAALCSSSSFLSFDVTDNAFDHEIPYKLGNSPSLERLRLGNNQFTGSIPQTLGNIS  634

Query  2074  ELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQF  2253
             ELSLLD+SGN L+G IP +LS C+KL H+DLNNN LSG IP WLG LP LGELKLSSN+F
Sbjct  635   ELSLLDVSGNSLTGPIPAELSSCKKLAHIDLNNNFLSGTIPRWLGGLPQLGELKLSSNRF  694

Query  2254  SGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLG  2433
             +G  P ELFNCSKLLVLSL +NSLNGTLP EIGNL+SLNVLNL+ N   GSIP  IG LG
Sbjct  695   TGPPPQELFNCSKLLVLSLNDNSLNGTLPAEIGNLESLNVLNLNHNLFSGSIPPAIGKLG  754

Query  2434  KLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHND  2613
             KLYELRLS+N F G+IP E+GQL++LQS+LD SYNNL+G+IP SIGTL+KLE+LDLSHN 
Sbjct  755   KLYELRLSQNGFDGDIPFELGQLQNLQSILDLSYNNLSGQIPASIGTLTKLEALDLSHNQ  814

Query  2614  LTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC--RDK  2787
             L GE+P  VA M SLG+LNLS N L+G+L K+ +HWP ++F GN HLCGSPLG C  R +
Sbjct  815   LVGEVPSPVAGMISLGKLNLSYNNLQGKLSKQLSHWPAEAFAGNLHLCGSPLGKCSVRRQ  874

Query  2788  GSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQR  2967
              S    S VVVISA+    AI LL+ GAA   +H +E +  R+  E     SSSSS AQR
Sbjct  875   QSGPSESAVVVISAICTLSAIALLIFGAASLLQHKQEVF--RKASEVNCLYSSSSSHAQR  932

Query  2968  KPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDD  3147
             + LF N + K D +W DIMEAT NLS+EF+IGSGG   +YKAEL  GETVA+K+I  KDD
Sbjct  933   RLLFPNGSVKPDFKWKDIMEATKNLSNEFVIGSGGSGIIYKAELSTGETVAVKKILYKDD  992

Query  3148  LFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANN  3327
             L  +KSF REIKTL RIRHRHLV+LMGYCSNKG GSN+LIYEYMENGSVWDW+H QPA +
Sbjct  993   LMANKSFTREIKTLGRIRHRHLVKLMGYCSNKGVGSNLLIYEYMENGSVWDWIHQQPATS  1052

Query  3328  KSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAK  3507
             K KKSLDWEARLKIA+GLAQGVEYLHHDCVPKIIHRD+KSSNVLLDSNMEAHLGDFGLAK
Sbjct  1053  K-KKSLDWEARLKIAVGLAQGVEYLHHDCVPKIIHRDVKSSNVLLDSNMEAHLGDFGLAK  1111

Query  3508  ALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             A+ +NY+S NTESNTWFAGS+GYIAPE
Sbjct  1112  AINENYES-NTESNTWFAGSFGYIAPE  1137



>ref|XP_010434316.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Camelina sativa]
Length=1252

 Score =  1261 bits (3262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 729/1116 (65%), Positives = 877/1116 (79%), Gaps = 16/1116 (1%)
 Frame = +1

Query  286   CQ-NTSSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCD--Gslkvvslnl  438
             CQ   ++ L+ LLEVK+SFV        LQ W+  N NYCSW GV+CD  G  +V++LNL
Sbjct  22    CQPGINNDLQTLLEVKKSFVTNQEDDDPLQQWNSVNINYCSWTGVTCDDIGLFRVIALNL  81

Query  439   sdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQ  618
             +   L GSISP  G L +L+HLDLSSN+L GPIP ALSNL+SLESL LFSN+L G IPSQ
Sbjct  82    TGLELTGSISPWFGRLDNLIHLDLSSNNLVGPIPTALSNLTSLESLFLFSNQLTGEIPSQ  141

Query  619   LGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnl  798
             LG L NL++LRIGDN L G IP + GNL NL  L LASC L+G IP QLGRL ++Q+L L
Sbjct  142   LGSLVNLRSLRIGDNELVGAIPETLGNLVNLQMLALASCRLTGPIPSQLGRLVRVQSLVL  201

Query  799   qqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQ  978
             Q N LEGP+P E+ N S LT  +AA N LNG+IP ELG L++L ILNLANN+LTG+IP Q
Sbjct  202   QDNYLEGPIPAELGNCSDLTVLTAAENMLNGTIPAELGRLENLEILNLANNSLTGDIPSQ  261

Query  979   LGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLAL  1158
             LG MS L YLNL+ NQL G IPKSLA L NLQ+LDLS N L G++P E  ++  L  L L
Sbjct  262   LGGMSQLQYLNLMANQLQGVIPKSLADLRNLQTLDLSENHLTGKIPEELWNISGLLDLVL  321

Query  1159  TSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPE  1338
              +N+LSG++PKS+CSN T+L+ L+LS T LSGEIP ELS+C+ L+QLDLSNNTL G+IPE
Sbjct  322   ANNHLSGSLPKSICSNNTSLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNTLVGTIPE  381

Query  1339  ELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIF  1518
              L++L +LTDL L+NNTL+GT+SPSV+NLTNLQ L L+HNNL G++P+EI  L  L++++
Sbjct  382   ALFQLVELTDLYLHNNTLDGTLSPSVSNLTNLQWLVLYHNNLEGKLPKEISALKKLEVLY  441

Query  1519  LYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPA  1698
             LYEN FSGEIP EIGNC+SL+ ID +GN F G+IP ++GRLK L  LHLR+N+  G +PA
Sbjct  442   LYENRFSGEIPKEIGNCTSLKMIDLFGNHFEGEIPSSIGRLKELNLLHLRQNEFVGGLPA  501

Query  1699  SLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRIN  1878
             SLGNCH L  LDLADN L G+IP++FG+++ L +LMLYNNSL+G+LPD L N+ NLTRIN
Sbjct  502   SLGNCHHLKILDLADNQLLGSIPSSFGFIKGLEQLMLYNNSLQGNLPDSLINMKNLTRIN  561

Query  1879  LSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMT  2058
             LSHN  +G+I P+C S S+LSFDVTNN F+ EIP  LGNSP+LDRLRLG N+FTG+IP T
Sbjct  562   LSHNMLNGTIHPLCGSSSYLSFDVTNNGFEDEIPLELGNSPNLDRLRLGKNQFTGRIPWT  621

Query  2059  LGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelkl  2238
             LG IRELSLLD+S N L+G IP QL LCRKLTH+DLNNN LSGP+P WLG+L  LGELKL
Sbjct  622   LGKIRELSLLDISSNSLTGTIPLQLVLCRKLTHIDLNNNFLSGPLPPWLGKLSQLGELKL  681

Query  2239  SSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPST  2418
             SSNQF  SLP ELFNC+KLLVLSL+ NSLNG++P  IGNL +LNVLNLD NQ  GS+P  
Sbjct  682   SSNQFVESLPTELFNCTKLLVLSLDGNSLNGSIPQAIGNLGALNVLNLDKNQFSGSLPQA  741

Query  2419  IGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLD  2598
             +G LGKLYELRLSRN  +GEIP E+GQL+DLQS LD SYNN TG+IP +IGTLSKLE+LD
Sbjct  742   MGKLGKLYELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLD  801

Query  2599  LSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC  2778
             LSHN LTGE+P  V +M SLG LNLS N L G+L K+++ WP DSFVGN+ LCGSPL  C
Sbjct  802   LSHNQLTGEVPGSVGDMKSLGYLNLSFNNLGGKLKKQFSRWPADSFVGNTGLCGSPLSRC  861

Query  2779  RDKGSRNK-----GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsss  2943
                 S NK        VV+ISA+SA  AI L+++  A FFK   + +++ +      SSS
Sbjct  862   NRVVSHNKQQGLSARSVVIISAISALTAIGLMILVIALFFKQRHDFFKKVQDGSTVYSSS  921

Query  2944  ssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAI  3123
             +SSSQA  KPLF N A K DI+W+DIMEAT+NLS+EF+IGSGG   VYKAEL NGETVA+
Sbjct  922   NSSSQATHKPLFRNGASKSDIKWEDIMEATHNLSEEFMIGSGGSGKVYKAELENGETVAV  981

Query  3124  KRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDW  3303
             K+I  KDDL  +KSF+RE+KTL  IRHRHLV+LMGYCS+K EG N+LIYEYM+NGSVWDW
Sbjct  982   KKILWKDDLMSNKSFSREVKTLGTIRHRHLVKLMGYCSSKSEGLNLLIYEYMKNGSVWDW  1041

Query  3304  LHNQ-PANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEA  3480
             LH + P  +K KK LDWEARL+IA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEA
Sbjct  1042  LHEENPVIDKKKKLLDWEARLRIAVGLAQGVEYLHHDCVPPIVHRDIKSSNVLLDSNMEA  1101

Query  3481  HLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             HLGDFGLAK LT+NYD+ NT+SNTWFA SYGYIAPE
Sbjct  1102  HLGDFGLAKVLTENYDT-NTDSNTWFACSYGYIAPE  1136



>ref|XP_002265191.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X1 [Vitis vinifera]
Length=1254

 Score =  1260 bits (3261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 746/1116 (67%), Positives = 890/1116 (80%), Gaps = 17/1116 (2%)
 Frame = +1

Query  277   YVRCQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-DG--slkvvsln  435
             YV C+    TLR+LLE+K SF       L  WS  NP++CSW+ VSC DG    +VV+LN
Sbjct  24    YVLCKEEEETLRILLEIKESFEEDPQNVLDEWSVDNPSFCSWRRVSCSDGYPVHQVVALN  83

Query  436   lsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPS  615
             LS SSL GSISPSL  LT+LLHLDLSSN L+G IPP LSNLSSL SLLLFSN+L G IP+
Sbjct  84    LSQSSLAGSISPSLARLTNLLHLDLSSNRLTGSIPPNLSNLSSLLSLLLFSNQLSGSIPA  143

Query  616   QLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnln  795
             QL  LTNL+ +RIGDN L+G IP SFGNL NLVTLGLAS  L+G IP QLGRLT+L+NL 
Sbjct  144   QLSSLTNLRVMRIGDNALSGSIPPSFGNLLNLVTLGLASSLLTGPIPWQLGRLTRLENLI  203

Query  796   lqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPG  975
             LQQN LEGP+PP++ N SSL  F++ALN LNGSIP EL  LK+L +LNLANNTL+G IPG
Sbjct  204   LQQNKLEGPIPPDLGNCSSLVVFTSALNRLNGSIPPELALLKNLQLLNLANNTLSGAIPG  263

Query  976   QLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLA  1155
             QLGE + LVYLNL+ NQL G IP+SLA+L +LQ+LDLS N+L G++P E G+MGQL ++ 
Sbjct  264   QLGESTQLVYLNLMANQLEGPIPRSLARLGSLQTLDLSVNKLTGQIPPELGNMGQLVYMV  323

Query  1156  LTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIP  1335
             L++N+LSG IP+++CSN T ++ L LSE  +SGEIP +L  C  L+QL+L+NNT+NGSIP
Sbjct  324   LSTNHLSGVIPRNICSNTTTMEHLFLSENQISGEIPADLGLCGSLKQLNLANNTINGSIP  383

Query  1336  EELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQII  1515
              +L++L  LTDL+LNNN+L G+ISPS+ANL+NLQTL+L+ NNL G +PREIGMLG L+I+
Sbjct  384   AQLFKLPYLTDLLLNNNSLVGSISPSIANLSNLQTLALYQNNLRGNLPREIGMLGKLEIL  443

Query  1516  FLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIP  1695
             ++Y+N  SGEIP+EIGNCSSLQ IDF+GN F G+IP+T+GRLK L FLHLR+NDLSGEIP
Sbjct  444   YIYDNRLSGEIPLEIGNCSSLQRIDFFGNHFKGQIPVTIGRLKELNFLHLRQNDLSGEIP  503

Query  1696  ASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRI  1875
              +LGNCHQL  LDLADN LSG IPATFG+LR L  LMLYNNSLEG+LPD+L N+ NLTR+
Sbjct  504   PTLGNCHQLTILDLADNSLSGGIPATFGFLRVLEELMLYNNSLEGNLPDELINVANLTRV  563

Query  1876  NLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPM  2055
             NLS+N  +GSIA +C+SHSFLSFDVTNNAFD +IP  LG SPSL RLRLG+N FTG IP 
Sbjct  564   NLSNNKLNGSIAALCSSHSFLSFDVTNNAFDGQIPRELGFSPSLQRLRLGNNHFTGAIPR  623

Query  2056  TLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelk  2235
             TLG I +LSL+D SGN L+G +P +LSLC+KLTH+DLN+N LSGPIP WLG LP LGELK
Sbjct  624   TLGEIYQLSLVDFSGNSLTGSVPAELSLCKKLTHIDLNSNFLSGPIPSWLGSLPNLGELK  683

Query  2236  lSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPS  2415
             LS N FSG LP ELF CS LLVLSL+NN LNGTLP E GNL SLNVLNL+ NQ  G IP 
Sbjct  684   LSFNLFSGPLPHELFKCSNLLVLSLDNNLLNGTLPLETGNLASLNVLNLNQNQFYGPIPP  743

Query  2416  TIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESL  2595
              IG L KLYELRLSRN F+GEIP E+G+L++LQSVLD SYNNLTGEIPPSIGTLSKLE+L
Sbjct  744   AIGNLSKLYELRLSRNSFNGEIPIELGELQNLQSVLDLSYNNLTGEIPPSIGTLSKLEAL  803

Query  2596  DLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGS  2775
             DLSHN L GEIP QV  MSSLG+LN S N LEG+LDK + HWP ++F+GN  LCG PL  
Sbjct  804   DLSHNQLVGEIPFQVGAMSSLGKLNFSYNNLEGKLDKEFLHWPAETFMGNLRLCGGPLVR  863

Query  2776  CRDKGSRN-----KGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAss  2940
             C  + S +     K S VV+ISA S   AI+LL++G A F K  RE+    +        
Sbjct  864   CNSEESSHHNSGLKLSYVVIISAFSTIAAIVLLMIGVALFLKGKRESLNAVK-----CVY  918

Query  2941  sssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVA  3120
             SSSSS   R+PL  N A KRD +W DIM+ATNNLSD FIIGSGG  T+YKAEL + ETVA
Sbjct  919   SSSSSIVHRRPLLPNTAGKRDFKWGDIMQATNNLSDNFIIGSGGSGTIYKAELSSEETVA  978

Query  3121  IKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWD  3300
             +K+I RKDDL L+KSF REI+TL R+RHRHL +L+G C NK  G N+L+YEYMENGS+WD
Sbjct  979   VKKILRKDDLLLNKSFEREIRTLGRVRHRHLAKLLGCCVNKEAGFNLLVYEYMENGSLWD  1038

Query  3301  WLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEA  3480
             WLH +  ++K +KSLDWEARL++A+GLA+GVEYLHHDCVPKIIHRDIKSSNVLLDSNMEA
Sbjct  1039  WLHPESVSSKKRKSLDWEARLRVAVGLAKGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEA  1098

Query  3481  HLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             HLGDFGLAK L +N++S NT+SN+WFAGSYGYIAPE
Sbjct  1099  HLGDFGLAKTLVENHNSFNTDSNSWFAGSYGYIAPE  1134



>ref|XP_010439612.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Camelina sativa]
Length=1252

 Score =  1259 bits (3258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 726/1116 (65%), Positives = 875/1116 (78%), Gaps = 16/1116 (1%)
 Frame = +1

Query  286   CQ-NTSSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCD--Gslkvvslnl  438
             CQ   ++ L+ LLEVK+SFV        L+ W+  N NYCSW GV+CD  G  +V++LNL
Sbjct  22    CQPGINNDLQTLLEVKKSFVTNQEEDDPLRQWNAVNVNYCSWTGVTCDDTGLFRVIALNL  81

Query  439   sdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQ  618
             +   L GSISP  G L +L+HLDLSSN+L GPIP ALSNL+SLESL LFSN+L G IPSQ
Sbjct  82    TGLGLTGSISPWFGRLDNLIHLDLSSNNLVGPIPTALSNLTSLESLFLFSNQLTGEIPSQ  141

Query  619   LGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnl  798
             LG L +L++LRIGDN L G IP + GNL NL  L LASC L+G IP QLGRL ++Q+L L
Sbjct  142   LGSLVSLRSLRIGDNELVGAIPETLGNLVNLQMLALASCRLTGPIPSQLGRLVRVQSLVL  201

Query  799   qqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQ  978
             Q N LEGP+P E+ N S LT  +AA N LNG+IP ELG L++L ILNLANN+LTGEIP Q
Sbjct  202   QDNYLEGPIPAELGNCSDLTVLTAAENMLNGTIPAELGRLENLEILNLANNSLTGEIPSQ  261

Query  979   LGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLAL  1158
             LGEM  L YLNL+ NQL G  PKSLA L NLQ+LDLS N L GE+P E  +M +L  L L
Sbjct  262   LGEMRQLQYLNLMANQLEGVSPKSLADLRNLQTLDLSENHLTGEIPEELWNMSELLDLVL  321

Query  1159  TSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPE  1338
              +N  SG++PKS+CSN T+L+ L+LS T LSGEIP ELS+C+ L+QLDLSNNTL GSIPE
Sbjct  322   ANNRFSGSLPKSICSNNTSLEQLVLSGTQLSGEIPAELSKCQSLRQLDLSNNTLIGSIPE  381

Query  1339  ELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIF  1518
              L++L +LTDL L+NNTL+ T+SPSV+NLTNLQ L L+HNNL G++P+EI  L  L++++
Sbjct  382   ALFQLVELTDLYLHNNTLDSTLSPSVSNLTNLQWLVLYHNNLEGKLPKEISALKKLEVLY  441

Query  1519  LYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPA  1698
             LYEN FSGEIP EIGNC+SL+ ID +GN F G+IP ++GRLK L  LHLR+N+L G +PA
Sbjct  442   LYENRFSGEIPKEIGNCTSLKMIDLFGNHFEGEIPSSIGRLKELNLLHLRQNELMGGLPA  501

Query  1699  SLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRIN  1878
             SLGNCH L  LDLADN L G+IP++FG+++ L +LMLYNNSL+G+LPD L N+ NLTRIN
Sbjct  502   SLGNCHHLKILDLADNQLLGSIPSSFGFIKGLEQLMLYNNSLQGNLPDSLINMKNLTRIN  561

Query  1879  LSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMT  2058
             LSHN  +G+I P+C S S+LSFDVTNN F+ EIP  LGNSP+LDRLRLG N+FTG+IP T
Sbjct  562   LSHNMLNGTIHPLCGSSSYLSFDVTNNGFEDEIPLELGNSPNLDRLRLGKNQFTGRIPWT  621

Query  2059  LGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelkl  2238
             LG IRELSLLD+S N L+G IP QL LC+KLTH+DLNNN LSGP+P WLG+L  LGELKL
Sbjct  622   LGKIRELSLLDISSNSLTGTIPLQLILCKKLTHIDLNNNFLSGPLPPWLGKLSQLGELKL  681

Query  2239  SSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPST  2418
             SSNQF  SLP ELFNC+KLLVLSL+ N LNG++P EIGNL +LNVLNLD NQ  G++P  
Sbjct  682   SSNQFVESLPTELFNCTKLLVLSLDGNYLNGSIPQEIGNLGALNVLNLDKNQFSGTLPQA  741

Query  2419  IGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLD  2598
             +G L KLYELRLSRN  +GEIP E+GQL+DLQS LD SYNN TG+IP +IGTLSKLE+LD
Sbjct  742   MGKLSKLYELRLSRNSLTGEIPVEIGQLRDLQSALDLSYNNFTGDIPSTIGTLSKLETLD  801

Query  2599  LSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC  2778
             LSHN LTGE+P  V +M SLG LNLS N   G+L K+++ WP DSFVGN+ LCGSPL  C
Sbjct  802   LSHNQLTGEVPGAVGDMKSLGYLNLSFNNFGGKLKKQFSRWPADSFVGNTGLCGSPLSRC  861

Query  2779  RDKGSRNK-----GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsss  2943
                GS NK        VV+ISA+SA  AI L+++  A FFK   + +++ +      SSS
Sbjct  862   NRVGSHNKQQGLSARSVVIISAISALTAIGLMILVIALFFKQRHDFFKKVQDGSTMYSSS  921

Query  2944  ssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAI  3123
             +SSSQA  KPLF N A K DI+W+DIMEAT+NLS+EF+IGSGG   VYKAEL NGETVA+
Sbjct  922   NSSSQATHKPLFRNGASKSDIKWEDIMEATHNLSEEFMIGSGGSGKVYKAELDNGETVAV  981

Query  3124  KRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDW  3303
             K+I  KDDL  +KSF+RE+KTL  IRHRHLV+LMGYCS+K EG N+LIYEYM+NGSVWDW
Sbjct  982   KKILWKDDLMSNKSFSREVKTLGTIRHRHLVKLMGYCSSKSEGLNLLIYEYMKNGSVWDW  1041

Query  3304  LHNQ-PANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEA  3480
             LH++ P  +K KK LDWEARL+IA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEA
Sbjct  1042  LHDEKPVIDKKKKLLDWEARLRIAVGLAQGVEYLHHDCVPPIVHRDIKSSNVLLDSNMEA  1101

Query  3481  HLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             HLGDFGLAK LT+NYD+ NT+SNTWFA SYGYIAPE
Sbjct  1102  HLGDFGLAKVLTENYDT-NTDSNTWFACSYGYIAPE  1136



>ref|XP_006285037.1| hypothetical protein CARUB_v10006344mg, partial [Capsella rubella]
 gb|EOA17935.1| hypothetical protein CARUB_v10006344mg, partial [Capsella rubella]
Length=1230

 Score =  1259 bits (3258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 720/1108 (65%), Positives = 870/1108 (79%), Gaps = 15/1108 (1%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsis  468
             L+ LLEVK+SF+        L+ W+  N N+CSW GV+CD +     + L+ + LG + S
Sbjct  8     LQTLLEVKKSFITNQEEDNPLRQWNSVNINHCSWTGVTCDDTRLFRVIALNLTGLGLTGS  67

Query  469   ps--lgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQ  642
              S  LG L +L+HLDLSSN+L GPIP ALSNL+SLESL LFSN+L G IP+QLG L NL+
Sbjct  68    ISPWLGRLDNLIHLDLSSNNLIGPIPTALSNLTSLESLFLFSNQLTGEIPTQLGSLLNLR  127

Query  643   ALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGP  822
             +LRIGDN L G IP +FGNL NL  L LASC L+G IP QLGRL ++Q+L LQ N LEGP
Sbjct  128   SLRIGDNELVGSIPETFGNLVNLQMLALASCRLTGPIPSQLGRLVRVQSLVLQDNYLEGP  187

Query  823   LPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLV  1002
             +P ++ N S LT  +AA N LNG+IP ELG L++L ILNLANNTLTGEIP QLGE+S L 
Sbjct  188   IPADLGNCSDLTVLTAAENMLNGTIPAELGRLENLEILNLANNTLTGEIPSQLGELSQLQ  247

Query  1003  YLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGT  1182
             YLNL+ NQL   IPKSLA L NLQ+LDLS N L GE+P E  +M QL  + L +N+LSG+
Sbjct  248   YLNLMANQLQDVIPKSLANLRNLQTLDLSANNLTGEIPEELWNMSQLLDMVLANNHLSGS  307

Query  1183  IPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQL  1362
             +PKS+CSN TNL+ L+LS T LSGEIP ELS+C+ L+QLDLSNN+L GSIPE L++L +L
Sbjct  308   LPKSICSNNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNSLVGSIPEALFQLVEL  367

Query  1363  TDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSG  1542
             TDL L+NNTLEGT+SP V+NLTNLQ L L+HNNL G++P+EI  L  L++++LYEN FSG
Sbjct  368   TDLYLHNNTLEGTLSPLVSNLTNLQWLVLYHNNLEGKLPKEISALKSLEVLYLYENRFSG  427

Query  1543  EIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQL  1722
             EIP EIGNC+SL+ ID +GN F G+IP ++GRLK L  LHLR+N+L G +PASLG+C  L
Sbjct  428   EIPKEIGNCTSLKMIDLFGNHFEGEIPPSIGRLKKLNLLHLRQNELVGGLPASLGSCQHL  487

Query  1723  DTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSG  1902
               LDLADN LSG+IP++FG+L+ L +LMLYNNSL+G+LP+ L N+ NLTRINLSHN  +G
Sbjct  488   KILDLADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPESLVNMKNLTRINLSHNMLNG  547

Query  1903  SIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELS  2082
             +I P+C S  +LSFDVTNN F+ EIP  LGNSP+LDRLRLG N+FTGKIP TLG IRELS
Sbjct  548   TIHPLCGSSLYLSFDVTNNGFEDEIPLELGNSPNLDRLRLGKNQFTGKIPWTLGKIRELS  607

Query  2083  LLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGS  2262
             LLD+S N L+G IP QL LC+KLTH+DLNNN LSGPIP WLG+L  LGELKLSSNQF  S
Sbjct  608   LLDISSNSLTGTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFIES  667

Query  2263  LPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLY  2442
             LP ELFNC+KLLVLSL+ N LNG++P EIGNL +LNVLNLD NQ  G +P  +G L KLY
Sbjct  668   LPTELFNCTKLLVLSLDENLLNGSIPQEIGNLGALNVLNLDKNQFSGPLPQAMGKLSKLY  727

Query  2443  ELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTG  2622
             ELRLSRN  +GEIP E+GQL+DLQS LD SYNN TG+IP +IG+LSKLE+LDLSHN LTG
Sbjct  728   ELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGSLSKLETLDLSHNQLTG  787

Query  2623  EIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNK  2802
             E+P  V +M SLG LN+S N L G+L K+++ WP DSF+GN+ LCGSPL  C   GS NK
Sbjct  788   EVPGAVGDMKSLGYLNISFNNLGGKLKKQFSRWPADSFIGNTGLCGSPLSRCNRAGSNNK  847

Query  2803  -----GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQR  2967
                     VV+ISA+SA  AI L+++  A FFK   + +++ +      SSS+SSSQA  
Sbjct  848   QQGLSARSVVIISAISALTAIGLMILVIALFFKQRHDFFKKVQDGSTVYSSSNSSSQATH  907

Query  2968  KPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDD  3147
             KPLF   A K DI+W+DIMEATNNLS+EF+IGSGG   VYKAEL NGETVA+K+I  KDD
Sbjct  908   KPLFRTGASKSDIKWEDIMEATNNLSEEFMIGSGGSGKVYKAELENGETVAVKKILWKDD  967

Query  3148  LFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQ-PAN  3324
             L  +KSF+RE+KTL RIRHRHLV+LMGYCS+K EG N+LIYEYM+NGSVWDWLH + P  
Sbjct  968   LMSNKSFSREVKTLGRIRHRHLVKLMGYCSSKSEGLNLLIYEYMKNGSVWDWLHEENPVI  1027

Query  3325  NKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLA  3504
             +K KK LDWEARL+IA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEAHLGDFGLA
Sbjct  1028  DKKKKPLDWEARLRIAVGLAQGVEYLHHDCVPPIVHRDIKSSNVLLDSNMEAHLGDFGLA  1087

Query  3505  KALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             KALT+NYD+ NT+SNTWFA SYGYIAPE
Sbjct  1088  KALTENYDT-NTDSNTWFACSYGYIAPE  1114



>ref|XP_010449218.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Camelina sativa]
Length=1252

 Score =  1256 bits (3249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 726/1116 (65%), Positives = 878/1116 (79%), Gaps = 16/1116 (1%)
 Frame = +1

Query  286   CQ-NTSSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCD--Gslkvvslnl  438
             CQ   ++ L+ LLEVK+SF+        L+ W+  N N+CSW GV+CD  G  +V++LNL
Sbjct  22    CQPGINNDLQTLLEVKKSFITNQEEDNPLRQWNAVNINHCSWTGVTCDDTGLFRVIALNL  81

Query  439   sdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQ  618
             +   L GSISP  G L +L+HLDLSSN+L GPIP ALSNL+SLESL LFSN+L G IPSQ
Sbjct  82    TGLGLTGSISPWFGRLDNLIHLDLSSNNLVGPIPTALSNLTSLESLFLFSNQLTGEIPSQ  141

Query  619   LGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnl  798
             LG L NL++LRIGDN L G IP + GNL NL  L LASC L+G IP QLGRL ++Q+L L
Sbjct  142   LGSLVNLRSLRIGDNELVGAIPETLGNLVNLQMLALASCRLTGPIPSQLGRLVRVQSLVL  201

Query  799   qqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQ  978
             Q N LEGP+P E+ N S LT  +AA N LNG+IP ELG L++L ILNLANN+LTG+IP Q
Sbjct  202   QDNYLEGPIPAELGNCSDLTVLTAAENMLNGTIPAELGRLENLEILNLANNSLTGDIPSQ  261

Query  979   LGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLAL  1158
             LGEMS L YLNL+ NQL G IPK+LA L NLQ+LDLS N L G++P E  +M  L  + L
Sbjct  262   LGEMSQLQYLNLMANQLQGVIPKTLADLRNLQTLDLSENHLTGKIPEELWNMSGLLDMVL  321

Query  1159  TSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPE  1338
              +N+LSG++PKS+CSN TNL+ L+LS T LSGEIP ELS+C+ L+QLDLSNNTL GSIPE
Sbjct  322   ANNHLSGSLPKSICSNNTNLEQLVLSGTQLSGEIPAELSKCQSLKQLDLSNNTLVGSIPE  381

Query  1339  ELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIF  1518
              L++L +LTDL L+NNTL+GT+SPSV+N TNLQ L L+HNNL G++P+EI  L  L++++
Sbjct  382   ALFQLVELTDLYLHNNTLDGTLSPSVSNFTNLQWLVLYHNNLEGKLPKEISALKKLEVLY  441

Query  1519  LYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPA  1698
             LYEN FSGEIP EIGNC+SL+ ID +GN F G+IP ++G LK L  LHLR+N+L G +PA
Sbjct  442   LYENRFSGEIPKEIGNCTSLKMIDLFGNHFEGEIPSSIGILKELNLLHLRQNELMGGLPA  501

Query  1699  SLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRIN  1878
             SLGNCH L  LDLADN L G+IP++FG+L+ L +LMLYNNSL+G+LPD L N+ NLTRIN
Sbjct  502   SLGNCHHLKILDLADNQLLGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLINMKNLTRIN  561

Query  1879  LSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMT  2058
             LSHN  +G+I P+C S S+LSFDVTNN F+ EIP  LGNSP+LDRLRLG N+FTG+IP T
Sbjct  562   LSHNMLNGTIHPLCGSSSYLSFDVTNNGFEDEIPLELGNSPNLDRLRLGKNQFTGRIPWT  621

Query  2059  LGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelkl  2238
             LG IRELSLLD+S N L+G IP QL LC+KLTH+DLNNN LSGP+P WLG+L  LGELKL
Sbjct  622   LGKIRELSLLDISSNSLTGTIPLQLVLCKKLTHIDLNNNFLSGPLPPWLGKLSQLGELKL  681

Query  2239  SSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPST  2418
             SSNQF  SLP ELFNC+KLLVLSL+ NSLNG++P EIGNL +LNVLNLD NQ  GS+P  
Sbjct  682   SSNQFVESLPTELFNCTKLLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQA  741

Query  2419  IGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLD  2598
             +G LGKLYELRLSRN  +GEIP E+GQL+DLQS LD SYNN TG+IP +IGTLSKLE+LD
Sbjct  742   MGKLGKLYELRLSRNSLTGEIPFEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLD  801

Query  2599  LSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC  2778
             LSHN LTGE+P  V +M SLG LNLS N L G+L K+++ WP DSF+GN+ LCGSPL  C
Sbjct  802   LSHNQLTGEVPGSVGDMKSLGYLNLSFNNLGGKLKKQFSRWPADSFLGNTGLCGSPLTRC  861

Query  2779  RDKGSRNK-----GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsss  2943
                 S NK        VV+ISA+SA  AI L+++  A FFK   + +++ +      SSS
Sbjct  862   NRVVSHNKQQGLSARSVVIISAISALTAIGLMILVIALFFKQRHDFFKKVQDGSTVYSSS  921

Query  2944  ssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAI  3123
             +SSSQA  KPLF N A K DI+W+DIMEATNNLS+EF+IGSGG   VYKAEL NGETVA+
Sbjct  922   NSSSQATHKPLFRNGASKSDIKWEDIMEATNNLSEEFMIGSGGSGKVYKAELENGETVAV  981

Query  3124  KRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDW  3303
             K+I  KDDL  +KSF+RE+KTL  IRHRHLV+LMGYCS+K EG N+LIYEYM+NGSVWDW
Sbjct  982   KKILWKDDLMSNKSFSREVKTLGTIRHRHLVKLMGYCSSKSEGLNLLIYEYMKNGSVWDW  1041

Query  3304  LHNQ-PANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEA  3480
             L+ + P  +K K+ LDWEARL+IA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEA
Sbjct  1042  LNEENPVIDKKKRVLDWEARLRIAVGLAQGVEYLHHDCVPPIVHRDIKSSNVLLDSNMEA  1101

Query  3481  HLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             HLGDFGLAK LT+NYD+ NT+SNTWFA SYGYIAPE
Sbjct  1102  HLGDFGLAKVLTENYDT-NTDSNTWFACSYGYIAPE  1136



>ref|XP_002869946.1| hypothetical protein ARALYDRAFT_354732 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46205.1| hypothetical protein ARALYDRAFT_354732 [Arabidopsis lyrata subsp. 
lyrata]
Length=1252

 Score =  1253 bits (3243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 727/1108 (66%), Positives = 867/1108 (78%), Gaps = 15/1108 (1%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCD--Gslkvvslnlsdsslggs  462
              + LLEVK+SFV        L+ W+  N NYCSW GV+CD  G  +V++LNL+   L GS
Sbjct  30    FQTLLEVKKSFVTTPQEDDPLRQWNSVNVNYCSWTGVTCDDTGLFRVIALNLTGLGLTGS  89

Query  463   ispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQ  642
             ISP  G   +L+HLDLSSN+L GPIP ALSNL+SLESL LFSN+L G IPSQLG L NL+
Sbjct  90    ISPWFGRFDNLIHLDLSSNNLVGPIPTALSNLTSLESLFLFSNQLTGEIPSQLGSLVNLR  149

Query  643   ALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGP  822
             +LRIGDN L G IP + GNL N+  L LASC L+G IP QLGRL ++Q+L LQ N LEG 
Sbjct  150   SLRIGDNELVGAIPETLGNLVNIQMLALASCRLTGPIPSQLGRLVRVQSLILQDNYLEGL  209

Query  823   LPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLV  1002
             +P E+ N S LT F+AA N LNG+IP ELG L  L ILNLANN+LTGEIP QLGEMS L 
Sbjct  210   IPVELGNCSDLTVFTAAENMLNGTIPAELGRLGSLEILNLANNSLTGEIPSQLGEMSQLQ  269

Query  1003  YLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGT  1182
             YL+L+ NQL G IPKSLA L NLQ+LDLS N L GE+P E  +M QL  L L +N+LSG+
Sbjct  270   YLSLMANQLQGFIPKSLADLRNLQTLDLSANNLTGEIPEEIWNMSQLLDLVLANNHLSGS  329

Query  1183  IPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQL  1362
             +PKS+CSN TNL+ L+LS T LSGEIP ELS+C+ L+QLDLSNN+L GSIPE L++L +L
Sbjct  330   LPKSICSNNTNLEQLILSGTQLSGEIPVELSKCQSLKQLDLSNNSLVGSIPEALFQLVEL  389

Query  1363  TDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSG  1542
             TDL L+NNTLEG +SPS++NLTNLQ L L+HNNL G +P+EI  L  L+++FLYEN FSG
Sbjct  390   TDLYLHNNTLEGKLSPSISNLTNLQWLVLYHNNLEGTLPKEISTLEKLEVLFLYENRFSG  449

Query  1543  EIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQL  1722
             EIP EIGNC+SL+ ID +GN F G+IP ++GRLK L  LHLR+N+L G +P SLGNCHQL
Sbjct  450   EIPKEIGNCTSLKMIDLFGNHFEGEIPPSIGRLKVLNLLHLRQNELVGGLPTSLGNCHQL  509

Query  1723  DTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSG  1902
               LDLADN L G+IP++FG+L+ L +LMLYNNSL+G+LPD L +L NLTRINLSHN  +G
Sbjct  510   KILDLADNQLLGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNG  569

Query  1903  SIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELS  2082
             +I P+C S S+LSFDVTNN F+ EIP  LGNS +LDRLRLG N+FTG+IP TLG IRELS
Sbjct  570   TIHPLCGSSSYLSFDVTNNEFEDEIPLELGNSQNLDRLRLGKNQFTGRIPWTLGKIRELS  629

Query  2083  LLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGS  2262
             LLD+S N L+G IP QL LC+KLTH+DLNNN LSGPIP WLG+L  LGELKLSSNQF  S
Sbjct  630   LLDISSNSLTGTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVES  689

Query  2263  LPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLY  2442
             LP ELFNC+KLLVLSL+ N LNG++P EIGNL +LNVLNLD NQ  GS+P  +G L KLY
Sbjct  690   LPTELFNCTKLLVLSLDGNLLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLY  749

Query  2443  ELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTG  2622
             ELRLSRN F+GEIP E+GQL+DLQS LD SYNN TG+IP +IGTLSKLE+LDLSHN LTG
Sbjct  750   ELRLSRNSFTGEIPIEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTG  809

Query  2623  EIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNK  2802
             E+P  V +M SLG LNLS N L G+L K+++ WP DSFVGN+ LCGSPL  C   GS NK
Sbjct  810   EVPGAVGDMKSLGYLNLSFNNLGGKLKKQFSRWPADSFVGNTGLCGSPLSRCNRVGSNNK  869

Query  2803  -----GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQR  2967
                     VV+ISA+SA +AI L+++  A FFK   + +++        SSSSSSSQA  
Sbjct  870   QQGLSARSVVIISAISALIAIGLMILVIALFFKQRHDFFKKVGDGSTAYSSSSSSSQATH  929

Query  2968  KPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDD  3147
             KPLF   A K DI+W+DIMEAT+NLS+EF+IGSGG   VYKAEL NGETVA+K+I  KDD
Sbjct  930   KPLFRTGASKSDIKWEDIMEATHNLSEEFMIGSGGSGKVYKAELDNGETVAVKKILWKDD  989

Query  3148  LFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQ-PAN  3324
             L  +KSF+RE+KTL RIRHRHLV+LMGYCS+K EG N+LIYEYM+NGS+WDWLH + P  
Sbjct  990   LMSNKSFSREVKTLGRIRHRHLVKLMGYCSSKSEGLNLLIYEYMKNGSIWDWLHEEKPVL  1049

Query  3325  NKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLA  3504
              K  K +DWEARL+IA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEAHLGDFGLA
Sbjct  1050  EKKTKLIDWEARLRIAVGLAQGVEYLHHDCVPPIVHRDIKSSNVLLDSNMEAHLGDFGLA  1109

Query  3505  KALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             K LT+N D+ NT+SNTWFA SYGYIAPE
Sbjct  1110  KVLTENCDT-NTDSNTWFACSYGYIAPE  1136



>ref|XP_010051801.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Eucalyptus grandis]
 gb|KCW75634.1| hypothetical protein EUGRSUZ_D00003 [Eucalyptus grandis]
Length=1258

 Score =  1252 bits (3239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 717/1106 (65%), Positives = 866/1106 (78%), Gaps = 12/1106 (1%)
 Frame = +1

Query  301   STLRVLLEVKRSF----VLQLQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsis  468
             +TLR+LLE K SF    +  L  WS  N ++C+W GVSCD   + V      +S      
Sbjct  33    TTLRILLEAKASFAGGDLGVLSDWSPSNRDFCTWTGVSCDQLQQQVVALNLSASSLSGSI  92

Query  469   pslgllthllhldlss-nhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQA  645
                      L     S N L+GPIPPALSNLSSLESLLLF+N+L G IP QLG L++L+ 
Sbjct  93    SPSLGRLRNLLHLDLSGNSLTGPIPPALSNLSSLESLLLFTNQLSGSIPPQLGSLSSLRF  152

Query  646   LRIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGP  822
             LR+GDN  LTG IP SFG L NLVTLGLASC L+G IPPQLG+L  LQNL LQ+N L GP
Sbjct  153   LRLGDNPALTGPIPPSFGGLKNLVTLGLASCSLTGPIPPQLGQLQLLQNLKLQENQLTGP  212

Query  823   LPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLV  1002
             +PPE+ N SSLT F+A+LN LNGSIP+ELG L++L +LNLANN+L+GEI   +G++S L 
Sbjct  213   IPPELGNCSSLTLFAASLNGLNGSIPRELGRLRNLELLNLANNSLSGEIDNVIGDISELH  272

Query  1003  YLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGT  1182
              LNLLGNQL G IP SLA+L  LQ+LDLS NRL G +P E GSMG+L +L L++NNLS T
Sbjct  273   SLNLLGNQLEGPIPTSLARLHKLQNLDLSLNRLTGSIPAELGSMGELVYLVLSNNNLSST  332

Query  1183  IPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQL  1362
             IP +LCSNATNL+ L L++  LSG IPP+LS CR L+QLDLSNNTL G IP ELYEL  L
Sbjct  333   IPAALCSNATNLEHLYLAQAQLSGPIPPQLSNCRALKQLDLSNNTLTGVIPIELYELVAL  392

Query  1363  TDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSG  1542
             TDL L+NN+L G IS S+ANL++LQ L+L+HN+L G +P EIGMLG+LQ+++LY+N  SG
Sbjct  393   TDLYLHNNSLAGNISTSIANLSSLQNLALYHNDLEGSLPHEIGMLGELQVLYLYDNRLSG  452

Query  1543  EIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQL  1722
             EIP EIGNCSSLQ IDF+GN F+G+IP ++GRL  L  LHLR+N+L GEIPA+LGNCHQL
Sbjct  453   EIPTEIGNCSSLQMIDFFGNHFSGRIPDSIGRLHQLNLLHLRQNELVGEIPAALGNCHQL  512

Query  1723  DTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSG  1902
               LDLADN LSG IP T G L AL +LMLYNNSL G+LPD L NL NLTRINL  N FSG
Sbjct  513   IILDLADNALSGGIPPTLGNLLALKQLMLYNNSLAGNLPDSLINLRNLTRINLFKNRFSG  572

Query  1903  SIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELS  2082
             S++ +C+S SFLSFDVT+N+F+ EIP  LGNSP L+R+RLG+NRF G +P TLG IRELS
Sbjct  573   SVSALCSSRSFLSFDVTDNSFEHEIPPQLGNSPFLERVRLGNNRFNGSLPWTLGKIRELS  632

Query  2083  LLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGS  2262
             LLDLSGN L+G +P QLSLC+KLTHLDLNNNLLSGP+P WLG LP LGELKLSSN F+G 
Sbjct  633   LLDLSGNLLTGPVPVQLSLCKKLTHLDLNNNLLSGPVPSWLGSLPQLGELKLSSNSFTGP  692

Query  2263  LPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLY  2442
             +PP+L  CSKLL LSL+ NSLNGTLP EIG+L SLNVLNLD NQL G IPS+IG LGKLY
Sbjct  693   VPPQLSECSKLLKLSLDGNSLNGTLPAEIGDLASLNVLNLDRNQLSGPIPSSIGKLGKLY  752

Query  2443  ELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTG  2622
             ELRLS N F+G+IP E+GQL++LQ++LD S+NNL+G+IPPSI  L KLE+LD+SHN L G
Sbjct  753   ELRLSENNFTGKIPVELGQLQNLQTILDLSHNNLSGQIPPSIAMLLKLEALDMSHNQLVG  812

Query  2623  EIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNK  2802
             EIP +V EMSSLG+L+ S N+L+G+L K+++ WP  +F GN HLCGSPL  C    S N+
Sbjct  813   EIPSEVGEMSSLGKLDFSYNQLQGKLGKQFSRWPAHAFQGNLHLCGSPLVPCNSFISSNQ  872

Query  2803  ----GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRK  2970
                  S VV+ISA+S   A+ LL+ G A F K  REA++R    E    SS+SSSQA R+
Sbjct  873   PRLSESAVVIISAVSTLAALALLVFGIALFLKRRREAFKRF--NEVKCVSSTSSSQAHRR  930

Query  2971  PLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDDL  3150
              LF   A K+D RW+DIMEATNNLSDEF+IGSGG   VY+AE+  GET+A+K+I  ++DL
Sbjct  931   LLFHQGAAKQDFRWEDIMEATNNLSDEFMIGSGGSGKVYRAEMPTGETLAVKKIVWREDL  990

Query  3151  FLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNK  3330
               +KSF RE+KTL R+RHRHLV+LMGYCSNK  GSN+LIYEYMENGS+WDWLH + AN+K
Sbjct  991   LSNKSFVREVKTLGRVRHRHLVKLMGYCSNKAAGSNLLIYEYMENGSLWDWLHQKSANSK  1050

Query  3331  SKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKA  3510
              ++SLDWEARL+IA+GLAQGVEYLHHDC PKI+HRDIKSSN+LLDSNMEAHLGDFGLAK+
Sbjct  1051  KQRSLDWEARLRIALGLAQGVEYLHHDCAPKIVHRDIKSSNLLLDSNMEAHLGDFGLAKS  1110

Query  3511  LTDNYDSLNTESNTWFAGSYGYIAPE  3588
             L +NY+SL+TESN+WFAGSYGYIAPE
Sbjct  1111  LVENYESLDTESNSWFAGSYGYIAPE  1136



>ref|XP_007040985.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOX96816.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=1257

 Score =  1252 bits (3239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 755/1119 (67%), Positives = 898/1119 (80%), Gaps = 22/1119 (2%)
 Frame = +1

Query  280   VRCQNTSSTLRVLLEVKRSFVLQ----LQGWSEK-NPNYCSWQGVSC------DGslkvv  426
             V CQN    L +LLEVK SF       L  WS K NPN+C+W GV+C        S+ VV
Sbjct  28    VFCQNQE--LSILLEVKSSFEEDPQNVLHDWSSKTNPNFCTWTGVTCGFSSFDSSSVHVV  85

Query  427   slnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGP  606
             SLNLS  SLGGSISPSLG L +LLHLDLSSN L+GPIP  LSNL SLESLLLFSN+L GP
Sbjct  86    SLNLSGFSLGGSISPSLGRLQNLLHLDLSSNRLTGPIPTTLSNLPSLESLLLFSNQLSGP  145

Query  607   IPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlq  786
             IP QLG LT+L+ +RIGDNGLTG IP++FGNL NLVTLGLASC L+G +PP+LG+L +++
Sbjct  146   IPPQLGSLTSLRVMRIGDNGLTGPIPSTFGNLVNLVTLGLASCNLTGPMPPELGQLARVE  205

Query  787   nlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGE  966
             NL LQ N LEGP+PPE+ N SSL  F+AALN+LNGSIP ELG LK L +LNL NN+L+GE
Sbjct  206   NLILQDNQLEGPIPPELGNCSSLNVFTAALNNLNGSIPAELGCLKGLQVLNLINNSLSGE  265

Query  967   IPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQ  1146
             IP QLGE+S LVYL+ +GN L G+IP+SLA L NLQ+LDLS N+L G +P E G M +L 
Sbjct  266   IPSQLGELSQLVYLSFMGNHLEGTIPRSLANLGNLQNLDLSLNKLTGGIPEELGQMSELV  325

Query  1147  FLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNG  1326
             FL L++NNLS  IP+++CSN +NL+ L+LSE  L GEIP EL  CR L QLDLSNNTLNG
Sbjct  326   FLVLSNNNLSCPIPRNICSNTSNLEHLILSEVQLLGEIPAELRLCRSLNQLDLSNNTLNG  385

Query  1327  SIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDL  1506
             SIP ELYEL +LTDL L+NN+L G+ISP +ANL+NLQTL+LFHNNL G +PREIGML  L
Sbjct  386   SIPVELYELLELTDLYLHNNSLVGSISPFIANLSNLQTLALFHNNLEGNLPREIGMLSKL  445

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
             +I++LYEN  SG++P EIGNCSSL+ IDF+GN+FTG+IP+T+GRLK L  LHLR+N L G
Sbjct  446   EILYLYENQLSGDLPSEIGNCSSLKMIDFFGNRFTGEIPVTIGRLKELHLLHLRQNALVG  505

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL  1866
              IPA+LGNCHQL  LDLADN LSG IPA+FGYL AL +LMLYNNS+EG+LP  L NL NL
Sbjct  506   YIPATLGNCHQLTILDLADNRLSGVIPASFGYLEALEQLMLYNNSIEGNLPTSLINLANL  565

Query  1867  TRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
             TR+NLS N  +GSIA +C+S S LSFD+TNNA D +IP  LGNSP L+RLRLG N+FTG+
Sbjct  566   TRVNLSKNKMNGSIAALCSSRSLLSFDLTNNALDGDIPPELGNSPFLERLRLGKNQFTGR  625

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             IP +LG IRELSLLDLSGN LSG IP +L LCRKL+H+DLNNN LSG +P WLG LP LG
Sbjct  626   IPGSLGKIRELSLLDLSGNMLSGPIPAELMLCRKLSHIDLNNNFLSGLVPPWLGGLPQLG  685

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             E++LSSNQF G+LP ELFNCSKLLVL L+ NSLNGTL  EIGNL SLNVLNL+ NQL G 
Sbjct  686   EIRLSSNQFFGALPRELFNCSKLLVLCLDGNSLNGTLVGEIGNLLSLNVLNLNRNQLSGP  745

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IP TIG L KLYEL+LS N F+G+IP E+GQL++LQS+LD S NNLTG+IPPSIGTLSKL
Sbjct  746   IPPTIGKLSKLYELQLSWNSFNGDIPTELGQLQNLQSILDLSNNNLTGQIPPSIGTLSKL  805

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSP  2766
             E+LDLSHN L GE+PPQ+ +MSSLG+LNLSCN+L+G+L K+ +HWP ++F GN +LCGSP
Sbjct  806   EALDLSHNQLIGEVPPQIGDMSSLGKLNLSCNKLQGKLSKQLSHWPAEAFEGNLNLCGSP  865

Query  2767  LGSCRDKGSRNKGSM-----VVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENY  2931
             L  C +  S  + S      VVVISA+S   AI LL +  A F K  RE Y +R  + N 
Sbjct  866   LDRCNNLPSSKQQSALSETSVVVISAISTLAAIALLALIVATFLKQRRE-YAKRASEVN-  923

Query  2932  AsssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGE  3111
              + SSSSSQA+R+ LF N A K+D +W+DIM+AT +LSDEF+IGSGG  TVYKAEL  GE
Sbjct  924   CTYSSSSSQARRRLLFQNGAAKQDYKWEDIMQATKHLSDEFVIGSGGSGTVYKAELPKGE  983

Query  3112  TVAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGS  3291
             TVA+K+I  K+DL L++SF REIKTL RIRHRHLV+LMGYC N+  G N+LIYEYMENGS
Sbjct  984   TVAVKKISWKEDLLLNRSFTREIKTLGRIRHRHLVKLMGYCRNRVAGLNLLIYEYMENGS  1043

Query  3292  VWDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSN  3471
             VWDWLH +P N K KKS+DWEAR++IA+GLAQGVEYLHHDCVPKI+HRDIKSSNVLLDSN
Sbjct  1044  VWDWLHRKPVNIK-KKSVDWEARIRIAVGLAQGVEYLHHDCVPKIVHRDIKSSNVLLDSN  1102

Query  3472  MEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             M+AHLGDFGLAK+L +N+DS NTESN+WFAGSYGYIAPE
Sbjct  1103  MDAHLGDFGLAKSLAENHDS-NTESNSWFAGSYGYIAPE  1140



>emb|CAA18239.1| leucine rich repeat-like protein [Arabidopsis thaliana]
 emb|CAB79014.1| leucine rich repeat-like protein [Arabidopsis thaliana]
Length=1232

 Score =  1251 bits (3238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 725/1103 (66%), Positives = 868/1103 (79%), Gaps = 22/1103 (2%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCD--Gslkvvslnlsdsslggs  462
             L+ LLEVK+S V        L+ W+  N NYCSW GV+CD  G  +V++LNL+   L GS
Sbjct  27    LQTLLEVKKSLVTNPQEDDPLRQWNSDNINYCSWTGVTCDNTGLFRVIALNLTGLGLTGS  86

Query  463   ispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQ  642
             ISP  G   +L+HLDLSSN+L GPIP ALSNL+SLESL LFSN+L G IPSQLG L N++
Sbjct  87    ISPWFGRFDNLIHLDLSSNNLVGPIPTALSNLTSLESLFLFSNQLTGEIPSQLGSLVNIR  146

Query  643   ALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGP  822
             +LRIGDN L G IP + GNL NL  L LASC L+G IP QLGRL ++Q+L LQ N LEGP
Sbjct  147   SLRIGDNELVGDIPETLGNLVNLQMLALASCRLTGPIPSQLGRLVRVQSLILQDNYLEGP  206

Query  823   LPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLV  1002
             +P E+ N S LT F+AA N LNG+IP ELG L++L ILNLANN+LTGEIP QLGEMS L 
Sbjct  207   IPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANNSLTGEIPSQLGEMSQLQ  266

Query  1003  YLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGT  1182
             YL+L+ NQL G IPKSLA L NLQ+LDLS N L GE+P EF +M QL  L L +N+LSG+
Sbjct  267   YLSLMANQLQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGS  326

Query  1183  IPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQL  1362
             +PKS+CSN TNL+ L+LS T LSGEIP ELS+C+ L+QLDLSNN+L GSIPE L+EL +L
Sbjct  327   LPKSICSNNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNSLAGSIPEALFELVEL  386

Query  1363  TDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSG  1542
             TDL L+NNTLEGT+SPS++NLTNLQ L L+HNNL G++P+EI  L  L+++FLYEN FSG
Sbjct  387   TDLYLHNNTLEGTLSPSISNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSG  446

Query  1543  EIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQL  1722
             EIP EIGNC+SL+ ID +GN F G+IP ++GRLK L  LHLR+N+L G +PASLGNCHQL
Sbjct  447   EIPQEIGNCTSLKMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQL  506

Query  1723  DTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSG  1902
             + LDLADN LSG+IP++FG+L+ L +LMLYNNSL+G+LPD L +L NLTRINLSHN  +G
Sbjct  507   NILDLADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNG  566

Query  1903  SIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELS  2082
             +I P+C S S+LSFDVTNN F+ EIP  LGNS +LDRLRLG N+ TGKIP TLG IRELS
Sbjct  567   TIHPLCGSSSYLSFDVTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELS  626

Query  2083  LLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGS  2262
             LLD+S N L+G IP QL LC+KLTH+DLNNN LSGPIP WLG+L  LGELKLSSNQF  S
Sbjct  627   LLDMSSNALTGTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVES  686

Query  2263  LPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLY  2442
             LP ELFNC+KLLVLSL+ NSLNG++P EIGNL +LNVLNLD NQ  GS+P  +G L KLY
Sbjct  687   LPTELFNCTKLLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLY  746

Query  2443  ELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTG  2622
             ELRLSRN  +GEIP E+GQL+DLQS LD SYNN TG+IP +IGTLSKLE+LDLSHN LTG
Sbjct  747   ELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTG  806

Query  2623  EIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNK  2802
             E+P  V +M SLG LN+S N L G+L K+++ WP DSF+GN+ LCGSPL  C        
Sbjct  807   EVPGSVGDMKSLGYLNVSFNNLGGKLKKQFSRWPADSFLGNTGLCGSPLSRCNR------  860

Query  2803  GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFG  2982
                   +  +SA  AI L+++  A FFK   + +++        +SSSSSSQA  KPLF 
Sbjct  861   ------VRTISALTAIGLMILVIALFFKQRHDFFKKVGHGSTAYTSSSSSSQATHKPLFR  914

Query  2983  NAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDDLFLDK  3162
             N A K DIRW+DIMEAT+NLS+EF+IGSGG   VYKAEL NGETVA+K+I  KDDL  +K
Sbjct  915   NGASKSDIRWEDIMEATHNLSEEFMIGSGGSGKVYKAELENGETVAVKKILWKDDLMSNK  974

Query  3163  SFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLH-NQPANNKSKK  3339
             SF+RE+KTL RIRHRHLV+LMGYCS+K EG N+LIYEYM+NGS+WDWLH ++P   K KK
Sbjct  975   SFSREVKTLGRIRHRHLVKLMGYCSSKSEGLNLLIYEYMKNGSIWDWLHEDKPVLEKKKK  1034

Query  3340  SLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTD  3519
              LDWEARL+IA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEAHLGDFGLAK LT+
Sbjct  1035  LLDWEARLRIAVGLAQGVEYLHHDCVPPIVHRDIKSSNVLLDSNMEAHLGDFGLAKVLTE  1094

Query  3520  NYDSLNTESNTWFAGSYGYIAPE  3588
             N D+ NT+SNTWFA SYGYIAPE
Sbjct  1095  NCDT-NTDSNTWFACSYGYIAPE  1116



>ref|XP_009368631.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
Length=1255

 Score =  1250 bits (3235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 750/1119 (67%), Positives = 905/1119 (81%), Gaps = 21/1119 (2%)
 Frame = +1

Query  274   GYVRCQ---NTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-----DGsl  417
             G++ C+   + ++TL VLLEVKR+ V      L GWSE +PN+C+W+GV+C     D S+
Sbjct  22    GFMFCEGKLDGNTTLSVLLEVKRAIVRDPENVLHGWSESDPNFCTWRGVTCSLDSLDNSV  81

Query  418   kvvslnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrl  597
             +VV LNLS SSL GSISPSLG L +LLHLDLSSN LSGPIPP LSNL+SLESLLLFSN+L
Sbjct  82    QVVGLNLSGSSLAGSISPSLGSLQNLLHLDLSSNRLSGPIPPTLSNLTSLESLLLFSNQL  141

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
             +G IP+ LG LT+L+ +RIG+NGLTG IP +FGNL NLVTLGLASC L+G IPPQLGRL 
Sbjct  142   IGDIPTHLGSLTSLRVMRIGNNGLTGSIPATFGNLVNLVTLGLASCSLNGPIPPQLGRLG  201

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
              L+NL LQ N LEG +P  + N SSLT F+AA N+LNG+IP ELG L +L +LNL NN+L
Sbjct  202   LLENLILQLNQLEGLIP--VGNCSSLTIFTAANNTLNGTIPAELGRLGNLQLLNLGNNSL  259

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             T +IP QLGE+S L Y+N +GNQL G IPKS+++L NLQSLDLS N+L G +P EFG+M 
Sbjct  260   TNQIPSQLGELSQLGYMNFMGNQLEGPIPKSISQLGNLQSLDLSVNKLTGGIPAEFGTMS  319

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
             QL  L L++N+LSG IP++LCSN T+L+LLM+S +GL GEIP ELSQCR ++QLDLSNN 
Sbjct  320   QLATLVLSNNSLSGVIPRNLCSN-TSLELLMISGSGLVGEIPAELSQCRSMKQLDLSNNL  378

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
             +NGSIP+E+Y L +LTDL+L+NN+L G+ISP ++NL+NLQ+L L+HNN  G +P EIGML
Sbjct  379   INGSIPDEIYGLVELTDLLLHNNSLVGSISPLISNLSNLQSLILYHNNFVGPLPSEIGML  438

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
             G+L+I++LY+N  SGEIP+EIGNCSSLQ IDF+GN+F+GKIP+T+GRLK+L  LH+R+N+
Sbjct  439   GELEILYLYDNQLSGEIPMEIGNCSSLQMIDFFGNRFSGKIPVTIGRLKNLNLLHIRQNE  498

Query  1678  LSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNL  1857
             L G+IPA+LGNCH+L  LDLADN LSG IP TFG L A+ + MLYNNSLEG+LPD L N+
Sbjct  499   LVGQIPATLGNCHKLTILDLADNRLSGGIPITFGSLGAMEQFMLYNNSLEGNLPDTLANM  558

Query  1858  GNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRF  2037
              NLTR+NLS N  +GSIA +C+S SFLSFDVT+NAFD EIPS LGNS SL RLRLG+N+F
Sbjct  559   VNLTRVNLSGNKLNGSIAALCSSSSFLSFDVTDNAFDHEIPSQLGNSKSLQRLRLGNNQF  618

Query  2038  TGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlp  2217
             TGKIP TLG I ELSLLD+SGN L+G IP +LS C+KL+H+DLN+NLLSG +P W G LP
Sbjct  619   TGKIPHTLGNISELSLLDVSGNSLTGSIPDELSSCKKLSHIDLNDNLLSGTVPRWFGGLP  678

Query  2218  llgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQL  2397
              LGELKLSSN+F+GSLP ELFNCSKLLVLS+  NSLNG LP EIGNL+SLNVLNLD N  
Sbjct  679   QLGELKLSSNRFTGSLPSELFNCSKLLVLSMSENSLNGILPAEIGNLESLNVLNLDHNHF  738

Query  2398  CGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTL  2577
              G IP  IG LGKLYELRLS+NRF G++P E+GQL++LQS+LD SYNNL+G+IP SIGTL
Sbjct  739   SGPIPPAIGKLGKLYELRLSQNRFDGDLPYELGQLQNLQSILDLSYNNLSGQIPASIGTL  798

Query  2578  SKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLC  2757
             SKLE LDLSHN L GE+P  V  M SLG+LNLS N L+G+L K+ +HWP ++F GN HLC
Sbjct  799   SKLEVLDLSHNQLIGEVPSPVGGMISLGKLNLSYNNLQGKLSKQLSHWPAEAFAGNLHLC  858

Query  2758  GSPLGSC--RDKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENY  2931
             GSPLGSC  R + S      VV I+A+    AI LL+ GAA   KH +EA+  ++  E  
Sbjct  859   GSPLGSCIGRKRQSDPTELAVVAIAAICTLSAIALLIFGAASLLKHKQEAF--QKASEMN  916

Query  2932  AsssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGE  3111
                SSSSS AQR+ LF N + K DI+W DIM+AT NLS+EF+IGSGG   +YKAEL N E
Sbjct  917   FLCSSSSSHAQRRLLFSNGSVKPDIKWKDIMDATKNLSNEFVIGSGGSGVIYKAELRNRE  976

Query  3112  TVAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGS  3291
             TVA+K+I  KDDL  +K+F REIKTL RIRHRHLV+LMGYCSNKG GSN+LIYEYMENGS
Sbjct  977   TVAVKKILYKDDLMANKTFTREIKTLGRIRHRHLVKLMGYCSNKGAGSNLLIYEYMENGS  1036

Query  3292  VWDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSN  3471
             V+DW+H Q  +NK KKSLDWEARLKIA+GLAQGVEYLHHDCVPKIIHRDIKSSN+LLDSN
Sbjct  1037  VYDWIH-QEQSNKKKKSLDWEARLKIAVGLAQGVEYLHHDCVPKIIHRDIKSSNILLDSN  1095

Query  3472  MEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             MEAHLGDFGLAK L +NY+S NTESNTWFAGSYGYIAPE
Sbjct  1096  MEAHLGDFGLAKTLNENYES-NTESNTWFAGSYGYIAPE  1133



>ref|XP_006413897.1| hypothetical protein EUTSA_v10027256mg, partial [Eutrema salsugineum]
 gb|ESQ55350.1| hypothetical protein EUTSA_v10027256mg, partial [Eutrema salsugineum]
Length=1251

 Score =  1246 bits (3223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 729/1111 (66%), Positives = 875/1111 (79%), Gaps = 15/1111 (1%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQLQ------GWSEKNPNYCSWQGVSCD--Gslkvvslnlsdssl  453
             +  L+ LLEVK+SFV   Q       W+  N N+CSW  V+CD  G  +VV+LNLS   L
Sbjct  27    TQDLQNLLEVKKSFVTNPQENDLLPQWNSLNINFCSWTSVTCDDTGLFRVVALNLSGLGL  86

Query  454   ggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLT  633
              GSISPS G   +L+HLDLSSN+L+GPIP ALSNLSSLESL LFSN+L G IPSQLG L 
Sbjct  87    TGSISPSFGRFDNLIHLDLSSNNLAGPIPTALSNLSSLESLFLFSNQLTGEIPSQLGSLL  146

Query  634   NLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnll  813
             NL++LRIGDN L G IP + GNL NL  L LASC L+G IP QLGRL ++++L LQ N L
Sbjct  147   NLRSLRIGDNDLVGAIPETLGNLVNLQMLALASCRLTGPIPSQLGRLVRVRSLILQDNNL  206

Query  814   EGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMS  993
             EGP+P  + N S LT  +AA N LNG+IP+ELG L++L ILNLA+N+L+GEIP QLGE+S
Sbjct  207   EGPIPANLGNCSDLTVLTAAENRLNGTIPEELGRLENLEILNLASNSLSGEIPSQLGELS  266

Query  994   SLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNL  1173
              L YLNL+GN L G IPK+L  L NLQ+LDLS N L GE+P E  +M QL  +AL +N L
Sbjct  267   QLEYLNLMGNSLQGLIPKALVNLQNLQTLDLSANNLTGEIPEELWNMSQLLDMALANNFL  326

Query  1174  SGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYEL  1353
             SG++PKS+CSN TNL+ L+LS T LSGEIP E+S+C+ L+QLDLSNN+L+GSIPE+L++L
Sbjct  327   SGSLPKSICSNNTNLEQLVLSGTRLSGEIPVEISKCKSLKQLDLSNNSLSGSIPEDLFQL  386

Query  1354  TQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENH  1533
              +LTDL L+NNTLEG +SPSV+NLTNLQ L L+HNNL G+VP+EI +L  L+++FLYEN 
Sbjct  387   VELTDLYLHNNTLEGKLSPSVSNLTNLQWLVLYHNNLEGKVPKEISLLKKLEVLFLYENR  446

Query  1534  FSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNC  1713
             FSGEIP EIGNC++L+ ID +GN F G+IP ++GRLK L  LHLR+N+L G+IPA+LGNC
Sbjct  447   FSGEIPKEIGNCTNLKMIDLFGNHFKGEIPPSIGRLKALNLLHLRQNELVGDIPATLGNC  506

Query  1714  HQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNN  1893
             HQL  LDLADN LSG+IP++FG+L  L + MLYNNSL G+LPD L NL NLTRINLSHN 
Sbjct  507   HQLKILDLADNQLSGSIPSSFGFLNGLEQFMLYNNSLHGNLPDSLINLKNLTRINLSHNR  566

Query  1894  FSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIR  2073
              +G+I P+C S SFLSFDVTNN F+ EIP  LGNSP+LDRLRLG N+FTG+IP TLG IR
Sbjct  567   LNGTILPLCGSSSFLSFDVTNNEFEDEIPLQLGNSPNLDRLRLGKNQFTGRIPWTLGKIR  626

Query  2074  ELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQF  2253
             ELSLLD+S N L+G IP QL LC+KLTH+DLNNN LSGPIP WLG+L  LGELKLSSNQF
Sbjct  627   ELSLLDISSNSLTGTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQF  686

Query  2254  SGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLG  2433
              GSLP EL NC+KLLVLSL+ N LNG++P EIGNL +LNVL+LD NQL GS+P  +G L 
Sbjct  687   DGSLPTELCNCTKLLVLSLDGNFLNGSIPQEIGNLGALNVLSLDKNQLSGSLPQAMGKLS  746

Query  2434  KLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHND  2613
             KLYELRLSRN  +GEIP E+GQL+DLQS LD SYNN TG+IP +IGTL KLE+LDLSHN 
Sbjct  747   KLYELRLSRNSLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLLKLETLDLSHNQ  806

Query  2614  LTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGS  2793
             LTGE+P  V +M SLG LNLS N  EG+L K+++ WP DSF+GN+ LCGSPL  C   G 
Sbjct  807   LTGEVPGAVGDMKSLGYLNLSFNNFEGKLKKQFSRWPADSFIGNTGLCGSPLVHCNRAGR  866

Query  2794  RNK-----GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQ  2958
              N+        VV+ISA+SA  AI L+++  A FFK   + +++ R      SSSSSSSQ
Sbjct  867   ENRQQGLSARSVVIISAISALAAIALMILVIALFFKQRHDFFKKVRDGSTAYSSSSSSSQ  926

Query  2959  AQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPR  3138
             A  KPLF   A K DIRW+DIMEATN+LS+EF+IGSGG   +YKAEL +GETVA+K+I  
Sbjct  927   ATHKPLFRTGASKSDIRWEDIMEATNSLSEEFMIGSGGSGKIYKAELEHGETVAVKKILW  986

Query  3139  KDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLH-NQ  3315
             KDDL  +KSF+RE+KTL RIRHRHLV+LMGYCS+K EG N+LIYEYMENGSVWDW H ++
Sbjct  987   KDDLMSNKSFSREVKTLGRIRHRHLVKLMGYCSSKSEGVNLLIYEYMENGSVWDWFHEDK  1046

Query  3316  PANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDF  3495
             P     KK LDWEARL+IA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEAHLGDF
Sbjct  1047  PVIESKKKLLDWEARLRIAVGLAQGVEYLHHDCVPPIVHRDIKSSNVLLDSNMEAHLGDF  1106

Query  3496  GLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             GLAK LT+NYD+ NTESNTWFAGSYGYIAPE
Sbjct  1107  GLAKVLTENYDT-NTESNTWFAGSYGYIAPE  1136



>ref|XP_003524132.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=1271

 Score =  1244 bits (3219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 746/1122 (66%), Positives = 895/1122 (80%), Gaps = 26/1122 (2%)
 Frame = +1

Query  292   NTSSTLRVLLEVKRSFVLQLQG----WSEKNPNYCSWQGVSC-----------DGslkvv  426
             ++ STLRVLLEVK+SFV   Q     WSE N +YCSW+GVSC           D    VV
Sbjct  31    DSESTLRVLLEVKKSFVEDPQNVLGDWSEDNTDYCSWRGVSCELNSNSNTLDSDSVQVVV  90

Query  427   slnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGP  606
             +LNLSDSSL GSISPSLG L +LLHLDLSSN L GPIPP LSNL+SLESLLLFSN+L G 
Sbjct  91    ALNLSDSSLTGSISPSLGRLQNLLHLDLSSNSLMGPIPPNLSNLTSLESLLLFSNQLTGH  150

Query  607   IPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlq  786
             IP++ G LT+L+ +R+GDN LTG IP S GNL NLV LGLASC ++G IP QLG+L+ L+
Sbjct  151   IPTEFGSLTSLRVMRLGDNALTGTIPASLGNLVNLVNLGLASCGITGSIPSQLGQLSLLE  210

Query  787   nlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGE  966
             NL LQ N L GP+P E+ N SSLT F+AA N LNGSIP ELG L +L ILNLANN+L+ +
Sbjct  211   NLILQYNELMGPIPTELGNCSSLTVFTAASNKLNGSIPSELGRLGNLQILNLANNSLSWK  270

Query  967   IPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQ  1146
             IP QL +MS LVY+N +GNQL G+IP SLA+L NLQ+LDLS N+L+G +P E G+MG L 
Sbjct  271   IPSQLSKMSQLVYMNFMGNQLEGAIPPSLAQLGNLQNLDLSMNKLSGGIPEELGNMGDLA  330

Query  1147  FLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNG  1326
             +L L+ NNL+  IP+++CSNAT+L+ LMLSE+GL GEIP ELSQC+ L+QLDLSNN LNG
Sbjct  331   YLVLSGNNLNCVIPRTICSNATSLEHLMLSESGLHGEIPAELSQCQQLKQLDLSNNALNG  390

Query  1327  SIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDL  1506
             SIP ELY L  LTDL+LNNNTL G+ISP + NL+ LQTL+LFHNNL G +PREIGMLG L
Sbjct  391   SIPLELYGLLGLTDLLLNNNTLVGSISPFIGNLSGLQTLALFHNNLEGSLPREIGMLGKL  450

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
             +I++LY+N  SG IP+EIGNCSSLQ +DF+GN F+G+IPIT+GRLK L FLHLR+N+L G
Sbjct  451   EILYLYDNQLSGAIPMEIGNCSSLQMVDFFGNHFSGEIPITIGRLKELNFLHLRQNELVG  510

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL  1866
             EIP++LG+CH+L+ LDLADN LSGAIP TF +L AL +LMLYNNSLEG+LP  L N+ NL
Sbjct  511   EIPSTLGHCHKLNILDLADNQLSGAIPETFEFLEALQQLMLYNNSLEGNLPHQLINVANL  570

Query  1867  TRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
             TR+NLS N  +GSIA +C+S SFLSFDVT+N FD EIPS +GNSPSL RLRLG+N+F+GK
Sbjct  571   TRVNLSKNRLNGSIAALCSSQSFLSFDVTDNEFDGEIPSQMGNSPSLQRLRLGNNKFSGK  630

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             IP TLG I ELSLLDLSGN L+G IP +LSLC KL ++DLN+NLL G IP WL  LP LG
Sbjct  631   IPRTLGKILELSLLDLSGNSLTGPIPAELSLCNKLAYIDLNSNLLFGQIPSWLENLPQLG  690

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             ELKLSSN FSG LP  LF CSKLLVLSL +NSLNG+LP  IG+L  LNVL LD N+  G 
Sbjct  691   ELKLSSNNFSGPLPLGLFKCSKLLVLSLNDNSLNGSLPSNIGDLAYLNVLRLDHNKFSGP  750

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IP  IG L KLYELRLSRN F GE+P E+G+L++LQ +LD SYNNL+G+IPPS+GTLSKL
Sbjct  751   IPPEIGKLSKLYELRLSRNSFHGEMPAEIGKLQNLQIILDLSYNNLSGQIPPSVGTLSKL  810

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSP  2766
             E+LDLSHN LTGE+PP V EMSSLG+L+LS N L+G+LDK+++ W  ++F GN HLCGSP
Sbjct  811   EALDLSHNQLTGEVPPHVGEMSSLGKLDLSYNNLQGKLDKQFSRWSDEAFEGNLHLCGSP  870

Query  2767  LGSC-RDKGSRNKG---SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYA  2934
             L  C RD  S + G   S V +IS+LS T+A+I LL+ A   F  N++ + R+  + NY 
Sbjct  871   LERCRRDDASGSAGLNESSVAIISSLS-TLAVIALLIVAVRIFSKNKQEFCRKGSEVNYV  929

Query  2935  sssssssQAQRKPLFG-NAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGE  3111
               SSSSSQAQR+PLF  NAA KRD RW+ IM+ATNNLSD+F+IGSGG   +YKAEL  GE
Sbjct  930   -YSSSSSQAQRRPLFQLNAAGKRDFRWEHIMDATNNLSDDFMIGSGGSGKIYKAELATGE  988

Query  3112  TVAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGE--GSNVLIYEYMEN  3285
             TVA+K+I  KD+  L+KSF RE+KTL RIRHRHLV+L+GYC+N+ +  G N+LIYEYMEN
Sbjct  989   TVAVKKISSKDEFLLNKSFLREVKTLGRIRHRHLVKLIGYCTNRNKEAGWNLLIYEYMEN  1048

Query  3286  GSVWDWLHNQPAN-NKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLL  3462
             GSVWDWLH +PA  +K K+ +DWE R KIA+GLAQGVEYLHHDCVP+IIHRDIKSSNVLL
Sbjct  1049  GSVWDWLHGKPAKASKVKRRIDWETRFKIAVGLAQGVEYLHHDCVPRIIHRDIKSSNVLL  1108

Query  3463  DSNMEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             DS MEAHLGDFGLAKALT+NYDS NTESN+WFAGSYGYIAPE
Sbjct  1109  DSKMEAHLGDFGLAKALTENYDS-NTESNSWFAGSYGYIAPE  1149



>ref|XP_009133495.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Brassica rapa]
Length=1256

 Score =  1230 bits (3182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 727/1111 (65%), Positives = 870/1111 (78%), Gaps = 18/1111 (2%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCD--Gslkvvslnlsdsslggs  462
             L  LLE K+SFV        L  W+  N NYCSW GV+CD  G  +VV+LNLS   L GS
Sbjct  31    LHNLLEAKKSFVTNPEEDDPLPQWNSVNINYCSWTGVTCDETGLFRVVALNLSGLGLTGS  90

Query  463   ispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQ  642
             ISPS G   +L+HLDLSSN+L+GPIP ALSNLSSLESL LFSN+L G IP QLG L NL+
Sbjct  91    ISPSFGRFDNLIHLDLSSNNLAGPIPTALSNLSSLESLFLFSNQLTGEIPPQLGSLFNLR  150

Query  643   ALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGP  822
             +LRIGDN L G IP + G+L NL  L LASC L+G IP QLGRL ++Q+L LQ N LEGP
Sbjct  151   SLRIGDNELVGTIPETLGSLVNLQMLALASCRLTGPIPSQLGRLARVQSLILQDNQLEGP  210

Query  823   LPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLV  1002
             +P E+AN S LT F+AA NSLNG+IP ELG L++L ILNLA+N L+GEIP QLGE+S L 
Sbjct  211   IPAELANCSDLTVFAAAANSLNGTIPAELGRLENLEILNLASNGLSGEIPSQLGELSQLE  270

Query  1003  YLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGT  1182
             YLNL+ NQL G +PK+LA L NLQ+LDLS N L GE+P E  +M QL  LAL +N  SG+
Sbjct  271   YLNLMENQLQGPVPKTLANLKNLQTLDLSANNLTGEIPEEIWNMSQLLDLALANNGFSGS  330

Query  1183  IPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQL  1362
             +P+S+CSN TNL+ L+LS T LSGE+P E+S+C+ L+QLDLSNN+L GSIPE L++L +L
Sbjct  331   LPRSICSNNTNLEQLVLSGTQLSGEVPAEISRCQSLKQLDLSNNSLTGSIPEALFQLVEL  390

Query  1363  TDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSG  1542
             TDL L+NNTLEG +SPS++NLTNLQ L L+HNNL G +P EI  L  L+++FLYEN FSG
Sbjct  391   TDLYLHNNTLEGKLSPSISNLTNLQWLVLYHNNLDGTLPNEIAALKKLEVLFLYENRFSG  450

Query  1543  EIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQL  1722
             EIP EIGNC+SLQ ID +GN F G+IP ++G LK L  LHLR+N+  G +PA+LGNCHQL
Sbjct  451   EIPKEIGNCTSLQMIDLFGNHFEGEIPSSIGALKELNLLHLRQNEFVGGLPATLGNCHQL  510

Query  1723  DTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSG  1902
               LDLADN LSG+IP+++G+L+ L + MLYNNSL+G LPD L NL NLTRINLSHN  +G
Sbjct  511   KILDLADNKLSGSIPSSYGFLKGLEQFMLYNNSLQGSLPDSLTNLKNLTRINLSHNKLNG  570

Query  1903  SIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELS  2082
             +I P+C S SFLSFDVTNN F+ EIP  LGNSP+LDRLRLG N+FTG+IP T G IRELS
Sbjct  571   TILPLCGSTSFLSFDVTNNEFEDEIPLQLGNSPNLDRLRLGKNQFTGRIPWTFGKIRELS  630

Query  2083  LLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGS  2262
             LLD+S N L+G IP QL LC+KLTH+DLNNN LSGPIP WLG+L  LGELKLSSNQF GS
Sbjct  631   LLDISSNSLTGTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFDGS  690

Query  2263  LPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLY  2442
             LP ELFNC+KLLVLSL+ N LNG++P EIGNL +LNVLNLD NQ  GS+P  IG L KLY
Sbjct  691   LPTELFNCTKLLVLSLDGNFLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQGIGKLSKLY  750

Query  2443  ELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTG  2622
             ELRLSRN  +GEIP E+GQL+DLQS LD SYNN TG++P +IGTL+KLE+LDLSHN LTG
Sbjct  751   ELRLSRNILAGEIPLEIGQLQDLQSALDLSYNNFTGDVPSTIGTLTKLETLDLSHNQLTG  810

Query  2623  EIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNK  2802
             E+P  V +M SLG LNLS N   G+L K+++ WP DSF+GN+ LCGSPL  C   G  NK
Sbjct  811   EVPGAVGDMKSLGYLNLSFNNFRGKLKKQFSRWPADSFIGNTGLCGSPLSRCNRSGRDNK  870

Query  2803  GSM------VVVISALSATVAIILLLMGAAFFFKHNREAYRR-RRGKENYAsssssssQA  2961
                      VV ISA+SA  AI L+++  A FFK   + +++ R G   Y+SSSSSSSQA
Sbjct  871   QQQGLSPRSVVTISAISALAAIALMILVIALFFKQRHDFFKKVRDGSTAYSSSSSSSSQA  930

Query  2962  QRKPLFGN-AAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPR  3138
               KPLF   A+ K DI+WDDIM+AT+NLS+EF+IGSGG   +YKAEL +G+TVA+K+I  
Sbjct  931   THKPLFRTGASSKSDIKWDDIMDATHNLSEEFMIGSGGSGKIYKAELESGQTVAVKKILW  990

Query  3139  KDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHN-Q  3315
             KDDL  +KSF+RE+KTL RI+HRHLV+LMGYCS+K EG N+LIYEYMENGSVWDW H+ +
Sbjct  991   KDDLMSNKSFSREVKTLGRIKHRHLVKLMGYCSSKSEGLNLLIYEYMENGSVWDWFHDEK  1050

Query  3316  PANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDF  3495
             P   K KK LDWEARL+IA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEAHLGDF
Sbjct  1051  PEVEKKKKVLDWEARLRIAVGLAQGVEYLHHDCVPPILHRDIKSSNVLLDSNMEAHLGDF  1110

Query  3496  GLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             GLAK LT+NYD+ NTESNTWFAGSYGYIAPE
Sbjct  1111  GLAKVLTENYDT-NTESNTWFAGSYGYIAPE  1140



>ref|XP_007158852.1| hypothetical protein PHAVU_002G187300g [Phaseolus vulgaris]
 gb|ESW30846.1| hypothetical protein PHAVU_002G187300g [Phaseolus vulgaris]
Length=1269

 Score =  1228 bits (3178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 728/1121 (65%), Positives = 875/1121 (78%), Gaps = 29/1121 (3%)
 Frame = +1

Query  304   TLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-------------DGslkvvsl  432
             T RVLLEVK+SFV      L  WSE N +YCSW+GVSC             DG    V  
Sbjct  33    TTRVLLEVKKSFVQDPRNVLSDWSEDNIDYCSWRGVSCELNSDSNSISNSLDGDSMQVVG  92

Query  433   nlsdsslggsisp-slgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPI  609
                  S        SLG L +LLHLDLSSN L+GPIPP LSNL+SLESLLLFSN+L G I
Sbjct  93    LNLSDSSLTGSVSPSLGRLKNLLHLDLSSNSLTGPIPPNLSNLTSLESLLLFSNQLTGHI  152

Query  610   PSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqn  789
             P + G L +L+ +R+GDN LTG IP S  NL NLV LGLASC L+G IP QLG+L  ++N
Sbjct  153   PKEFGSLKSLRVMRLGDNALTGTIPASLANLNNLVNLGLASCGLTGSIPSQLGQLKLMEN  212

Query  790   lnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEI  969
             L LQ N L GP+P E+ N SSLT F+AA N LNGSIP ELG L +L ILN ANN+++G+I
Sbjct  213   LILQDNELMGPIPTELGNCSSLTIFTAANNKLNGSIPSELGRLSNLQILNFANNSISGKI  272

Query  970   PGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQF  1149
             P QLG MS LVYLN + NQL G+IP SLA+L NLQ+LD S N L+G +P E G++G+L +
Sbjct  273   PSQLGNMSQLVYLNFMENQLEGTIPPSLAQLGNLQNLDFSMNNLSGGIPEELGNLGELAY  332

Query  1150  LALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGS  1329
             L L+ NNL+G IP+++CSNAT+L+ LMLSE+GL GEIP ELSQC+ L QLDLSNN LNGS
Sbjct  333   LVLSGNNLNGVIPRTICSNATSLEHLMLSESGLHGEIPAELSQCQQLMQLDLSNNALNGS  392

Query  1330  IPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQ  1509
             IP ELY L +LTDL LNNN+L G+ISP + NL+ LQTL+LFHNNL G +PREIGMLG L+
Sbjct  393   IPLELYGLLRLTDLRLNNNSLVGSISPFIGNLSGLQTLALFHNNLEGVLPREIGMLGKLE  452

Query  1510  IIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGE  1689
             I++LY+N  SG IPV IGNCSSLQ IDF+GN+F+G+IP+T+GRLK L FLHLR+N+L GE
Sbjct  453   ILYLYDNQLSGAIPVGIGNCSSLQMIDFFGNRFSGEIPVTIGRLKELNFLHLRQNELVGE  512

Query  1690  IPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLT  1869
             IPA+LGNCH+L+ LDLADN LSGAIPATFG+L+ L +LM+YNNSLEG+LP  L  + NLT
Sbjct  513   IPATLGNCHKLNILDLADNQLSGAIPATFGFLKELQKLMIYNNSLEGNLPHQLITVANLT  572

Query  1870  RINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKI  2049
             R+NLS N  +GSIA +C+S SFLSFDVT+N FD EIPS +GNSPSL+RLRLGSN+F+G+I
Sbjct  573   RVNLSKNRLNGSIAALCSSQSFLSFDVTDNEFDGEIPSQMGNSPSLERLRLGSNKFSGEI  632

Query  2050  PMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllge  2229
             P TLG IRELSLLDLSGN L+G IP +LSLC KL ++DLN+N L G IP WLG L  LGE
Sbjct  633   PRTLGKIRELSLLDLSGNSLTGPIPAELSLCNKLAYIDLNSNFLFGQIPSWLGSLSELGE  692

Query  2230  lklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSI  2409
             LKLSSN FSG LP  LF C KLLVLSL +NSLNG+LP +IG L +LNVL LD N+  G I
Sbjct  693   LKLSSNNFSGPLPLGLFKCFKLLVLSLNDNSLNGSLPSDIGELANLNVLRLDHNKFSGPI  752

Query  2410  PSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLE  2589
             P  IG L KLYELRLSRN F GE+P E+G+L++LQ +LD SYNNL+G IPPS+GT SKLE
Sbjct  753   PLEIGKLIKLYELRLSRNGFHGEMPAEIGKLQNLQIILDLSYNNLSGLIPPSLGTQSKLE  812

Query  2590  SLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPL  2769
             +LDLSHN LTGE+PPQ+ EMSSLG+L+LS N L+G+LDK+++ WP  +F GN HLCGSPL
Sbjct  813   ALDLSHNRLTGEVPPQIGEMSSLGKLDLSYNNLQGKLDKQFSRWPDQAFEGNLHLCGSPL  872

Query  2770  GSC-RDKGSRNKG---SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAs  2937
              SC R+  S N G   S VV+IS+LS   AI LL++    F K N++ + R+  + NY  
Sbjct  873   ESCHRNDDSGNAGLNESTVVIISSLSTIAAIALLILAVRIFSK-NKQEFCRKASEVNYV-  930

Query  2938  ssssssQAQRKPLFG-NAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGET  3114
              SSSSSQAQR+PLF  NAA  RD+RW+DIM+ATNNLS++F+IGSGG   +YKAEL +GET
Sbjct  931   YSSSSSQAQRRPLFQLNAAGNRDLRWEDIMDATNNLSEDFMIGSGGSGKIYKAELASGET  990

Query  3115  VAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGE--GSNVLIYEYMENG  3288
             VA+K+I  KD+  L+KSF RE+KTL RIRHRHLV+L+GYCSN+ +  G N+LIYEYMENG
Sbjct  991   VAVKKISSKDEFLLNKSFIREVKTLGRIRHRHLVKLIGYCSNRNKEAGWNLLIYEYMENG  1050

Query  3289  SVWDWLHNQPAN-NKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLD  3465
             SVWDWLH +P   +K K SLDWE R KIA+GLAQGVEYLHHDCVPKI+HRDIKSSN+LLD
Sbjct  1051  SVWDWLHGKPGKESKVKSSLDWETRFKIAVGLAQGVEYLHHDCVPKILHRDIKSSNLLLD  1110

Query  3466  SNMEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             S MEAHLGDFGLAK+LT+NYDS NTESN+WFAGSYGYIAPE
Sbjct  1111  SKMEAHLGDFGLAKSLTENYDS-NTESNSWFAGSYGYIAPE  1150



>gb|KHN28913.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=1272

 Score =  1228 bits (3176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/1126 (66%), Positives = 897/1126 (80%), Gaps = 30/1126 (3%)
 Frame = +1

Query  292   NTSSTLRVLLEVKRSFVLQLQG----WSEKNPNYCSWQGVSC---------------DGs  414
             ++ S LR+LLEVK+SFV   Q     WSE N +YCSW+GVSC               D  
Sbjct  28    DSESILRLLLEVKKSFVQDQQNVLSDWSEDNTDYCSWRGVSCELNSNSNSISNTLDSDSV  87

Query  415   lkvvslnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnr  594
               VV LNLSDSSL GSISPSLGLL +LLHLDLSSN L GPIPP LS L+SL+SLLLFSN+
Sbjct  88    QVVVGLNLSDSSLTGSISPSLGLLQNLLHLDLSSNSLMGPIPPNLSKLTSLQSLLLFSNQ  147

Query  595   lVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrl  774
             L G IP++LG LT+L+ +R+GDN LTG+IP S GNL NLV LGLASC L+G IP +LG+L
Sbjct  148   LTGHIPTELGSLTSLRVMRLGDNTLTGKIPASLGNLVNLVNLGLASCGLTGSIPRRLGKL  207

Query  775   tqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNT  954
             + L+NL LQ N L GP+P E+ N SSLT F+AA N LNGSIP ELG L +L ILN ANN+
Sbjct  208   SLLENLILQDNELMGPIPTELGNCSSLTIFTAANNKLNGSIPSELGQLSNLQILNFANNS  267

Query  955   LTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSM  1134
             L+GEIP QLG++S LVY+N +GNQL G+IP SLA+L NLQ+LDLS N+L+G +P E G+M
Sbjct  268   LSGEIPSQLGDVSQLVYMNFMGNQLEGAIPPSLAQLGNLQNLDLSTNKLSGGIPEELGNM  327

Query  1135  GQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNN  1314
             G+L +L L+ NNL+  IPK++CSNAT+L+ LMLSE+GL G+IP ELSQC+ L+QLDLSNN
Sbjct  328   GELAYLVLSGNNLNCVIPKTICSNATSLEHLMLSESGLHGDIPAELSQCQQLKQLDLSNN  387

Query  1315  TLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGM  1494
              LNGSI  ELY L  LTDL+LNNN+L G+ISP + NL+ LQTL+LFHNNL G +PREIGM
Sbjct  388   ALNGSINLELYGLLGLTDLLLNNNSLVGSISPFIGNLSGLQTLALFHNNLQGALPREIGM  447

Query  1495  LGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREN  1674
             LG L+I++LY+N  S  IP+EIGNCSSLQ +DF+GN F+GKIPIT+GRLK L FLHLR+N
Sbjct  448   LGKLEILYLYDNQLSEAIPMEIGNCSSLQMVDFFGNHFSGKIPITIGRLKELNFLHLRQN  507

Query  1675  DLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRN  1854
             +L GEIPA+LGNCH+L+ LDLADN LSGAIPATFG+L AL +LMLYNNSLEG+LP  L N
Sbjct  508   ELVGEIPATLGNCHKLNILDLADNQLSGAIPATFGFLEALQQLMLYNNSLEGNLPHQLIN  567

Query  1855  LGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNR  2034
             + NLTR+NLS N  +GSIA +C+S SFLSFDVT N FD EIPS +GNSPSL RLRLG+N+
Sbjct  568   VANLTRVNLSKNRLNGSIAALCSSQSFLSFDVTENEFDGEIPSQMGNSPSLQRLRLGNNK  627

Query  2035  FTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrl  2214
             F+G+IP TL  IRELSLLDLSGN L+G IP +LSLC KL ++DLN+NLL G IP WL +L
Sbjct  628   FSGEIPRTLAKIRELSLLDLSGNSLTGPIPAELSLCNKLAYIDLNSNLLFGQIPSWLEKL  687

Query  2215  pllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQ  2394
             P LGELKLSSN FSG LP  LF CSKLLVLSL +NSLNG+LP +IG+L  LNVL LD N+
Sbjct  688   PELGELKLSSNNFSGPLPLGLFKCSKLLVLSLNDNSLNGSLPSDIGDLAYLNVLRLDHNK  747

Query  2395  LCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGT  2574
               G IP  IG L K+YELRLSRN F+ E+P E+G+L++LQ +LD SYNNL+G+IP S+GT
Sbjct  748   FSGPIPPEIGKLSKIYELRLSRNNFNAEMPPEIGKLQNLQIILDLSYNNLSGQIPSSVGT  807

Query  2575  LSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHL  2754
             L KLE+LDLSHN LTGE+PP + EMSSLG+L+LS N L+G+LDK+++ WP ++F GN  L
Sbjct  808   LLKLEALDLSHNQLTGEVPPHIGEMSSLGKLDLSYNNLQGKLDKQFSRWPDEAFEGNLQL  867

Query  2755  CGSPLGSC-RDKGSRNKG---SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGK  2922
             CGSPL  C RD  SR+ G   S+V +IS++S T+A I LL+ A   F  N++ +  +  +
Sbjct  868   CGSPLERCRRDDASRSAGLNESLVAIISSIS-TLAAIALLILAVRIFSKNKQEFCWKGSE  926

Query  2923  ENYAsssssssQAQRKPLFG-NAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAEL  3099
              NY   SSSSSQAQR+PLF  NAA KRD RW+DIM+ATNNLSD+F+IGSGG   +YKAEL
Sbjct  927   VNYV-YSSSSSQAQRRPLFQLNAAGKRDFRWEDIMDATNNLSDDFMIGSGGSGKIYKAEL  985

Query  3100  FNGETVAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGE--GSNVLIYE  3273
               GETVA+K+I  KD+  L+KSF RE+KTL RIRHRHLV+L+GYC+NK +  G N+LIYE
Sbjct  986   ATGETVAVKKISSKDEFLLNKSFIREVKTLGRIRHRHLVKLIGYCTNKNKEAGWNLLIYE  1045

Query  3274  YMENGSVWDWLHNQPAN-NKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSS  3450
             YMENGSVW+WLH +PA  NK K+S+DWE R KIA+GLAQGVEYLHHDCVP+IIHRDIKSS
Sbjct  1046  YMENGSVWNWLHGKPAKANKVKRSIDWETRFKIAVGLAQGVEYLHHDCVPRIIHRDIKSS  1105

Query  3451  NVLLDSNMEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             NVLLD+ MEAHLGDFGLAKALT+N DS NTESN+WFAGSYGYIAPE
Sbjct  1106  NVLLDTKMEAHLGDFGLAKALTENCDS-NTESNSWFAGSYGYIAPE  1150



>ref|XP_010260807.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nelumbo nucifera]
Length=1265

 Score =  1227 bits (3175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 719/1112 (65%), Positives = 876/1112 (79%), Gaps = 20/1112 (2%)
 Frame = +1

Query  301   STLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-----DGslkvvslnlsdssl  453
             +TLRVLLEVK+SFV      L  WSE NP +C+W+GVSC     DGS  V  LNLSDSSL
Sbjct  38    TTLRVLLEVKKSFVEDPLNVLDDWSEDNPEFCTWRGVSCGSDTVDGSYDVTGLNLSDSSL  97

Query  454   ggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLT  633
              GSISPSLGLL +LLHLDLSSN L+GPIPP LSNLSSL SL LFSN+L G IP+QLG LT
Sbjct  98    AGSISPSLGLLHNLLHLDLSSNRLTGPIPPQLSNLSSLMSLFLFSNQLSGTIPTQLGSLT  157

Query  634   NLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnll  813
              LQ LRIG+N LTG IP+SFGNL NLV LGL +C L+G IPP+LG+L  +Q LN+Q+N L
Sbjct  158   GLQFLRIGNNDLTGSIPSSFGNLSNLVFLGLGTCNLNGRIPPELGQLGHVQTLNIQENYL  217

Query  814   EGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMS  993
             EGPLPPE+ N +SL  F+ ALN+L G IP ELG L +L  LNLANNTL+GEIP QLGE+S
Sbjct  218   EGPLPPELGNCTSLVTFTVALNNLTGPIPPELGRLSNLQTLNLANNTLSGEIPSQLGELS  277

Query  994   SLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNL  1173
              L+Y+N +GNQL G IPKSLA+L+ L++LDLS NRL GE+P E G + +L  + L++N L
Sbjct  278   QLLYINFMGNQLEGQIPKSLAQLSGLKNLDLSYNRLTGEIPEELGKLDKLLDMVLSNNKL  337

Query  1174  SGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYEL  1353
             SGT+  +L SN T+L  ++LS+  L G+IP  L +CR L QLDL++N   G IP EL++L
Sbjct  338   SGTLSSNLFSNTTSLDQIILSDNALVGKIPASLRECRSLTQLDLADNRFEGPIPIELFDL  397

Query  1354  TQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENH  1533
               LTDL L+NN+L GTI PS+ NL+NL+TL+L+HNNLHG +P+EIG LG L  ++LYEN 
Sbjct  398   LDLTDLYLHNNSLVGTIPPSIGNLSNLRTLALYHNNLHGGLPQEIGKLGQLGTLYLYENR  457

Query  1534  FSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNC  1713
              SGEIP+EI NCS LQ +D YGNQF+G IPIT+GRLK L  +HLR+NDLSGEIPASLGNC
Sbjct  458   LSGEIPIEITNCSRLQMLDLYGNQFSGSIPITIGRLKELNLIHLRQNDLSGEIPASLGNC  517

Query  1714  HQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNN  1893
              QLDTLDLADN LSG+IPATFG+L +L   MLYNNSL+G+LP++L N+ NLTR+NLS+N 
Sbjct  518   KQLDTLDLADNRLSGSIPATFGFLESLKLFMLYNNSLQGNLPEELANIANLTRVNLSNNR  577

Query  1894  FSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIR  2073
              +G+I P+C+S+S LSFD+TNN+FD EIP  LGNS SLDRLRLG+NRF+G IP TLG I 
Sbjct  578   LNGTIVPLCSSNSLLSFDLTNNSFDSEIPPQLGNSRSLDRLRLGNNRFSGNIPWTLGNIT  637

Query  2074  ELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQF  2253
             ELSLLDLSGN L+G IP +LS C+KL+H+DLNNNLLSG IP WLG LPLLGELKLSSN  
Sbjct  638   ELSLLDLSGNSLTGPIPMELSFCKKLSHIDLNNNLLSGSIPTWLGSLPLLGELKLSSNLL  697

Query  2254  SGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLG  2433
              G LP +LFNC+ LLVLSL+ NSLNGT+PPEIGNL+SLNVL LD N+  G IPS I  L 
Sbjct  698   VGPLPDQLFNCTNLLVLSLDVNSLNGTIPPEIGNLESLNVLTLDHNRFSGPIPSDISKLS  757

Query  2434  KLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHND  2613
             KLYELRLSRN F G+IP E+GQL++LQ VLD S+NNLTGEIPPSIGTLSKLE L+LSHN+
Sbjct  758   KLYELRLSRNSFDGQIPIELGQLQNLQIVLDLSHNNLTGEIPPSIGTLSKLEILNLSHNN  817

Query  2614  LTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC-----  2778
             L GE+PPQV EMSSLG L+LS N L+G+LD++++HWP ++F GN  LCG PL  C     
Sbjct  818   LVGEVPPQVGEMSSLGMLDLSYNNLQGQLDEQFSHWPAEAFAGNLGLCGDPLSPCSNLLQ  877

Query  2779  --RDKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAssssss  2952
               R     N  S+V +I A+S  VAI+++++G +   KH  +++RR R         SSS
Sbjct  878   SHRSHSGLNASSVVAII-AVSTFVAIVVMVLGVSLLIKHKHQSFRRDR---EVNCVHSSS  933

Query  2953  sQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRI  3132
             S  QR+ LF + A +R+ +W +IM+AT NLSDE++IG+GG  T+YKAEL +GETVA+K+I
Sbjct  934   SSMQRRLLFRHGAMRREFKWSNIMKATGNLSDEYMIGTGGSGTIYKAELPSGETVAVKKI  993

Query  3133  PRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHN  3312
               KDD+ LD+SF REI+TL RIRHRHLV+L+G CSNK  GSN+LIYEYMENGS+WDWLHN
Sbjct  994   LSKDDVLLDRSFTREIRTLGRIRHRHLVKLLGCCSNKAAGSNLLIYEYMENGSLWDWLHN  1053

Query  3313  QPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGD  3492
               AN+K KK+LDWE RL+IA+GL  GVEYLHHDCVP IIHRDIKSSNVLLD++MEAHLGD
Sbjct  1054  PFANSKKKKNLDWEMRLRIAVGLVHGVEYLHHDCVPVIIHRDIKSSNVLLDADMEAHLGD  1113

Query  3493  FGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             FGLAK L +N+DS  TES++ FAGSYGYIAPE
Sbjct  1114  FGLAKLLIENHDSECTESSSLFAGSYGYIAPE  1145



>ref|XP_003532673.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=1275

 Score =  1224 bits (3166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 741/1126 (66%), Positives = 897/1126 (80%), Gaps = 30/1126 (3%)
 Frame = +1

Query  292   NTSSTLRVLLEVKRSFVLQLQG----WSEKNPNYCSWQGVSC---------------DGs  414
             ++ S LR+LLEVK+SFV   Q     WSE N +YCSW+GVSC               D  
Sbjct  31    DSESILRLLLEVKKSFVQDQQNVLSDWSEDNTDYCSWRGVSCELNSNSNSISNTLDSDSV  90

Query  415   lkvvslnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnr  594
               VV LNLSDSSL GSISPSLGLL +LLHLDLSSN L GPIPP LSNL+SL+SLLLFSN+
Sbjct  91    QVVVGLNLSDSSLTGSISPSLGLLQNLLHLDLSSNSLMGPIPPNLSNLTSLQSLLLFSNQ  150

Query  595   lVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrl  774
             L G IP++LG LT+L+ +R+GDN LTG+IP S GNL NLV LGLASC L+G IP +LG+L
Sbjct  151   LTGHIPTELGSLTSLRVMRLGDNTLTGKIPASLGNLVNLVNLGLASCGLTGSIPRRLGKL  210

Query  775   tqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNT  954
             + L+NL LQ N L GP+P E+ N SSLT F+AA N LNGSIP ELG L +L ILN ANN+
Sbjct  211   SLLENLILQDNELMGPIPTELGNCSSLTIFTAANNKLNGSIPSELGQLSNLQILNFANNS  270

Query  955   LTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSM  1134
             L+GEIP QLG++S LVY+N +GNQL G+IP SLA+L NLQ+LDLS N+L+G +P E G+M
Sbjct  271   LSGEIPSQLGDVSQLVYMNFMGNQLEGAIPPSLAQLGNLQNLDLSTNKLSGGIPEELGNM  330

Query  1135  GQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNN  1314
             G+L +L L+ NNL+  IPK++CSNAT+L+ LMLSE+GL G+IP ELSQC+ L+QLDLSNN
Sbjct  331   GELAYLVLSGNNLNCVIPKTICSNATSLEHLMLSESGLHGDIPAELSQCQQLKQLDLSNN  390

Query  1315  TLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGM  1494
              LNGSI  ELY L  LTDL+LNNN+L G+ISP + NL+ LQTL+LFHNNL G +PREIGM
Sbjct  391   ALNGSINLELYGLLGLTDLLLNNNSLVGSISPFIGNLSGLQTLALFHNNLQGALPREIGM  450

Query  1495  LGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREN  1674
             LG L+I++LY+N  S  IP+EIGNCSSLQ +DF+GN F+GKIPIT+GRLK L FLHLR+N
Sbjct  451   LGKLEILYLYDNQLSEAIPMEIGNCSSLQMVDFFGNHFSGKIPITIGRLKELNFLHLRQN  510

Query  1675  DLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRN  1854
             +L GEIPA+LGNCH+L+ LDLADN LSGAIPATFG+L AL +LMLYNNSLEG+LP  L N
Sbjct  511   ELVGEIPATLGNCHKLNILDLADNQLSGAIPATFGFLEALQQLMLYNNSLEGNLPHQLIN  570

Query  1855  LGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNR  2034
             + NLTR+NLS N  +GSIA +C+S SFLSFDVT N FD EIPS +GNSPSL RLRLG+N+
Sbjct  571   VANLTRVNLSKNRLNGSIAALCSSQSFLSFDVTENEFDGEIPSQMGNSPSLQRLRLGNNK  630

Query  2035  FTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrl  2214
             F+G+IP TL  IRELSLLDLSGN L+G IP +LSLC KL ++DLN+NLL G IP WL +L
Sbjct  631   FSGEIPRTLAKIRELSLLDLSGNSLTGPIPAELSLCNKLAYIDLNSNLLFGQIPSWLEKL  690

Query  2215  pllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQ  2394
             P LGELKLSSN FSG LP  LF CSKLLVLSL +NSLNG+LP +IG+L  LNVL LD N+
Sbjct  691   PELGELKLSSNNFSGPLPLGLFKCSKLLVLSLNDNSLNGSLPSDIGDLAYLNVLRLDHNK  750

Query  2395  LCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGT  2574
               G IP  IG L K+YEL LSRN F+ E+P E+G+L++LQ +LD SYNNL+G+IP S+GT
Sbjct  751   FSGPIPPEIGKLSKIYELWLSRNNFNAEMPPEIGKLQNLQIILDLSYNNLSGQIPSSVGT  810

Query  2575  LSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHL  2754
             L KLE+LDLSHN LTGE+PP + EMSSLG+L+LS N L+G+LDK+++ WP ++F GN  L
Sbjct  811   LLKLEALDLSHNQLTGEVPPHIGEMSSLGKLDLSYNNLQGKLDKQFSRWPDEAFEGNLQL  870

Query  2755  CGSPLGSC-RDKGSRNKG---SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGK  2922
             CGSPL  C RD  SR+ G   S+V +IS++S T+A I LL+ A   F  N++ +  +  +
Sbjct  871   CGSPLERCRRDDASRSAGLNESLVAIISSIS-TLAAIALLILAVRIFSKNKQEFCWKGSE  929

Query  2923  ENYAsssssssQAQRKPLFG-NAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAEL  3099
              NY   SSSSSQAQR+PLF  NAA KRD RW+DIM+ATNNLSD+F+IGSGG   +YKAEL
Sbjct  930   VNYV-YSSSSSQAQRRPLFQLNAAGKRDFRWEDIMDATNNLSDDFMIGSGGSGKIYKAEL  988

Query  3100  FNGETVAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGE--GSNVLIYE  3273
               GETVA+K+I  KD+  L+KSF RE+KTL RIRHRHLV+L+GYC+NK +  G N+LIYE
Sbjct  989   ATGETVAVKKISSKDEFLLNKSFIREVKTLGRIRHRHLVKLIGYCTNKNKEAGWNLLIYE  1048

Query  3274  YMENGSVWDWLHNQPAN-NKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSS  3450
             YMENGSVW+WLH +PA  NK K+S+DWE R KIA+GLAQGVEYLHHDCVP+IIHRDIKSS
Sbjct  1049  YMENGSVWNWLHGKPAKANKVKRSIDWETRFKIAVGLAQGVEYLHHDCVPRIIHRDIKSS  1108

Query  3451  NVLLDSNMEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             NVLLD+ MEAHLGDFGLAKALT+N DS NTESN+WFAGSYGYIAPE
Sbjct  1109  NVLLDTKMEAHLGDFGLAKALTENCDS-NTESNSWFAGSYGYIAPE  1153



>ref|XP_010537057.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Tarenaya hassleriana]
Length=1274

 Score =  1219 bits (3155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 735/1110 (66%), Positives = 877/1110 (79%), Gaps = 18/1110 (2%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQLQG-----WSEKNPNYCSWQGVSCD-----Gslkvvslnlsdsslg  456
             L+ LLEVK+S     +G     W+ KN ++C+W GV+C      GS +VV LNLS   L 
Sbjct  43    LQALLEVKKSLATDAEGDVLRQWNSKNTDFCTWIGVTCGSVSDGGSFRVVGLNLSGLGLT  102

Query  457   gsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTN  636
             GSISP      +L HLDLSSN L GPIPPAL+NLSSLESLLLFSN+L G IPSQLG L N
Sbjct  103   GSISPWFARFDNLTHLDLSSNSLVGPIPPALANLSSLESLLLFSNQLTGGIPSQLGSLIN  162

Query  637   LQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllE  816
             L+ ++IGDN LTG IP + GNL NL TL +ASC L+G IP QLG+L Q++++ LQ N L 
Sbjct  163   LRVMKIGDNELTGPIPETLGNLVNLQTLAMASCRLTGPIPSQLGQLDQVESMILQDNELN  222

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             G +P E+ N SSLT F+AA N LNGSIP ELG L +L ILNL NN+L+GEIP QLG+MS 
Sbjct  223   GQIPAELGNCSSLTVFTAAQNRLNGSIPAELGRLDNLQILNLGNNSLSGEIPSQLGKMSQ  282

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             L YLNL+GN+L G IPK+LA L NLQ+LDLS N L G +P EFG+MGQL  L L +N LS
Sbjct  283   LGYLNLMGNELQGLIPKALADLGNLQTLDLSANNLTGGIPDEFGNMGQLVNLVLANNGLS  342

Query  1177  GTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
             G++PKSLCSN TNL+ L+LS T LSGEIP ELS+CR L+QLDLSNNTL+GSIPEEL+EL 
Sbjct  343   GSVPKSLCSNNTNLEQLVLSGTHLSGEIPAELSKCRSLKQLDLSNNTLSGSIPEELFELI  402

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
             +LTDL L+NN+LEGTI+PS++NLTNLQ L L+HNNL G++P++IG L +L+++F+YEN F
Sbjct  403   ELTDLYLHNNSLEGTITPSISNLTNLQWLVLYHNNLEGKLPKDIGALSNLEVLFVYENRF  462

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
             SGEIPVEIGNC+ L+ ID +GN F G+IP T+GRLK L  LHLR+N L G +P +LGNCH
Sbjct  463   SGEIPVEIGNCTKLKMIDMFGNHFNGEIPPTIGRLKELNLLHLRQNQLVGGLPVTLGNCH  522

Query  1717  QLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNF  1896
             QL  LDLADN LSG+IP +FG+L+AL +LMLYNNSL+G+LP  L NL NLTRINLS N F
Sbjct  523   QLTILDLADNRLSGSIPPSFGFLKALEQLMLYNNSLQGNLPGSLANLKNLTRINLSRNKF  582

Query  1897  SGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRE  2076
             +GSIAP C+S S+LSFDVTNN F+ EIP  LGNSPSLDRLRLG N+FTG+IP TLG IRE
Sbjct  583   NGSIAPFCSSSSYLSFDVTNNEFEGEIPLQLGNSPSLDRLRLGKNQFTGRIPWTLGKIRE  642

Query  2077  LSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFS  2256
             LSLLDLS N LSG IP +L LC+KLTH+DLNNN LSGP+P WLG+LP LGE+KLSSNQF 
Sbjct  643   LSLLDLSSNSLSGAIPLELVLCKKLTHIDLNNNFLSGPMPPWLGKLPQLGEIKLSSNQFV  702

Query  2257  GSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGK  2436
             GSLP ELFNC++LLVLSL+ NSLNG++P EIGNL +LN+LNL+ NQL G +P  IG L K
Sbjct  703   GSLPTELFNCTRLLVLSLDGNSLNGSIPNEIGNLGALNLLNLERNQLSGPLPPAIGKLSK  762

Query  2437  LYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDL  2616
             LY+LRLSRN  +G+IP E+GQL++LQSVLD SYNN TGEIP +IG LSKLESLDLSHN L
Sbjct  763   LYDLRLSRNSLTGDIPVEIGQLQNLQSVLDLSYNNFTGEIPSTIGALSKLESLDLSHNQL  822

Query  2617  TGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSR  2796
             TGE+P  + EM SL  LNLS N L G+L K+++ WP D F GN  LCGSPL  C   GS 
Sbjct  823   TGEVPANIGEMRSLSNLNLSYNNLNGKLKKQFSRWPADVFEGNVGLCGSPLSHCNRTGSD  882

Query  2797  NK-----GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQA  2961
             NK      + VV+ISA+S   AI L+++  A FFK  R+ +++ R + N   SSSSSSQA
Sbjct  883   NKQPGLSATSVVIISAISTLAAIALMILVIALFFKQRRDFFKKAR-ESNSTFSSSSSSQA  941

Query  2962  QRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRK  3141
             Q +PLF   A K D RW+DIMEAT NLSDEF+IGSGG   +YKAEL +GE VA+K+I  K
Sbjct  942   QHRPLFRPGAAKSDFRWEDIMEATKNLSDEFMIGSGGSGKIYKAELDDGEAVAVKKILWK  1001

Query  3142  DDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLH-NQP  3318
             DDL  +KSF+RE+KTL RIRHRHLV+L+GYCSN+ EG N+LIYEYMENGSVWDWLH  QP
Sbjct  1002  DDLLSNKSFSREVKTLGRIRHRHLVKLIGYCSNRAEGLNLLIYEYMENGSVWDWLHAKQP  1061

Query  3319  ANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFG  3498
              N K K++LDWEARL+IA+GLAQGVEYLHHDCVP IIHRDIKSSN+LLDSNME HLGDFG
Sbjct  1062  VNGKKKQALDWEARLRIAVGLAQGVEYLHHDCVPPIIHRDIKSSNLLLDSNMEPHLGDFG  1121

Query  3499  LAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             LAK LT+NYD+ NTESNTWFAGSYGYIAPE
Sbjct  1122  LAKILTENYDT-NTESNTWFAGSYGYIAPE  1150



>ref|XP_010653998.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X2 [Vitis vinifera]
Length=1101

 Score =  1216 bits (3145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 665/986 (67%), Positives = 796/986 (81%), Gaps = 10/986 (1%)
 Frame = +1

Query  646   LRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPL  825
             +RIGDN L+G IP SFGNL NLVTLGLAS  L+G IP QLGRLT+L+NL LQQN LEGP+
Sbjct  1     MRIGDNALSGSIPPSFGNLLNLVTLGLASSLLTGPIPWQLGRLTRLENLILQQNKLEGPI  60

Query  826   PPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVY  1005
             PP++ N SSL  F++ALN LNGSIP EL  LK+L +LNLANNTL+G IPGQLGE + LVY
Sbjct  61    PPDLGNCSSLVVFTSALNRLNGSIPPELALLKNLQLLNLANNTLSGAIPGQLGESTQLVY  120

Query  1006  LNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTI  1185
             LNL+ NQL G IP+SLA+L +LQ+LDLS N+L G++P E G+MGQL ++ L++N+LSG I
Sbjct  121   LNLMANQLEGPIPRSLARLGSLQTLDLSVNKLTGQIPPELGNMGQLVYMVLSTNHLSGVI  180

Query  1186  PKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLT  1365
             P+++CSN T ++ L LSE  +SGEIP +L  C  L+QL+L+NNT+NGSIP +L++L  LT
Sbjct  181   PRNICSNTTTMEHLFLSENQISGEIPADLGLCGSLKQLNLANNTINGSIPAQLFKLPYLT  240

Query  1366  DLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGE  1545
             DL+LNNN+L G+ISPS+ANL+NLQTL+L+ NNL G +PREIGMLG L+I+++Y+N  SGE
Sbjct  241   DLLLNNNSLVGSISPSIANLSNLQTLALYQNNLRGNLPREIGMLGKLEILYIYDNRLSGE  300

Query  1546  IPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLD  1725
             IP+EIGNCSSLQ IDF+GN F G+IP+T+GRLK L FLHLR+NDLSGEIP +LGNCHQL 
Sbjct  301   IPLEIGNCSSLQRIDFFGNHFKGQIPVTIGRLKELNFLHLRQNDLSGEIPPTLGNCHQLT  360

Query  1726  TLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGS  1905
              LDLADN LSG IPATFG+LR L  LMLYNNSLEG+LPD+L N+ NLTR+NLS+N  +GS
Sbjct  361   ILDLADNSLSGGIPATFGFLRVLEELMLYNNSLEGNLPDELINVANLTRVNLSNNKLNGS  420

Query  1906  IAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSL  2085
             IA +C+SHSFLSFDVTNNAFD +IP  LG SPSL RLRLG+N FTG IP TLG I +LSL
Sbjct  421   IAALCSSHSFLSFDVTNNAFDGQIPRELGFSPSLQRLRLGNNHFTGAIPRTLGEIYQLSL  480

Query  2086  LDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSL  2265
             +D SGN L+G +P +LSLC+KLTH+DLN+N LSGPIP WLG LP LGELKLS N FSG L
Sbjct  481   VDFSGNSLTGSVPAELSLCKKLTHIDLNSNFLSGPIPSWLGSLPNLGELKLSFNLFSGPL  540

Query  2266  PPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYE  2445
             P ELF CS LLVLSL+NN LNGTLP E GNL SLNVLNL+ NQ  G IP  IG L KLYE
Sbjct  541   PHELFKCSNLLVLSLDNNLLNGTLPLETGNLASLNVLNLNQNQFYGPIPPAIGNLSKLYE  600

Query  2446  LRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGE  2625
             LRLSRN F+GEIP E+G+L++LQSVLD SYNNLTGEIPPSIGTLSKLE+LDLSHN L GE
Sbjct  601   LRLSRNSFNGEIPIELGELQNLQSVLDLSYNNLTGEIPPSIGTLSKLEALDLSHNQLVGE  660

Query  2626  IPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRN--  2799
             IP QV  MSSLG+LN S N LEG+LDK + HWP ++F+GN  LCG PL  C  + S +  
Sbjct  661   IPFQVGAMSSLGKLNFSYNNLEGKLDKEFLHWPAETFMGNLRLCGGPLVRCNSEESSHHN  720

Query  2800  ---KGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRK  2970
                K S VV+ISA S   AI+LL++G A F K  RE+    +        SSSSS   R+
Sbjct  721   SGLKLSYVVIISAFSTIAAIVLLMIGVALFLKGKRESLNAVK-----CVYSSSSSIVHRR  775

Query  2971  PLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDDL  3150
             PL  N A KRD +W DIM+ATNNLSD FIIGSGG  T+YKAEL + ETVA+K+I RKDDL
Sbjct  776   PLLPNTAGKRDFKWGDIMQATNNLSDNFIIGSGGSGTIYKAELSSEETVAVKKILRKDDL  835

Query  3151  FLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNK  3330
              L+KSF REI+TL R+RHRHL +L+G C NK  G N+L+YEYMENGS+WDWLH +  ++K
Sbjct  836   LLNKSFEREIRTLGRVRHRHLAKLLGCCVNKEAGFNLLVYEYMENGSLWDWLHPESVSSK  895

Query  3331  SKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKA  3510
              +KSLDWEARL++A+GLA+GVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAK 
Sbjct  896   KRKSLDWEARLRVAVGLAKGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKT  955

Query  3511  LTDNYDSLNTESNTWFAGSYGYIAPE  3588
             L +N++S NT+SN+WFAGSYGYIAPE
Sbjct  956   LVENHNSFNTDSNSWFAGSYGYIAPE  981


 Score =   291 bits (746),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 217/565 (38%), Positives = 308/565 (55%), Gaps = 7/565 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPql-grlt  777
             GPIP  L  L +LQ L +  N LTGQIP   GN+G LV + L++ +LSG+IP  +    T
Sbjct  130   GPIPRSLARLGSLQTLDLSVNKLTGQIPPELGNMGQLVYMVLSTNHLSGVIPRNICSNTT  189

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
              +++L L +N + G +P ++    SL   + A N++NGSIP +L  L +L  L L NN+L
Sbjct  190   TMEHLFLSENQISGEIPADLGLCGSLKQLNLANNTINGSIPAQLFKLPYLTDLLLNNNSL  249

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
              G I   +  +S+L  L L  N L G++P+ +  L  L+ L +  NRL+GE+P E G+  
Sbjct  250   VGSISPSIANLSNLQTLALYQNNLRGNLPREIGMLGKLEILYIYDNRLSGEIPLEIGNCS  309

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
              LQ +    N+  G IP ++      L  L L +  LSGEIPP L  C  L  LDL++N+
Sbjct  310   SLQRIDFFGNHFKGQIPVTI-GRLKELNFLHLRQNDLSGEIPPTLGNCHQLTILDLADNS  368

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
             L+G IP     L  L +L+L NN+LEG +   + N+ NL  ++L +N L+G +       
Sbjct  369   LSGGIPATFGFLRVLEELMLYNNSLEGNLPDELINVANLTRVNLSNNKLNGSIAALCSSH  428

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
               L    +  N F G+IP E+G   SLQ +    N FTG IP TLG +  L  +    N 
Sbjct  429   SFLSFD-VTNNAFDGQIPRELGFSPSLQRLRLGNNHFTGAIPRTLGEIYQLSLVDFSGNS  487

Query  1678  LSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNL  1857
             L+G +PA L  C +L  +DL  N LSG IP+  G L  L  L L  N   G LP +L   
Sbjct  488   LTGSVPAELSLCKKLTHIDLNSNFLSGPIPSWLGSLPNLGELKLSFNLFSGPLPHELFKC  547

Query  1858  GNLTRINLSHNNFSGSIAPICTSH--SFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSN  2031
              NL  ++L +N  +G++ P+ T +  S    ++  N F   IP  +GN   L  LRL  N
Sbjct  548   SNLLVLSLDNNLLNGTL-PLETGNLASLNVLNLNQNQFYGPIPPAIGNLSKLYELRLSRN  606

Query  2032  RFTGKIPMTLGLIREL-SLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlg  2208
              F G+IP+ LG ++ L S+LDLS N L+G IPP +    KL  LDL++N L G IP  +G
Sbjct  607   SFNGEIPIELGELQNLQSVLDLSYNNLTGEIPPSIGTLSKLEALDLSHNQLVGEIPFQVG  666

Query  2209  rlpllgelklSSNQFSGSLPPELFN  2283
              +  LG+L  S N   G L  E  +
Sbjct  667   AMSSLGKLNFSYNNLEGKLDKEFLH  691



>gb|KEH31437.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1268

 Score =  1212 bits (3136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 723/1120 (65%), Positives = 884/1120 (79%), Gaps = 24/1120 (2%)
 Frame = +1

Query  292   NTSSTLRVLLEVKRSFVLQ-----LQGWSEKNPNYCSWQGVSC------DGslkvvslnl  438
             +  +TLRVLLEVK +F LQ     L  WS+ N +YCSW+GVSC      D S  VV LNL
Sbjct  30    DKDTTLRVLLEVK-TFFLQDPQNVLSDWSQDNTDYCSWKGVSCGLNPLVDDSEHVVGLNL  88

Query  439   sdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQ  618
             SDSSL GSISPSLG L +LLHLDLSSN L+GPIP  LSNL SLE+LLLFSN+L G +P +
Sbjct  89    SDSSLTGSISPSLGRLKNLLHLDLSSNCLTGPIPTNLSNLVSLETLLLFSNQLSGSVPVE  148

Query  619   LGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnl  798
              G LT+L+ +R+GDN LTG IP S G L NLV+LGLASC L+G IPP+L +L  L+NL L
Sbjct  149   FGSLTSLRVMRLGDNALTGMIPASLGKLVNLVSLGLASCELTGSIPPELSQLGLLENLVL  208

Query  799   qqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQ  978
             Q N L GP+P E+ N SSLT F+A+ N LNGSIP ELG L++L +LNL NN+L GEIP Q
Sbjct  209   QDNGLMGPIPSELGNCSSLTVFTASNNKLNGSIPSELGQLQNLQLLNLGNNSLAGEIPSQ  268

Query  979   LGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLAL  1158
             LG+MS LVYLN +GNQL G+IP SLA+L NLQ+LDLS N+L+G +P EFG+MGQL F+ L
Sbjct  269   LGDMSELVYLNFMGNQLEGAIPPSLAQLGNLQNLDLSMNKLSGGIPEEFGNMGQLGFMVL  328

Query  1159  TSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPE  1338
             + NNL+  IP+++CSNATNL+ LMLSE+GL GEIP ELSQC+ L+Q+DLSNN+LNGSIP 
Sbjct  329   SGNNLNSVIPRTICSNATNLEHLMLSESGLFGEIPAELSQCQSLKQIDLSNNSLNGSIPL  388

Query  1339  ELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIF  1518
             ELY L +LTDL+LNNN+L G+ISP + N ++LQTLSL+HN L G++PREIGML  L+I++
Sbjct  389   ELYGLVELTDLLLNNNSLVGSISPFIGNFSSLQTLSLYHNKLQGDLPREIGMLEKLEILY  448

Query  1519  LYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPA  1698
             LY+N  SG+IP+EIGNCSSLQ IDF+GN F G+IPIT+GRLK L FLHLR+N+L GEIPA
Sbjct  449   LYDNQLSGDIPMEIGNCSSLQMIDFFGNSFKGEIPITIGRLKELNFLHLRQNELVGEIPA  508

Query  1699  SLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRIN  1878
             +LGNCH+L+ LDLADN LSGAIPAT G+L +L +LMLYNNSLEG+LP  L N+ NLTR+N
Sbjct  509   TLGNCHKLNILDLADNQLSGAIPATLGFLESLQQLMLYNNSLEGNLPHQLINVANLTRVN  568

Query  1879  LSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMT  2058
             LS N  +GSIA +C+S SFL+FDVT+N FD EIP  LGNSP+L R++LG+N+F+G+IP T
Sbjct  569   LSKNRLNGSIAALCSSKSFLTFDVTDNEFDGEIPPQLGNSPTLYRIKLGNNKFSGEIPRT  628

Query  2059  LGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelkl  2238
             LG I +LS+L LSGN L+G IP +LSLC KL ++DLN+NLL G IP WLG+LP LGELKL
Sbjct  629   LGKIHDLSVLVLSGNSLTGPIPAELSLCNKLAYIDLNSNLLYGQIPSWLGKLPQLGELKL  688

Query  2239  SSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPST  2418
             SSN FSG LP  LF CS LLVLSL  NSLNG+LP +IG+L  LNVL LD N+    IP  
Sbjct  689   SSNNFSGPLPLGLFKCSNLLVLSLNENSLNGSLPADIGDLTYLNVLRLDRNKFSEPIPPE  748

Query  2419  IGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLD  2598
             IG L KLYEL+LSRN F+GEIP E+G+L++LQ ++D SYNNL+G IP S+GT+SKLE+LD
Sbjct  749   IGRLSKLYELQLSRNSFNGEIPSEIGKLQNLQIIVDLSYNNLSGGIPYSLGTMSKLETLD  808

Query  2599  LSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC  2778
             LSHN LTG+IPPQV +MSSL +L+LS N L+G+LDK+++ WP D+F GN +LCGSPL  C
Sbjct  809   LSHNQLTGKIPPQVGDMSSLEKLDLSYNNLQGKLDKKFSRWPDDAFEGNLNLCGSPLDRC  868

Query  2779  RD------KGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAss  2940
                     K SR   S VV+IS +S + AI LL++    F K N++ + R   K      
Sbjct  869   DSDDTSGGKQSRLSESTVVIISVISTSAAIALLILSVRMFCK-NKQEFSREDSKVTSYVY  927

Query  2941  sssssQAQRKPLFG-NAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETV  3117
             SSSSSQAQR+PLF   AA KRD  W+DIM+ATNNL+D+F+IGSGG   VYKAEL +GETV
Sbjct  928   SSSSSQAQRRPLFQLRAAGKRDFNWEDIMDATNNLNDDFMIGSGGSGKVYKAELASGETV  987

Query  3118  AIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCS--NKGEGSNVLIYEYMENGS  3291
             A+K+I  KDD  L+KSF RE+ TL RI+HRHLV+L+G+CS  NKG  SN+LIYEYMENGS
Sbjct  988   AVKKISSKDDFLLNKSFLREVNTLGRIKHRHLVKLIGFCSSRNKGASSNLLIYEYMENGS  1047

Query  3292  VWDWLHNQP-ANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDS  3468
             +WDWLH +P   +K KK+LDWE R KIA+GLAQGVEYLHHDC PKIIHRDIKSSN+LLDS
Sbjct  1048  LWDWLHRKPNIASKVKKNLDWETRFKIAVGLAQGVEYLHHDCAPKIIHRDIKSSNILLDS  1107

Query  3469  NMEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
              MEAHLGDFGLAKAL ++YDS NTESN+ FAGSYGY+APE
Sbjct  1108  KMEAHLGDFGLAKALIESYDS-NTESNSCFAGSYGYMAPE  1146



>ref|NP_199283.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Arabidopsis 
thaliana]
 sp|Q9FIZ3.2|GSO2_ARATH RecName: Full=LRR receptor-like serine/threonine-protein kinase 
GSO2; AltName: Full=Protein EMBRYO SAC DEVELOPMENT ARREST 
23; AltName: Full=Protein GASSHO 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AED95148.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Arabidopsis 
thaliana]
Length=1252

 Score =  1210 bits (3130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/1105 (61%), Positives = 830/1105 (75%), Gaps = 17/1105 (2%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsis  468
             L+ LLE+K SF+        L+ W+  +P+YC+W GV+C G   +          G    
Sbjct  30    LQTLLELKNSFITNPKEEDVLRDWNSGSPSYCNWTGVTCGGREIIGLNLSGLGLTGSISP  89

Query  469   pslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlV-GPIPSQLGLLTNLQA  645
                     +     S+  + GPIP  LSNLSS    L   + L+ G IPSQLG L NL++
Sbjct  90    SIGRFNNLIHIDLSSNRLV-GPIPTTLSNLSSSLESLHLFSNLLSGDIPSQLGSLVNLKS  148

Query  646   LRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPL  825
             L++GDN L G IP +FGNL NL  L LASC L+GLIP + GRL QLQ L LQ N LEGP+
Sbjct  149   LKLGDNELNGTIPETFGNLVNLQMLALASCRLTGLIPSRFGRLVQLQTLILQDNELEGPI  208

Query  826   PPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVY  1005
             P EI N +SL  F+AA N LNGS+P EL  LK+L  LNL +N+ +GEIP QLG++ S+ Y
Sbjct  209   PAEIGNCTSLALFAAAFNRLNGSLPAELNRLKNLQTLNLGDNSFSGEIPSQLGDLVSIQY  268

Query  1006  LNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTI  1185
             LNL+GNQL G IPK L +L NLQ+LDLS N L G +  EF  M QL+FL L  N LSG++
Sbjct  269   LNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIHEEFWRMNQLEFLVLAKNRLSGSL  328

Query  1186  PKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLT  1365
             PK++CSN T+L+ L LSET LSGEIP E+S C+ L+ LDLSNNTL G IP+ L++L +LT
Sbjct  329   PKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSLKLLDLSNNTLTGQIPDSLFQLVELT  388

Query  1366  DLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGE  1545
             +L LNNN+LEGT+S S++NLTNLQ  +L+HNNL G+VP+EIG LG L+I++LYEN FSGE
Sbjct  389   NLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGE  448

Query  1546  IPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLD  1725
             +PVEIGNC+ LQ ID+YGN+ +G+IP ++GRLK L  LHLREN+L G IPASLGNCHQ+ 
Sbjct  449   MPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNCHQMT  508

Query  1726  TLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGS  1905
              +DLADN LSG+IP++FG+L AL   M+YNNSL+G+LPD L NL NLTRIN S N F+GS
Sbjct  509   VIDLADNQLSGSIPSSFGFLTALELFMIYNNSLQGNLPDSLINLKNLTRINFSSNKFNGS  568

Query  1906  IAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSL  2085
             I+P+C S S+LSFDVT N F+ +IP  LG S +LDRLRLG N+FTG+IP T G I ELSL
Sbjct  569   ISPLCGSSSYLSFDVTENGFEGDIPLELGKSTNLDRLRLGKNQFTGRIPRTFGKISELSL  628

Query  2086  LDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSL  2265
             LD+S N LSG IP +L LC+KLTH+DLNNN LSG IP WLG+LPLLGELKLSSN+F GSL
Sbjct  629   LDISRNSLSGIIPVELGLCKKLTHIDLNNNYLSGVIPTWLGKLPLLGELKLSSNKFVGSL  688

Query  2266  PPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYE  2445
             P E+F+ + +L L L+ NSLNG++P EIGNL++LN LNL++NQL G +PSTIG L KL+E
Sbjct  689   PTEIFSLTNILTLFLDGNSLNGSIPQEIGNLQALNALNLEENQLSGPLPSTIGKLSKLFE  748

Query  2446  LRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGE  2625
             LRLSRN  +GEIP E+GQL+DLQS LD SYNN TG IP +I TL KLESLDLSHN L GE
Sbjct  749   LRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPKLESLDLSHNQLVGE  808

Query  2626  IPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKG  2805
             +P Q+ +M SLG LNLS N LEG+L K+++ W  D+FVGN+ LCGSPL  C   GS+N+ 
Sbjct  809   VPGQIGDMKSLGYLNLSYNNLEGKLKKQFSRWQADAFVGNAGLCGSPLSHCNRAGSKNQR  868

Query  2806  SM----VVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKP  2973
             S+    VV+ISA+S+  AI L+++    FFK N + +++ RG  +  SS+SSSSQA   P
Sbjct  869   SLSPKTVVIISAISSLAAIALMVLVIILFFKQNHDLFKKVRGGNSAFSSNSSSSQA---P  925

Query  2974  LFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDDLF  3153
             LF N   K DI+WDDIMEAT+ L++EF+IGSGG   VYKAEL NGET+A+K+I  KDDL 
Sbjct  926   LFSNGGAKSDIKWDDIMEATHYLNEEFMIGSGGSGKVYKAELKNGETIAVKKILWKDDLM  985

Query  3154  LDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKS  3333
              +KSF RE+KTL  IRHRHLV+LMGYCS+K +G N+LIYEYM NGSVWDWLH    N K 
Sbjct  986   SNKSFNREVKTLGTIRHRHLVKLMGYCSSKADGLNLLIYEYMANGSVWDWLHAN-ENTKK  1044

Query  3334  KKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKAL  3513
             K+ L WE RLKIA+GLAQGVEYLH+DCVP I+HRDIKSSNVLLDSN+EAHLGDFGLAK L
Sbjct  1045  KEVLGWETRLKIALGLAQGVEYLHYDCVPPIVHRDIKSSNVLLDSNIEAHLGDFGLAKIL  1104

Query  3514  TDNYDSLNTESNTWFAGSYGYIAPE  3588
             T NYD+ NTESNT FAGSYGYIAPE
Sbjct  1105  TGNYDT-NTESNTMFAGSYGYIAPE  1128



>ref|XP_010100604.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Morus 
notabilis]
 gb|EXB83241.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Morus 
notabilis]
Length=1267

 Score =  1207 bits (3122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 716/1120 (64%), Positives = 876/1120 (78%), Gaps = 20/1120 (2%)
 Frame = +1

Query  280   VRCQNTSSTLRVLLEVKRSFVLQLQG----WSEKNPNYCSWQGVSC------DGslkvvs  429
             V CQ+  +TL  LLEVK++FV   +G    WS+ N N+C+W+GVSC        S +VV 
Sbjct  28    VLCQDKLTTLTTLLEVKKAFVEDPEGVLHTWSKTNKNFCNWRGVSCGLNDSVADSGQVVG  87

Query  430   lnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPI  609
             LNLSDSSL G+ISPS G L  L HLDLSSN LSG IP  LSN S LESL+LF+N+L GPI
Sbjct  88    LNLSDSSLAGAISPSFGRLQSLTHLDLSSNRLSGSIPLTLSNFSHLESLILFTNQLTGPI  147

Query  610   PSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqn  789
             PSQLG LT+L+ LRIGDNGLTG IP SFG L NL  LGLASC L+G IP  LGRL+QL+N
Sbjct  148   PSQLGQLTSLRVLRIGDNGLTGTIPESFGGLMNLEVLGLASCQLTGSIPSALGRLSQLRN  207

Query  790   lnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEI  969
             L +Q+N L GP+P E+ N SSL  F+AA N +NG+IP E+G L++L  LNL NN+L+GE+
Sbjct  208   LIVQENQLSGPIPSELGNCSSLEIFTAANNDINGTIPPEMGRLQNLQNLNLVNNSLSGEL  267

Query  970   PGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQF  1149
             P QL  +S L YLNL GNQL G IPKSL++L NL +LDLS N+L   +P EFG M QLQF
Sbjct  268   PSQLSSLSRLAYLNLAGNQLVGPIPKSLSQLGNLYNLDLSRNKLTRGIPEEFGDMDQLQF  327

Query  1150  LALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGS  1329
             L L+ NNLSG IPK +CSNAT+L+ L LSET + GEIP ELSQC+ L+QLDLSNNTL+GS
Sbjct  328   LVLSKNNLSGVIPKKICSNATSLEHLFLSETQIHGEIPVELSQCKSLKQLDLSNNTLSGS  387

Query  1330  IPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQ  1509
             IP E+Y+L  LTDL+LNNN+L G I+P + NLTNLQT++++HNNL G++P+EIGMLG L+
Sbjct  388   IPVEIYKLVALTDLLLNNNSLVGPIAPLIGNLTNLQTVTMYHNNLKGDLPKEIGMLGKLE  447

Query  1510  IIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGE  1689
             I++LYEN   GEIP+EIGNCSSLQ +DF+GN+F+G+IPIT+GRLK L  LHLR+N+L G 
Sbjct  448   ILYLYENQLHGEIPLEIGNCSSLQMVDFFGNRFSGQIPITIGRLKELKLLHLRQNELVGS  507

Query  1690  IPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLT  1869
             IPA+LGNCH+L+ LDLADN+LSG IP T G++++L +L+LYNNSLEG LPD L +L NLT
Sbjct  508   IPATLGNCHKLNILDLADNNLSGGIPLTIGFIKSLEQLLLYNNSLEGTLPDSLSHLTNLT  567

Query  1870  RINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKI  2049
             R+NLS N  +GS+A +C S+S LSFDVT+N F  EIPS LGNS SL+RLRLG N FT  I
Sbjct  568   RVNLSGNRLNGSVAVLCGSNSLLSFDVTDNDFGHEIPSALGNSHSLERLRLGGNHFTENI  627

Query  2050  PMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllge  2229
             P TL  +RELS+LDLSGN L+G +P +LS C+KL+H+ LNNNLLSG IP WLG    LGE
Sbjct  628   PTTLRELRELSMLDLSGNLLTGSVPDELSFCKKLSHVVLNNNLLSGAIPPWLGSFSQLGE  687

Query  2230  lklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLK-SLNVLNLDDNQLCGS  2406
             L+LS+N+FSG +P E+FNCSKLLVLSL +NSLNGTLP EI  L  SLNVLNL+ NQL G 
Sbjct  688   LRLSTNRFSGPIPREIFNCSKLLVLSLNDNSLNGTLPDEICKLAPSLNVLNLERNQLSGP  747

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IP  IG L KLYELRLSRN F GEIP E+GQL++LQS+LD S+NNL+G+IP +IG LSKL
Sbjct  748   IPPAIGKLEKLYELRLSRNNFDGEIPEELGQLRNLQSILDLSHNNLSGQIPLAIGELSKL  807

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSP  2766
             E LDLS N L GE+PPQV EMSSL +LNLS N LEG+L K+++HWP  +F GN  LCG+P
Sbjct  808   EELDLSDNQLVGEVPPQVGEMSSLVKLNLSYNTLEGKLGKQFSHWPAKAFQGNLQLCGNP  867

Query  2767  LGSCR-DKGSRNKGSM----VVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENY  2931
             LG C  D   + K  +    VV+ISA+    AI LLL+ AA F KH RE++  R    +Y
Sbjct  868   LGECNADASGKQKSGLSQISVVIISAVCTLAAIALLLIVAATFLKHRRESF-GRTSDVSY  926

Query  2932  AsssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGE  3111
               SSSS++  +R  LF N + +++ RW+DIMEATNNLS++FIIG+GG   ++KAEL NGE
Sbjct  927   IYSSSSTATQRRLLLFQNGSTRQEFRWEDIMEATNNLSNKFIIGTGGSGVIFKAELPNGE  986

Query  3112  TVAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKG-EGSNVLIYEYMENG  3288
             TVA+K+I  KD L  +KSF RE+KTL RIRHRHLV+LMGYCSNKG  G+N+LIYEYMENG
Sbjct  987   TVAVKKISSKDSLLANKSFVREVKTLGRIRHRHLVKLMGYCSNKGASGANLLIYEYMENG  1046

Query  3289  SVWDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDS  3468
             SVWDWLH QP N K K++LDWE RL+IA+GLAQGVEYLHHDC+PKIIHRDIKSSNVLLDS
Sbjct  1047  SVWDWLHKQPVNGKRKRTLDWEERLRIAVGLAQGVEYLHHDCMPKIIHRDIKSSNVLLDS  1106

Query  3469  NMEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             NMEAHLGDFGLAK L ++    +T+S+TWFAGS+GY+APE
Sbjct  1107  NMEAHLGDFGLAKPLLEHES--HTDSSTWFAGSFGYVAPE  1144



>ref|XP_006279730.1| hypothetical protein CARUB_v10027518mg [Capsella rubella]
 gb|EOA12628.1| hypothetical protein CARUB_v10027518mg [Capsella rubella]
Length=1253

 Score =  1201 bits (3108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/1110 (61%), Positives = 841/1110 (76%), Gaps = 22/1110 (2%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslgg  459
             S  L  LLE+K +FV        L+ W+  +PN+C+W GV+C G +       S    G 
Sbjct  29    SDDLGTLLELKNAFVTNPKDETILKTWNSDDPNFCNWTGVTCGGRVITGLNLSSLGLTGS  88

Query  460   sispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlV-GPIPSQLGLLTN  636
                              S+  + GPIP  LSNLS+    L   +  + G IPSQLG L N
Sbjct  89    ISPSIGRFTNLTHIDLSSNRLV-GPIPTTLSNLSASLESLHLFSNQLSGVIPSQLGSLVN  147

Query  637   LQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllE  816
             L++L++GDN L G IP +FGNL NL  L LASC L+G IP QLGRL QLQ L LQ N LE
Sbjct  148   LKSLKLGDNELHGSIPETFGNLVNLQLLALASCRLTGSIPSQLGRLVQLQLLILQDNELE  207

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             GP+P EI N +SL  F+AA N LNGS+P EL  L +LH LNLANN ++GE+P QLG++ +
Sbjct  208   GPIPAEIGNCTSLVLFTAAENRLNGSLPAELSRLVNLHTLNLANNRVSGELPSQLGDLVN  267

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             L YLNL+GN+L GSIPK L +L NLQ+LDLS N L GE+   F +M QL+FL L+ N LS
Sbjct  268   LQYLNLIGNKLQGSIPKRLTELVNLQTLDLSWNSLTGEIHEGFWNMSQLEFLILSKNRLS  327

Query  1177  GTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
             G++PK++CSN T+L+ L LSET LSGEIP E+S+C++L++LDLSNNT+ G IP+ L++L 
Sbjct  328   GSLPKTICSNNTSLKYLSLSETQLSGEIPAEISKCQLLRELDLSNNTITGRIPDSLFQLV  387

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
             +L +L LNNNTLEGT+SPS++NLTNLQ  +L+ NNL G+VP+EIG LG+L+ ++LYEN F
Sbjct  388   ELRNLYLNNNTLEGTLSPSISNLTNLQEFTLYRNNLEGKVPKEIGFLGELEFLYLYENRF  447

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
             SGEIP+EIGNC+ L+ +D++GN+ +G+IP ++GRLK L  LHLREN L G +PA+LGNCH
Sbjct  448   SGEIPMEIGNCTKLKAMDWFGNRLSGEIPSSIGRLKELTLLHLRENQLVGNMPATLGNCH  507

Query  1717  QLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNF  1896
             QL  LDLADN LSG+IPA+FG+L AL + M+YNNSL+G+ P  L NL NLTRIN S N F
Sbjct  508   QLTILDLADNRLSGSIPASFGFLTALKQFMIYNNSLQGNFPSSLINLKNLTRINFSSNKF  567

Query  1897  SGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRE  2076
             +G+I+P+C S S+LSFDVT+N F+ +IP  LG SP+L+RLRLG N+FTG+IP T G IRE
Sbjct  568   NGTISPLCGSTSYLSFDVTDNGFEGDIPLQLGKSPNLNRLRLGKNQFTGRIPWTFGKIRE  627

Query  2077  LSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFS  2256
             LSLLD+S N L+G IP +L LC+ LTH+DLNNN LSG IP WLG+LPLLGELKLSSNQF 
Sbjct  628   LSLLDISSNSLTGIIPEELGLCKNLTHIDLNNNFLSGVIPPWLGKLPLLGELKLSSNQFI  687

Query  2257  GSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGK  2436
             G LP ELFN ++LLVLSL++NSLNG++P EIGNL++LN LNL+ NQ+ G +PS+IG L K
Sbjct  688   GPLPIELFNLTQLLVLSLDDNSLNGSIPQEIGNLEALNALNLEKNQISGPLPSSIGKLSK  747

Query  2437  LYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDL  2616
             LYELRLSRN  + +IP EVGQL+DLQS LD SYNN TG IP ++ TL KLESLDLSHN L
Sbjct  748   LYELRLSRNALTRDIPVEVGQLQDLQSALDLSYNNFTGHIPATVSTLHKLESLDLSHNQL  807

Query  2617  TGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSR  2796
              GE+P Q+ EM SLG LNLS N LEG+L K+++ W  D+FVGN+ LCGSPL  C ++ S+
Sbjct  808   VGEVPGQIGEMKSLGYLNLSYNNLEGKLKKQFSRWQADAFVGNAGLCGSPLSHC-NRTSK  866

Query  2797  NKGSM----VVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQ  2964
             N+ S+    VV+ISA+S+ VAI L+++    FFK + + +++ RG  +  SS SSSSQA 
Sbjct  867   NQRSLSPKTVVIISAVSSLVAIALMVLVIFLFFKQSHDLFKKGRGGSSAFSSDSSSSQA-  925

Query  2965  RKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKD  3144
               PLF N   K DI+W+DIMEAT+ L+DEF+IGSGG   VYKAEL  GET+A+K++  KD
Sbjct  926   --PLFRNGGAKSDIKWEDIMEATHYLNDEFMIGSGGSGKVYKAELKKGETIAVKKVLWKD  983

Query  3145  DLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPAN  3324
             DL  +KSF RE+KTL RIRHRHLV+LMGYCS+K EG N+LIYEYMENGSVWDW+H   AN
Sbjct  984   DLMSNKSFNREVKTLGRIRHRHLVKLMGYCSSKAEGLNLLIYEYMENGSVWDWIH---AN  1040

Query  3325  NKSKKS--LDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFG  3498
              K+KK   LDWE RLKIA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEAHLGDFG
Sbjct  1041  EKTKKKEVLDWETRLKIAVGLAQGVEYLHHDCVPSIVHRDIKSSNVLLDSNMEAHLGDFG  1100

Query  3499  LAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             LAK L++N D+ NTESNT FAGSYGYIAPE
Sbjct  1101  LAKILSENCDT-NTESNTLFAGSYGYIAPE  1129



>ref|XP_004504632.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Cicer arietinum]
Length=1267

 Score =  1196 bits (3094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 729/1118 (65%), Positives = 887/1118 (79%), Gaps = 21/1118 (2%)
 Frame = +1

Query  292   NTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC------DGslkvvslnls  441
             +  + L+VLLEVK+SF       L  WSE N +YCSW+GVSC      D S+ VVSLNLS
Sbjct  30    DKDTILKVLLEVKKSFDKDPQNVLSDWSENNTDYCSWRGVSCGLNSLVDDSVHVVSLNLS  89

Query  442   dsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQL  621
             DSSL GSISPSLG L +LLHLD+SSN L+G IP  LSNL+SLESLLLFSN+L G +P++ 
Sbjct  90    DSSLTGSISPSLGRLKNLLHLDISSNFLTGHIPRNLSNLASLESLLLFSNQLSGSVPTEF  149

Query  622   GLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlq  801
             G LT+L+ +R+GDN LTG IP+S G L NLVTLGLASC L+G IPP+LG+L+ ++NL LQ
Sbjct  150   GSLTSLRVMRLGDNPLTGMIPSSLGKLFNLVTLGLASCELTGSIPPELGQLSLMENLLLQ  209

Query  802   qnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQL  981
              N L GP+P E+ N SSLT F+A+ N LNGSIP EL  L +L ILNL NN+L+GEIP QL
Sbjct  210   DNELMGPIPSELGNCSSLTVFTASNNKLNGSIPSELSQLNNLQILNLGNNSLSGEIPSQL  269

Query  982   GEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALT  1161
             GEMS LVYLNL+ NQL G+IP SLA+L NLQ LDLS N+L+G +P EFG MGQL ++ L+
Sbjct  270   GEMSELVYLNLMDNQLEGAIPPSLAQLGNLQKLDLSMNKLSGGIPDEFGDMGQLGYMVLS  329

Query  1162  SNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEE  1341
              NNL+  IP+++CSNAT+L+ LMLS++GL GEIP ELSQC+ L+QLDLSNN+LNGSIP E
Sbjct  330   GNNLNSVIPRTICSNATSLEHLMLSQSGLIGEIPAELSQCQSLKQLDLSNNSLNGSIPLE  389

Query  1342  LYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFL  1521
             LY L  LTDL+LNNN+L G+ISP + N ++LQTL+L+HNNL G +PREIGMLG L+I++L
Sbjct  390   LYGLLGLTDLLLNNNSLVGSISPFIGNFSSLQTLALYHNNLQGALPREIGMLGKLEILYL  449

Query  1522  YENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPAS  1701
             Y+N  SG IP+EIGNCSSLQ +DF GN+F+G+IPIT+GRLK L FLHLR+N+L GEIPA+
Sbjct  450   YDNWLSGAIPMEIGNCSSLQMVDFSGNRFSGEIPITIGRLKKLNFLHLRQNELVGEIPAT  509

Query  1702  LGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINL  1881
             LGNCH+++ LDLADN LSGAIPATFG+L +L +LMLYNNSLEG+LP  L N+ NLTR+NL
Sbjct  510   LGNCHKMNILDLADNQLSGAIPATFGFLESLQKLMLYNNSLEGNLPHQLINVANLTRVNL  569

Query  1882  SHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTL  2061
             S N  +GS+A +C+S SFLSFDVT+N F  EIPS LGNSPSL RLRLG+N+F+G+IP TL
Sbjct  570   SKNRLNGSLAALCSSQSFLSFDVTDNEFASEIPSQLGNSPSLQRLRLGNNKFSGEIPRTL  629

Query  2062  GLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklS  2241
             G I +LSLLDLSGN L+G IP +LSLC KL ++DLN+NLL G IP WLG LP LGELKLS
Sbjct  630   GKIHDLSLLDLSGNSLTGPIPAELSLCNKLAYIDLNSNLLFGQIPFWLGSLPQLGELKLS  689

Query  2242  SNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTI  2421
             SN FSG LP  LF CSKLLVLSL +NSLNG+LP +IG+L  LNVL LD N+  G IP  I
Sbjct  690   SNNFSGPLPLGLFKCSKLLVLSLNDNSLNGSLPTDIGDLTYLNVLRLDRNKFSGLIPPEI  749

Query  2422  GGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDL  2601
             G L KLYEL+LSRN F+GE+P E+G+L++LQ VLD SYN+L+G IP S+GTLSKLE+LDL
Sbjct  750   GKLSKLYELQLSRNSFNGEMPIEIGKLQNLQIVLDLSYNSLSGRIPDSLGTLSKLEALDL  809

Query  2602  SHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCR  2781
             SHN LTG+IPPQV EMSSLG+L+LS N L+G+LDKR+  WP + F GNS+LCGSPL  C 
Sbjct  810   SHNQLTGKIPPQVGEMSSLGKLDLSYNNLQGKLDKRFTRWPNEVFEGNSNLCGSPLDLCN  869

Query  2782  --DKGSRNKGSM---VVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAssss  2946
               D   R +  +    VVI ++ +T+A I LL+ +   F  N++ + R+  K      SS
Sbjct  870   SDDTSGREQSGLSESSVVIISVISTLAAISLLILSVRIFCKNKQEFLRKDSKM-SYVYSS  928

Query  2947  sssQAQRKPLFG-NAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAI  3123
             SSS AQR PLF  NAA KRD RW+DIM+ATNNLSD+F+IGSGG   +YKA+L  GETVA+
Sbjct  929   SSSHAQRLPLFQLNAAGKRDFRWEDIMDATNNLSDDFMIGSGGSGKIYKADLVTGETVAV  988

Query  3124  KRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCS--NKGEGSNVLIYEYMENGSVW  3297
             K+I  KDD  L+KSF REI+TL RI+HRHLV+L+G+CS  NKG G N+LIYEYMENGS+W
Sbjct  989   KKISSKDDFLLNKSFLREIQTLGRIKHRHLVKLIGFCSSRNKGAGWNLLIYEYMENGSLW  1048

Query  3298  DWLHNQPAN-NKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNM  3474
             DWLH +  N  K K SLDWE R KIA+GLAQGVEYLHHDC P IIHRDIKSSN+LLDSNM
Sbjct  1049  DWLHGKSVNAGKVKNSLDWETRFKIAVGLAQGVEYLHHDCAPNIIHRDIKSSNILLDSNM  1108

Query  3475  EAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             EAHLGDFGLAKAL ++YDS NTESN+ FAGSYGY+APE
Sbjct  1109  EAHLGDFGLAKALVESYDS-NTESNSCFAGSYGYMAPE  1145



>ref|XP_010494516.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Camelina sativa]
Length=1248

 Score =  1192 bits (3084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 663/1109 (60%), Positives = 830/1109 (75%), Gaps = 21/1109 (2%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslgg  459
             S  LR LLE+K SFV        L+ W+  +PN+C+W GV+C G + +     S    G 
Sbjct  24    SDDLRTLLELKNSFVTNPKDETILRTWNADDPNFCNWTGVTCGGRVIIGLNLSSLGLTGS  83

Query  460   sispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlV-GPIPSQLGLLTN  636
                              S+  + GPIP  LSNLS+    L   +  + G IPSQLG L N
Sbjct  84    ISPSIGRFSNLTHIDLSSNRLV-GPIPTTLSNLSASLETLHLFSNQLSGEIPSQLGSLVN  142

Query  637   LQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllE  816
             L++L++GDN L G IP +FGNL +L  L LASC L+G IP QLGRL QLQ L LQ N LE
Sbjct  143   LKSLKLGDNELNGSIPETFGNLVSLRMLALASCKLTGTIPSQLGRLVQLQALILQDNELE  202

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             GP+PPEI N +SL   +AA+N LNGS+P EL  L +L  LNL  N+ +GE+P QLG++ S
Sbjct  203   GPIPPEIGNCTSLVLITAAVNRLNGSLPAELSRLANLQTLNLGKNSFSGELPSQLGDLVS  262

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             L YLNL+GN+L G IP+ L +L NLQ+LDLS N L GEL  EF  M QL  L L++N LS
Sbjct  263   LTYLNLIGNKLQGLIPQRLTELVNLQTLDLSSNNLTGELHEEFWKMDQLVSLVLSNNRLS  322

Query  1177  GTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
             G++PK++CSN T+L+ L LSET LSGEIP E+ +C+ L+ LDLSNNT  G IP+ L+ L 
Sbjct  323   GSLPKTICSNNTSLKQLALSETQLSGEIPAEIGKCQSLEALDLSNNTFTGRIPDSLFHLV  382

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
             +LT+L LNNNTLEGT+SPS++NLT LQ  +L+ NNL G++P+EIG+LG L+I+++Y+N F
Sbjct  383   ELTNLYLNNNTLEGTLSPSISNLTKLQEFTLYRNNLEGKLPKEIGLLGKLEILYIYDNRF  442

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
             SGE+P+EIGNC+ L+ ID+YGN+ +G+IP ++GRLK L  LHLREN+L G IPA+LGNC 
Sbjct  443   SGEMPIEIGNCTKLKAIDWYGNRISGEIPSSIGRLKELTLLHLRENELVGNIPATLGNCD  502

Query  1717  QLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNF  1896
             +L  LDLADN LSG++P++ G+L AL +L++YNNSL+G+LP  L NL NLTRIN+S N F
Sbjct  503   KLTILDLADNKLSGSVPSSLGFLTALEQLLIYNNSLQGNLPSSLVNLKNLTRINISSNKF  562

Query  1897  SGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRE  2076
             +GSI+P+C S S+LSFDVT N F+ EIP  LG SP+LDRLRLG N+FTG+IP T G IRE
Sbjct  563   NGSISPLCGSSSYLSFDVTENRFEGEIPLELGKSPNLDRLRLGKNQFTGRIPWTFGKIRE  622

Query  2077  LSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFS  2256
             LSLLD+S N ++G IP +L LC+KLTH+DLN N LSG IP WLG+LPLLGELKLSSNQF 
Sbjct  623   LSLLDISSNSITGIIPLELGLCKKLTHIDLNGNFLSGIIPPWLGKLPLLGELKLSSNQFI  682

Query  2257  GSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGK  2436
             GSLP ELF+ +KLLVLSL+ NSLNG++P EIGNL++LN LNL+ NQ+ G +PS+IG L K
Sbjct  683   GSLPTELFDLTKLLVLSLDGNSLNGSIPQEIGNLEALNALNLEKNQISGHLPSSIGKLSK  742

Query  2437  LYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDL  2616
             LYELRLSRN  +G+IP E+GQL+DLQS LD SYNN TG IP  + TL KLESLDLSHN L
Sbjct  743   LYELRLSRNALTGDIPVEIGQLQDLQSALDLSYNNFTGHIPSMVSTLHKLESLDLSHNQL  802

Query  2617  TGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGS-  2793
              GE+P Q+ EM SLG LNLS N LEG+L K+++ W  D+FVGN+ LCGSPL  C   GS 
Sbjct  803   VGEVPGQIGEMKSLGYLNLSYNNLEGKLKKQFSRWQADAFVGNAGLCGSPLSHCNRAGSN  862

Query  2794  RNKGSM----VVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQA  2961
             +N+ S     VV ISA+S+ VAI L+++    FFK + + +++RRG    ++ SS SS +
Sbjct  863   KNQRSFSPKTVVFISAISSLVAIALMVLVIFLFFKQSHDVFKKRRGGN--SAVSSDSSSS  920

Query  2962  QRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRK  3141
              + PLF N   K DI+W++IMEAT  L+DE++IGSGG   VYKAEL NGET+A+K+I  K
Sbjct  921   SQAPLFRNGGAKSDIKWEEIMEATRYLNDEYMIGSGGSGKVYKAELKNGETIAVKKILWK  980

Query  3142  DDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPA  3321
             DDL  +KSF RE+KTL RIRHRHLV+LMGYCS+K EG N+LIYEYMENGSVWDW+H    
Sbjct  981   DDLMSNKSFNREVKTLGRIRHRHLVKLMGYCSSKAEGLNLLIYEYMENGSVWDWIH----  1036

Query  3322  NNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGL  3501
               K K+ L WE RLKIA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEAHLGDFGL
Sbjct  1037  -TKKKECLGWETRLKIAVGLAQGVEYLHHDCVPPIVHRDIKSSNVLLDSNMEAHLGDFGL  1095

Query  3502  AKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             AK L++NYD+ NTESNT FAGSYGYIAPE
Sbjct  1096  AKILSENYDT-NTESNTMFAGSYGYIAPE  1123



>dbj|BAB08823.1| receptor-like protein kinase [Arabidopsis thaliana]
Length=1236

 Score =  1192 bits (3083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/1101 (60%), Positives = 820/1101 (74%), Gaps = 25/1101 (2%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsis  468
             L+ LLE+K SF+        L+ W+  +P+YC+W GV+C G   +          G    
Sbjct  30    LQTLLELKNSFITNPKEEDVLRDWNSGSPSYCNWTGVTCGGREIIGLNLSGLGLTGSISP  89

Query  469   pslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlV-GPIPSQLGLLTNLQA  645
                     +     S+  + GPIP  LSNLSS    L   + L+ G IPSQLG L NL++
Sbjct  90    SIGRFNNLIHIDLSSNRLV-GPIPTTLSNLSSSLESLHLFSNLLSGDIPSQLGSLVNLKS  148

Query  646   LRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPL  825
             L++GDN L G IP +FGNL NL  L LASC L+GLIP + GRL QLQ L LQ N LEGP+
Sbjct  149   LKLGDNELNGTIPETFGNLVNLQMLALASCRLTGLIPSRFGRLVQLQTLILQDNELEGPI  208

Query  826   PPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVY  1005
             P EI N +SL  F+AA N LNGS+P EL  LK+L  LNL +N+ +GEIP QLG++ S+ Y
Sbjct  209   PAEIGNCTSLALFAAAFNRLNGSLPAELNRLKNLQTLNLGDNSFSGEIPSQLGDLVSIQY  268

Query  1006  LNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTI  1185
             LNL+GNQL G IPK L +L NLQ+LDLS N L G +  EF  M QL+FL L  N LSG++
Sbjct  269   LNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIHEEFWRMNQLEFLVLAKNRLSGSL  328

Query  1186  PKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLT  1365
             PK++CSN T+L+ L LSET LSGEIP E+S C+ L+ LDLSNNTL G IP+ L++L +LT
Sbjct  329   PKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSLKLLDLSNNTLTGQIPDSLFQLVELT  388

Query  1366  DLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGE  1545
             +L LNNN+LEGT+S S++NLTNLQ  +L+HNNL G+VP+EIG LG L+I++LYEN FSGE
Sbjct  389   NLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGE  448

Query  1546  IPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLD  1725
             +PVEIGNC+ LQ ID+YGN+ +G+IP ++GRLK L  LHLREN+L G IPASLGNCHQ+ 
Sbjct  449   MPVEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDLTRLHLRENELVGNIPASLGNCHQMT  508

Query  1726  TLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGS  1905
              +DLADN LSG+IP++FG+L AL   M+YNNSL+G+LPD L NL NLTRIN S N F+GS
Sbjct  509   VIDLADNQLSGSIPSSFGFLTALELFMIYNNSLQGNLPDSLINLKNLTRINFSSNKFNGS  568

Query  1906  IAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSL  2085
             I+P+C S S+LSFDVT N F+ +IP  LG S +LDRLRLG N+FTG+IP T G I ELSL
Sbjct  569   ISPLCGSSSYLSFDVTENGFEGDIPLELGKSTNLDRLRLGKNQFTGRIPRTFGKISELSL  628

Query  2086  LDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSL  2265
             LD+S N LSG IP +L LC+KLTH+DLNNN LSG IP WLG+LPLLGELKLSSN+F GSL
Sbjct  629   LDISRNSLSGIIPVELGLCKKLTHIDLNNNYLSGVIPTWLGKLPLLGELKLSSNKFVGSL  688

Query  2266  PPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYE  2445
             P E+F+ + +L L L+ NSLNG++P EIGNL++LN LNL++NQL G +PSTIG L KL+E
Sbjct  689   PTEIFSLTNILTLFLDGNSLNGSIPQEIGNLQALNALNLEENQLSGPLPSTIGKLSKLFE  748

Query  2446  LRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGE  2625
             LRLSRN  +GEIP E+GQL+DLQS LD SYNN TG IP +I TL KLESLDLSHN L GE
Sbjct  749   LRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPKLESLDLSHNQLVGE  808

Query  2626  IPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKG  2805
             +P Q+ +M SLG LNLS N LEG+L K+++ W  D+FVGN+ LCGSPL  C         
Sbjct  809   VPGQIGDMKSLGYLNLSYNNLEGKLKKQFSRWQADAFVGNAGLCGSPLSHCNR-------  861

Query  2806  SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGN  2985
                  +SA+S+  AI L+++    FFK N + +++ RG  +  SS+SSSSQA   PLF N
Sbjct  862   -----VSAISSLAAIALMVLVIILFFKQNHDLFKKVRGGNSAFSSNSSSSQA---PLFSN  913

Query  2986  AAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDDLFLDKS  3165
                K DI+WDDIMEAT+ L++EF+IGSGG   VYKAEL NGET+A+K+I  KDDL  +KS
Sbjct  914   GGAKSDIKWDDIMEATHYLNEEFMIGSGGSGKVYKAELKNGETIAVKKILWKDDLMSNKS  973

Query  3166  FAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKKSL  3345
             F RE+KTL  IRHRHLV+LMGYCS+K +G N+LIYEYM NGSVWDWLH    N K K+ L
Sbjct  974   FNREVKTLGTIRHRHLVKLMGYCSSKADGLNLLIYEYMANGSVWDWLHAN-ENTKKKEVL  1032

Query  3346  DWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNY  3525
              WE RLKIA+GLAQGVEYLH+DCVP I+HRDIKSSNVLLDSN+EAHLGDFGLAK LT NY
Sbjct  1033  GWETRLKIALGLAQGVEYLHYDCVPPIVHRDIKSSNVLLDSNIEAHLGDFGLAKILTGNY  1092

Query  3526  DSLNTESNTWFAGSYGYIAPE  3588
             D+ NTESNT FAGSYGYIAPE
Sbjct  1093  DT-NTESNTMFAGSYGYIAPE  1112



>gb|KHG25582.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Gossypium 
arboreum]
Length=1260

 Score =  1190 bits (3079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/1119 (66%), Positives = 899/1119 (80%), Gaps = 21/1119 (2%)
 Frame = +1

Query  280   VRCQNTSSTLRVLLEVKRSFVLQ----LQGWS-EKNPNYCSWQGVSCD-----Gslkvvs  429
             V CQN    L +LL++KRSFV      L  WS + NPN+C+W GV+C       S  VVS
Sbjct  25    VFCQNQD--LSLLLDIKRSFVQDPQNVLHDWSSQANPNFCAWTGVACGFISPANSFHVVS  82

Query  430   lnlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPI  609
             LNLS  SLGGS+SPSLG L +LLHLDLSSN L+GPIP  LSNLSSLESLLL+SN+L GPI
Sbjct  83    LNLSGFSLGGSLSPSLGRLQNLLHLDLSSNRLTGPIPTTLSNLSSLESLLLYSNQLSGPI  142

Query  610   PSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqn  789
             P QLG  T+L+ +RIGDN LTG IP+SFGNL NLVTLGLASC L+G IP +LG+LT+L++
Sbjct  143   PPQLGSFTSLRVMRIGDNELTGPIPSSFGNLVNLVTLGLASCRLTGPIPRELGQLTRLED  202

Query  790   lnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEI  969
             L LQ N LEGP+PP++ N SSL  F+AA N+LNGSIP ELG LK+L +LNL NN+L+G++
Sbjct  203   LVLQDNQLEGPIPPQLGNCSSLNVFTAAFNNLNGSIPAELGRLKNLQLLNLINNSLSGDL  262

Query  970   PGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQF  1149
             P QLGE+S LVYL+L GN L G+IPKSLA L NL++LDLS N+L G +P E G + +L +
Sbjct  263   PSQLGELSQLVYLSLTGNHLEGAIPKSLANLRNLENLDLSLNKLTGGIPEELGKLSKLVY  322

Query  1150  LALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGS  1329
             L L++NNLSG IP+++CSN +NL+ L+LSE  L GEIP EL  CR L+QLDLSNNTLNGS
Sbjct  323   LVLSNNNLSGPIPRNICSNTSNLEHLILSEVQLLGEIPVELRLCRALKQLDLSNNTLNGS  382

Query  1330  IPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQ  1509
             IP ELYEL +LTDL L+NN+L G+ISPS+ANL+NLQTL+LFHNNL G +P EIGML  L+
Sbjct  383   IPVELYELRELTDLYLHNNSLVGSISPSIANLSNLQTLALFHNNLEGNLPGEIGMLSKLE  442

Query  1510  IIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGE  1689
             I++LYEN  SG+IP EIGNCSSL+ +DF+GN+FTG+IP+T+GRLK L  LHLR+N L GE
Sbjct  443   ILYLYENRLSGDIPWEIGNCSSLKMMDFFGNRFTGEIPLTIGRLKELQLLHLRQNALVGE  502

Query  1690  IPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLT  1869
             IPASLGNC+ L  LDLADNHLSG +P++FG+L+AL +LMLYNNSLEG+LP  L +L NLT
Sbjct  503   IPASLGNCNHLTILDLADNHLSGGVPSSFGFLQALEQLMLYNNSLEGNLPASLISLANLT  562

Query  1870  RINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKI  2049
             R+NLS N  +GSIA +C+S S LSFDVTNNAFD EIP  LGNSP+L+RLRLG NRF G I
Sbjct  563   RVNLSKNKMNGSIAALCSSSSLLSFDVTNNAFDGEIPEELGNSPALERLRLGKNRFIGTI  622

Query  2050  PMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllge  2229
             P +LG+IRELSLLDLSGN L+G IP +L LCRKL+H+DLN+N LSG +P WLG LP LGE
Sbjct  623   PGSLGMIRELSLLDLSGNLLTGPIPGELKLCRKLSHIDLNDNSLSGVVPSWLGDLPQLGE  682

Query  2230  lklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSI  2409
             L+LSSNQF G+L  +LFNCSKLLVL L+ NSLNGTL  EIG+L SLN+LNL+ NQL G I
Sbjct  683   LRLSSNQFFGALSRQLFNCSKLLVLQLDGNSLNGTLLGEIGDLLSLNILNLNRNQLSGPI  742

Query  2410  PSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLE  2589
             P+TIG L  LYEL+LS N FSG+IP E+GQLK+LQS+LD SYNNLTG+IPPSIGTLSKLE
Sbjct  743   PTTIGKLSNLYELQLSHNGFSGDIPTELGQLKNLQSILDLSYNNLTGQIPPSIGTLSKLE  802

Query  2590  SLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPL  2769
             +LDLSHN L GE+PP++ +MSSLG+LNLS N L+G+L K+ +HWP ++F GN +LCGSPL
Sbjct  803   ALDLSHNLLLGEVPPEIGDMSSLGKLNLSHNNLQGKLSKQLSHWPAEAFEGNLNLCGSPL  862

Query  2770  GSCRDKGSRNKGSM-----VVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYA  2934
               C +  S  + +      VVVISA++   AI LL++    F K  RE +  +RG     
Sbjct  863   DGCDNLASGQQQAALSETSVVVISAIATLAAIALLVLVVTVFLKQRREYF--KRGSVVNF  920

Query  2935  sssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGET  3114
             + SSSSSQA+R+ LF N A K+D +W+DIM AT NLSDE +IGSGG  T+Y+ EL  GET
Sbjct  921   TYSSSSSQARRRLLFHNGAAKQDYKWEDIMRATKNLSDELVIGSGGSGTIYRGELRTGET  980

Query  3115  VAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSV  3294
             VAIK+I  K+DL  ++SFAREIKTL RIRHRHLV+LMGYCSN+  G N+LIYEYMENGSV
Sbjct  981   VAIKKILWKEDLLSNRSFAREIKTLGRIRHRHLVKLMGYCSNRVAGFNLLIYEYMENGSV  1040

Query  3295  WDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNM  3474
             WDWLH QPAN K KKSLDWEAR+KIA+GLAQGVEYLHHDCVPKI+HRDIKSSNVLLDSNM
Sbjct  1041  WDWLHKQPANIK-KKSLDWEARIKIAVGLAQGVEYLHHDCVPKIVHRDIKSSNVLLDSNM  1099

Query  3475  EAHLGDFGLAKALTDNYDSL-NTESNTWFAGSYGYIAPE  3588
             EAHLGDFGLAK++ ++YDS  NTESN+WFAGSYGYIAPE
Sbjct  1100  EAHLGDFGLAKSVAESYDSASNTESNSWFAGSYGYIAPE  1138



>ref|XP_010688659.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Beta vulgaris subsp. vulgaris]
Length=1254

 Score =  1188 bits (3074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 714/1113 (64%), Positives = 856/1113 (77%), Gaps = 9/1113 (1%)
 Frame = +1

Query  274   GYVRCQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSCDGslkvvslnls  441
             GY  C   +STL  LL+VK+SF+      L+ WSEKNP++C W+G+ C+    VVSLNLS
Sbjct  22    GYSSCME-NSTLDTLLQVKKSFLEDPNDVLKDWSEKNPDFCKWRGIKCNSVGVVVSLNLS  80

Query  442   dsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQL  621
             +SSL GSISPSLG L HLLHLDLS N LSGPIP  LSNLS LESLLLFSN+L G IP+QL
Sbjct  81    ESSLSGSISPSLGGLQHLLHLDLSMNQLSGPIPTNLSNLSKLESLLLFSNQLSGTIPTQL  140

Query  622   GLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlq  801
              L+T+L  +RIGDN LTG IPTSFG L NLV LGLASC  +GLIPPQLG+LT L+NL LQ
Sbjct  141   SLITSLSVIRIGDNDLTGSIPTSFGQLSNLVILGLASCSFTGLIPPQLGKLTNLENLVLQ  200

Query  802   qnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQL  981
              N L GP+P E+ N ++L  F+AA+N LNGSIP+ELG L++L  LNLANN+L+GEIP Q+
Sbjct  201   DNFLVGPIPSELGNCTNLVVFTAAVNMLNGSIPQELGQLQNLQTLNLANNSLSGEIPDQI  260

Query  982   GEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALT  1161
             GE+  L YLNLLGN+L G IP+SLAKL NLQSLDLS N+L+GE+P EFG M QL  L L+
Sbjct  261   GELGQLNYLNLLGNELVGQIPRSLAKLGNLQSLDLSVNKLSGEIPAEFGQMNQLVSLVLS  320

Query  1162  SNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEE  1341
             SN++ G IP  +CSN T+L+ L LS   LSG IPPE+ QC+ L  LDL+NNTLNGSIP E
Sbjct  321   SNSIFGGIPPDICSNTTSLESLSLSNAQLSGGIPPEIGQCKSLTSLDLANNTLNGSIPVE  380

Query  1342  LYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFL  1521
             LY+L +LTDL L NN+L G+ISP++ NL+ LQT++L++N L G +P+EIGML  L++IF+
Sbjct  381   LYQLVELTDLYLYNNSLSGSISPAIGNLSKLQTVALYYNKLGGYLPKEIGMLEKLEVIFI  440

Query  1522  YENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPAS  1701
             Y N FSGEIP+EIGNCSSLQ IDFYGNQFTG++P T+G LK L FLHLR+NDL G+IPA+
Sbjct  441   YNNQFSGEIPLEIGNCSSLQMIDFYGNQFTGRLPATIGLLKELNFLHLRQNDLVGDIPAT  500

Query  1702  LGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINL  1881
             LGNC QL  LDLADN LSG IP T G L+AL + MLYNN+LEG++PD+L+NL NLTR+NL
Sbjct  501   LGNCQQLTILDLADNRLSGGIPVTLGNLKALQQFMLYNNTLEGNIPDELKNLSNLTRVNL  560

Query  1882  SHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTL  2061
             S+N  +GS+AP+ +S S LSFDVTNNAFD +IP  LGNSP L+RLRLGSN  TGKIP T 
Sbjct  561   SNNKLNGSLAPLSSSTSLLSFDVTNNAFDHDIPPQLGNSPLLERLRLGSNHLTGKIPRTF  620

Query  2062  GLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklS  2241
             G IRELSLLDLS N LSG IP +LS C+KL+H+DLN N L+G IP W G LP LGE+KLS
Sbjct  621   GFIRELSLLDLSRNSLSGSIPFELSFCKKLSHVDLNGNHLTGRIPTWFGSLPQLGEIKLS  680

Query  2242  SNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTI  2421
             SN   G LPP+LFNCSKLLVLSLE+N LNGTLP E+GNL SLNVL L  NQ+ GSIP +I
Sbjct  681   SNSLFGPLPPQLFNCSKLLVLSLEDNQLNGTLPTEVGNLASLNVLQLSKNQISGSIPPSI  740

Query  2422  GGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDL  2601
             G L KLYELRLS N  +GEIP E+ QL++LQ +LD S+NNL G IPP IG+LSKLE+L L
Sbjct  741   GKLSKLYELRLSYNHLNGEIPIEISQLQNLQIMLDLSFNNLIGHIPPQIGSLSKLEALSL  800

Query  2602  SHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCR  2781
             SHN LTG +PP +  M SL  LNLS N L G+LD++++HWP+D FVGN  LCG PL  C 
Sbjct  801   SHNQLTGSVPPPIGAMISLSMLNLSYNNLGGKLDEQFSHWPLDVFVGNKLLCGKPLEHCS  860

Query  2782  DKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQA  2961
                + N       +   S    +  +++         R     +R +E  ++ SSSSS  
Sbjct  861   ATNASNHKHSPKALILSSFLAVVAAVVLLLGLVICIRRRREIIKRSREVGSTFSSSSSNT  920

Query  2962  QRKPLFGNAAKKR-DIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPR  3138
              R+ L   + +++ + RWDDIM AT NLSD +IIGSGG  T+YKA+L  GETVA+K+I R
Sbjct  921   NRRLLNSKSPRRQPEYRWDDIMAATKNLSDAYIIGSGGSGTIYKADLAFGETVAVKKIAR  980

Query  3139  KDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQP  3318
             KDDL LDKSFAREIKTL RIRHRHLV+L+GYCSNKG  SN+LIY+YMENGSVWDWLH Q 
Sbjct  981   KDDLLLDKSFAREIKTLGRIRHRHLVKLIGYCSNKGAASNLLIYDYMENGSVWDWLHGQE  1040

Query  3319  ANNKS--KKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGD  3492
              +NK   KK LDWE RLKIA+GLAQGVEYLHHDCVPKIIHRDIKSSN+LLDSNMEAHLGD
Sbjct  1041  NSNKKVGKKGLDWETRLKIAVGLAQGVEYLHHDCVPKIIHRDIKSSNLLLDSNMEAHLGD  1100

Query  3493  FGLAKALTDNYDSLN-TESNTWFAGSYGYIAPE  3588
             FGLAK +  NY+S+N TES  WFAGSYGYIAPE
Sbjct  1101  FGLAKQIHSNYESINDTESGLWFAGSYGYIAPE  1133



>ref|XP_002863549.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39808.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1253

 Score =  1188 bits (3074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 694/1107 (63%), Positives = 851/1107 (77%), Gaps = 20/1107 (2%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsis  468
             L+ LLE+K SF+        L+ W+  +PN+C+W GV+C G  +++ LNLS   L GSIS
Sbjct  30    LQTLLELKNSFITNPKEENLLRDWNSGDPNFCNWTGVTCGGGREIIGLNLSGLGLTGSIS  89

Query  469   pslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlV-GPIPSQLGLLTNLQA  645
             PS+G   +L+H+DLSSN L GPIP  LSNLSS    L   +  + G +PSQLG L NL++
Sbjct  90    PSIGRFNNLIHIDLSSNRLVGPIPTTLSNLSSSLESLHLFSNQLSGELPSQLGSLVNLKS  149

Query  646   LRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPL  825
             L++GDN   G IP +FGNL NL  L LASC L+GLIP QLGRL Q+Q LNLQ N LEGP+
Sbjct  150   LKLGDNEFNGTIPETFGNLVNLQMLALASCRLTGLIPNQLGRLVQIQALNLQDNELEGPI  209

Query  826   PPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVY  1005
             P EI N +SL  FSAA+N LNGS+P EL  LK+L  LNL  NT +GEIP QLG++ +L Y
Sbjct  210   PAEIGNCTSLVMFSAAVNRLNGSLPAELSRLKNLQTLNLKENTFSGEIPSQLGDLVNLNY  269

Query  1006  LNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTI  1185
             LNL+ N+L G IPK L +L NLQ LDLS N L GE+  EF  M QL  L L  N LSG++
Sbjct  270   LNLINNELQGLIPKRLTELKNLQILDLSSNNLTGEIHEEFWRMNQLVALVLAKNRLSGSL  329

Query  1186  PKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLT  1365
             PK++CSN T+L+ L+LSET LSGEIP E+S+CR+L++LDLSNNTL G IP+ L++L +LT
Sbjct  330   PKTVCSNNTSLKQLVLSETQLSGEIPVEISKCRLLEELDLSNNTLTGRIPDSLFQLVELT  389

Query  1366  DLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGE  1545
             +L LNNNTLEGT+S S+ANLTNLQ  +L+HNNL G+VP+EIG LG L+I++LYEN FSGE
Sbjct  390   NLYLNNNTLEGTLSSSIANLTNLQEFTLYHNNLEGKVPKEIGFLGKLEIMYLYENRFSGE  449

Query  1546  IPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLD  1725
             +PVEIGNC+ L+ ID+YGN+ +G+IP ++GRLK L  LHLREN+L G IPASLGNCH++ 
Sbjct  450   MPVEIGNCTKLKEIDWYGNRLSGEIPSSIGRLKELTRLHLRENELVGNIPASLGNCHRMT  509

Query  1726  TLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGS  1905
              +DLADN LSG+IP++FG+L AL   M+YNNSL+G+LP  L NL NLTRIN S N F+G+
Sbjct  510   VMDLADNQLSGSIPSSFGFLTALELFMIYNNSLQGNLPHSLINLKNLTRINFSSNKFNGT  569

Query  1906  IAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSL  2085
             I+P+C S S+LSFDVT+N F+ +IP  LG   +LDRLRLG N+FTG+IP T G IRELSL
Sbjct  570   ISPLCGSSSYLSFDVTDNGFEGDIPLELGKCLNLDRLRLGKNQFTGRIPWTFGKIRELSL  629

Query  2086  LDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSL  2265
             LD+S N L+G IP +L LC+KLTH+DLN+N LSG IP WLG LPLLGELKL SNQF GSL
Sbjct  630   LDISRNSLTGIIPVELGLCKKLTHIDLNDNFLSGVIPPWLGNLPLLGELKLFSNQFVGSL  689

Query  2266  PPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYE  2445
             P E+FN + LL LSL+ NSLNG++P EIGNL++LN LNL+ NQL G +PS+IG L KL+E
Sbjct  690   PTEIFNLTSLLTLSLDGNSLNGSIPQEIGNLEALNALNLEKNQLSGPLPSSIGKLSKLFE  749

Query  2446  LRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGE  2625
             LRLSRN  +GEIP E+GQL+DLQS LD SYNN TG IP +I TL KLESLDLSHN L GE
Sbjct  750   LRLSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLHKLESLDLSHNQLVGE  809

Query  2626  IPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKG  2805
             +P Q+ +M SLG LNLS N LEG+L K+++ W  D+FVGN+ LCGSPL  C   GS  + 
Sbjct  810   VPGQIGDMKSLGYLNLSYNNLEGKLKKQFSRWQADAFVGNAGLCGSPLSHCNRAGSNKQR  869

Query  2806  SM----VVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKP  2973
             S+    VV+ISA+S+  AI L+++    FFK N + +++ RG  +  SS+SSSSQA   P
Sbjct  870   SLSPKTVVIISAISSLAAIALMVLVIVLFFKKNHDLFKKVRGGNSAFSSNSSSSQA---P  926

Query  2974  LFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDDLF  3153
             LF N   K DI+WDDIMEAT+ L+DEFIIGSGG   VYKA+L NGET+A+K+I  KDDL 
Sbjct  927   LFRNGGAKSDIKWDDIMEATHYLNDEFIIGSGGSGKVYKADLRNGETIAVKKILWKDDLM  986

Query  3154  LDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKS  3333
              +KSF RE+KTL  IRHRHLV+LMGYCS+K EG N+LIYEYM NGSVWDW+H   AN K+
Sbjct  987   SNKSFNREVKTLGTIRHRHLVKLMGYCSSKAEGLNLLIYEYMANGSVWDWIH---ANEKT  1043

Query  3334  KKS--LDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAK  3507
             KK   LDWE RLKIA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEAHLGDFGLAK
Sbjct  1044  KKKEILDWETRLKIAVGLAQGVEYLHHDCVPPIVHRDIKSSNVLLDSNMEAHLGDFGLAK  1103

Query  3508  ALTDNYDSLNTESNTWFAGSYGYIAPE  3588
              LT NYD+ NTESNT FAGSYGYIAPE
Sbjct  1104  ILTGNYDT-NTESNTMFAGSYGYIAPE  1129



>ref|XP_010481721.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Camelina sativa]
Length=1249

 Score =  1183 bits (3060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 665/1110 (60%), Positives = 830/1110 (75%), Gaps = 22/1110 (2%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslgg  459
             S  LR LLE+K SFV        L+ W+  +PN+C+W GV+C GS+ +     S    G 
Sbjct  24    SDDLRTLLELKNSFVTNPKDETILRTWNADDPNFCNWTGVTCGGSVIIGLNLSSLGLTGS  83

Query  460   sispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlV-GPIPSQLGLLTN  636
                              S+  + GPIP  LSNLS+    L   +  + G IPSQLG L N
Sbjct  84    ISPSIGRFNNLTHIDLSSNRLV-GPIPTTLSNLSASLETLHLFSNRLSGEIPSQLGSLVN  142

Query  637   LQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllE  816
             L++L++GDN L G IP +FGNL +L  L LASC L+G IP QLGRL QLQ L LQ N LE
Sbjct  143   LKSLKLGDNELNGSIPETFGNLVSLRMLALASCRLTGTIPSQLGRLVQLQALILQDNELE  202

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             G +PP+I N +SL   +AA+N LNGS+P EL  L +L  LNL  N+ +GE+P QLG++ +
Sbjct  203   GLIPPDIGNCTSLVLITAAVNRLNGSLPAELSRLVNLQTLNLGKNSFSGELPSQLGDLVN  262

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             L YLNL+GN+L G IPK L +L NLQ+LDLS N L GE+  EF +M QL  L L++N LS
Sbjct  263   LNYLNLIGNKLQGLIPKRLTELVNLQTLDLSSNNLTGEIHEEFWNMNQLVSLVLSNNRLS  322

Query  1177  GTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
             G++PK++CSN T+L+ L LSET LSGEIP E+ +C+ L+ LDLSNNTL G IP+ L+ L 
Sbjct  323   GSLPKTICSNNTSLKQLALSETQLSGEIPAEIGKCQSLEALDLSNNTLTGRIPDSLFHLV  382

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
             +LT+L LNNNTLEGT+SPS++NLT LQ  +L  NNL G+VP EIG+LG L+I++LYEN F
Sbjct  383   ELTNLYLNNNTLEGTLSPSISNLTKLQEFTLHRNNLEGKVPNEIGLLGKLEILYLYENRF  442

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
             SGE+P+EIGNC++L  ID+YGN+ +G+IP ++GRLK L  LHLREN+L G IPA+LGNC 
Sbjct  443   SGEMPIEIGNCTNLNAIDWYGNRISGEIPSSIGRLKELTLLHLRENELVGNIPATLGNCD  502

Query  1717  QLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNF  1896
             +L  LDLADN LSG++P++ G+L AL +L++YNNSL+G+LPD L NL NLTRIN+S N F
Sbjct  503   KLTILDLADNKLSGSVPSSLGFLTALEQLLIYNNSLQGNLPDSLVNLKNLTRINISSNKF  562

Query  1897  SGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRE  2076
             +GSI+P+C S S+LSFDVT N F+ +IP  +GNSP+LDRLRLG N+FTG+IP T G IRE
Sbjct  563   NGSISPLCGSSSYLSFDVTENRFEGDIPLQIGNSPNLDRLRLGKNQFTGRIPWTFGKIRE  622

Query  2077  LSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFS  2256
             LSLLD+S N L+G IP +L LC+KLTH+DLN+N LSG IP WLGRLPLLGELKLSSNQF 
Sbjct  623   LSLLDISSNSLTGIIPLELGLCKKLTHIDLNDNFLSGVIPPWLGRLPLLGELKLSSNQFI  682

Query  2257  GSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGK  2436
             GSLP ELFN +KLLVLSL+ NSLNG++P EIGNL++LN LNL+ NQ+ G +PS+IG L K
Sbjct  683   GSLPTELFNLTKLLVLSLDGNSLNGSIPEEIGNLEALNALNLEKNQISGPLPSSIGKLSK  742

Query  2437  LYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDL  2616
             LYELRLSRN  +G+IP E+GQL+DLQS LD SYNN TG IP  + TL KLESLDLSHN L
Sbjct  743   LYELRLSRNALTGDIPVEIGQLQDLQSALDLSYNNFTGHIPSMVSTLHKLESLDLSHNQL  802

Query  2617  TGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSR  2796
              GE+P Q+ EM SLG LNLS N LEG+L K ++ W  D+FVGN+ LCG PL S  ++   
Sbjct  803   IGEVPGQIGEMKSLGYLNLSYNNLEGKLKKHFSRWQADAFVGNAGLCGRPLLSHCNRAGS  862

Query  2797  NKG------SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQ  2958
             NK         VV+ISA+S+ VAI L+++    FFK + + +++RRG    ++ SS SS 
Sbjct  863   NKSQRSLSPKTVVIISAISSLVAIALMVLVIFLFFKQSHDVFKKRRGGN--SAVSSDSSS  920

Query  2959  AQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPR  3138
             + + PLF N   K DI+W+DIMEAT  L+DEF+IGSGG   VYKAEL +GET+A+K+I  
Sbjct  921   SSQAPLFRNGGAKSDIKWEDIMEATRYLNDEFMIGSGGSGKVYKAELKSGETIAVKKILW  980

Query  3139  KDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQP  3318
             KDDL  +KSF RE+KTL RIRHRHLV+LMGYCS+K EG N+LIYEYMENGSVWDW+H   
Sbjct  981   KDDLMSNKSFNREVKTLGRIRHRHLVKLMGYCSSKAEGLNLLIYEYMENGSVWDWIH---  1037

Query  3319  ANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFG  3498
                K K+ L WE RLKIA+GLAQGVEYLH+DCVP I+HRDIKSSNVLLDSNMEAHLGDFG
Sbjct  1038  --TKKKECLSWETRLKIAVGLAQGVEYLHYDCVPPIVHRDIKSSNVLLDSNMEAHLGDFG  1095

Query  3499  LAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             LAK L++NYD+ NTESNT FAGSYGYIAPE
Sbjct  1096  LAKILSENYDT-NTESNTMFAGSYGYIAPE  1124



>ref|XP_010445856.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Camelina sativa]
Length=1313

 Score =  1182 bits (3057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 657/1106 (59%), Positives = 833/1106 (75%), Gaps = 21/1106 (2%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsis  468
             LR LLE+K SF+        L+ W+  + N+C+W GV+C GS+ +     S    G    
Sbjct  92    LRTLLELKNSFLTNPKDETVLRTWNAVDSNFCNWTGVTCGGSVIIGLNLSSLGLTGSISP  151

Query  469   pslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlV-GPIPSQLGLLTNLQA  645
                           S+  + GPIP  LSNLS+    L   +  + G IPSQLG L NL++
Sbjct  152   SIGRFNNLTHIDLSSNRLV-GPIPTTLSNLSASLETLHLFSNQLSGKIPSQLGSLVNLKS  210

Query  646   LRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPL  825
             L++GDN L G IP +FGNL +L  L LASC L+G IP QLGRL QLQ L LQ N LEGP+
Sbjct  211   LKLGDNELNGSIPETFGNLVSLRMLALASCRLTGTIPSQLGRLVQLQALILQDNELEGPI  270

Query  826   PPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVY  1005
             PPEI N +SL   +AA+N LNGS+P EL  L +L  LNL  N+ +GE+P QLG++ +L Y
Sbjct  271   PPEIGNCTSLVLITAAVNRLNGSLPAELSRLANLQTLNLGKNSFSGELPSQLGDLVNLNY  330

Query  1006  LNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTI  1185
             +NL+GN+L G IPK L +L NLQ+LDLS N L GE+  EF +M QL    L++N LSG++
Sbjct  331   INLIGNKLQGLIPKRLTELVNLQTLDLSSNNLTGEIHEEFWNMDQLVSFVLSNNRLSGSL  390

Query  1186  PKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLT  1365
             PK++CSN T+L+ L LSET LSGEIP E+ +C+ L+ LDLSNNTL G IP+ L+ L +LT
Sbjct  391   PKTICSNNTSLKQLALSETQLSGEIPAEIGKCQSLEALDLSNNTLTGRIPDSLFHLVELT  450

Query  1366  DLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGE  1545
             +L LNNNTLEGT+SPS++NLT L   +L+ NNL G+VP+EIG+L  L+I++LYEN FSGE
Sbjct  451   NLYLNNNTLEGTLSPSISNLTKLLEFTLYRNNLEGKVPKEIGLLRKLEILYLYENRFSGE  510

Query  1546  IPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLD  1725
             +P+EIGNC+ L+ ID+YGN+ +G+IP ++GRLK L  LHLREN+L G IPA+LGNCH+L 
Sbjct  511   MPIEIGNCTKLKAIDWYGNRISGEIPSSIGRLKELTLLHLRENELVGNIPATLGNCHKLT  570

Query  1726  TLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGS  1905
              LDLADN LSG++P++ G+L AL +L++YNNSL+G+LP  L NL NLTRIN+S N F+GS
Sbjct  571   ILDLADNKLSGSVPSSLGFLTALEQLLIYNNSLQGNLPSSLVNLKNLTRINISSNKFNGS  630

Query  1906  IAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSL  2085
             I+P+C S S+LSFDVT N F+ +IP  +GNSP+LDRLRLG N+FTG+IP T G IRELSL
Sbjct  631   ISPLCGSSSYLSFDVTENRFEGDIPLQIGNSPNLDRLRLGKNQFTGRIPWTFGKIRELSL  690

Query  2086  LDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSL  2265
             LD+S N L+G IP +L LC+KLTH+DLN+N LSG IP WLG+LPLLGELKLSSNQF GSL
Sbjct  691   LDISSNSLTGIIPLELGLCKKLTHIDLNDNFLSGVIPPWLGKLPLLGELKLSSNQFIGSL  750

Query  2266  PPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYE  2445
             P ELFN +KLLVL L+ NSLNG++P EIGNL++LN LNL+ NQ+ G +PS+IG L KLYE
Sbjct  751   PTELFNLTKLLVLYLDGNSLNGSIPEEIGNLEALNALNLEKNQISGPLPSSIGKLSKLYE  810

Query  2446  LRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGE  2625
             LRLSRN  +G+IP E+G+L+DLQS LD SYNN TG IP  I TL KLE+LDLSHN L GE
Sbjct  811   LRLSRNSLTGDIPVEIGELQDLQSALDLSYNNFTGHIPSMISTLHKLETLDLSHNQLVGE  870

Query  2626  IPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGS-RNK  2802
             +P Q+ +M SLG L+LS N LEG+L K+++ W  D+FVGN+ LCGSPL  C   GS +N+
Sbjct  871   VPSQIGDMKSLGYLSLSYNNLEGKLKKQFSRWQADAFVGNTGLCGSPLSHCNRAGSNKNQ  930

Query  2803  GSM----VVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRK  2970
              S+    VV+ISA+S+ VAI L+++    FFK + + +++RRG    ++ SS SS + + 
Sbjct  931   RSLSPKTVVIISAISSLVAIPLMVLVIFLFFKQSHDVFKKRRGGN--SAVSSDSSSSSQA  988

Query  2971  PLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDDL  3150
             PLF N   K DI+W+DIMEAT  L+DE++IGSGG   VYKAEL +GET+A+K+I  KDDL
Sbjct  989   PLFRNGGAKSDIKWEDIMEATRYLNDEYMIGSGGSGKVYKAELKSGETIAVKKILWKDDL  1048

Query  3151  FLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNK  3330
               +KSF RE+KTL RIRHRHLV+LMGYCS+K EG N+LIYEYMENGSVWDW+H      K
Sbjct  1049  MSNKSFNREVKTLGRIRHRHLVKLMGYCSSKAEGLNLLIYEYMENGSVWDWIH-----TK  1103

Query  3331  SKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKA  3510
              K+ L WEARLKIA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLD+NMEAHLGDFGLAK 
Sbjct  1104  KKECLGWEARLKIAVGLAQGVEYLHHDCVPPIVHRDIKSSNVLLDTNMEAHLGDFGLAKI  1163

Query  3511  LTDNYDSLNTESNTWFAGSYGYIAPE  3588
             L++NYD+ NTESNT FAGSYGY+APE
Sbjct  1164  LSENYDT-NTESNTMFAGSYGYVAPE  1188



>ref|XP_009123608.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Brassica rapa]
Length=1243

 Score =  1174 bits (3038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 665/1107 (60%), Positives = 824/1107 (74%), Gaps = 20/1107 (2%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslgg  459
             S  L+ LLEVK+S V+       LQ W+  + NYC+W GV+C G + +          G 
Sbjct  27    SDDLQTLLEVKKSIVINPEDEKVLQNWNSDDLNYCNWTGVTCRGRVVIGLNLSDFDLTGS  86

Query  460   sispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlV-GPIPSQLGLLTN  636
                        +     S++ + GPIP ALSNLS+    L   +  + G +PSQLG L N
Sbjct  87    ISPSIGRFSNLIHLDLSSNSLV-GPIPTALSNLSASLETLHLFSNQLTGELPSQLGSLVN  145

Query  637   LQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllE  816
             L++L++GDN L G IP +FGNL NL TL LA C L+G IP QLGRL  LQ L LQQN L+
Sbjct  146   LRSLKLGDNDLIGPIPDTFGNLVNLQTLALAKCRLTGSIPSQLGRLVNLQALILQQNFLQ  205

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             GP+PPE+ N +SL  F+AALNSLNGS+P EL  L +L ILNL NN+ +GEIP QLG++ +
Sbjct  206   GPIPPELGNCTSLVLFTAALNSLNGSLPTELSQLGNLQILNLGNNSFSGEIPSQLGDLRN  265

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             L YLNL+GN+L G IPK +  L NLQ+LDLS N L GE+  EF +M QL+ L L +N LS
Sbjct  266   LQYLNLVGNRLQGPIPKRVTGLENLQTLDLSDNNLTGEIHEEFWNMNQLEDLVLANNRLS  325

Query  1177  GTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
             G++PKSLCSN T+L+ L+LS T LSGEIP E+S+C+ LQ LDLSNNTL G IP+ L+ L 
Sbjct  326   GSLPKSLCSNNTSLKQLVLSGTQLSGEIPAEVSKCQSLQALDLSNNTLAGRIPDSLFNLA  385

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
             +LT L LNNNTL+GT+S S++NL NLQ L+L+HN+L G++P EIG L  L++++LYEN F
Sbjct  386   ELTVLYLNNNTLKGTLSHSISNLRNLQELALYHNDLEGKLPNEIGFLSKLEVLYLYENRF  445

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
             SGEIP EIGNC+SL+ +D +GN F+G+IP ++GRL+ L  LHLREN+  G IPA+LGNCH
Sbjct  446   SGEIPTEIGNCTSLKSVDMFGNHFSGEIPFSIGRLEDLTLLHLRENEFVGNIPAALGNCH  505

Query  1717  QLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNF  1896
             +L  LDLADN LSG+IP++FG+L++L +L LYNNSL G LP  L NL NLTRIN S N  
Sbjct  506   KLTILDLADNQLSGSIPSSFGFLKSLEQLHLYNNSLRGSLPSSLINLKNLTRINFSSNKL  565

Query  1897  SGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRE  2076
             +GSI+ +C S S+LSFDVT+N F+ ++P  LG SPSLDRLRLG N+FTG+IP T G I  
Sbjct  566   NGSISALCGSSSYLSFDVTDNEFEGDVPLELGKSPSLDRLRLGKNQFTGRIPWTFGKISA  625

Query  2077  LSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFS  2256
             LSLLD+S N L+G IP +L LC+KLTH+DLN+N LSG IP WLG+LPLLGELKLSSNQF+
Sbjct  626   LSLLDVSSNSLTGNIPLELGLCKKLTHIDLNDNFLSGVIPPWLGKLPLLGELKLSSNQFT  685

Query  2257  GSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGK  2436
             GSLP E+FN +KLLVLSL+ NSLNG++P EIGNL++LNVLNL  NQ  G +PS IG L K
Sbjct  686   GSLPTEIFNLTKLLVLSLDGNSLNGSIPQEIGNLEALNVLNLGKNQFSGELPSGIGKLSK  745

Query  2437  LYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDL  2616
             LYELRLSRN  +GEIP E+GQL+DLQS LD SYNN TG+IP +I TL KLESLDLSHN L
Sbjct  746   LYELRLSRNILTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTISTLHKLESLDLSHNHL  805

Query  2617  TGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSR  2796
              G +P Q+ +M SL  LNLS N LEG+L K+++ W  D+FVGN+ LCGSPL  C     +
Sbjct  806   VGVVPGQIGDMKSLVYLNLSYNNLEGKLKKQFSKWQADAFVGNAGLCGSPLSHCAGLNKK  865

Query  2797  NKG---SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQR  2967
              +G     VV+ISALS+  AI L+++    FFK N   +++ RG  +  SS+SSSS+A  
Sbjct  866   QQGLSAKTVVIISALSSVAAIALMVLVIVVFFKQNIALFKKGRGGNSAFSSNSSSSEA--  923

Query  2968  KPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDD  3147
              PLF N   K DI+W+DIMEAT+ L DEF+IGSGG   VYKA+L NGET+A+K+I  KDD
Sbjct  924   -PLFSNGGAKSDIKWEDIMEATHYLDDEFMIGSGGSGKVYKADLVNGETIAVKKILWKDD  982

Query  3148  LFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANN  3327
             L  +KSF RE+KTL  IRHRHLV+LMGYCS+K +G N+LIYEYMENGSVWDWLH      
Sbjct  983   LMSNKSFNREVKTLGTIRHRHLVKLMGYCSSKAQGLNMLIYEYMENGSVWDWLH-----A  1037

Query  3328  KSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAK  3507
             K K+ LDWE RLKIA+GLAQGVEYLH DCVP I+HRDIKSSNVLLDSNMEAHLGDFGLAK
Sbjct  1038  KKKEVLDWETRLKIAVGLAQGVEYLHFDCVPPIVHRDIKSSNVLLDSNMEAHLGDFGLAK  1097

Query  3508  ALTDNYDSLNTESNTWFAGSYGYIAPE  3588
              LT+N D+ NTESN+ FAGSYGYIAPE
Sbjct  1098  ILTENCDT-NTESNSLFAGSYGYIAPE  1123



>emb|CDY14942.1| BnaA02g22840D [Brassica napus]
Length=1243

 Score =  1173 bits (3035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/1107 (60%), Positives = 823/1107 (74%), Gaps = 20/1107 (2%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslgg  459
             S  L+ LLEVK+S V+       LQ W+  + NYC+W GV+C G + +          G 
Sbjct  27    SDDLQTLLEVKKSIVINPEDEKVLQNWNSDDLNYCNWTGVTCRGRVVIGLNLSDFDLTGS  86

Query  460   sispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlV-GPIPSQLGLLTN  636
                        +     S++ + GPIP ALSNLS+    L   +  + G +PSQLG L N
Sbjct  87    ISPSIGRFSNLIHLDLSSNSLV-GPIPTALSNLSASLETLHLFSNQLTGELPSQLGSLVN  145

Query  637   LQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllE  816
             L++L++GDN L G IP +FGNL NL TL LA C L+G IP QLGRL  LQ L LQQN L+
Sbjct  146   LRSLKLGDNDLIGPIPDTFGNLVNLQTLALAKCRLTGSIPSQLGRLVNLQALILQQNFLQ  205

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             GP+PPE+ N +SL  F+AALNSLNGS+P EL  L +L ILNL NN+L+GEIP QLG++ +
Sbjct  206   GPIPPELGNCTSLVLFTAALNSLNGSLPTELSQLGNLQILNLGNNSLSGEIPSQLGDLRN  265

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             L YLNL+GN+L G IPK +  L NLQ+LDLS N L GE+  EF +M QL+ L L +N LS
Sbjct  266   LQYLNLVGNRLQGPIPKRVTGLENLQTLDLSNNNLTGEIHKEFWNMNQLEDLVLANNRLS  325

Query  1177  GTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
             G++PKSLCSN T+L+ L+LS T LSGEIP E+S+C+ LQ LDLSNNTL+G IP+ L+ L 
Sbjct  326   GSLPKSLCSNNTSLKQLVLSGTQLSGEIPAEVSKCQSLQALDLSNNTLSGRIPDSLFNLA  385

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
             +LT L LNNNTL+GT+S S++NL NLQ L+L+HN+L G++P EIG L  L++++LYEN F
Sbjct  386   ELTVLYLNNNTLKGTLSHSISNLRNLQELALYHNDLEGKLPDEIGFLSKLEVLYLYENRF  445

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
             SGEIP EIGNC+ L+ +D +GN F+G+IP ++GRL+ L  LHLREN+  G IPA+LGNCH
Sbjct  446   SGEIPTEIGNCTCLKSVDMFGNHFSGEIPSSIGRLEDLTLLHLRENEFVGNIPAALGNCH  505

Query  1717  QLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNF  1896
             +L  LDLADN LSG+IP++FG+L++L +L LYNNSL G LP  L NL NLTRIN S N  
Sbjct  506   KLTILDLADNQLSGSIPSSFGFLKSLEQLHLYNNSLRGSLPSSLINLKNLTRINFSSNKL  565

Query  1897  SGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRE  2076
             +GSI+ +C S S+LSFDVT+N F+ ++P  LG SPSLDRLRLG N+FTG+IP T G I  
Sbjct  566   NGSISALCGSSSYLSFDVTDNEFEGDVPLELGKSPSLDRLRLGKNQFTGRIPWTFGKISA  625

Query  2077  LSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFS  2256
             LSLLD+S N L+G IP +L LC+KLTH+DLN+N LSG IP WLG+LPLLGELKLSSNQF+
Sbjct  626   LSLLDVSSNSLTGNIPLELGLCKKLTHIDLNDNFLSGVIPPWLGKLPLLGELKLSSNQFT  685

Query  2257  GSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGK  2436
             GSLP E+FN +KLLVLSL+ NSLNG++P EIGN ++LNVLNL  NQ  G +PS IG L K
Sbjct  686   GSLPKEIFNLTKLLVLSLDGNSLNGSIPQEIGNFEALNVLNLGKNQFSGELPSEIGKLSK  745

Query  2437  LYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDL  2616
             LYELRLSRN  S EIP E+GQL+DLQS LD SYNN TG+IP +I TL KLESLDLSHN L
Sbjct  746   LYELRLSRNILSEEIPVEIGQLQDLQSALDLSYNNFTGDIPSTISTLHKLESLDLSHNHL  805

Query  2617  TGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSR  2796
              G +P Q+ +M SL  LNLS N LEG+L K+++ W  D+FVGN+ LCGSPL  C     +
Sbjct  806   IGVVPGQIGDMKSLVYLNLSYNNLEGKLKKQFSKWQADAFVGNAGLCGSPLSHCAGLNKK  865

Query  2797  NKG---SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQR  2967
              +G     VV+ISALS+  AI L+++    FFK N   +++ RG  +  SS+SSSS+A  
Sbjct  866   QQGLSAKTVVIISALSSVAAIALMVLVIVVFFKQNIALFKKGRGGSSAFSSNSSSSEA--  923

Query  2968  KPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDD  3147
              PLF N   K DI+W+DIMEAT+ L DEF+IGSGG   VYKA+L NGET+A+K+I  KDD
Sbjct  924   -PLFSNGGAKSDIKWEDIMEATHYLDDEFMIGSGGSGKVYKADLVNGETIAVKKILWKDD  982

Query  3148  LFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANN  3327
             L  +KSF RE+KTL  IRHRHLV+LMGYCS+K +G N+LIYEYMENGSVWDWLH      
Sbjct  983   LMSNKSFNREVKTLGTIRHRHLVKLMGYCSSKAQGLNMLIYEYMENGSVWDWLH-----A  1037

Query  3328  KSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAK  3507
             K K+ LDWE RLKIA+GLAQGVEYLH DCVP I+HRDIKSSNVLLDSNMEAHLGDFGLAK
Sbjct  1038  KKKEVLDWETRLKIAVGLAQGVEYLHFDCVPPIVHRDIKSSNVLLDSNMEAHLGDFGLAK  1097

Query  3508  ALTDNYDSLNTESNTWFAGSYGYIAPE  3588
              LT+N D+ NTESN+ FAGSYGYIAPE
Sbjct  1098  ILTENCDT-NTESNSLFAGSYGYIAPE  1123



>ref|XP_003533521.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=1257

 Score =  1167 bits (3018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/1118 (63%), Positives = 849/1118 (76%), Gaps = 23/1118 (2%)
 Frame = +1

Query  286   CQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-------DGslkvvsl  432
             C    ST+RVLLEVK SF       L  WSE N +YCSW+GVSC       D    VV L
Sbjct  25    CDGNESTMRVLLEVKSSFTQDPENVLSDWSENNTDYCSWRGVSCGSKSKPLDRDDSVVGL  84

Query  433   nlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIP  612
             NLS+SSL GSIS SLG L +L+HLDLSSN LSGPIPP LSNL+SLESLLL SN+L G IP
Sbjct  85    NLSESSLSGSISTSLGRLQNLIHLDLSSNRLSGPIPPTLSNLTSLESLLLHSNQLTGQIP  144

Query  613   SQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnl  792
             ++L  LT+L+ LRIGDN LTG IP SFG +  L  +GLASC L+G IP +LGRL+ LQ L
Sbjct  145   TELHSLTSLRVLRIGDNELTGPIPASFGFMFRLEYVGLASCRLTGPIPAELGRLSLLQYL  204

Query  793   nlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIP  972
              LQ+N L GP+PPE+    SL  FSAA N LN SIP +L  L  L  LNLANN+LTG IP
Sbjct  205   ILQENELTGPIPPELGYCWSLQVFSAAGNRLNDSIPSKLSRLNKLQTLNLANNSLTGSIP  264

Query  973   GQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFL  1152
              QLGE+S L YLN +GN+L G IP SLA+L NLQ+LDLS N L+GE+P   G+MG+LQ+L
Sbjct  265   SQLGELSQLRYLNFMGNKLEGRIPSSLAQLGNLQNLDLSWNLLSGEIPEVLGNMGELQYL  324

Query  1153  ALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSI  1332
              L+ N LSGTIP ++CSNAT+L+ LM+S +G+ GEIP EL QC+ L+QLDLSNN LNGSI
Sbjct  325   VLSENKLSGTIPGTMCSNATSLENLMISGSGIHGEIPAELGQCQSLKQLDLSNNFLNGSI  384

Query  1333  PEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQI  1512
             P E+Y L  LTDL+L+NNTL G+ISP + NLTN+QTL+LFHNNL G++PREIG LG L+I
Sbjct  385   PIEVYGLLGLTDLMLHNNTLVGSISPFIGNLTNMQTLALFHNNLQGDLPREIGRLGKLEI  444

Query  1513  IFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEI  1692
             +FLY+N  SG+IP+EIGNCSSLQ +D +GN F+G+IP T+GRLK L FLHLR+N L GEI
Sbjct  445   MFLYDNMLSGKIPLEIGNCSSLQMVDLFGNHFSGRIPFTIGRLKELNFLHLRQNGLVGEI  504

Query  1693  PASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTR  1872
             PA+LGNCH+L  LDLADN LSGAIP+TFG+LR L + MLYNNSL+G LP  L N+ N+TR
Sbjct  505   PATLGNCHKLGVLDLADNKLSGAIPSTFGFLRELKQFMLYNNSLQGSLPHQLVNVANMTR  564

Query  1873  INLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIP  2052
             +NLS+N  +GS+  +C+S SFLSFDVT+N FD EIP  LGNSPSLDRLRLG+N+F+G+IP
Sbjct  565   VNLSNNTLNGSLDALCSSRSFLSFDVTDNEFDGEIPFLLGNSPSLDRLRLGNNKFSGEIP  624

Query  2053  MTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgel  2232
              TLG I  LSLLDLSGN L+G IP +LSLC  LTH+DLNNN LSG IP WLG L  LGE+
Sbjct  625   RTLGKITMLSLLDLSGNSLTGPIPDELSLCNNLTHIDLNNNFLSGHIPSWLGSLSQLGEV  684

Query  2233  klSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIP  2412
             KLS NQFSGS+P  L    KLLVLSL+NN +NG+LP +IG+L SL +L LD N   G IP
Sbjct  685   KLSFNQFSGSIPLGLLKQPKLLVLSLDNNLINGSLPADIGDLASLGILRLDHNNFSGPIP  744

Query  2413  STIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLES  2592
               IG L  LYEL+LSRNRFSGEIP E+G L++LQ  LD SYNNL+G IP ++  LSKLE 
Sbjct  745   RAIGKLTNLYELQLSRNRFSGEIPFEIGSLQNLQISLDLSYNNLSGHIPSTLSMLSKLEV  804

Query  2593  LDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLG  2772
             LDLSHN LTG +P  V EM SLG+LN+S N L+G LDK+++ WP D+F GN  LCG+ LG
Sbjct  805   LDLSHNQLTGVVPSMVGEMRSLGKLNISYNNLQGALDKQFSRWPHDAFEGNLLLCGASLG  864

Query  2773  SCRDKGSRN---KGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsss  2943
             SC   G++      + VV++SALS   AI LL++    F ++ +E +  RRG E  +   
Sbjct  865   SCDSGGNKRVVLSNTSVVIVSALSTLAAIALLVLAVIIFLRNKQEFF--RRGSE-LSLVF  921

Query  2944  ssssQAQRKPLFG-NAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVA  3120
             SSSS+AQ++ L       KRD RW+DIM+AT+NLS+EFIIG GG ATVY+ E   GETVA
Sbjct  922   SSSSRAQKRTLIPLTVPGKRDFRWEDIMDATDNLSEEFIIGCGGSATVYRVEFPTGETVA  981

Query  3121  IKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNK--GEGSNVLIYEYMENGSV  3294
             +K+I  KDD  L KSF RE+KTL RI+HRHLV+++G CSN+  G G N+LIYEYMENGSV
Sbjct  982   VKKISWKDDYLLHKSFIRELKTLGRIKHRHLVKVLGCCSNRFNGGGWNLLIYEYMENGSV  1041

Query  3295  WDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNM  3474
             WDWLH +P   K K  LDW+ R +IA+GLA G+EYLHHDCVPKI+HRDIKSSN+LLDSNM
Sbjct  1042  WDWLHGEPL--KLKGRLDWDTRFRIAVGLAHGMEYLHHDCVPKILHRDIKSSNILLDSNM  1099

Query  3475  EAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             EAHLGDFGLAK L +N++S+ TESN+ FAGSYGYIAPE
Sbjct  1100  EAHLGDFGLAKTLVENHESI-TESNSCFAGSYGYIAPE  1136



>gb|KHN26588.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=1226

 Score =  1160 bits (3002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/1111 (63%), Positives = 846/1111 (76%), Gaps = 23/1111 (2%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-------DGslkvvslnlsdssl  453
             +RVLLEVK SF       L  WSE N +YCSW+GVSC       D    VV LNLS+SSL
Sbjct  1     MRVLLEVKSSFTQDPENVLSDWSENNTDYCSWRGVSCGSKSKPLDRDDSVVGLNLSESSL  60

Query  454   ggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLT  633
              GSIS SLG L +L+HLDLSSN LSGPIPP LSNL+SLESLLL SN+L G IP++L  LT
Sbjct  61    SGSISTSLGRLQNLIHLDLSSNRLSGPIPPTLSNLTSLESLLLHSNQLTGQIPTELHSLT  120

Query  634   NLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnll  813
             +L+ LRIGDN LTG IP SFG +  L  +GLASC L+G IP +LGRL+ LQ L LQ+N L
Sbjct  121   SLRVLRIGDNELTGPIPASFGFMFRLEYVGLASCRLTGPIPAELGRLSLLQYLILQENEL  180

Query  814   EGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMS  993
              GP+PPE+    SL  FSAA N LN SIP +L  L  L  LNLANN+LTG IP QLGE+S
Sbjct  181   TGPIPPELGYCWSLQVFSAAGNRLNDSIPSKLSRLNKLQTLNLANNSLTGSIPSQLGELS  240

Query  994   SLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNL  1173
              L YLN +GN+L G IP SLA+L NLQ+LDLS N L+GE+P   G+MG+LQ+L L+ N L
Sbjct  241   QLRYLNFMGNKLEGRIPSSLAQLGNLQNLDLSWNLLSGEIPEVLGNMGELQYLVLSENKL  300

Query  1174  SGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYEL  1353
             SGTIP ++CSNAT+L+ LM+S +G+ GEIP EL QC+ L+QLDLSNN LNGSIP E+Y L
Sbjct  301   SGTIPGTMCSNATSLENLMISGSGIHGEIPAELGQCQSLKQLDLSNNFLNGSIPIEVYGL  360

Query  1354  TQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENH  1533
               LTDL+L+NNTL G+ISP + NLTN+QTL+LFHNNL G++PREIG LG L+I+FLY+N 
Sbjct  361   LGLTDLMLHNNTLVGSISPFIGNLTNMQTLALFHNNLQGDLPREIGRLGKLEIMFLYDNM  420

Query  1534  FSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNC  1713
              SG+IP+EIGNCSSLQ +D +GN F+G+IP T+GRLK L FLHLR+N L GEIPA+LGNC
Sbjct  421   LSGKIPLEIGNCSSLQMVDLFGNHFSGRIPFTIGRLKELNFLHLRQNGLVGEIPATLGNC  480

Query  1714  HQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNN  1893
             H+L  LDLADN LSGAIP+TFG+LR L + MLYNNSL+G LP  L N+ N+TR+NLS+N 
Sbjct  481   HKLGVLDLADNKLSGAIPSTFGFLRELKQFMLYNNSLQGSLPHQLVNVANMTRVNLSNNT  540

Query  1894  FSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIR  2073
              +GS+  +C+S SFLSFDVT+N FD EIP  LGNSPSLDRLRLG+N+F+G+IP TLG I 
Sbjct  541   LNGSLDALCSSRSFLSFDVTDNEFDGEIPFLLGNSPSLDRLRLGNNKFSGEIPRTLGKIT  600

Query  2074  ELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQF  2253
              LSLLDLSGN L+G IP +LSLC  LTH+DLNNN LSG IP WLG L  LGE+KLS NQF
Sbjct  601   MLSLLDLSGNSLTGPIPDELSLCNNLTHIDLNNNFLSGHIPSWLGSLSQLGEVKLSFNQF  660

Query  2254  SGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLG  2433
             SGS+P  L    KLLVLSL+NN +NG+LP +IG+L SL +L LD N   G IP  IG L 
Sbjct  661   SGSIPLGLLKQPKLLVLSLDNNLINGSLPADIGDLASLGILRLDHNNFSGPIPRAIGKLT  720

Query  2434  KLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHND  2613
              LYEL+LSRNRFSGEIP E+G L++LQ  LD SYNNL+G IP ++  LSKLE LDLSHN 
Sbjct  721   NLYELQLSRNRFSGEIPFEIGSLQNLQISLDLSYNNLSGHIPSTLSMLSKLEVLDLSHNQ  780

Query  2614  LTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGS  2793
             LTG +P  V EM SLG+LN+S N L+G LDK+++ WP D+F GN  LCG+ LGSC   G+
Sbjct  781   LTGVVPSMVGEMRSLGKLNISYNNLQGALDKQFSRWPHDAFEGNLLLCGASLGSCDSGGN  840

Query  2794  RN---KGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQ  2964
             +      + VV++SALS   AI LL++    F ++ +E +  RRG E  +   SSSS+AQ
Sbjct  841   KRVVLSNTSVVIVSALSTLAAIALLVLAVIIFLRNKQEFF--RRGSE-LSLVFSSSSRAQ  897

Query  2965  RKPLFG-NAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRK  3141
             ++ L       KRD RW+DIM+AT+NLS+EFIIG GG ATVY+ E   GETVA+K+I  K
Sbjct  898   KRTLIPLTVPGKRDFRWEDIMDATDNLSEEFIIGCGGSATVYRVEFPTGETVAVKKISWK  957

Query  3142  DDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNK--GEGSNVLIYEYMENGSVWDWLHNQ  3315
             DD  L KSF RE+KTL RI+HRHLV+++G CSN+  G G N+LIYEYMENGSVWDWLH +
Sbjct  958   DDYLLHKSFIRELKTLGRIKHRHLVKVLGCCSNRFNGGGWNLLIYEYMENGSVWDWLHGE  1017

Query  3316  PANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDF  3495
             P   K K  LDW+ R +IA+GLA G+EYLHHDCVPKI+HRDIKSSN+LLDSNMEAHLGDF
Sbjct  1018  PL--KLKGRLDWDTRFRIAVGLAHGMEYLHHDCVPKILHRDIKSSNILLDSNMEAHLGDF  1075

Query  3496  GLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             GLAK L +N++S+ TESN+ FAGSYGYIAPE
Sbjct  1076  GLAKTLVENHESI-TESNSCFAGSYGYIAPE  1105



>emb|CDX96976.1| BnaC02g31140D [Brassica napus]
Length=1243

 Score =  1155 bits (2988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 657/1107 (59%), Positives = 822/1107 (74%), Gaps = 20/1107 (2%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslgg  459
             S  L+ LLEVK+S V+       LQ W+  + NYC+W GV+C G + +          G 
Sbjct  27    SDDLQTLLEVKKSIVINPEDEKVLQNWNSDDLNYCNWTGVTCGGRVVIGLNLSDFDLTGS  86

Query  460   sispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlV-GPIPSQLGLLTN  636
                        +     S++ + GPIP ALSNLS+    L   +  + G +PSQLG L N
Sbjct  87    ISPSIGRFSNLIHLDLSSNSLV-GPIPTALSNLSASLETLHLFSNQLTGELPSQLGSLVN  145

Query  637   LQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllE  816
             L++L++GDN L G IP +F NL NL TL LA C L+G IP QLGRL  LQ L LQQN L+
Sbjct  146   LRSLKLGDNDLIGSIPDTFRNLVNLQTLALAKCRLTGSIPSQLGRLVNLQALILQQNFLQ  205

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             GP+PPE+ N +SL  F+AALNSLNGS+  EL  L++L ILNL NN+ +G IP QLG++ +
Sbjct  206   GPIPPELGNCTSLVLFTAALNSLNGSLLTELSQLRNLQILNLGNNSFSGGIPSQLGDLRN  265

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             L YLNL+GN+L G IPK +  L NLQ+LDLS N L GE+  EF +M QL+ L L +N LS
Sbjct  266   LQYLNLVGNRLQGPIPKKITGLENLQTLDLSNNNLTGEIHEEFWNMNQLEDLVLANNRLS  325

Query  1177  GTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
             G++PKSLCSN T+L  L+LS T LSGEIP E+S+C+ LQ LDLSNNTL+G IP+ L++L 
Sbjct  326   GSLPKSLCSNNTSLNQLVLSGTQLSGEIPAEVSKCQSLQALDLSNNTLSGRIPDSLFKLA  385

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
             +LT L LNNNTL+GT+S S+++L NLQ L+L+HN+L G++P EIG L  L++++LYEN F
Sbjct  386   ELTVLYLNNNTLKGTLSHSISSLRNLQELALYHNDLEGKLPNEIGFLSKLEVLYLYENRF  445

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
             SGEIP EIGNC+SL+ +D +GN F+G+IP ++GRL  L  LHLREN+  G IPA+LGNCH
Sbjct  446   SGEIPTEIGNCTSLKSVDMFGNHFSGEIPSSIGRLDDLTLLHLRENEFVGNIPATLGNCH  505

Query  1717  QLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNF  1896
             +L  LDLADN LSG IP++F +L++L +L LYNNSL+G LP  L NL NLTRIN S N  
Sbjct  506   KLTILDLADNQLSGTIPSSFEFLKSLEQLHLYNNSLQGSLPSSLINLKNLTRINFSSNKL  565

Query  1897  SGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRE  2076
             +GSI+P+C S S+LSFDVT+N F+ ++P  LG S SLDRLRLG N+FTG+IP T G I E
Sbjct  566   NGSISPLCGSSSYLSFDVTDNEFEGDVPLQLGKSRSLDRLRLGKNQFTGRIPWTFGKIHE  625

Query  2077  LSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFS  2256
             LSLLD+S N L+G IP +L LC+KLTH+D+N+N LSG IP WLG+LPLLGELKLSSNQF+
Sbjct  626   LSLLDISSNSLTGNIPLELGLCKKLTHIDINDNFLSGVIPPWLGKLPLLGELKLSSNQFT  685

Query  2257  GSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGK  2436
             GSLP E+FN +KLLVLSL+ NSLNG++P EIGNL+SLNVLNL  NQ+ G +PS IG L K
Sbjct  686   GSLPKEIFNLTKLLVLSLDGNSLNGSIPQEIGNLESLNVLNLGKNQMSGQLPSGIGKLSK  745

Query  2437  LYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDL  2616
             LYELRLSRN  +GEIP E+GQL+DLQS LD SYNN TG+IP +I TL KLESLDLSHN L
Sbjct  746   LYELRLSRNILTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTISTLHKLESLDLSHNHL  805

Query  2617  TGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSR  2796
              G +P Q+ +M SL  LNLS N LEG+L K+++ W  D+FVGN+ LCGSPLG C     +
Sbjct  806   VGVVPGQIGDMKSLVYLNLSYNNLEGKLKKQFSKWQADAFVGNAGLCGSPLGHCAGLNKK  865

Query  2797  NKG---SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQR  2967
              +G     V++ISA+S+  AI ++++    FFK N   +++ RG  N  SS+SSSS+A  
Sbjct  866   QQGLSAKTVIIISAISSLAAIAVMVLVIVVFFKQNLALFKKGRGGSNAFSSNSSSSEA--  923

Query  2968  KPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDD  3147
              PLF +   K DI+W+DIMEAT+ L DEF+IGSGG   VYKA+L NGET+A+K+I  KDD
Sbjct  924   -PLFSHGGAKSDIKWEDIMEATHYLDDEFMIGSGGSGKVYKADLVNGETIAVKKILWKDD  982

Query  3148  LFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANN  3327
             L  +KSF RE+KTL  IRHRHLV+LMGYCS+K +G N+LIYEYMENGSVWD LH      
Sbjct  983   LMSNKSFNREVKTLGTIRHRHLVKLMGYCSSKAQGLNMLIYEYMENGSVWDGLH-----A  1037

Query  3328  KSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAK  3507
             K K+ L WE RLKIA+GLAQGVEYLH DCVP I+HRDIKSSNVLLDSNMEAHLGDFGLAK
Sbjct  1038  KKKEVLGWETRLKIAVGLAQGVEYLHFDCVPPIVHRDIKSSNVLLDSNMEAHLGDFGLAK  1097

Query  3508  ALTDNYDSLNTESNTWFAGSYGYIAPE  3588
              LT+N D+ NTESN+ FAGSYGYIAPE
Sbjct  1098  ILTENCDT-NTESNSLFAGSYGYIAPE  1123



>ref|XP_004488225.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Cicer arietinum]
Length=1264

 Score =  1155 bits (2987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/1118 (62%), Positives = 854/1118 (76%), Gaps = 26/1118 (2%)
 Frame = +1

Query  301   STLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC---------DGslkvvslnls  441
             STL+VLLEVK SF+      L  WSE N +YCSW+GVSC         D    VV LNLS
Sbjct  31    STLKVLLEVKSSFLKDPENVLIDWSENNTDYCSWRGVSCELIKKLNSNDSVHAVVGLNLS  90

Query  442   dsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQL  621
             +SSL GSISPSLG L +LL+LDLSSN+L GPIPP+LSNL+ LESLLLFSN+L G IP++L
Sbjct  91    NSSLTGSISPSLGHLQNLLYLDLSSNNLVGPIPPSLSNLTKLESLLLFSNQLKGQIPTEL  150

Query  622   GLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlq  801
             G LT+L+ LR+GDN L+G IP SFGNL NLV LGLASC L+GLIP QLGRL++L+N+ LQ
Sbjct  151   GSLTSLRVLRLGDNELSGSIPASFGNLVNLVILGLASCRLTGLIPSQLGRLSELENMILQ  210

Query  802   qnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQL  981
              N L GP+P E+ N SSL  FSAA N LNG+IP +L  L++L +LN ANN+L GEIPGQ 
Sbjct  211   DNELTGPIPSELGNCSSLIKFSAAENKLNGTIPSQLSQLRNLQVLNFANNSLIGEIPGQF  270

Query  982   GEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALT  1161
             G+MS L+YLNL+GN+L G IP SL+++  LQ+LDLS N+L+G +P  F  MGQL+++ L+
Sbjct  271   GQMSELLYLNLMGNKLEGHIPMSLSQMGKLQNLDLSMNKLSGGIPENFSIMGQLKYMVLS  330

Query  1162  SNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEE  1341
              N L G IPK+LCSNATNL+ L++S  GL GEIP ELS+C+ L+QLDLSNN+ NGSIP E
Sbjct  331   GNPLYGKIPKTLCSNATNLEQLIISMCGLCGEIPIELSECKSLKQLDLSNNSFNGSIPIE  390

Query  1342  LYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFL  1521
             +Y L  LT+L+L+NN+L G+ISP + NLTN+QTL+L+HN L G +P+EIG LG L+  +L
Sbjct  391   IYSLLGLTELLLHNNSLVGSISPFIGNLTNMQTLALYHNKLQGTLPKEIGRLGKLETFYL  450

Query  1522  YENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPAS  1701
             Y+N FSG+IP+EIGNCS+LQ +D +GN F+G+IPIT+GRLK L FLHLR+N+L GEIPA+
Sbjct  451   YDNQFSGKIPMEIGNCSNLQKVDLFGNHFSGRIPITIGRLKELNFLHLRQNELVGEIPAT  510

Query  1702  LGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINL  1881
             LGNCH+L+ LDLADN+LSG IPATFG+L+ L + MLYNNSLEG LP  + N+ NLTR+NL
Sbjct  511   LGNCHKLNVLDLADNNLSGGIPATFGFLKDLQQFMLYNNSLEGSLPHQMVNIANLTRVNL  570

Query  1882  SHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTL  2061
             S N  +GS+ P+C+S  FLSFDVT N FD +IPS LGNS SL+RLRLG N+F+G+IP TL
Sbjct  571   SKNRLNGSLVPLCSSRLFLSFDVTGNEFDGKIPSRLGNSVSLERLRLGGNKFSGEIPRTL  630

Query  2062  GLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklS  2241
             G I  LSLLDLSGN L G IP +LSLC KL  + LNNNLL G IP WLG LP LG+L L+
Sbjct  631   GKIVGLSLLDLSGNSLIGPIPSELSLCSKLAFIHLNNNLLFGHIPSWLGNLPKLGDLNLA  690

Query  2242  SNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTI  2421
              NQF G +P  LF    LLVLSL NNSLNG+L  +IG+L+SLNVL LD N   G IP  I
Sbjct  691   FNQFFGPIPLGLFKLPMLLVLSLNNNSLNGSLSNDIGDLQSLNVLRLDHNNFSGPIPIAI  750

Query  2422  GGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDL  2601
             G L  LYEL LSRN FSG IP E+G L++LQ VLD SYNNL+G++P S+GTL+KLESLDL
Sbjct  751   GKLRNLYELTLSRNVFSGNIPIEIGNLQNLQIVLDLSYNNLSGQLPSSLGTLAKLESLDL  810

Query  2602  SHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC-  2778
             SHN L GE+P  +AEM SL +L++S N  +G LDKR++ WP ++F GN  LCG+ LG C 
Sbjct  811   SHNQLNGEVPSLIAEMLSLEKLDISYNNFQGALDKRFSRWPNETFEGNIRLCGASLGRCS  870

Query  2779  RDKGSRNKGS----MVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAssss  2946
             R +  RNK S      ++I +  +T+A I L++ A   F  NR+ +  ++G E     SS
Sbjct  871   RSRAFRNKLSGLNETSIIIISAISTLAAIALMVLAVKIFLRNRQDF-SKKGNEVGWFFSS  929

Query  2947  sssQAQRKPLF--GNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVA  3120
             SSSQAQ++ LF     A  RD RW+DIMEATNNLSDEFIIG+GG  TVY+ E   GET A
Sbjct  930   SSSQAQKRLLFPLSTTAGNRDFRWEDIMEATNNLSDEFIIGAGGSGTVYRVEFATGETFA  989

Query  3121  IKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCS--NKGEGSNVLIYEYMENGSV  3294
             +K+I  KD+    KSF RE+KTL RI+HRHLV+L+G CS  NKG G N LIYE+MENGSV
Sbjct  990   VKKISLKDEYLFHKSFIREVKTLGRIKHRHLVKLVGCCSNRNKGTGWNFLIYEFMENGSV  1049

Query  3295  WDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNM  3474
             WDWLH +P   K+K+SLDWE R KIA+GLAQGVEYLHHDCVPKIIHRDIKSSNVLLDS M
Sbjct  1050  WDWLHKKPL--KAKRSLDWETRFKIALGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSKM  1107

Query  3475  EAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             +AHLGDFGLAKAL +N+DS NTES + FAGSYGYIAPE
Sbjct  1108  DAHLGDFGLAKALIENHDS-NTESTSCFAGSYGYIAPE  1144



>gb|KFK31615.1| hypothetical protein AALP_AA6G136200 [Arabis alpina]
Length=1253

 Score =  1154 bits (2985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/1112 (61%), Positives = 851/1112 (77%), Gaps = 19/1112 (2%)
 Frame = +1

Query  295   TSSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslg  456
             T+  L+ LLE+K+SF+        L+ W+ K+ N+C+W GV+C G   VVSLNLS   L 
Sbjct  24    TNDDLQTLLELKKSFITNPKEETILKNWNSKDLNFCNWTGVTCGGGGFVVSLNLSGLGLT  83

Query  457   gsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlV-GPIPSQLGLLT  633
             GSISP +G   +L HLDLSSN L GPIP  LSNLSS    LL  +  + GPI SQLG L 
Sbjct  84    GSISPLIGRFNNLNHLDLSSNRLVGPIPTTLSNLSSSLESLLLFSNQLTGPITSQLGSLL  143

Query  634   NLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnll  813
             NL+ L++GDN L G IP +FGNL NL TL LASC L+GLIP QLGRL QLQ L +Q N  
Sbjct  144   NLKTLKLGDNKLVGTIPETFGNLVNLETLALASCRLTGLIPSQLGRLVQLQRLIVQDNNF  203

Query  814   EGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMS  993
             EGP+P E+ N ++L  F+AALN LNGS+P EL  L +L ILNL NN+ +GEIP QLG++ 
Sbjct  204   EGPIPNELGNCTNLVLFTAALNRLNGSLPSELSQLVNLQILNLGNNSFSGEIPSQLGDLR  263

Query  994   SLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNL  1173
             +L YLNL+GN+L GSIPK L  L NL +LDLS + L GE+P  F  M +L  L L+ N L
Sbjct  264   NLQYLNLVGNKLQGSIPKRLTDLVNLATLDLSNSDLTGEIPEGFWYMNRLVELFLSKNRL  323

Query  1174  SGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL-NGSIPEELYE  1350
             +G++PKSLCSN T+L+ L+LSET +SGEIP E+S+C+ LQ ++LSNNTL  G IP+  ++
Sbjct  324   NGSLPKSLCSNNTSLKQLVLSETEISGEIPAEISKCQSLQVVNLSNNTLITGKIPDSFFD  383

Query  1351  LTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYEN  1530
             L +L  L L+NN LEGT+SP ++NLTNLQ L+L +NNL G++P+EIG+L  L++++LYEN
Sbjct  384   LVELNVLALHNNNLEGTLSPLISNLTNLQELALSNNNLEGKLPKEIGLLSKLEVLYLYEN  443

Query  1531  HFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGN  1710
              FSGEIP EIGNC++L+ +D +GN+F+G++P TLGRLK L  LH+REN+L+G IPA+LGN
Sbjct  444   RFSGEIPSEIGNCTNLKAVDLFGNRFSGEVPSTLGRLKDLTLLHVRENELNGNIPATLGN  503

Query  1711  CHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHN  1890
             C+QL  LDLADN  SG+IP++FG+L+AL +L LYNNSL+G+LPD L NL NLTRIN S N
Sbjct  504   CNQLTILDLADNRFSGSIPSSFGFLKALEQLHLYNNSLQGNLPDSLINLKNLTRINFSSN  563

Query  1891  NFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLI  2070
               +GSI+P+C S S+LSFD+T+N F+ EIP  LG S +LDRLRLG N+FTGKIP T G I
Sbjct  564   KLNGSISPLCGSSSYLSFDITDNGFEGEIPLELGKSLNLDRLRLGKNQFTGKIPWTFGKI  623

Query  2071  RELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQ  2250
             RELSLLD+S N L+G IP +L LC+KLTH+DLN+NLLSG IP WLG LPLLGE+KLSSN+
Sbjct  624   RELSLLDISSNSLTGVIPVELGLCKKLTHIDLNSNLLSGLIPTWLGELPLLGEIKLSSNK  683

Query  2251  FSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGL  2430
             F GSLP +LFN +KLLVLSL+ NSLNG++P EIGNL++L VLNL+ NQ+ G +PS+IG L
Sbjct  684   FIGSLPIKLFNLTKLLVLSLDGNSLNGSIPEEIGNLEALTVLNLEKNQISGHLPSSIGKL  743

Query  2431  GKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHN  2610
              KLY+LRLSRN  +GEIP E+GQL+DLQS LD SYNN TG+IP ++ TL KLESLDLSHN
Sbjct  744   SKLYDLRLSRNTLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTMSTLLKLESLDLSHN  803

Query  2611  DLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKG  2790
              L GE+P  + EM SLG LNLS N LEG+L K++  W  DSFVGN+ LCGSPL  C   G
Sbjct  804   QLVGEVPGPIGEMKSLGYLNLSYNNLEGKLKKQFTKWQADSFVGNAGLCGSPLSHCNKAG  863

Query  2791  SRNKG-----SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssss  2955
             S  K        VV+ISA+++  AI L+++    F+K N + +++ RG  N   SS+SSS
Sbjct  864   SNKKQQRLSPKTVVIISAIASLAAIALMVLVIILFYKQNFDLFKKSRGG-NSKYSSNSSS  922

Query  2956  QAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIP  3135
              + + P F N   K DI+W++IMEAT+ L++EF++GSGG   VYKAEL NGET+A+K+I 
Sbjct  923   ASSQAPFFRNGGAKSDIKWENIMEATHYLNEEFMVGSGGSGKVYKAELENGETIAVKKIL  982

Query  3136  RKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQ  3315
              KDDL  +KSF RE+KTL  IRHRHLV+LMGYCS+K +G N+LIYE+MENGSVWDWLH  
Sbjct  983   WKDDLMSNKSFNREVKTLGTIRHRHLVKLMGYCSSKADGLNLLIYEFMENGSVWDWLH--  1040

Query  3316  PANNKSKKS-LDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGD  3492
              AN K KK  LDWE RLKIA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEAHLGD
Sbjct  1041  -ANEKKKKEVLDWETRLKIAVGLAQGVEYLHHDCVPPIVHRDIKSSNVLLDSNMEAHLGD  1099

Query  3493  FGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             FGLAK LT++ D+ NTESNT FAGSYGYIAPE
Sbjct  1100  FGLAKILTESNDT-NTESNTLFAGSYGYIAPE  1130



>ref|XP_006398094.1| hypothetical protein EUTSA_v10000741mg [Eutrema salsugineum]
 gb|ESQ39547.1| hypothetical protein EUTSA_v10000741mg [Eutrema salsugineum]
Length=1252

 Score =  1153 bits (2983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/1111 (59%), Positives = 828/1111 (75%), Gaps = 18/1111 (2%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQ------LQGW-SEKNPNYCSWQGVSCDGslkvvslnlsdsslg  456
             ++ L+ LLEVK+S V        L+ W S+ +PN+C+W GV+C G + +     + +  G
Sbjct  24    TNDLQTLLEVKKSLVTNPKDENVLRDWNSDADPNFCNWTGVTCGGRVIIGLNLSNLALTG  83

Query  457   gsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlV-GPIPSQLGLLT  633
                               S+    GPIP  LSNLSS    L   +  + G IPSQL  L 
Sbjct  84    SISPSIGRFTNLTHLDLSSNRLT-GPIPTTLSNLSSSLESLHLFSNQLSGEIPSQLDSLV  142

Query  634   NLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnll  813
              L++L++GDN L G IP +FG+L NL TL LASC L+G IP QLGRL ++Q L LQ N L
Sbjct  143   KLKSLKLGDNELVGSIPETFGSLVNLQTLALASCRLTGSIPSQLGRLVRIQALILQDNYL  202

Query  814   EGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMS  993
             EGP+PPE+ N + L  F+AALN LNGS+P EL  L ++ ILNL NN+ +GEIP QLG++ 
Sbjct  203   EGPIPPELGNCTDLVLFTAALNRLNGSLPAELSQLVNIQILNLGNNSFSGEIPSQLGDLR  262

Query  994   SLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNL  1173
             +L YLNL+GN+L G IPK L +L NLQ+LDLS N L GE+  EF +M QL +L L +N L
Sbjct  263   NLQYLNLVGNKLQGPIPKRLTELVNLQTLDLSKNDLTGEIHEEFWNMSQLVYLVLANNPL  322

Query  1174  SGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL-NGSIPEELYE  1350
             SG++PKSLCSN+T+L+ L+LSET LSGEIP E+S+C+ L  LDLSNNTL  G IP+ L+ 
Sbjct  323   SGSLPKSLCSNSTSLKQLVLSETQLSGEIPAEISKCQSLTALDLSNNTLVTGQIPDSLFH  382

Query  1351  LTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYEN  1530
             L +LT+L  +N +L+GT+SPS++NLTNLQ L+L HN+L G++P+EIG+L  L++++LY+N
Sbjct  383   LVELTNLYFHNCSLKGTLSPSISNLTNLQELALSHNDLEGKLPKEIGLLSKLEVLYLYKN  442

Query  1531  HFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGN  1710
              FSGEIP EIGNC++L+ ID +GN F+G++P ++GRLK L +LHLREN+L G IPA+LGN
Sbjct  443   RFSGEIPFEIGNCTNLKSIDMFGNHFSGEVPSSIGRLKELTWLHLRENELVGNIPATLGN  502

Query  1711  CHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHN  1890
             CH+L  LDLADN LSG+IP++FG+L++L  LMLYNNSL G+LP  L NL NLTRIN S N
Sbjct  503   CHKLTVLDLADNQLSGSIPSSFGFLKSLKELMLYNNSLHGNLPKSLINLKNLTRINFSSN  562

Query  1891  NFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLI  2070
               +GSI+P+C S S+LSFDVT+N F+ +IP  LG S +LDRLRLG N+FTG+IP T G I
Sbjct  563   KLNGSISPLCGSSSYLSFDVTDNGFEGDIPLQLGKSLNLDRLRLGKNQFTGRIPWTFGKI  622

Query  2071  RELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQ  2250
             +ELSLLD+S N L+G +P +L LC+KLTH+DLN+N LSG IP WLG+L LLGELKLSSNQ
Sbjct  623   QELSLLDISSNSLTGILPVELGLCKKLTHIDLNDNFLSGLIPSWLGKLRLLGELKLSSNQ  682

Query  2251  FSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGL  2430
             F+GSL  E+ N +KLLVLSL+ N LNG++P EIGNL++LNVLNL  NQ+ G +PS IG L
Sbjct  683   FTGSLTKEICNLTKLLVLSLDGNKLNGSIPQEIGNLEALNVLNLGKNQISGPLPSEIGKL  742

Query  2431  GKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHN  2610
              KLYELRLSRN  +GEIP E+GQL+DLQS LD SYNN TG+IP +I TL KLE+LDLSHN
Sbjct  743   SKLYELRLSRNMLTGEIPVEIGQLQDLQSALDLSYNNFTGDIPSTISTLHKLEALDLSHN  802

Query  2611  DLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKG  2790
              L GE+P Q+ +M SLG LN+S N LEG+L K++  W  D+F GN+ LCGSPL  C   G
Sbjct  803   QLVGEVPGQIGDMKSLGYLNVSYNNLEGKLKKQFIKWQADAFAGNAGLCGSPLSHCNRAG  862

Query  2791  SRNK-----GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssss  2955
                K        VV+ISA+ +  AI L+++    FFK + + +++ RG  +  SS+SSSS
Sbjct  863   LNKKQQGRSAKTVVIISAICSLAAIALMVLVIVLFFKQSHDLFKKGRGGNSKFSSNSSSS  922

Query  2956  QAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIP  3135
              +Q  PLF N A K DI+W+DIMEAT+ L+DEF+IGSGG   VYKA+L NGET+A+K+I 
Sbjct  923   SSQ-APLFRNGAAKSDIKWEDIMEATHYLNDEFMIGSGGSGKVYKADLENGETIAVKKIL  981

Query  3136  RKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQ  3315
              KDDL  +KSF RE+KTL  IRHRHLV+LMGYCS+K EG N+LIYEYMENGSVWDWL  +
Sbjct  982   WKDDLMSNKSFNREVKTLGTIRHRHLVKLMGYCSSKAEGLNLLIYEYMENGSVWDWLQTK  1041

Query  3316  PANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDF  3495
                 K K+ LD E RLKIA+GLAQGVEYLH DCVP ++HRDIKSSNVLLDSNMEAHLGDF
Sbjct  1042  -KKKKKKEVLDLETRLKIAVGLAQGVEYLHFDCVPPMVHRDIKSSNVLLDSNMEAHLGDF  1100

Query  3496  GLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             GLAK LT++YD+ NTESN+ FAGSYGYIAPE
Sbjct  1101  GLAKILTESYDT-NTESNSLFAGSYGYIAPE  1130



>ref|XP_003547404.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=1257

 Score =  1149 bits (2972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 694/1118 (62%), Positives = 848/1118 (76%), Gaps = 24/1118 (2%)
 Frame = +1

Query  286   CQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-------DGslkvvsl  432
             C    ST+RVLLEVK SF       L  WS  N +YCSW+GVSC       D    VV L
Sbjct  26    CHGNESTMRVLLEVKTSFTEDPENVLSDWSVNNTDYCSWRGVSCGSKSKPLDHDDSVVGL  85

Query  433   nlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIP  612
             NLS+ SL GSISPSLG L +L+HLDLSSN LSGPIPP LSNL+SLESLLL SN+L G IP
Sbjct  86    NLSELSLSGSISPSLGRLKNLIHLDLSSNRLSGPIPPTLSNLTSLESLLLHSNQLTGHIP  145

Query  613   SQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnl  792
             ++   L +L+ LRIGDN LTG IP SFG + NL  +GLASC L+G IP +LGRL+ LQ L
Sbjct  146   TEFDSLMSLRVLRIGDNKLTGPIPASFGFMVNLEYIGLASCRLAGPIPSELGRLSLLQYL  205

Query  793   nlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIP  972
              LQ+N L G +PPE+    SL  FSAA N LN SIP  L  L  L  LNLANN+LTG IP
Sbjct  206   ILQENELTGRIPPELGYCWSLQVFSAAGNRLNDSIPSTLSRLDKLQTLNLANNSLTGSIP  265

Query  973   GQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFL  1152
              QLGE+S L Y+N++GN+L G IP SLA+L NLQ+LDLS N L+GE+P E G+MG+LQ+L
Sbjct  266   SQLGELSQLRYMNVMGNKLEGRIPPSLAQLGNLQNLDLSRNLLSGEIPEELGNMGELQYL  325

Query  1153  ALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSI  1332
              L+ N LSGTIP+++CSNAT+L+ LM+S +G+ GEIP EL +C  L+QLDLSNN LNGSI
Sbjct  326   VLSENKLSGTIPRTICSNATSLENLMMSGSGIHGEIPAELGRCHSLKQLDLSNNFLNGSI  385

Query  1333  PEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQI  1512
             P E+Y L  LTDL+L  NTL G+ISP + NLTN+QTL+LFHNNL G++PRE+G LG L+I
Sbjct  386   PIEVYGLLGLTDLLLQTNTLVGSISPFIGNLTNMQTLALFHNNLQGDLPREVGRLGKLEI  445

Query  1513  IFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEI  1692
             +FLY+N  SG+IP+EIGNCSSLQ +D +GN F+G+IP+T+GRLK L F HLR+N L GEI
Sbjct  446   MFLYDNMLSGKIPLEIGNCSSLQMVDLFGNHFSGRIPLTIGRLKELNFFHLRQNGLVGEI  505

Query  1693  PASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTR  1872
             PA+LGNCH+L  LDLADN LSG+IP+TFG+LR L + MLYNNSLEG LP  L N+ N+TR
Sbjct  506   PATLGNCHKLSVLDLADNKLSGSIPSTFGFLRELKQFMLYNNSLEGSLPHQLVNVANMTR  565

Query  1873  INLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIP  2052
             +NLS+N  +GS+A +C+S SFLSFDVT+N FD EIP  LGNSPSL+RLRLG+N+F+G+IP
Sbjct  566   VNLSNNTLNGSLAALCSSRSFLSFDVTDNEFDGEIPFLLGNSPSLERLRLGNNKFSGEIP  625

Query  2053  MTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgel  2232
              TLG I  LSLLDLS N L+G IP +LSLC  LTH+DLNNNLLSG IP WLG LP LGE+
Sbjct  626   RTLGKITMLSLLDLSRNSLTGPIPDELSLCNNLTHIDLNNNLLSGHIPSWLGSLPQLGEV  685

Query  2233  klSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIP  2412
             KLS NQFSGS+P  LF   +LLVLSL NNSLNG+LP +IG+L SL +L LD N   G IP
Sbjct  686   KLSFNQFSGSVPLGLFKQPQLLVLSLNNNSLNGSLPGDIGDLASLGILRLDHNNFSGPIP  745

Query  2413  STIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLES  2592
              +IG L  LYE++LSRN FSGEIP E+G L++LQ  LD SYNNL+G IP ++G LSKLE 
Sbjct  746   RSIGKLSNLYEMQLSRNGFSGEIPFEIGSLQNLQISLDLSYNNLSGHIPSTLGMLSKLEV  805

Query  2593  LDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLG  2772
             LDLSHN LTGE+P  V EM SLG+L++S N L+G LDK+++ WP ++F GN  LCG+ L 
Sbjct  806   LDLSHNQLTGEVPSIVGEMRSLGKLDISYNNLQGALDKQFSRWPHEAFEGN-LLCGASLV  864

Query  2773  SCRDKGSRN---KGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsss  2943
             SC   G +      + VV++SALS   AI LL++    F K+ +E +  RRG E  +   
Sbjct  865   SCNSGGDKRAVLSNTSVVIVSALSTLAAIALLILVVIIFLKNKQEFF--RRGSE-LSFVF  921

Query  2944  ssssQAQRKPLFG-NAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVA  3120
             SSSS+AQ++ L       KRD RW+DIM+ATNNLS+EFIIG GG  TVY+ E   GETVA
Sbjct  922   SSSSRAQKRTLIPLTVPGKRDFRWEDIMDATNNLSEEFIIGCGGSGTVYRVEFPTGETVA  981

Query  3121  IKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNK--GEGSNVLIYEYMENGSV  3294
             +K+I  K+D  L KSF RE+KTL RI+HRHLV+L+G CSN+  G G N+LIYEYMENGSV
Sbjct  982   VKKISWKNDYLLHKSFIRELKTLGRIKHRHLVKLLGCCSNRFNGGGWNLLIYEYMENGSV  1041

Query  3295  WDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNM  3474
             WDWLH +P   K K+ LDW+ R +IA+ LAQGVEYLHHDCVPKI+HRDIKSSN+LLDSNM
Sbjct  1042  WDWLHGEPL--KLKRKLDWDTRFRIAVTLAQGVEYLHHDCVPKILHRDIKSSNILLDSNM  1099

Query  3475  EAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             E+HLGDFGLAK L +N++S+ TESN+ FAGSYGYIAPE
Sbjct  1100  ESHLGDFGLAKTLFENHESI-TESNSCFAGSYGYIAPE  1136



>gb|KHN47744.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=1231

 Score =  1115 bits (2883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/1116 (61%), Positives = 832/1116 (75%), Gaps = 41/1116 (4%)
 Frame = +1

Query  286   CQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-------DGslkvvsl  432
             C    ST+RVLLEVK SF       L  WS  N +YCSW+GVSC       D    VV L
Sbjct  21    CHGNESTMRVLLEVKTSFTEDPENVLSDWSVNNTDYCSWRGVSCGSKSKPLDHDDSVVGL  80

Query  433   nlsdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIP  612
             NLS+ SL GSISPSLG L +L+HLDLSSN LSGPIPP LSNL+SLESLLL SN+L G IP
Sbjct  81    NLSELSLSGSISPSLGRLKNLIHLDLSSNRLSGPIPPTLSNLTSLESLLLHSNQLTGHIP  140

Query  613   SQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnl  792
             ++   L +L+ LRIG+N LTG IP SFG + NL  +GLASC L+G IP +LGRL+ LQ L
Sbjct  141   TEFDSLMSLRVLRIGNNKLTGPIPASFGFMVNLEYIGLASCRLAGPIPSELGRLSLLQYL  200

Query  793   nlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIP  972
              LQ+N L G +PPE+    SL  FSAA N LN SIP  L  L  L  LNLANN+LTG IP
Sbjct  201   ILQENELTGRIPPELGYCWSLQVFSAAGNRLNDSIPSTLSRLDKLQTLNLANNSLTGSIP  260

Query  973   GQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFL  1152
              QLGE+S L Y+N++GN+L G IP SLA+L NLQ+LDLS N L+GE+P E G+MG+LQ+L
Sbjct  261   SQLGELSQLRYMNVMGNKLEGRIPPSLAQLGNLQNLDLSRNLLSGEIPEELGNMGELQYL  320

Query  1153  ALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSI  1332
              L+ N LSGTIP+++CSNAT+L+ LM+S +G+ GEIP EL +C  L+QLDLSNN LNGSI
Sbjct  321   VLSENKLSGTIPRTICSNATSLENLMMSGSGIHGEIPAELGRCHSLKQLDLSNNFLNGSI  380

Query  1333  PEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQI  1512
             P E+Y L  LTDL+L  NTL G+ISP + NLTN+QTL+LFHNNL G++PRE+G LG L+I
Sbjct  381   PIEVYGLLGLTDLLLQTNTLVGSISPFIGNLTNMQTLALFHNNLQGDLPREVGRLGKLEI  440

Query  1513  IFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEI  1692
             +FLY+N  SG+IP+EIGNCSSLQ +D +GN F+G+IP+T+GRLK L F HLR+N L GEI
Sbjct  441   MFLYDNMLSGKIPLEIGNCSSLQMVDLFGNHFSGRIPLTIGRLKELNFFHLRQNGLVGEI  500

Query  1693  PASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTR  1872
             PA+LGNCH+L  LDLADN LSG+IP+TFG+LR L + MLYNNSLEG LP  L N+ N+TR
Sbjct  501   PATLGNCHKLSVLDLADNKLSGSIPSTFGFLRELKQFMLYNNSLEGSLPHQLVNVANMTR  560

Query  1873  INLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIP  2052
             +NLS+N  +GS+A +C+S SFLSFDVT+N FD EIP  LGNSPSL+RLRLG+N+F+G+IP
Sbjct  561   VNLSNNTLNGSLAALCSSRSFLSFDVTDNEFDGEIPFLLGNSPSLERLRLGNNKFSGEIP  620

Query  2053  MTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgel  2232
              TLG I  LSLLDLS N L+G IP +LSLC  LTH+DLNNNLLSG IP WLG LP LGE+
Sbjct  621   RTLGKITMLSLLDLSRNSLTGPIPDELSLCNNLTHIDLNNNLLSGHIPSWLGSLPQLGEV  680

Query  2233  klSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIP  2412
             KLS NQFSGS+P  LF   +LLVLSL NNSLNG+LP +IG+L SL +L LD N   G IP
Sbjct  681   KLSFNQFSGSVPLGLFKQPQLLVLSLNNNSLNGSLPGDIGDLASLGILRLDHNNFSGPIP  740

Query  2413  STIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLES  2592
              +IG L  LYE++LSRN FSGEIP E+G L++LQ  LD SYNNL+G IP ++G LSKLE 
Sbjct  741   RSIGKLSNLYEMQLSRNGFSGEIPFEIGSLQNLQISLDLSYNNLSGHIPSTLGMLSKLEV  800

Query  2593  LDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLG  2772
             LDLSHN LTGE+P  V EM SLG+L++S N L+G LDK+++ WP ++F GN  LCG+ L 
Sbjct  801   LDLSHNQLTGEVPSIVGEMRSLGKLDISYNNLQGALDKQFSRWPHEAFEGN-LLCGASLV  859

Query  2773  SCRDKGSRN---KGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsss  2943
             SC   G +      + VV++SALS   AI LL++    F K+ +E +  RRG E  +   
Sbjct  860   SCNSGGDKRAVLSNTSVVIVSALSTLAAIALLILVVIIFLKNKQEFF--RRGSE-LSFVF  916

Query  2944  ssssQAQRKPLFG-NAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVA  3120
             SSSS+AQ++ L       KRD RW+DIM+ATNNLS+EFIIG GG  TVY+ E   GETVA
Sbjct  917   SSSSRAQKRTLIPLTVPGKRDFRWEDIMDATNNLSEEFIIGCGGSGTVYRVEFPTGETVA  976

Query  3121  IKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWD  3300
             +K+I  K+D  L KSF RE+KTL RI+HRHL                   EYMENGSVWD
Sbjct  977   VKKISWKNDYLLHKSFIRELKTLGRIKHRHL-------------------EYMENGSVWD  1017

Query  3301  WLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEA  3480
             WLH +P   K K+ LDW+ R +IA+ LAQGVEYLHHDCVPKI+HRDIKSSN+LLDSNME+
Sbjct  1018  WLHGEPL--KLKRRLDWDTRFRIAVTLAQGVEYLHHDCVPKILHRDIKSSNILLDSNMES  1075

Query  3481  HLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             HLGDFGLAK L +N++S+ TESN+ FAGSYGYIAPE
Sbjct  1076  HLGDFGLAKTLFENHESI-TESNSCFAGSYGYIAPE  1110



>ref|XP_009101649.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Brassica rapa]
Length=1240

 Score =  1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/1107 (58%), Positives = 803/1107 (73%), Gaps = 24/1107 (2%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslgg  459
             S+ L+ LLE+K+S V        L+ W+  +PNYC+  GV+C G   +       +  G 
Sbjct  26    SNDLQTLLELKKSLVANPKDETVLRSWNSDDPNYCNGTGVTCGGREVIGLNLSGLNLTGS  85

Query  460   sispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlV-GPIPSQLGLLTN  636
                        +     S++ + GPIP ALSNLSS    L   + L+ G IPSQLG L N
Sbjct  86    ISPSIGRFDNIIDLDLSSNSLV-GPIPAALSNLSSSLETLHLFSNLLSGEIPSQLGSLVN  144

Query  637   LQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllE  816
             L++L+IG+N L G IP + GNL NL TLGLA+C L+G IP QLGRL Q+Q L L+ N LE
Sbjct  145   LKSLKIGNNDLAGSIPETLGNLANLQTLGLAACRLTGPIPSQLGRLVQMQYLYLRHNYLE  204

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             GP+PPE+ N ++L  FSA +NSLNGS+P EL  L +L  LNLANN+L+GEIP QLG++ S
Sbjct  205   GPIPPELGNCANLVTFSAEVNSLNGSLPAELSRLGNLESLNLANNSLSGEIPSQLGDLRS  264

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             L +L L+GN+L GSIPK+L +L NL+ LDLS N L G +  EF +M QL++L L  N LS
Sbjct  265   LNHLYLIGNKLQGSIPKTLTELKNLRILDLSKNSLTGGIHEEFWNMNQLEYLVLEYNPLS  324

Query  1177  GTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
             G++PKSLCSN TNL+LL+LSET LSGEIP E+S+CR LQ+L+LSNNTL G IP+ L+ L 
Sbjct  325   GSLPKSLCSNNTNLKLLLLSETQLSGEIPTEISKCRSLQELNLSNNTLTGLIPDSLFHLV  384

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
             +LT L +NN +L GT+SPS++NLTNLQ     HN L G++P+EIG L  L+ + L++N F
Sbjct  385   ELTVLYINNCSLRGTLSPSISNLTNLQEFGPSHNALEGKLPKEIGFLSKLERLLLHDNRF  444

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
             SG+IPVEIGNC+SLQ ID YGN F+G+IP  +GRLK L +LHLREN+ SG IPA+LGNC 
Sbjct  445   SGQIPVEIGNCTSLQEIDMYGNHFSGEIPSWIGRLKDLTWLHLRENEFSGNIPATLGNCQ  504

Query  1717  QLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNF  1896
             QL  LDLADNHL+G+IP++FG+L AL +L LYNNSL+G+LP  L NL  LTRIN S+N  
Sbjct  505   QLTLLDLADNHLTGSIPSSFGFLTALDQLHLYNNSLQGNLPSSLMNLKKLTRINFSNNTL  564

Query  1897  SGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRE  2076
             +GSI+P+C S S+LSFD+T+N F+ ++P  LG SPSL+RLRLG N+F G+IP TLG I  
Sbjct  565   NGSISPLCGSSSYLSFDLTDNRFEGDVPLELGKSPSLNRLRLGKNQFRGRIPWTLGKINA  624

Query  2077  LSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFS  2256
             LSLLD+S N L+G IP +L LC  LT +DL+NN LSG IP WLG+LP LGELKLSSNQ +
Sbjct  625   LSLLDISSNSLTGIIPVELGLCTNLTLIDLSNNFLSGVIPPWLGKLPFLGELKLSSNQLT  684

Query  2257  GSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGK  2436
             GSLP E+FN SKLLVLSL+ NSLNG++P EIGNL++LNVLNLD NQ+ G +PS IG L K
Sbjct  685   GSLPSEIFNLSKLLVLSLDGNSLNGSIPQEIGNLEALNVLNLDKNQISGQLPSAIGKLSK  744

Query  2437  LYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDL  2616
             LYELRLSRN   G+IP E+GQL+DLQS LD SYNN TG IP +I TL KLESLDLSHN L
Sbjct  745   LYELRLSRNSLIGDIPVEIGQLQDLQSALDLSYNNFTGHIPSTISTLHKLESLDLSHNHL  804

Query  2617  TGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSR  2796
              G++P  + +M SLG LNLS N L G L K +  W  D+FVGN+ LCGSPL  C+  GS+
Sbjct  805   VGDVPGPIGDMKSLGYLNLSYNNLTGRLKKPFYKWHADAFVGNADLCGSPLSPCKRVGSK  864

Query  2797  NKG---SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQR  2967
              +G     VV+ISALS+  AI L ++    F K   +         +          + +
Sbjct  865   QQGLSAKTVVIISALSSVAAIALTVLVVVLFCKQGHDLLNSTFSSNSSP--------SSQ  916

Query  2968  KPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDD  3147
              PLF N A K DI+W+DIMEAT+ L DEF+IGSGG   VYKA+L NGET+A+K+I  KDD
Sbjct  917   APLFRNGAAKTDIKWEDIMEATHRLDDEFMIGSGGSGKVYKADLKNGETIAVKKILWKDD  976

Query  3148  LFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANN  3327
             L  +KSF RE+KTL  IRHRHLV+LMGYC++K EG N+LIYEYMENGSVWDWLH      
Sbjct  977   LMSNKSFNREVKTLGTIRHRHLVKLMGYCTSKEEGLNLLIYEYMENGSVWDWLH-----E  1031

Query  3328  KSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAK  3507
             K K+ L WE RLKIA+GLAQGVEYLH DC P I+HRDIK+SNVLLD NMEAHLGDFGLAK
Sbjct  1032  KKKQVLGWETRLKIALGLAQGVEYLHFDCAPPIVHRDIKTSNVLLDPNMEAHLGDFGLAK  1091

Query  3508  ALTDNYDSLNTESNTWFAGSYGYIAPE  3588
              LT+  +  NT S++ FAGSYGYIAPE
Sbjct  1092  ILTEESNDTNTGSHSLFAGSYGYIAPE  1118



>gb|KFK28656.1| hypothetical protein AALP_AA7G028000 [Arabis alpina]
Length=1053

 Score =  1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/965 (64%), Positives = 740/965 (77%), Gaps = 37/965 (4%)
 Frame = +1

Query  718   LGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSI  897
             L LASC L+G IP QLGRL ++++L LQ N LEGP+P E+ N S LT F+AA N LNG+I
Sbjct  2     LALASCRLTGPIPSQLGRLVRVRSLVLQDNNLEGPIPAELGNCSDLTVFTAAENKLNGTI  61

Query  898   PKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQS  1077
             P+ELG L +L ILNLA+N L+GEIP QLGEMS L YLNL+GNQL G IPKSLA L NL++
Sbjct  62    PEELGRLGNLEILNLASNGLSGEIPNQLGEMSQLNYLNLMGNQLQGFIPKSLANLRNLET  121

Query  1078  LDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGE  1257
             LDLS N L G +P E  SM QL  + L  N+ SG++ KS+CSN T+L+ L+LS T LSGE
Sbjct  122   LDLSTNNLTGAVPEELWSMSQLVDMVLADNHFSGSLSKSVCSNNTSLEQLVLSGTQLSGE  181

Query  1258  IPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQ  1437
             IP ELS+C+ L+QLDLSNN+L GSIPE L++L +LTDL L+NNTLEGT+SPS++NL NLQ
Sbjct  182   IPVELSKCQSLKQLDLSNNSLTGSIPEALFQLVELTDLYLHNNTLEGTLSPSISNLINLQ  241

Query  1438  TLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGK  1617
              L L+HNNL G++P+EI  L  L++++LYEN FSGEIP EIGNC+ L+ ID +GN F G+
Sbjct  242   WLVLYHNNLEGKLPKEISALKKLEVLYLYENRFSGEIPKEIGNCTKLKMIDMFGNHFEGE  301

Query  1618  IPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALT  1797
             IP T+GRLK L  LHLR+N+L+G +PA+LGNC QL  LDLADN LSG IP++FG+++ L 
Sbjct  302   IPPTIGRLKELNLLHLRQNELAGGLPATLGNCQQLKILDLADNQLSGTIPSSFGFIKGLE  361

Query  1798  RLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEI  1977
             + MLYNNSL+G LPD L NL NLTRINLSHN  +G+I P+  S SFLSFDVTNN F+ EI
Sbjct  362   QFMLYNNSLQGSLPDSLINLKNLTRINLSHNKLNGTILPLSGSSSFLSFDVTNNEFEDEI  421

Query  1978  PSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTH  2157
             P  LGNSP+LDRLRLG N+FTG+IP TLG IRELSLLD+S N L+G IP QL LC+KLTH
Sbjct  422   PLQLGNSPNLDRLRLGKNQFTGRIPWTLGKIRELSLLDISSNSLTGTIPLQLVLCKKLTH  481

Query  2158  LDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTL  2337
             +DL+NN LSGPIP WLG+L LLGELKLSSNQF GSLP ELFNC+KLLVLSL+ N+LNG++
Sbjct  482   MDLDNNFLSGPIPPWLGKLSLLGELKLSSNQFVGSLPTELFNCTKLLVLSLDGNALNGSI  541

Query  2338  PPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQS  2517
             P EIGNL +LNVLNLD NQ  G +P  +G L KLYELRLSRN  +GEIP E+G+L+DLQS
Sbjct  542   PQEIGNLGALNVLNLDKNQFSGLLPQAMGKLSKLYELRLSRNILTGEIPFEIGRLQDLQS  601

Query  2518  VLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGE  2697
              LD SYNN TG IP +IGTL KLE+LDLSHN LTGE+P  V +M SLG LNLS N  EG+
Sbjct  602   ALDLSYNNFTGAIPSTIGTLLKLETLDLSHNQLTGEVPGAVGDMKSLGYLNLSFNNFEGK  661

Query  2698  LDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNK-----GSMVVVISALSATVAIILLL  2862
             L K+++ WP DSF+GN+ LCGSPL  C   G  NK        VV+ISA+SA  AI L++
Sbjct  662   LKKQFSRWPADSFIGNTGLCGSPLSHCNKAGRDNKQQGLSARSVVIISAMSALAAIALMI  721

Query  2863  MGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLF--GNAAKKRDIRWDDIMEATN  3036
             +  A FFK   + ++R R   +  SSSSSSSQA  KPLF  G AA K DI+W+DIMEAT+
Sbjct  722   LVIALFFKQRHDFFKRVRDGSSPYSSSSSSSQATHKPLFRTGAAASKSDIKWEDIMEATH  781

Query  3037  NLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLV  3216
             NLS+EF+IGSGG   +YKAEL NGE VA+K+I  KDDL                      
Sbjct  782   NLSEEFMIGSGGSGKIYKAELENGEIVAVKKILWKDDLI---------------------  820

Query  3217  RLMGYCSNKGEGSNVLIYEYMENGSVWDWLH-NQPANNKSKKSLDWEARLKIAMGLAQGV  3393
                    +K EG N+LIYEYM+NGSVWDW H +QP   K KK LDWEARL+IA+GLAQGV
Sbjct  821   -------SKSEGLNLLIYEYMKNGSVWDWFHEDQPVIEKKKKLLDWEARLRIAVGLAQGV  873

Query  3394  EYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYG  3573
             EYLHHDCVP I+HRDIKSSNVLLDSNMEAHLGDFGLAK LT++YD+ NT+SNTWFAGSYG
Sbjct  874   EYLHHDCVPPILHRDIKSSNVLLDSNMEAHLGDFGLAKVLTEDYDT-NTDSNTWFAGSYG  932

Query  3574  YIAPE  3588
             YIAPE
Sbjct  933   YIAPE  937


 Score =   257 bits (656),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 188/519 (36%), Positives = 267/519 (51%), Gaps = 28/519 (5%)
 Frame = +1

Query  1222  LLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGT  1401
             +L L+   L+G IP +L +   ++ L L +N L G IP EL   + LT      N L GT
Sbjct  1     MLALASCRLTGPIPSQLGRLVRVRSLVLQDNNLEGPIPAELGNCSDLTVFTAAENKLNGT  60

Query  1402  ISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQ  1581
             I   +  L NL+ L+L  N L GE+P ++G +  L  + L  N   G IP  + N  +L+
Sbjct  61    IPEELGRLGNLEILNLASNGLSGEIPNQLGEMSQLNYLNLMGNQLQGFIPKSLANLRNLE  120

Query  1582  FIDFYGNQFTGKIPITLGRLKHLFFLHLREN-------------------------DLSG  1686
              +D   N  TG +P  L  +  L  + L +N                          LSG
Sbjct  121   TLDLSTNNLTGAVPEELWSMSQLVDMVLADNHFSGSLSKSVCSNNTSLEQLVLSGTQLSG  180

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL  1866
             EIP  L  C  L  LDL++N L+G+IP     L  LT L L+NN+LEG L   + NL NL
Sbjct  181   EIPVELSKCQSLKQLDLSNNSLTGSIPEALFQLVELTDLYLHNNTLEGTLSPSISNLINL  240

Query  1867  TRINLSHNNFSGSI-APICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTG  2043
               + L HNN  G +   I          +  N F  EIP  +GN   L  + +  N F G
Sbjct  241   QWLVLYHNNLEGKLPKEISALKKLEVLYLYENRFSGEIPKEIGNCTKLKMIDMFGNHFEG  300

Query  2044  KIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpll  2223
             +IP T+G ++EL+LL L  N+L+G +P  L  C++L  LDL +N LSG IP   G +  L
Sbjct  301   EIPPTIGRLKELNLLHLRQNELAGGLPATLGNCQQLKILDLADNQLSGTIPSSFGFIKGL  360

Query  2224  gelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCG  2403
              +  L +N   GSLP  L N   L  ++L +N LNGT+ P      S    ++ +N+   
Sbjct  361   EQFMLYNNSLQGSLPDSLINLKNLTRINLSHNKLNGTILPLS-GSSSFLSFDVTNNEFED  419

Query  2404  SIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSK  2583
              IP  +G    L  LRL +N+F+G IP  +G++++L S+LD S N+LTG IP  +    K
Sbjct  420   EIPLQLGNSPNLDRLRLGKNQFTGRIPWTLGKIREL-SLLDISSNSLTGTIPLQLVLCKK  478

Query  2584  LESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGEL  2700
             L  +DL +N L+G IPP + ++S LG L LS N+  G L
Sbjct  479   LTHMDLDNNFLSGPIPPWLGKLSLLGELKLSSNQFVGSL  517



>emb|CDP04099.1| unnamed protein product [Coffea canephora]
Length=1143

 Score =  1095 bits (2831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/966 (65%), Positives = 729/966 (75%), Gaps = 31/966 (3%)
 Frame = +1

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             LV+L L+   L G I P LG L  L  L+L  N L GP+P  ++N+SSL +     N L+
Sbjct  81    LVSLNLSDSSLGGTISPSLGLLHDLLQLDLSSNQLSGPIPTTLSNLSSLESLLLYSNQLS  140

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             G IP +LG L +L IL + +N LTG IP   G + +L+ L L    L G IP  L KL  
Sbjct  141   GPIPSQLGILINLQILKIGDNGLTGSIPASFGNLDNLIILGLASCSLSGHIPPELGKLGQ  200

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             LQ L L  N+L G +P E G+   L       NNL+G+IP  L S   NLQ L L+   L
Sbjct  201   LQYLILQDNQLDGPIPAELGNCSSLVVFTAALNNLNGSIPAELGS-LQNLQTLNLANNTL  259

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVAN--  1422
             SGEIP +L +   L  L+L  N L G IP+ L  L  L  L L+ N L G I     N  
Sbjct  260   SGEIPAQLGEMSQLVYLNLLGNQLQGGIPKSLANLQNLQTLDLSANKLSGGIPTEFGNMG  319

Query  1423  LTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGN  1602
             L N  TL+L+ NNL G +PREIGMLG+LQI++LY+N  SGEIP EIGNCSSLQ IDF+GN
Sbjct  320   LINYLTLALYQNNLKGNLPREIGMLGNLQILYLYDNQLSGEIPEEIGNCSSLQMIDFFGN  379

Query  1603  QFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGY  1782
             QF+G++P+T+GRLK L FLHLR+NDLSGEIPASLGNC +L  LDLADN LSG IP TFG 
Sbjct  380   QFSGQMPMTIGRLKQLNFLHLRQNDLSGEIPASLGNCRELTILDLADNRLSGGIPPTFGN  439

Query  1783  LRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNA  1962
             L+AL   MLYNNSLEG +P +L  + NLTR+NLS N F+GSIA +C+SHSFLSFDVT+NA
Sbjct  440   LQALQEFMLYNNSLEGTIPAELIKISNLTRVNLSSNKFNGSIAALCSSHSFLSFDVTDNA  499

Query  1963  FDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLC  2142
             FDQEIPS LG SP+L+RLRLG+N+ TGKIP T G IRELSLLD+SGN L+G IP QLS C
Sbjct  500   FDQEIPSQLGYSPALERLRLGNNQLTGKIPWTFGFIRELSLLDISGNSLTGSIPFQLSSC  559

Query  2143  RKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslenns  2322
             +KLTHLDLNNNL SGPIP WLG LPLLGELKLSSN+F G LP ELFNCSKLLVLS+ +NS
Sbjct  560   KKLTHLDLNNNLFSGPIPSWLGTLPLLGELKLSSNRFYGPLPQELFNCSKLLVLSINDNS  619

Query  2323  lnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQL  2502
             LNGTLPPEIG L SLNVLNLD NQL G +PSTIGGL KLYEL L+RN  SGEIP E+G L
Sbjct  620   LNGTLPPEIGRLNSLNVLNLDANQLSGPMPSTIGGLSKLYELHLARNSLSGEIPSEIGSL  679

Query  2503  KDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCN  2682
              +LQS+LD SYNNLTG IP SIG LSKLE+LDLSHN+L+GE+PP+V EM SLGRLNLS N
Sbjct  680   PNLQSILDLSYNNLTGLIPSSIGALSKLEALDLSHNELSGEVPPKVGEMISLGRLNLSYN  739

Query  2683  ELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD-KGSRNKG---SMVVVISALSATVAI  2850
              L+G+LDKR+AHWPV +FVGNS LCGSPL SC+D + ++N G   S VVVISA+S  VAI
Sbjct  740   NLQGKLDKRFAHWPVAAFVGNSLLCGSPLQSCKDFQENKNSGLSQSSVVVISAISTIVAI  799

Query  2851  ILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGNAAKKRDIRWDDIMEA  3030
             ILL    A++                     SSSSQAQ++PLF   A + DIRW+DIMEA
Sbjct  800   ILL---CAYW---------------------SSSSQAQKRPLFQQHAARLDIRWEDIMEA  835

Query  3031  TNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDDLFLDKSFAREIKTLWRIRHRH  3210
             TNNLS+EF+IGSGG  T+Y+A+LFNGETVA+K+I RKDD  LDKSFAREIKTL RIRHRH
Sbjct  836   TNNLSEEFMIGSGGSGTIYRAQLFNGETVAVKKIRRKDDPMLDKSFAREIKTLGRIRHRH  895

Query  3211  LVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKKSLDWEARLKIAMGLAQG  3390
             LV+L+GYC+NKGE SN+LIYE+MENGS WDWLH QP  +K KK LDWEARL+IA+GLAQG
Sbjct  896   LVKLLGYCNNKGEQSNLLIYEFMENGSAWDWLHKQPGKHKKKKGLDWEARLRIAVGLAQG  955

Query  3391  VEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSLNTESNTWFAGSY  3570
             VEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALT NYDS++T+SN WFAGSY
Sbjct  956   VEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTSNYDSVDTDSNLWFAGSY  1015

Query  3571  GYIAPE  3588
             GYIAPE
Sbjct  1016  GYIAPE  1021


 Score =   203 bits (517),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 181/526 (34%), Positives = 255/526 (48%), Gaps = 77/526 (15%)
 Frame = +1

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
             QL  L L++++L GTISPS+  L +L  L L  N L G +P  +  L  L+ + LY N  
Sbjct  80    QLVSLNLSDSSLGGTISPSLGLLHDLLQLDLSSNQLSGPIPTTLSNLSSLESLLLYSNQL  139

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPIT------------------------LGRLK  1644
             SG IP ++G   +LQ +    N  TG IP +                        LG+L 
Sbjct  140   SGPIPSQLGILINLQILKIGDNGLTGSIPASFGNLDNLIILGLASCSLSGHIPPELGKLG  199

Query  1645  HLFFLHLRENDLSGEIPASLGNC------------------------HQLDTLDLADNHL  1752
              L +L L++N L G IPA LGNC                          L TL+LA+N L
Sbjct  200   QLQYLILQDNQLDGPIPAELGNCSSLVVFTAALNNLNGSIPAELGSLQNLQTLNLANNTL  259

Query  1753  SGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHS  1932
             SG IPA  G +  L  L L  N L+G +P  L NL NL  ++LS N  SG I     +  
Sbjct  260   SGEIPAQLGEMSQLVYLNLLGNQLQGGIPKSLANLQNLQTLDLSANKLSGGIPTEFGNMG  319

Query  1933  FLSF---------------------------DVTNNAFDQEIPSFLGNSPSLDRLRLGSN  2031
              +++                            + +N    EIP  +GN  SL  +    N
Sbjct  320   LINYLTLALYQNNLKGNLPREIGMLGNLQILYLYDNQLSGEIPEEIGNCSSLQMIDFFGN  379

Query  2032  RFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgr  2211
             +F+G++PMT+G +++L+ L L  N LSG IP  L  CR+LT LDL +N LSG IP   G 
Sbjct  380   QFSGQMPMTIGRLKQLNFLHLRQNDLSGEIPASLGNCRELTILDLADNRLSGGIPPTFGN  439

Query  2212  lpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDN  2391
             L  L E  L +N   G++P EL   S L  ++L +N  NG++   + +  S    ++ DN
Sbjct  440   LQALQEFMLYNNSLEGTIPAELIKISNLTRVNLSSNKFNGSI-AALCSSHSFLSFDVTDN  498

Query  2392  QLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIG  2571
                  IPS +G    L  LRL  N+ +G+IP   G +++L S+LD S N+LTG IP  + 
Sbjct  499   AFDQEIPSQLGYSPALERLRLGNNQLTGKIPWTFGFIREL-SLLDISGNSLTGSIPFQLS  557

Query  2572  TLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKR  2709
             +  KL  LDL++N  +G IP  +  +  LG L LS N   G L + 
Sbjct  558   SCKKLTHLDLNNNLFSGPIPSWLGTLPLLGELKLSSNRFYGPLPQE  603



>ref|XP_008795782.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Phoenix dactylifera]
Length=1223

 Score =  1077 bits (2786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/1106 (58%), Positives = 798/1106 (72%), Gaps = 38/1106 (3%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsisps  474
             + VLLEVK+SF+      L+GW+  NP +CSW GV+CD    VV LNLS +SLGG +SP+
Sbjct  24    MDVLLEVKKSFLDDPYGVLEGWTADNPVFCSWTGVACDPGSAVVGLNLSAASLGGQVSPA  83

Query  475   lgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRI  654
             LG L  L  LDLSSN L+G IP  L+NLS L SL L+SN L GPIP  +G L+ L+ LR+
Sbjct  84    LGRLARLQALDLSSNRLTGSIPVQLANLSDLASLFLYSNLLSGPIPPSVGSLSALRVLRL  143

Query  655   GDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPP  831
             G+N GL+G IP S GNL NL T+ LA+C L+G                         +P 
Sbjct  144   GNNPGLSGPIPDSLGNLRNLATIALAACNLTG------------------------SMPR  179

Query  832   EIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLN  1011
              +  +S L       N L GSIP ELG L  L I+NLA+N+L G IP QLGE++ LVYLN
Sbjct  180   RLGELSHLENLVLRENQLTGSIPPELGRLARLRIMNLADNSLQGAIPSQLGELNQLVYLN  239

Query  1012  LLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPK  1191
             L GN L G IPKSL KL +LQ+LDLS N+L GE+P E   +G+L FL L+ NNLSG +P+
Sbjct  240   LGGNHLQGPIPKSLGKLASLQTLDLSVNKLEGEIPDELEELGELSFLVLSQNNLSGRLPR  299

Query  1192  SLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDL  1371
             +LC +A NLQ L+LS    SG IP  L+QCR L QLDL+NN+L G+IP E  EL+ LTDL
Sbjct  300   NLCRDAPNLQHLLLSTNNFSGRIPASLAQCRSLMQLDLANNSLTGAIPVEFGELSNLTDL  359

Query  1372  VLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIP  1551
             VLNNN+L G+I+ ++ NLTNLQ L+L+HN L G++P EIG LG L+I++LYEN  SGEIP
Sbjct  360   VLNNNSLSGSITRTLWNLTNLQMLTLYHNGLVGQLPEEIGRLGKLEILYLYENQLSGEIP  419

Query  1552  VEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTL  1731
               IGNCSSL+ IDF+GNQF G IP+T+GRLK L FLHLR+N LSG IP +LGNC QL  L
Sbjct  420   SAIGNCSSLRMIDFFGNQFAGSIPVTVGRLKQLSFLHLRQNGLSGAIPPTLGNCRQLTIL  479

Query  1732  DLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIA  1911
             DLADN LSG IPATFG+L++L + MLYNNSLEG +PD++ N  N+TR+NLS+N  +GSI 
Sbjct  480   DLADNQLSGRIPATFGFLQSLEQFMLYNNSLEGSIPDEMFNCRNITRVNLSNNRLNGSIL  539

Query  1912  PICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLD  2091
             P+C S S LSFD+TNN+F+ EIP+ LGNSP L+R+RLGSNR  G+IP  LG I  LSLL 
Sbjct  540   PLCGSSSLLSFDLTNNSFNFEIPAQLGNSPMLERIRLGSNRLVGEIPPMLGEIESLSLLY  599

Query  2092  LSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPP  2271
             LS N L+G IP +L+ CRKL+H+ LN+N LSG IP W G LP LGEL+LSSN FSGSLP 
Sbjct  600   LSSNSLTGEIPKELASCRKLSHIVLNDNHLSGSIPTWFGSLPQLGELRLSSNGFSGSLPK  659

Query  2272  ELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELR  2451
             ELFNCS LL LSL+NN LNG+LP +IG+L SLNVLNL  NQ  G+IP++IG L +LYEL+
Sbjct  660   ELFNCSNLLKLSLDNNLLNGSLPDQIGDLVSLNVLNLAHNQFSGAIPASIGKLSRLYELQ  719

Query  2452  LSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIP  2631
             LSRN FS EIP E+GQL++LQS LD S+N L GEIP S+ +LSKLE L+LSHN L+GE+P
Sbjct  720   LSRNLFSEEIPVELGQLQELQSTLDLSFNKLIGEIPSSLKSLSKLEELNLSHNLLSGEVP  779

Query  2632  PQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKGSM  2811
              +V EMSSL RL+LS N L G LD++++ WP  SF  N  LCGSPL  C    S    S 
Sbjct  780   REVGEMSSLVRLDLSYNGLRGRLDEQFSRWPSQSFAANLALCGSPLPPCATSDSTAHRST  839

Query  2812  V--VVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGN  2985
             +  V I+ +SA+V ++ +++  A      R   RR       A SS S SQ  R  L   
Sbjct  840   LKSVFIALISASVTLVAVILLIALAISIRRHHLRRSSEVNCAAYSSKSFSQTYRHLLMLK  899

Query  2986  AAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKD-DLFL-D  3159
              + +R+ +W+ IMEAT+NLSDE+ +GSGG  TVYKAEL  GET+A+K+I  K+ DLF  D
Sbjct  900   GSARREFKWEAIMEATSNLSDEYAVGSGGSGTVYKAELPTGETLAVKKIVHKEWDLFFQD  959

Query  3160  KSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKK  3339
             KSFARE+K L  +RHRHLV+L+G+ SN GE  N+LIY+YMENGSVWDWLH    + K K 
Sbjct  960   KSFAREVKILSGVRHRHLVKLLGFLSNNGE--NLLIYDYMENGSVWDWLHRPAVSRKKKG  1017

Query  3340  SLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTD  3519
              L+WE RLKIA+GLA+GVEYLHHDCVPKI+HRDIKSSNVLLD ++EAHLGDFGLAKA+ +
Sbjct  1018  ELNWERRLKIAIGLAKGVEYLHHDCVPKIVHRDIKSSNVLLDGDLEAHLGDFGLAKAVAE  1077

Query  3520  NYDSL---NTESNTWFAGSYGYIAPE  3588
             ++ +    +TES +WFAGSYGYIAPE
Sbjct  1078  SHQADSKGHTESCSWFAGSYGYIAPE  1103



>ref|XP_010928757.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Elaeis guineensis]
Length=1231

 Score =  1061 bits (2745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/1106 (58%), Positives = 805/1106 (73%), Gaps = 37/1106 (3%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsisps  474
             + VLLEVK+SF+      L+ WS  NP +CSW GV+CD    VV LNLS + L G +SP+
Sbjct  31    MDVLLEVKKSFLEDPYGVLESWSADNPVFCSWTGVACDPGSAVVGLNLSAALLAGRVSPA  90

Query  475   lgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRI  654
             LG L  L  LDLS+N L+G IP  L+NLS L SLLL+SN L GPIP  LG L+ L+ LR+
Sbjct  91    LGRLGRLQALDLSTNRLAGSIPVQLANLSDLASLLLYSNLLSGPIPPSLGSLSALRVLRL  150

Query  655   GDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPP  831
             GDN GL+G IP S GNL NL TL LA+C L+G                         +P 
Sbjct  151   GDNPGLSGPIPDSLGNLRNLTTLALAACNLTG------------------------SMPR  186

Query  832   EIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLN  1011
              +  +S L      +N L GSIP ELG L  L I+NLANN+L G IP QLGE++ LVYLN
Sbjct  187   RLGELSHLENLYLRVNQLTGSIPPELGRLASLQIINLANNSLQGAIPSQLGELNQLVYLN  246

Query  1012  LLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPK  1191
              +GNQL G IPKSL KL +LQ+LDLSGN+L GE+P E   +G++ FL L+ NNLSG +P+
Sbjct  247   FMGNQLQGPIPKSLGKLASLQTLDLSGNKLQGEIPDELEELGEISFLVLSENNLSGRLPR  306

Query  1192  SLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDL  1371
             +LC +A NLQ L+LS    SG IP  L+QCR L QLDL+NN+L G+IP E  EL+ LTDL
Sbjct  307   NLCRDAPNLQHLLLSTNNFSGRIPAGLAQCRSLMQLDLANNSLTGAIPVEFGELSNLTDL  366

Query  1372  VLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIP  1551
             +LNNN+L G+I  ++ NLTNLQTL+L+HN+L GE+P EIG LG L++++LYEN  SGEIP
Sbjct  367   LLNNNSLSGSIPRTLWNLTNLQTLTLYHNDLVGELPEEIGKLGKLEVLYLYENQLSGEIP  426

Query  1552  VEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTL  1731
               IGNCSSLQ IDFYGNQFTG IP+T+GRLK L  L LR+N LSG IPA+LGNC QL  L
Sbjct  427   SAIGNCSSLQMIDFYGNQFTGSIPVTVGRLKQLSLLDLRQNGLSGAIPATLGNCQQLTIL  486

Query  1732  DLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIA  1911
             DLADN LSG IPATFG+L++L + MLYNNSLEG +PD++ N  N+TR+NLS+N  +GSI 
Sbjct  487   DLADNQLSGRIPATFGFLQSLEQFMLYNNSLEGSIPDEMFNCRNITRVNLSNNRLNGSIL  546

Query  1912  PICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLD  2091
             P+C S S LSFD+TNN+F+ E+P+ LGNSP L+R+RLGSNR  G+IP  LG I  LSLLD
Sbjct  547   PLCGSSSLLSFDLTNNSFNFEVPAQLGNSPMLERIRLGSNRLVGEIPPMLGEIEALSLLD  606

Query  2092  LSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPP  2271
             LS N L+G IP +L+ CR L+H+ LN+N LSG IP W+G LP LGEL++SSN FSGSLP 
Sbjct  607   LSSNSLTGEIPKELASCRNLSHIVLNDNHLSGAIPSWIGSLPQLGELRVSSNGFSGSLPV  666

Query  2272  ELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELR  2451
             ELFNCS LL LSL++N LNG+LP +IG+L SLNVL+L  NQ  G IP++IG L  LYELR
Sbjct  667   ELFNCSNLLKLSLDDNLLNGSLPYQIGDLVSLNVLDLAHNQFSGPIPASIGKLSMLYELR  726

Query  2452  LSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIP  2631
             LS+N FS  IP E+GQL++LQS+LD S+N+LTGEIP S+ +LSKLE L+LSHN LTGE+P
Sbjct  727   LSQNLFSENIPVELGQLQELQSILDLSFNSLTGEIPSSLKSLSKLEELNLSHNLLTGEVP  786

Query  2632  PQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKGSM  2811
              Q+ EMSSL +L+LS N L G LD++++ WP   FV N  LCGSPL  C    S    S 
Sbjct  787   RQIGEMSSLVKLDLSYNRLRGRLDEQFSRWPPQCFVANLALCGSPLQPCAPSNSTPHRST  846

Query  2812  V--VVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGN  2985
             +  V I+ +SA+V ++++++  A      R   RR   + N A SS SSSQ  R      
Sbjct  847   LNSVSIALVSASVTLVVVILLIALAISIRRHHLRRSSSEVNCADSSKSSSQIHRHLSILK  906

Query  2986  AAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKD-DLF-LD  3159
              + +R+ +W+ IMEAT+NLSDEF+IGSGG  TVYKAEL +GE +A+K+I RKD DLF  D
Sbjct  907   RSARREFKWEAIMEATSNLSDEFVIGSGGSGTVYKAELPSGEILAVKKIVRKDRDLFSQD  966

Query  3160  KSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKK  3339
             KSFARE+K L  +RHRHLV+L+G+ SN  +G ++LIY+YMENGSVWDWLH    + K K+
Sbjct  967   KSFAREVKILSGVRHRHLVKLLGFLSNN-KGEHLLIYDYMENGSVWDWLHRPVVSQKKKR  1025

Query  3340  SLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTD  3519
              L+WE RLKIA+GLA+GVEYLHHDCVPKIIHRDIK+SN LLD NMEAHLGDFGLAK + +
Sbjct  1026  ELNWERRLKIAIGLAKGVEYLHHDCVPKIIHRDIKTSNALLDGNMEAHLGDFGLAKVVAE  1085

Query  3520  NYDSLN---TESNTWFAGSYGYIAPE  3588
             ++ + +   TES +WFAGSYGYIAPE
Sbjct  1086  SHRADSKGGTESGSWFAGSYGYIAPE  1111



>gb|EPS61003.1| hypothetical protein M569_13794, partial [Genlisea aurea]
Length=1159

 Score =  1057 bits (2734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/1086 (61%), Positives = 804/1086 (74%), Gaps = 45/1086 (4%)
 Frame = +1

Query  349   LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsispslgllthllhldlssnhls  528
             L  WS  + ++CSW+GVSC G  +VV LNLS SSL G++SP++GLL  LL LDLSSN LS
Sbjct  2     LNDWSSGDADFCSWRGVSCSGRREVVGLNLSASSLAGAVSPAIGLLPRLLRLDLSSNLLS  61

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             G IPP L+NL+SLESLLLFSNRL G IP +L  L  LQ LRIGDN LTG+IP S G L +
Sbjct  62    GSIPPDLANLTSLESLLLFSNRLSGSIPPELSSLRRLQLLRIGDNLLTGEIPPSLGELRS  121

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L TLGLASC L+G IPP+LG+L +LQNL LQQN L GP+PPE+ N S L  F+AA N L+
Sbjct  122   LATLGLASCSLTGTIPPELGKLDKLQNLILQQNQLRGPIPPELGNCSGLVIFTAAENQLD  181

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             GSIP ELG LK+L I+NLANN+L+GEIP Q+G+M+ L YLNLLGN+L G IP SL  LTN
Sbjct  182   GSIPPELGRLKNLEIMNLANNSLSGEIPPQIGDMNRLSYLNLLGNRLQGRIPNSLPNLTN  241

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             L++LDLSG                        NNL G IP +L +  T+L   ML +  L
Sbjct  242   LRNLDLSG------------------------NNLVGEIPPALTATLTHL---MLGQNLL  274

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
             SG IP E+  C+ L+ LDLSNN++ GS+P ELYE++QLTDL+LN+N+L G++SP + NLT
Sbjct  275   SGGIPAEIKSCKFLEVLDLSNNSIGGSMPPELYEMSQLTDLILNDNSLSGSVSPRIGNLT  334

Query  1429  NLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQF  1608
             NL+TLSL+ N L G +PREIGMLG+LQI++LYEN  SGEIP+EI NCS+LQ +D +GNQF
Sbjct  335   NLRTLSLYQNQLQGSLPREIGMLGNLQILYLYENRLSGEIPLEIANCSNLQMVDLFGNQF  394

Query  1609  TGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLR  1788
             +GKIP  +G L  L FLHLR+NDLSGEIPASLGNC  L  +DLADN LSG IPATFG L 
Sbjct  395   SGKIPTAIGELTQLKFLHLRQNDLSGEIPASLGNCTSLAVVDLADNRLSGEIPATFGNLG  454

Query  1789  ALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFD  1968
             AL +L+LYNNSL+G LP  L NL N TRINLS+N   GS+ P+C+S   LSFDV+NN FD
Sbjct  455   ALEQLILYNNSLQGALPQRLINLVNFTRINLSNNRLHGSLEPLCSSRKLLSFDVSNNGFD  514

Query  1969  QEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRK  2148
               IP  LG SPSL+RLRL  N  +G+IP+TLG+IRELSLLDLS NKL+G IP +LS C++
Sbjct  515   TGIPHQLGYSPSLERLRLSGNMLSGEIPVTLGIIRELSLLDLSRNKLTGQIPFELSHCKR  574

Query  2149  LTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsln  2328
             LT+LDL++N+LSG +P W+G +PLLGEL L  N+ S SLP ELFNC  LL+LSL NN L 
Sbjct  575   LTYLDLDHNMLSGTVPHWVGDMPLLGELNLEDNRLSESLPEELFNCKNLLLLSLGNNFLT  634

Query  2329  GTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKD  2508
             G L PEIG L SLNVL+L  N+  G IPS++G L +LY+L+LS NRFSGEIP E+GQL++
Sbjct  635   GDLSPEIGKLVSLNVLDLKGNRFSGRIPSSLGQLRELYQLQLSGNRFSGEIPSEIGQLQN  694

Query  2509  LQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNEL  2688
             LQS+LD SYNNL+G +P SI  LSKLE+LDLSHN+L+GE+PPQV  M+SL RL+LS N  
Sbjct  695   LQSILDLSYNNLSGTVPLSIAALSKLEALDLSHNELSGEVPPQVNRMNSLERLDLSFNNF  754

Query  2689  EGELDKRYAHWPVDSFVGNSHLCGSPLGSCR-DKGSRNKGSMVVVISALSATVAIILLLM  2865
              GELD  YA WP  +FVGNS LCG PL +C+  + S   G   V+  ++ +   +++LL 
Sbjct  755   NGELDGGYARWPAIAFVGNSDLCGGPLRNCKFIEKSYGLGESSVIAISIISATFVLILLS  814

Query  2866  GAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLS  3045
                FFF    +  +        A   +S S +Q   LF     KRD +W DIMEATNNLS
Sbjct  815   VVGFFFFFLLKHKKTTMAGIQLAGCPTSDSPSQ--ALFDRP--KRDFKWVDIMEATNNLS  870

Query  3046  DEFIIGSGGCATVYKAELFNGETVAIKRI-PRKDDLFLDKSFAREIKTLWRIRHRHLVRL  3222
             +EF+IGSGG  T+Y+A+L  GETVAIKRI P K D   DK+F+REIKTL RIRHRHLVRL
Sbjct  871   EEFVIGSGGSGTIYRADLSTGETVAIKRITPLKKD---DKTFSREIKTLGRIRHRHLVRL  927

Query  3223  MGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYL  3402
             +GYCSN  +GSN+LIYE+MENGS+WDWLH      K    LDW ARLKIA+GLA G+EYL
Sbjct  928   VGYCSNNKDGSNLLIYEFMENGSLWDWLH-----KKKPSKLDWYARLKIAVGLAHGLEYL  982

Query  3403  HHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSL-NTE---SNTWFAGSY  3570
             HHDC PKI+HRD+KSSNVLLDS MEA LGDFGLAK L+D++DS  NTE   S++WFAGSY
Sbjct  983   HHDCAPKILHRDVKSSNVLLDSKMEARLGDFGLAKLLSDHHDSENNTESSSSSSWFAGSY  1042

Query  3571  GYIAPE  3588
             GYIAPE
Sbjct  1043  GYIAPE  1048



>ref|XP_009413356.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Musa acuminata subsp. malaccensis]
Length=1235

 Score =  1051 bits (2719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/1113 (57%), Positives = 793/1113 (71%), Gaps = 45/1113 (4%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQLQG----WSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsi  465
             S  + VL EV++SF    +G    W   NP+YCSW GV+CD    VV+LNLS SSL GS+
Sbjct  30    SVYMEVLFEVRKSFTEDPRGVLDDWRRDNPDYCSWNGVTCDLDSAVVALNLSSSSLAGSL  89

Query  466   spslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQA  645
             S SLG L+ L  LD+SSN  +G IP  L+ LS+L +L L+SNRL G IPS LG L++L+ 
Sbjct  90    SRSLGRLSRLATLDVSSNRFTGTIPSQLAGLSALTTLFLYSNRLSGTIPSSLGSLSSLRV  149

Query  646   LRIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGP  822
             +R+GDN GL+G IP SFG+L NL TL LA C LSG IP                      
Sbjct  150   IRLGDNPGLSGPIPDSFGDLRNLTTLALALCNLSGSIPR---------------------  188

Query  823   LPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLV  1002
                 +  ++ L       N L+G IP ELG L  L ILNLANN L GEIP QLG++S L 
Sbjct  189   ---RLGRLTHLQNLVLQQNQLDGHIPSELGNLADLRILNLANNLLQGEIPSQLGKLSQLT  245

Query  1003  YLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGT  1182
             YLN++ N+L G+IP+SL KL  LQ+LDLS N L GE P E G + +L +L L++N LSG 
Sbjct  246   YLNMMSNRLEGTIPRSLCKLVGLQNLDLSMNELEGEFPAELGQLSELNYLVLSNNKLSGG  305

Query  1183  IPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQL  1362
             +P+ LC NAT LQ L LS    SG+IP  L QC  L QLDL+NN+  G+IP EL EL  L
Sbjct  306   LPEDLCQNATRLQHLFLSTNRFSGQIPAGLVQCLSLTQLDLANNSFTGAIPVELGELVDL  365

Query  1363  TDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSG  1542
             TDL+LNNN+L G+I     NL+NLQ L+L+HN L G++P EIG L  LQI++LYEN  SG
Sbjct  366   TDLLLNNNSLSGSILREFGNLSNLQILTLYHNELRGQLPEEIGRLQQLQILYLYENQLSG  425

Query  1543  EIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQL  1722
             EIP  IGNCSSL+ IDFYGNQF+G IP T+GRL+ L FLHLR+NDLS +IPASLGNC QL
Sbjct  426   EIPSAIGNCSSLKMIDFYGNQFSGGIPATIGRLEQLSFLHLRQNDLSSKIPASLGNCRQL  485

Query  1723  DTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSG  1902
               LDLADN L G IPATFG L++L +LMLYNNSLEG +PD++ +  N+TR+NLS+N F+G
Sbjct  486   TILDLADNRLPGGIPATFGLLKSLQQLMLYNNSLEGSIPDEMFDCRNITRVNLSNNRFNG  545

Query  1903  SIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELS  2082
             SI P+C S S LSFD+TNN+F+ EIP+ LGNSP+L+R+RLG+NR TGKIP  LG I  LS
Sbjct  546   SILPLCGSTSLLSFDLTNNSFNLEIPAQLGNSPALERIRLGNNRLTGKIPPMLGEIGALS  605

Query  2083  LLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGS  2262
             LLDLS N L+G IP +L+ C+ LTH+ LNNN L+G +P WLG +P LGELKLSSN+F G 
Sbjct  606   LLDLSSNLLTGVIPKELAACKNLTHIVLNNNRLTGVVPTWLGSIPQLGELKLSSNRFFGP  665

Query  2263  LPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLY  2442
             LP ELFNCS LL +SL +NSL+G+LPPEIG L S+NVL+L  NQ  G+IP++I  L KLY
Sbjct  666   LPVELFNCSNLLKVSLADNSLSGSLPPEIGKLTSVNVLDLAHNQFSGAIPASIAQLSKLY  725

Query  2443  ELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTG  2622
             ELRLSRN F+G +  E+G+L++LQS LD S+NNL+GEIP S+ +L+KLE L+LSHN LTG
Sbjct  726   ELRLSRNLFTGPVLVELGRLQELQSALDLSFNNLSGEIPSSLASLAKLEYLNLSHNFLTG  785

Query  2623  EIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD-----K  2787
             ++P Q+ EMSSL  L+LS N+LEG+LD R+A WP  SF  N  LCGSPL  C       +
Sbjct  786   DVPRQIGEMSSLVVLDLSSNDLEGQLDGRFARWPPQSFAANLGLCGSPLQPCNIISPACE  845

Query  2788  GSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQR  2967
             GS    + V VISA + T+ IILLL+ A  +    R     R  + N A S   SS    
Sbjct  846   GSTLSSAAVAVISA-TVTLVIILLLIAAVLWI---RRRCAERSSEVNCAYSFKGSSSKIH  901

Query  2968  KPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRI--PRK  3141
             + L    + +R+++W+ IMEAT NLSDEF+IGSGG  TVY+ E+ +GETVA+K+I   ++
Sbjct  902   RELIVKGSTRRELKWEAIMEATCNLSDEFVIGSGGSGTVYRVEMPSGETVAVKKILHDKR  961

Query  3142  DDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPA  3321
             + L  DKSF RE+K L RIRHRHLV+L+GY S + +G ++L+YEYMENGS+W+WLH    
Sbjct  962   ESLLQDKSFVREVKILGRIRHRHLVKLLGYLS-RNQGEHLLVYEYMENGSLWNWLHEPAV  1020

Query  3322  NNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGL  3501
             + K K+ L WEARLKIA+GLA+GVEYLHHDCVP I+HRDIKSSNVLLD +MEAHLGDFGL
Sbjct  1021  SQKRKRELSWEARLKIAIGLAKGVEYLHHDCVPMIVHRDIKSSNVLLDGDMEAHLGDFGL  1080

Query  3502  AKAL-TDNY---DSLNTESNTWFAGSYGYIAPE  3588
             AKA+  +NY    +  TE+ + FAGSYGY+APE
Sbjct  1081  AKAVAAENYPDGSARYTETGSCFAGSYGYMAPE  1113



>ref|XP_009412457.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Musa acuminata subsp. malaccensis]
Length=1238

 Score =  1005 bits (2599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/1117 (55%), Positives = 765/1117 (68%), Gaps = 48/1117 (4%)
 Frame = +1

Query  283   RCQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdss  450
             R  ++   + VLLEVK SF       +  W+  N  YCSW GV+CD    VV+LNLS +S
Sbjct  27    RSLDSVDYVEVLLEVKNSFTEDPRRLIHDWNSDNQEYCSWTGVACDRDSAVVALNLSSTS  86

Query  451   lggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLL  630
             L GS+SPSLG L  L  LD SSN L+G IP  L  LS+L +L L+SNRL G IP  LG L
Sbjct  87    LAGSLSPSLGRLIRLATLDFSSNRLTGAIPSQLGRLSALTALFLYSNRLSGTIPFSLGFL  146

Query  631   TNLQALRIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqn  807
              +L+ +R+GDN GL+G IP SFG+L NL TL LA C LSG                    
Sbjct  147   YSLRVVRLGDNPGLSGPIPDSFGDLRNLTTLALALCNLSG--------------------  186

Query  808   llEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGE  987
                 P+   +  ++ L       N LNG IP ELG L +L ILNLANNTL GEIP +LGE
Sbjct  187   ----PISSRLGRLTQLQNLVLQQNQLNGPIPPELGNLANLQILNLANNTLQGEIPSRLGE  242

Query  988   MSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSN  1167
             +S L YLNL+ NQL G+IP SL KL+ L+ LDLS N L GE P E   + +L++L L+ N
Sbjct  243   LSLLSYLNLMSNQLKGTIPGSLGKLSALRVLDLSMNELEGEFPAELARLSELEYLVLSDN  302

Query  1168  NLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELY  1347
               SG +P++LC NAT L  L LS    SG IP  LSQC  L QLDL+NN+  G IP +L 
Sbjct  303   KFSGHLPENLCPNATKLGYLFLSTNNFSGPIPAGLSQCWSLTQLDLANNSFTGDIPVDLG  362

Query  1348  ELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYE  1527
             ELT LTDL+LNNN+L G+I     NL+ LQTL+L+HN L G +P EIG L  LQI++LYE
Sbjct  363   ELTNLTDLLLNNNSLTGSIPREFGNLSILQTLTLYHNELRGRLPEEIGRLRQLQILYLYE  422

Query  1528  NHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLG  1707
             N  S EIP  IGNCS L+ +DF+GNQF+G IP  +G L  L FLHLR+N+LSGEIPAS+G
Sbjct  423   NQLSDEIPSAIGNCSRLRMMDFFGNQFSGSIPARIGELTQLSFLHLRQNNLSGEIPASMG  482

Query  1708  NCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSH  1887
             NC +L  LDLADN L+G IPATFG LR+L + MLYNNSL+G +PD++    N+TR+NLS+
Sbjct  483   NCRRLTVLDLADNRLTGGIPATFGLLRSLEQFMLYNNSLDGGIPDEMFECRNITRVNLSN  542

Query  1888  NNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGL  2067
             N  +GSI P+C S S LSFD+TNN+FDQEIP+ LGNSP L+R+RLGSNR TG++P  LG 
Sbjct  543   NRLNGSILPLCGSSSLLSFDLTNNSFDQEIPAQLGNSPMLERIRLGSNRLTGQVPPVLGG  602

Query  2068  IRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSN  2247
             I  LSLLDLSGN L+G IP  LS CR LTH+ L+ N L G IP W+G L  LGEL+LSSN
Sbjct  603   IGALSLLDLSGNSLTGTIPEDLSSCRGLTHIILSENQLDGVIPTWIGSLQQLGELELSSN  662

Query  2248  QFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGG  2427
              FSG LP ELF+CS LL +SL++NSLNG+L PE+G L SLNVLNL  NQ  G+IP++IG 
Sbjct  663   SFSGPLPVELFDCSNLLKVSLDDNSLNGSLSPEVGKLASLNVLNLAHNQFSGAIPASIGR  722

Query  2428  LGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSH  2607
             L KLYELRLS+N FSG IP ++GQL+DLQS LD S+N+L G IP S+ +L KLE L+LSH
Sbjct  723   LSKLYELRLSQNLFSGSIPVQLGQLQDLQSALDLSFNDLNGGIPLSLASLMKLEDLNLSH  782

Query  2608  NDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDK  2787
             N LTGE+P Q+ EMSSL  L+LS N+L+G+LD R++ WP  SF  N  LCG PL  C   
Sbjct  783   NSLTGEVPRQIGEMSSLVTLDLSHNDLQGQLDGRFSRWPPQSFAANRALCGRPLQPCGIA  842

Query  2788  GSRNKGSMV----VVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssss  2955
              S  + S +    V + ++   + I+LLL+ A  +    R  Y +R    N ASS     
Sbjct  843   SSTKRRSTLSSAAVAVVSVVGALVIVLLLVAALTWI---RRWYTKRSSGVNRASSPIGHR  899

Query  2956  QAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRI-  3132
             Q     L    + +R++ W+ IMEAT NLSDEF IGSGG   VY+AE   GETVA+K+I 
Sbjct  900   Q-----LITKGSIRRELTWEAIMEATCNLSDEFAIGSGGSGIVYRAEFPTGETVAVKKIL  954

Query  3133  --PRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWL  3306
                R++ +  + SF RE+KTL RIRHRHL  L+G C +   G ++LIYEYME GS+WDWL
Sbjct  955   HYNRENLMLQENSFVREVKTLGRIRHRHLANLLG-CLSSNHGEHLLIYEYMEKGSLWDWL  1013

Query  3307  HNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHL  3486
             H   A+ K K+ L WEARL+IA+GLA+GVEYLHHDCVP I+HRDIKS NVLLD +MEAHL
Sbjct  1014  HKPEASQKRKRELSWEARLRIAIGLAKGVEYLHHDCVPSILHRDIKSGNVLLDGDMEAHL  1073

Query  3487  GDFGLAKALTDNYDSL---NTESNTWFAGSYGYIAPE  3588
             GDFGLAKA+ ++  S    NTES + FAGSYGY+APE
Sbjct  1074  GDFGLAKAVAESRGSDSTGNTESGSCFAGSYGYVAPE  1110



>ref|XP_009417199.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Musa acuminata subsp. malaccensis]
Length=1228

 Score =  1004 bits (2597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/1108 (57%), Positives = 795/1108 (72%), Gaps = 45/1108 (4%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQLQ----GWSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsi  465
             S  + VLLEVK+SF   L+     WS  NP++CSW GV+CD    VV+LNLS SSL GS+
Sbjct  31    SVDMEVLLEVKKSFTEDLRRVLDDWSSDNPDHCSWTGVTCDLDSGVVALNLSSSSLAGSL  90

Query  466   spslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQA  645
             SPSLG L+ L  LDLSSN L+G IP  L+ LS+L +L L+SNRL G +P  LG L+ L+ 
Sbjct  91    SPSLGRLSRLATLDLSSNRLTGTIPSQLARLSALTTLFLYSNRLSGTMPPSLGSLSGLRV  150

Query  646   LRIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGP  822
             +R+GDN GL+G IP SFG+L NL TL LA C LSG                        P
Sbjct  151   VRLGDNPGLSGPIPGSFGDLRNLTTLALALCNLSG------------------------P  186

Query  823   LPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLV  1002
             +P  +  ++ L       N L+G IP ELG L  L ILNLA+N L GEIP QLGE+S L 
Sbjct  187   IPSRLGRLTQLHNLVLQQNQLDGPIPPELGNLDKLQILNLADNLLGGEIPSQLGELSQLT  246

Query  1003  YLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGT  1182
             YLNL+ NQL G+I  SL KL+ L++LDLS N+L GELP E G + +L +L L++N LSG 
Sbjct  247   YLNLMSNQLEGTITSSLGKLSGLRNLDLSMNQLEGELPTELGQLSELNYLVLSNNKLSGH  306

Query  1183  IPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQL  1362
             +P++LC NAT L+ L LS    +G IP  + QCR L QLDL+NN+  G+IP EL EL  L
Sbjct  307   LPENLCLNATKLEHLFLSGNNFTGRIPASIVQCRSLTQLDLANNSFTGAIPVELGELANL  366

Query  1363  TDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSG  1542
             TDL+LNNN+L G+I     NL+NLQTL+L+HN L G +P EIG L  LQI++LYEN  SG
Sbjct  367   TDLLLNNNSLWGSIPSEFGNLSNLQTLALYHNELRGGLPEEIGKLQQLQILYLYENQLSG  426

Query  1543  EIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQL  1722
             EIP  IGNCSSLQ IDFYGNQF+G IP ++GRL+ L F+HLR+NDLSGEIPASLG C QL
Sbjct  427   EIPPAIGNCSSLQMIDFYGNQFSGSIPASIGRLEQLSFVHLRQNDLSGEIPASLGRCRQL  486

Query  1723  DTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSG  1902
               LDLADN LSG IPAT G L++L +LMLYNNSLEG +P+++ +  N+TR+NLS+N F+G
Sbjct  487   TILDLADNRLSGGIPATLGLLQSLQQLMLYNNSLEGSIPEEMFDCRNITRVNLSNNRFNG  546

Query  1903  SIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELS  2082
             SI P+C S S LSFD+TNN+F+ EIP+ LGNSP+L+R+RLGSNR  G+IP  LG I  LS
Sbjct  547   SILPLCGSSSLLSFDLTNNSFNLEIPAQLGNSPALERIRLGSNRLAGEIPPMLGEIGALS  606

Query  2083  LLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGS  2262
             LLDLS N L+G IP +L+ C+ LTH+ LNNN L+G IP W+G LP LGELKLSSN+F G 
Sbjct  607   LLDLSSNSLTGVIPEELASCKNLTHIVLNNNQLTGVIPTWVGSLPQLGELKLSSNRFFGP  666

Query  2263  LPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLY  2442
             LP ELFNCSKLL LSL++NSLNG+LP E+G L SLNVL+   NQL G IP++IG L KLY
Sbjct  667   LPIELFNCSKLLKLSLDDNSLNGSLPSEVGKLASLNVLDFARNQLSGGIPASIGRLSKLY  726

Query  2443  ELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTG  2622
             +LRLS N FSG I  E+GQL++LQS LD S+N+L+GEIP S+ +L+KLE L+LSHN L G
Sbjct  727   DLRLSHNLFSGPILMELGQLQELQSALDLSFNDLSGEIPSSLASLAKLEDLNLSHNSLAG  786

Query  2623  EIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNK  2802
             E+P Q+ EMSSL  L+LS N L+G+LD+R+A WP  SF  N  LCG PL  C    S + 
Sbjct  787   EVPRQIGEMSSLVELDLSHNNLQGQLDERFARWPPQSFAANLALCGYPLPPCGVARSAHH  846

Query  2803  GSM----VVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRK  2970
              S      V   + S T+ IILLL+ A  +    R    +R  + N   SS SSSQA R+
Sbjct  847   RSTSSSAAVAAISASVTLVIILLLIAAVIWI---RRWCTKRTIEVNCTYSSRSSSQAHRE  903

Query  2971  PLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRI--PRKD  3144
              L    +++R+++WD IMEAT NLSDEF+IGSGG  TVY+AEL +GETVA+K+I    ++
Sbjct  904   -LIMKGSRRRELKWDAIMEATCNLSDEFVIGSGGSGTVYRAELPSGETVAVKKILHQHRE  962

Query  3145  DLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPAN  3324
              L  DKSF RE+K L RIRHRH V+L+G+ S+  +G ++L+YEYMENGS+WDWLH    +
Sbjct  963   SLLQDKSFVREVKILGRIRHRHFVKLLGFLSSN-DGEHLLVYEYMENGSLWDWLHKPGVS  1021

Query  3325  NKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLA  3504
              K K+ L+WEARLKIA+GLA+GVEYLHHDCVP+I+HRDIKS NVLLD +MEAHLGDFGLA
Sbjct  1022  QKRKRELNWEARLKIAIGLAKGVEYLHHDCVPRIVHRDIKSGNVLLDGDMEAHLGDFGLA  1081

Query  3505  KALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             KA+TD      TE+ + FAGSYGY+APE
Sbjct  1082  KAVTD-----GTETGSCFAGSYGYMAPE  1104



>ref|XP_004957750.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Setaria italica]
Length=1264

 Score =   988 bits (2553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/1122 (54%), Positives = 782/1122 (70%), Gaps = 34/1122 (3%)
 Frame = +1

Query  313   VLLEVKRSFVLQLQG---------WSEKNPNYCSWQGVSCD-Gslkvvslnlsdsslggs  462
             VLLEVKR+FV  L+G                +CSW GV+CD   L+VVSLNLS + L G 
Sbjct  31    VLLEVKRAFVGDLEGVLAGWNASGAGAGAAGFCSWAGVACDDAGLRVVSLNLSGAGLAGP  90

Query  463   ispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQ  642
             +  +L  L  L  +DLSSN L+GPIP AL  L+SL+ LLL+SN+L G IP+ LG L  LQ
Sbjct  91    VPRALARLDALQAIDLSSNALAGPIPAALGALASLQVLLLYSNQLTGEIPASLGKLAVLQ  150

Query  643   ALRIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEG  819
              LR GDN GL+G IP + G LGNL  LGLASC L+G IP  LGRL  L  LNLQQN L G
Sbjct  151   VLRAGDNPGLSGAIPDALGELGNLTVLGLASCNLTGPIPAGLGRLAALTALNLQQNALSG  210

Query  820   PLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSL  999
             P+P  +A ++SL   + A N L G+IP ELG L  L  LNL NN+L G IP +LGE+  L
Sbjct  211   PIPRGLAGLASLQVLALAGNQLTGAIPPELGRLTGLQKLNLGNNSLVGAIPPELGELGEL  270

Query  1000  VYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSG  1179
              YLNL+ N+L G +P++LAKL++++ +DLSGN L+G+LP + G + +L FL L+ N L+G
Sbjct  271   QYLNLMNNRLSGRVPRALAKLSSVRMIDLSGNMLSGDLPADLGRLPELTFLVLSDNQLTG  330

Query  1180  TIPKSLCSNA--------TNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIP  1335
             ++P  LC  A        ++L+ LMLS    +GEIP  LS+C+ L QLDL+NN+L+G+IP
Sbjct  331   SVPGDLCGGAGASDEAESSSLEHLMLSTNNFTGEIPEGLSRCQALTQLDLANNSLSGAIP  390

Query  1336  EELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQII  1515
               L EL  LTDL+LNNN+L G + P + NLT LQTL+L+HN L G +P  IG L +L+++
Sbjct  391   AALGELGNLTDLMLNNNSLSGELPPELFNLTELQTLALYHNKLTGRLPDAIGRLVNLEVL  450

Query  1516  FLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIP  1695
             +LYEN F+GEIP  IG+C+SLQ ID +GN+F G IP ++G L  L F+  R+N+LSG IP
Sbjct  451   YLYENQFAGEIPESIGDCTSLQMIDIFGNRFNGSIPASMGNLSQLAFIDFRQNELSGSIP  510

Query  1696  ASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRI  1875
               LG C QL  LDLADN LSG IP TFG LR+L + MLYNNSL G +PD +    N+TR+
Sbjct  511   PELGECRQLQVLDLADNALSGPIPETFGKLRSLQQFMLYNNSLSGTIPDSMFECRNITRV  570

Query  1876  NLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPM  2055
             N++HN  +GS+ P+C +   LSFD TNN+F   IP+ LG S SL R+RLGSN  +G IP 
Sbjct  571   NIAHNRLTGSLLPLCGTARLLSFDATNNSFHGGIPAQLGRSSSLQRVRLGSNMLSGPIPP  630

Query  2056  TLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelk  2235
             +LG I  L+LLD+S N L+G IP  L+ C++L+ + L++N LSGP+P WLG LP LGEL 
Sbjct  631   SLGGIAALTLLDVSNNALTGSIPATLAQCKQLSLIVLSHNRLSGPVPDWLGSLPQLGELT  690

Query  2236  lSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPS  2415
             LS+N+F+G LP +L NCSKLL LSL+NN +NGT+PPEIG+L SLNVLNL  NQL G IP+
Sbjct  691   LSNNEFAGPLPVQLSNCSKLLKLSLDNNQINGTVPPEIGSLVSLNVLNLAHNQLSGLIPT  750

Query  2416  TIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESL  2595
             TI  L  LYEL LS+N  SG IP ++G+L++LQS+LD S NN +G IP S+G+LSKLE L
Sbjct  751   TIAKLNNLYELNLSQNFLSGPIPPDIGKLQELQSLLDLSSNNFSGHIPASLGSLSKLEDL  810

Query  2596  DLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGS  2775
             +LSHN L G +P Q+A MSSL +L+LS N+LEG L   +  WP  +F  N  LCGSPL +
Sbjct  811   NLSHNALVGAVPSQLAGMSSLVQLDLSSNQLEGRLGAEFGRWPQGAFADNVGLCGSPLRA  870

Query  2776  CRDKGSRNK-GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAssssss  2952
             C   G  +   S+ + + + + T++++LL++  A      R    R   + N  + SSSS
Sbjct  871   CSSGGGPSTLSSVTIALVSAAVTLSVVLLIIVLALMVVRRRGRRSR---EVNCTAFSSSS  927

Query  2953  sQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRI  3132
             +   R+ L    + +R+ RW+ IMEAT NLSD+F IGSGG  TVY+AEL  GETVA+KRI
Sbjct  928   ANTNRQ-LVVKGSARREFRWEAIMEATANLSDQFAIGSGGSGTVYRAELSTGETVAVKRI  986

Query  3133  PRKD-DLFL-DKSFAREIKTLWRIRHRHLVRLMGYCS--NKGEGSNVLIYEYMENGSVWD  3300
                D D+ L DKSF REIK L R+RHRHLV+L+G+ +  + G G ++L+YEYMENGS++D
Sbjct  987   AHMDSDMLLHDKSFTREIKILGRVRHRHLVKLLGFITSHDAGAGGSMLVYEYMENGSLYD  1046

Query  3301  WLHNQPANNKSKKS--LDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNM  3474
             WLH     + S+K   L W+ARLK+A GLAQGVEYLHHDCVP+I+HRDIKSSNVLLD +M
Sbjct  1047  WLHGGVGGDGSRKKRVLGWDARLKVAAGLAQGVEYLHHDCVPRIVHRDIKSSNVLLDGDM  1106

Query  3475  EAHLGDFGLAKALTDNYDSL----NTESNTWFAGSYGYIAPE  3588
             EAHLGDFGLAKA+ +N  +      TES + FAGSYGYIAPE
Sbjct  1107  EAHLGDFGLAKAVAENRQAAFGKDCTESASCFAGSYGYIAPE  1148



>ref|XP_002460722.1| hypothetical protein SORBIDRAFT_02g033810 [Sorghum bicolor]
 gb|EER97243.1| hypothetical protein SORBIDRAFT_02g033810 [Sorghum bicolor]
Length=1255

 Score =   964 bits (2491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/1114 (54%), Positives = 785/1114 (70%), Gaps = 27/1114 (2%)
 Frame = +1

Query  313   VLLEVKRSFVLQ----LQGW--SEKNPNYCSWQGVSCD-Gslkvvslnlsdsslggsisp  471
             VLL+VK +FV      L GW  S     +CSW GV CD   L+VV LNLS + L G++  
Sbjct  31    VLLQVKSAFVDDPQGVLAGWNASADASGFCSWAGVVCDEAGLRVVGLNLSGAGLAGTVPR  90

Query  472   slgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALR  651
             +L  L  L  +DLSSN L+GP+P AL  L++L+ LLL+SN L G IP+ LG L+ LQ LR
Sbjct  91    ALARLDALEAIDLSSNALTGPVPAALGGLANLQVLLLYSNHLTGEIPALLGALSALQVLR  150

Query  652   IGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLP  828
             +GDN GL+G IP + G LGNL  LGLASC L+G IP  LGRL  L  LNLQQN L GP+P
Sbjct  151   LGDNPGLSGAIPDALGKLGNLTVLGLASCNLTGPIPASLGRLDALTALNLQQNALSGPIP  210

Query  829   PEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYL  1008
               +A ++SL   S A N L G+IP ELG L  L  LNL NN+L G IP +LG +  L YL
Sbjct  211   RGLAGLASLQVLSLAGNQLTGAIPPELGRLTGLQKLNLGNNSLVGTIPPELGALGELQYL  270

Query  1009  NLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIP  1188
             NL+ N+L G +P++LA L+ ++++DLSGN L+G LP + G + +L FL L+ N L+G++P
Sbjct  271   NLMNNRLSGRVPRTLAALSRVRTIDLSGNMLSGALPAKLGRLPELTFLVLSDNQLTGSVP  330

Query  1189  KSLC----SNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
               LC    + +++++ LMLS    +GEIP  LS+CR L QLDL+NN+L+G IP  L EL 
Sbjct  331   GDLCGGDEAESSSIEHLMLSTNNFTGEIPEGLSRCRALTQLDLANNSLSGGIPAALGELG  390

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
              LTDL+LNNN+L G + P + NLT LQTL+L+HN L G +P  IG L +L++++LYEN F
Sbjct  391   NLTDLLLNNNSLSGELPPELFNLTELQTLALYHNELSGRLPDAIGRLVNLEVLYLYENQF  450

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
              GEIP  IG+C+SLQ IDF+GN+F G IP ++G L  L FL  R+N+LSG IP  LG C 
Sbjct  451   VGEIPESIGDCASLQLIDFFGNRFNGSIPASMGNLSQLTFLDFRQNELSGVIPPELGECQ  510

Query  1717  QLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNF  1896
             QL+ LDLADN LSG+IP TFG LR+L + MLYNNSL G +PD +    N+TR+N++HN  
Sbjct  511   QLEILDLADNALSGSIPKTFGKLRSLEQFMLYNNSLSGVIPDGMFECRNITRVNIAHNRL  570

Query  1897  SGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRE  2076
             SGS+ P+C +   LSFD TNN+FD  IP+ LG S SL R+RLG N  +G IP +LG I  
Sbjct  571   SGSLLPLCGTARLLSFDATNNSFDGGIPAQLGRSSSLQRVRLGFNMLSGPIPPSLGGIAA  630

Query  2077  LSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFS  2256
             L+LLD+S N L+G IP  L+ C++L+ + L++N LSG +P WLG LP LGEL LS+N+F+
Sbjct  631   LTLLDVSSNALTGGIPATLAQCKQLSLIVLSHNRLSGAVPDWLGSLPQLGELTLSNNEFA  690

Query  2257  GSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGK  2436
             G++P +L  CSKLL LSL+NN +NGT+PPE+G L SLNVLNL  NQL G IP+ +  L  
Sbjct  691   GAIPVQLSKCSKLLKLSLDNNQINGTVPPELGRLVSLNVLNLAHNQLSGLIPTAVAKLSS  750

Query  2437  LYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDL  2616
             LYEL LS+N  SG IP ++G+L++LQS+LD S NNL+G IP S+G+LSKLE L+LSHN L
Sbjct  751   LYELNLSQNYLSGPIPLDIGKLQELQSLLDLSSNNLSGHIPASLGSLSKLEDLNLSHNAL  810

Query  2617  TGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSR  2796
              G +P Q+A MSSL +L+LS N+LEG+L   +  WP  +F  N+ LCGSPL   RD GSR
Sbjct  811   VGAVPSQLAGMSSLVQLDLSSNQLEGKLGTEFGRWPQAAFADNAGLCGSPL---RDCGSR  867

Query  2797  NKGSMV--VVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRK  2970
             N  S +    I+ +SA V ++++L+         R   R  R     A SSSSS  A R 
Sbjct  868   NSHSALHAATIALVSAAVTLLIVLLIIMLALMAVRRRARGSREVNCTAFSSSSSGSANRH  927

Query  2971  PLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKD-D  3147
              +F  +A +R+ RW+ IMEAT NLSD+F IGSGG  TVY+AEL  GETVA+KRI   D D
Sbjct  928   LVFKGSA-RREFRWEAIMEATANLSDQFAIGSGGSGTVYRAELSTGETVAVKRIAHMDSD  986

Query  3148  LFL-DKSFAREIKTLWRIRHRHLVRLMGYCSNK--GEGSNVLIYEYMENGSVWDWLHNQP  3318
             + L DKSFARE+K L R+RHRHLV+L+G+ +++  G G  +L+YEYMENGS++DWLH   
Sbjct  987   MLLHDKSFAREVKILGRVRHRHLVKLLGFVTSRECGGGGGMLVYEYMENGSLYDWLHGG-  1045

Query  3319  ANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFG  3498
             ++ + K++L W+ARLK+A GLAQGVEYLHHDCVP+I+HRDIKSSNVLLD +MEAHLGDFG
Sbjct  1046  SDGRKKQTLSWDARLKVAAGLAQGVEYLHHDCVPRIVHRDIKSSNVLLDGDMEAHLGDFG  1105

Query  3499  LAKALTDNYDSL----NTESNTWFAGSYGYIAPE  3588
             LAKA+ +N  +      TES + FAGSYGYIAPE
Sbjct  1106  LAKAVAENRQAAFGKDCTESASCFAGSYGYIAPE  1139



>tpg|DAA62772.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1260

 Score =   961 bits (2485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/1119 (52%), Positives = 765/1119 (68%), Gaps = 33/1119 (3%)
 Frame = +1

Query  313   VLLEVKRSFVLQ----LQGWSEKNPN------YCSWQGVSCDGslkvvslnlsdsslgg-  459
             VLL+VK +FV      L GW++   +      +CSW GV+CD S   V       +    
Sbjct  32    VLLQVKSAFVDDPQGVLAGWNDSAGSGAGSSGFCSWSGVACDASGLRVVGLNLSGAGLAG  91

Query  460   sispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNL  639
             ++S +L  L  L  +DLSSN L+GP+P AL  L +L+ LLL+SN+L G IP+ LG L+ L
Sbjct  92    TVSRALARLDALEAIDLSSNALTGPVPAALGGLPNLQLLLLYSNQLTGQIPASLGALSAL  151

Query  640   QALRIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllE  816
             Q LR+GDN GL+G IP + G LGNL  LGLASC L+G IP  L RL  L  LNLQQN L 
Sbjct  152   QVLRLGDNPGLSGAIPDALGKLGNLTVLGLASCNLTGPIPASLVRLDALTALNLQQNALS  211

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             GP+P  +A ++SL A + A N L G+IP ELG L  L  LNL NN+L G IP +LG +  
Sbjct  212   GPIPRGLAGLASLQALALAGNQLTGAIPPELGTLAGLQKLNLGNNSLVGAIPPELGALGE  271

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             L YLNL+ N+L G +P++LA L+ + ++DLSGN L+G LP E G + QL FL L+ N L+
Sbjct  272   LQYLNLMNNRLTGRVPRTLAALSRVHTIDLSGNMLSGALPAELGRLPQLTFLVLSDNQLT  331

Query  1177  GTIPKSLC----SNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEEL  1344
             G++P  LC    + +++++ LMLS    +GEIP  LS+CR L QL L+NN+L+G IP  L
Sbjct  332   GSVPGDLCGGDEAESSSIEHLMLSMNNFTGEIPEGLSRCRALTQLGLANNSLSGVIPAAL  391

Query  1345  YELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLY  1524
              EL  LTDLVLNNN+L G + P + NLT LQTL+L+HN L G +P  IG L +L+ ++LY
Sbjct  392   GELGNLTDLVLNNNSLSGELPPELFNLTELQTLALYHNKLSGRLPDAIGRLVNLEELYLY  451

Query  1525  ENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASL  1704
             EN F+GEIP  IG+C+SLQ IDF+GN+F G IP ++G L  L FL  R+N+LSG I   L
Sbjct  452   ENQFTGEIPESIGDCASLQMIDFFGNRFNGSIPASMGNLSQLIFLDFRQNELSGVIAPEL  511

Query  1705  GNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLS  1884
             G C QL  LDLADN LSG+IP TFG LR+L + MLYNNSL G +PD +    N+TR+N++
Sbjct  512   GECQQLKILDLADNALSGSIPETFGKLRSLEQFMLYNNSLSGAIPDGMFECRNITRVNIA  571

Query  1885  HNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLG  2064
             HN  SGS+ P+C +   LSFD TNN+FD  IP+  G S  L R+RLGSN  +G IP +LG
Sbjct  572   HNRLSGSLLPLCGTARLLSFDATNNSFDGAIPAQFGRSSGLQRVRLGSNMLSGPIPPSLG  631

Query  2065  LIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSS  2244
              I  L+LLD+S N L+G  P  L+ C  L+ + L++N LSG IP WLG LP LGEL LS+
Sbjct  632   GITALTLLDVSSNALTGGFPATLAQCTNLSLVVLSHNRLSGAIPDWLGSLPQLGELTLSN  691

Query  2245  NQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIG  2424
             N+F+G++P +L NCS LL LSL+NN +NGT+PPE+G+L SLNVLNL  NQL G IP+T+ 
Sbjct  692   NEFTGAIPVQLSNCSNLLKLSLDNNQINGTVPPELGSLASLNVLNLAHNQLSGQIPTTVA  751

Query  2425  GLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLS  2604
              L  LYEL LS+N  SG IP ++ +L++LQS+LD S NN +G IP S+G+LSKLE L+LS
Sbjct  752   KLSSLYELNLSQNYLSGPIPPDISKLQELQSLLDLSSNNFSGHIPASLGSLSKLEDLNLS  811

Query  2605  HNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD  2784
             HN L G +P Q+A MSSL +L+LS N+LEG L   +  WP  +F  N+ LCGSPL  C  
Sbjct  812   HNALVGAVPSQLAGMSSLVQLDLSSNQLEGRLGIEFGRWPQAAFANNAGLCGSPLRGCSS  871

Query  2785  KGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRR-GKE--NYAsssssss  2955
             + SR+      V     A V  ++ L+           A RR+  G E  N ++ SSSSS
Sbjct  872   RNSRSAFHAASV-----ALVTAVVTLLIVLVIIVLALMAVRRQAPGSEEMNCSAFSSSSS  926

Query  2956  QAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIP  3135
              +  + L    + +R+ RW+ IMEAT NLSD+F IGSGG  TVY+AEL  GETVA+KRI 
Sbjct  927   GSANRQLVIKGSARREFRWEAIMEATANLSDQFAIGSGGSGTVYRAELSTGETVAVKRIA  986

Query  3136  RKDD--LFLDKSFAREIKTLWRIRHRHLVRLMGYCSNK--GEGSNVLIYEYMENGSVWDW  3303
               D   L  DKSF RE+KTL R+RHRHLV+L+G+ +++  G G  +L+YEYMENGS++DW
Sbjct  987   DMDSGMLLHDKSFTREVKTLGRVRHRHLVKLLGFVTSRECGGGGGMLVYEYMENGSLYDW  1046

Query  3304  LHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAH  3483
             LH   ++ + K++L W+ARLK+A GLAQGVEYLHHDCVP+I+HRDIKSSNVLLD +MEAH
Sbjct  1047  LHGG-SDGRKKQTLSWDARLKVAAGLAQGVEYLHHDCVPRIVHRDIKSSNVLLDGDMEAH  1105

Query  3484  LGDFGLAKALTDNYDSL----NTESNTWFAGSYGYIAPE  3588
             LGDFGLAKA+ +N  +      TES + FAGSYGYIAPE
Sbjct  1106  LGDFGLAKAVRENRQAAFGKDCTESGSCFAGSYGYIAPE  1144



>dbj|BAJ92367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1262

 Score =   958 bits (2476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/1113 (54%), Positives = 776/1113 (70%), Gaps = 26/1113 (2%)
 Frame = +1

Query  313   VLLEVKRSFVLQ----LQGWSE---KNPNYCSWQGVSCD-Gslkvvslnlsdsslggsis  468
             VLLEVK +F       L+GWS     +  +CSW GV+CD   L+V  LNLS + L G + 
Sbjct  36    VLLEVKSAFAEDPEGVLEGWSGDGGASSGFCSWAGVTCDPAGLRVAGLNLSGAGLSGPVP  95

Query  469   pslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQAL  648
              +L  L  L  +DLSSN ++GPIP AL  L  L+ L+L+SN+L G IP+ LG L  LQ L
Sbjct  96    GALARLDALEVIDLSSNRITGPIPAALGRLERLQLLMLYSNQLAGGIPASLGRLAALQVL  155

Query  649   RIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPL  825
             R+GDN GL+G IP + G L NL  +GLASC L+G IP  LGRL  L  LNLQ+N L GP+
Sbjct  156   RLGDNLGLSGPIPKALGELRNLTVIGLASCNLTGEIPGGLGRLAALTALNLQENSLSGPI  215

Query  826   PPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVY  1005
             P +I  ++SL A + A N L G IP ELG L +L  LNL NN+L G IP +LG +  L+Y
Sbjct  216   PADIGAMASLEALALAGNHLTGKIPPELGKLSYLQKLNLGNNSLEGAIPPELGALGELLY  275

Query  1006  LNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTI  1185
             LNL+ N+L GS+P++LA L+ + ++DLSGN L G LP E G + QL FL L  N+LSG +
Sbjct  276   LNLMNNRLSGSVPRALAALSRVHTIDLSGNMLTGGLPAELGRLPQLNFLVLADNHLSGRL  335

Query  1186  PKSLCS------NATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELY  1347
             P +LCS      ++T+L+ L+LS   L+GEIP  LS+CR L QLDL+NN+L+G+IP  L 
Sbjct  336   PGNLCSGSNEEESSTSLEHLLLSTNNLTGEIPDGLSRCRALTQLDLANNSLSGAIPPGLG  395

Query  1348  ELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYE  1527
             EL  LT L+LNNN+L G + P + NLT L +L+L+HN L G++P  IG L +LQ ++LYE
Sbjct  396   ELGNLTGLLLNNNSLSGGLPPEIFNLTELTSLALYHNQLTGQLPDAIGNLKNLQELYLYE  455

Query  1528  NHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLG  1707
             N FSGEIP  IG CSSLQ IDF+GNQF G IP ++G L  L FLHLR+N+LSG IP  LG
Sbjct  456   NQFSGEIPETIGKCSSLQMIDFFGNQFNGSIPASIGNLSELIFLHLRQNELSGLIPPELG  515

Query  1708  NCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSH  1887
             +CHQL  LDLADN LSG IPATF  L++L + MLYNNSL G +PD +    N+TR+N++H
Sbjct  516   DCHQLQVLDLADNALSGEIPATFEKLQSLQQFMLYNNSLSGVVPDGMFECRNITRVNIAH  575

Query  1888  NNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGL  2067
             N   GS+ P+C S S LSFD TNN+F+  IP+ LG S SL R+RLGSN  +G IP +LG 
Sbjct  576   NRLGGSLLPLCGSASLLSFDATNNSFEGGIPAQLGRSSSLQRVRLGSNGLSGPIPPSLGG  635

Query  2068  IRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSN  2247
             I  L+LLD+S N+L+G IP  L  C +L+H+ LN+N LSG +P WLG LP LGEL LS+N
Sbjct  636   IAALTLLDVSNNELTGIIPEALLRCTQLSHIVLNHNRLSGSVPAWLGTLPQLGELTLSAN  695

Query  2248  QFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGG  2427
             +F+G+LP +L  CSKLL LSL+ N +NGT+P EIG L SLNVLNL  NQL G IP+T+  
Sbjct  696   EFTGALPVQLTKCSKLLKLSLDGNQINGTVPAEIGRLASLNVLNLAQNQLSGPIPATVAR  755

Query  2428  LGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSH  2607
             L  LYEL LS+N  SG IP ++G++++LQS+LD S NNL G IP SIG+LSKLE L+LSH
Sbjct  756   LSNLYELNLSQNHLSGAIPPDMGKMQELQSLLDLSSNNLVGIIPASIGSLSKLEDLNLSH  815

Query  2608  NDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC-RD  2784
             N L G +P Q+A MSSL  L+LS N+L+G L   ++ WP D+F GN+ LCG  L  C R 
Sbjct  816   NALVGTVPSQLARMSSLVELDLSSNQLDGRLGDEFSRWPQDAFSGNAALCGGHLRGCGRG  875

Query  2785  KGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQ  2964
             + + +  S+ +V +A++ T+ ++++++      +  R +     G+ +    SSS     
Sbjct  876   RSTLHSASIAMVSAAVTLTIVLLVIVLVLMAVLRRGRHS---GSGEVDCTVFSSSMGNTN  932

Query  2965  RKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKD  3144
             R+ +   +A +R+ RWD IMEAT NLS++F IGSGG  TVY+AEL  GETVA+KR    D
Sbjct  933   RQLIIKGSA-RREFRWDAIMEATANLSEQFAIGSGGSGTVYRAELPTGETVAVKRFVHMD  991

Query  3145  -DLFL-DKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQP  3318
              D+ L DKSFARE+K L R+RHRHLV+L+G+      G ++LIYEYME GS++DWLH   
Sbjct  992   SDMLLHDKSFAREVKILGRVRHRHLVKLLGFVGQGEHGGSMLIYEYMEKGSLYDWLHGCV  1051

Query  3319  ANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFG  3498
              + K K+ L W+ARLK+A GL QGVEYLHHDCVP+++HRDIKSSNVLLD NMEAHLGDFG
Sbjct  1052  GDGK-KRVLSWDARLKVAAGLVQGVEYLHHDCVPRVVHRDIKSSNVLLDGNMEAHLGDFG  1110

Query  3499  LAKALTDNYDSLN---TESNTWFAGSYGYIAPE  3588
             LAKA+ ++ +      TES + FAGSYGYIAPE
Sbjct  1111  LAKAIAEHRNGGGKECTESASLFAGSYGYIAPE  1143



>gb|EAZ03961.1| hypothetical protein OsI_26097 [Oryza sativa Indica Group]
Length=1273

 Score =   957 bits (2475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/1097 (53%), Positives = 745/1097 (68%), Gaps = 31/1097 (3%)
 Frame = +1

Query  379   YCSWQGVSCD--GslkvvslnlsdsslggsispslgllthllhldlssnhlsGPIPPAls  552
             +CSW GV CD  G+             G     +L  L  L  +DLSSN L+GP+P AL 
Sbjct  64    FCSWAGVECDAAGARVTGLNLSGAGLAGEVPGAALARLDRLEVVDLSSNRLAGPVPAALG  123

Query  553   nlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDN-GLTGQIPTSFGNLGNLVTLGLA  729
              L  L +LLL+SNRL G +P  LG L  L+ LR+GDN  L+G IP + G L NL  L  A
Sbjct  124   ALGRLTALLLYSNRLAGELPPSLGALAALRVLRVGDNPALSGPIPAALGVLANLTVLAAA  183

Query  730   SCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKEL  909
             SC L+G IP  LGRL  L  LNLQ+N L GP+PPE+  I+ L   S A N L G IP EL
Sbjct  184   SCNLTGAIPRSLGRLAALTALNLQENSLSGPIPPELGGIAGLEVLSLADNQLTGVIPPEL  243

Query  910   GGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLS  1089
             G L  L  LNLANNTL G +P +LG++  L YLNL+ N+L G +P+ LA L+  +++DLS
Sbjct  244   GRLAALQKLNLANNTLEGAVPPELGKLGELAYLNLMNNRLSGRVPRELAALSRARTIDLS  303

Query  1090  GNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLC------SNATNLQLLMLSETGLS  1251
             GN L GELP E G + +L FLAL+ N+L+G IP  LC      + +T+L+ LMLS    S
Sbjct  304   GNLLTGELPAEVGQLPELSFLALSGNHLTGRIPGDLCGGGGGGAESTSLEHLMLSTNNFS  363

Query  1252  GEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTN  1431
             GEIP  LS+CR L QLDL+NN+L G+IP  L EL  LTDL+LNNNTL G + P + NLT 
Sbjct  364   GEIPGGLSRCRALTQLDLANNSLTGAIPAALGELGNLTDLLLNNNTLSGELPPELFNLTE  423

Query  1432  LQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFT  1611
             L+ L+L+HN L G +P  +G L +L+++FLYEN FSGEIP  IG CSSLQ +DF+GN+F 
Sbjct  424   LKVLALYHNGLTGRLPDAVGRLVNLEVLFLYENDFSGEIPETIGECSSLQMVDFFGNRFN  483

Query  1612  GKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRA  1791
             G +P ++G+L  L FLHLR+N+LSG IP  LG+C  L  LDLADN LSG IPATFG LR+
Sbjct  484   GSLPASIGKLSELAFLHLRQNELSGRIPPELGDCVNLAVLDLADNALSGEIPATFGRLRS  543

Query  1792  LTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQ  1971
             L +LMLYNNSL GD+PD +    N+TR+N++HN  +GS+ P+C S   LSFD TNN+F  
Sbjct  544   LEQLMLYNNSLAGDVPDGMFECRNITRVNIAHNRLAGSLLPLCGSARLLSFDATNNSFSG  603

Query  1972  EIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKL  2151
              IP+ LG S SL R+R GSN  +G IP  LG    L++LD SGN L+G IP  L+ C +L
Sbjct  604   GIPAQLGRSRSLQRVRFGSNALSGPIPAALGNAAALTMLDASGNALTGGIPDALARCARL  663

Query  2152  THLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnG  2331
             +H+ L+ N LSGP+P W+G LP LGEL LS N+ +G +P +L NCSKL+ LSL+ N +NG
Sbjct  664   SHIALSGNRLSGPVPAWVGALPELGELALSGNELTGPVPVQLSNCSKLIKLSLDGNQING  723

Query  2332  TLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDL  2511
             T+P EIG+L SLNVLNL  NQL G IP+T+  L  LYEL LSRN  SG IP ++GQL++L
Sbjct  724   TVPSEIGSLVSLNVLNLAGNQLSGEIPATLAKLINLYELNLSRNLLSGPIPPDIGQLQEL  783

Query  2512  QSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELE  2691
             QS+LD S N+L+G IP S+G+LSKLESL+LSHN L G +PPQ+A MSSL +L+LS N+L+
Sbjct  784   QSLLDLSSNDLSGSIPASLGSLSKLESLNLSHNALAGAVPPQLAGMSSLVQLDLSSNQLQ  843

Query  2692  GELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKGSMVVVISALSATVAIILLLMGA  2871
             G L   ++ WP  +F GN+ LCG PL SC   G          I+ +SA V + ++L+  
Sbjct  844   GRLGSEFSRWPRGAFAGNARLCGHPLVSCGVGGGGRSALRSATIALVSAAVTLSVVLLVI  903

Query  2872  AFFFKHNREAYRRRRGKENYAsssss----ssQAQRKPLFGNAAKKRDIRWDDIMEATNN  3039
                    R   RRR G+ N  + SSS     +    + L    + +R+ RW+ IMEAT N
Sbjct  904   VLVLIAVR---RRRSGEVNCTAFSSSLGGGGNNTNGRQLVVKGSARREFRWEAIMEATAN  960

Query  3040  LSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKD-DLFL-DKSFAREIKTLWRIRHRHL  3213
             LSD+F IGSGG  TVY+AEL  GETVA+KRI   D D+ L DKSFARE+K L R+RHRHL
Sbjct  961   LSDQFAIGSGGSGTVYRAELPTGETVAVKRIANMDSDMLLHDKSFAREVKILGRVRHRHL  1020

Query  3214  VRLMGYCSNK-----GEGSNVLIYEYMENGSVWDWLH-------NQPANNKSKKSLDWEA  3357
             V+L+G+ ++      G G ++L+YEYMENGS++DWLH             + K+ L W+A
Sbjct  1021  VKLLGFVASHDVGGGGGGGSMLVYEYMENGSLYDWLHGIAAGGGGGGDGERKKRVLSWDA  1080

Query  3358  RLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSLN  3537
             RLK+A GLAQGVEYLHHDCVP+++HRDIKSSNVLLD +MEAHLGDFGLAK++ DN     
Sbjct  1081  RLKVAAGLAQGVEYLHHDCVPRVVHRDIKSSNVLLDGDMEAHLGDFGLAKSVADNRKDF-  1139

Query  3538  TESNTWFAGSYGYIAPE  3588
             T+S + FAGSYGY+APE
Sbjct  1140  TDSASCFAGSYGYMAPE  1156



>ref|NP_001059710.2| Os07g0498400 [Oryza sativa Japonica Group]
 dbj|BAF21624.2| Os07g0498400 [Oryza sativa Japonica Group]
Length=1275

 Score =   954 bits (2466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/1098 (53%), Positives = 743/1098 (68%), Gaps = 32/1098 (3%)
 Frame = +1

Query  379   YCSWQGVSCD--GslkvvslnlsdsslggsispslgllthllhldlssnhlsGPIPPAls  552
             +CSW GV CD  G+             G     +L  L  L  +DLSSN L+GP+P AL 
Sbjct  65    FCSWAGVECDAAGARVTGLNLSGAGLAGEVPGAALARLDRLEVVDLSSNRLAGPVPAALG  124

Query  553   nlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDN-GLTGQIPTSFGNLGNLVTLGLA  729
              L  L +LLL+SNRL G +P  LG L  L+ LR+GDN  L+G IP + G L NL  L  A
Sbjct  125   ALGRLTALLLYSNRLAGELPPSLGALAALRVLRVGDNPALSGPIPAALGVLANLTVLAAA  184

Query  730   SCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKEL  909
             SC L+G IP  LGRL  L  LNLQ+N L GP+PPE+  I+ L   S A N L G IP EL
Sbjct  185   SCNLTGAIPRSLGRLAALTALNLQENSLSGPIPPELGGIAGLEVLSLADNQLTGVIPPEL  244

Query  910   GGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLS  1089
             G L  L  LNLANNTL G +P +LG++  L YLNL+ N+L G +P+ LA L+  +++DLS
Sbjct  245   GRLAALQKLNLANNTLEGAVPPELGKLGELAYLNLMNNRLSGRVPRELAALSRARTIDLS  304

Query  1090  GNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLC------SNATNLQLLMLSETGLS  1251
             GN L GELP E G + +L FLAL+ N+L+G IP  LC      + +T+L+ LMLS    S
Sbjct  305   GNLLTGELPAEVGQLPELSFLALSGNHLTGRIPGDLCGGGGGGAESTSLEHLMLSTNNFS  364

Query  1252  GEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTN  1431
             GEIP  LS+CR L QLDL+NN+L G IP  L EL  LTDL+LNNNTL G + P + NLT 
Sbjct  365   GEIPGGLSRCRALTQLDLANNSLTGVIPAALGELGNLTDLLLNNNTLSGELPPELFNLTE  424

Query  1432  LQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFT  1611
             L+ L+L+HN L G +P  +G L +L+++FLYEN FSGEIP  IG CSSLQ +DF+GN+F 
Sbjct  425   LKVLALYHNGLTGRLPDAVGRLVNLEVLFLYENDFSGEIPETIGECSSLQMVDFFGNRFN  484

Query  1612  GKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRA  1791
             G +P ++G+L  L FLHLR+N+LSG IP  LG+C  L  LDLADN LSG IPATFG LR+
Sbjct  485   GSLPASIGKLSELAFLHLRQNELSGRIPPELGDCVNLAVLDLADNALSGEIPATFGRLRS  544

Query  1792  LTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQ  1971
             L +LMLYNNSL GD+PD +    N+TR+N++HN  +G + P+C S   LSFD TNN+F  
Sbjct  545   LEQLMLYNNSLAGDVPDGMFECRNITRVNIAHNRLAGGLLPLCGSARLLSFDATNNSFSG  604

Query  1972  EIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKL  2151
              IP+ LG S SL R+R GSN  +G IP  LG    L++LD SGN L+G IP  L+ C +L
Sbjct  605   GIPAQLGRSRSLQRVRFGSNALSGPIPAALGNAAALTMLDASGNALTGGIPDALARCARL  664

Query  2152  THLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnG  2331
             +H+ L+ N LSGP+P W+G LP LGEL LS N+ +G +P +L NCSKL+ LSL+ N +NG
Sbjct  665   SHIALSGNRLSGPVPAWVGALPELGELALSGNELTGPVPVQLSNCSKLIKLSLDGNQING  724

Query  2332  TLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDL  2511
             T+P EIG+L SLNVLNL  NQL G IP+T+  L  LYEL LSRN  SG IP ++GQL++L
Sbjct  725   TVPSEIGSLVSLNVLNLAGNQLSGEIPATLAKLINLYELNLSRNLLSGPIPPDIGQLQEL  784

Query  2512  QSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELE  2691
             QS+LD S N+L+G IP S+G+LSKLESL+LSHN L G +PPQ+A MSSL +L+LS N+L+
Sbjct  785   QSLLDLSSNDLSGSIPASLGSLSKLESLNLSHNALAGAVPPQLAGMSSLVQLDLSSNQLQ  844

Query  2692  GELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKGSMVVVISALSATVAIILLLMGA  2871
             G L   ++ WP  +F GN+ LCG PL SC   G          I+ +SA V + ++L+  
Sbjct  845   GRLGSEFSRWPRGAFAGNARLCGHPLVSCGVGGGGRSALRSATIALVSAAVTLSVVLLVI  904

Query  2872  AFFFKHNREAYRRRRGKENYAsssss----ssQAQRKPLFGNAAKKRDIRWDDIMEATNN  3039
                    R   RRR G+ N  + SSS     +    + L    + +R+ RW+ IMEAT N
Sbjct  905   VLVLIAVR---RRRSGEVNCTAFSSSLGGGGNNTNGRQLVVKGSARREFRWEAIMEATAN  961

Query  3040  LSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKD-DLFL-DKSFAREIKTLWRIRHRHL  3213
             LSD+F IGSGG  TVY+AEL  GETVA+KRI   D D+ L DKSFARE+K L R+RHRHL
Sbjct  962   LSDQFAIGSGGSGTVYRAELPTGETVAVKRIAHMDSDMLLHDKSFAREVKILGRVRHRHL  1021

Query  3214  VRLMGYCSNK------GEGSNVLIYEYMENGSVWDWLH-------NQPANNKSKKSLDWE  3354
             V+L+G+ ++       G G ++L+YEYMENGS++DWLH             + K+ L W+
Sbjct  1022  VKLLGFVASHDVGGGGGGGGSMLVYEYMENGSLYDWLHGIAAGGGGGGDGERKKRVLSWD  1081

Query  3355  ARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSL  3534
             ARLK+A GLAQGVEYLHHDCVP+++HRDIKSSNVLLD +MEAHLGDFGLAK++ DN    
Sbjct  1082  ARLKVAAGLAQGVEYLHHDCVPRVVHRDIKSSNVLLDGDMEAHLGDFGLAKSVADNRKDF  1141

Query  3535  NTESNTWFAGSYGYIAPE  3588
              T+S + FAGSYGY+APE
Sbjct  1142  -TDSASCFAGSYGYMAPE  1158



>dbj|BAC07048.1| putative receptor protein kinase [Oryza sativa Japonica Group]
 gb|EAZ39903.1| hypothetical protein OsJ_24343 [Oryza sativa Japonica Group]
Length=1274

 Score =   953 bits (2464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/1098 (53%), Positives = 743/1098 (68%), Gaps = 32/1098 (3%)
 Frame = +1

Query  379   YCSWQGVSCD--GslkvvslnlsdsslggsispslgllthllhldlssnhlsGPIPPAls  552
             +CSW GV CD  G+             G     +L  L  L  +DLSSN L+GP+P AL 
Sbjct  64    FCSWAGVECDAAGARVTGLNLSGAGLAGEVPGAALARLDRLEVVDLSSNRLAGPVPAALG  123

Query  553   nlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDN-GLTGQIPTSFGNLGNLVTLGLA  729
              L  L +LLL+SNRL G +P  LG L  L+ LR+GDN  L+G IP + G L NL  L  A
Sbjct  124   ALGRLTALLLYSNRLAGELPPSLGALAALRVLRVGDNPALSGPIPAALGVLANLTVLAAA  183

Query  730   SCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKEL  909
             SC L+G IP  LGRL  L  LNLQ+N L GP+PPE+  I+ L   S A N L G IP EL
Sbjct  184   SCNLTGAIPRSLGRLAALTALNLQENSLSGPIPPELGGIAGLEVLSLADNQLTGVIPPEL  243

Query  910   GGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLS  1089
             G L  L  LNLANNTL G +P +LG++  L YLNL+ N+L G +P+ LA L+  +++DLS
Sbjct  244   GRLAALQKLNLANNTLEGAVPPELGKLGELAYLNLMNNRLSGRVPRELAALSRARTIDLS  303

Query  1090  GNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLC------SNATNLQLLMLSETGLS  1251
             GN L GELP E G + +L FLAL+ N+L+G IP  LC      + +T+L+ LMLS    S
Sbjct  304   GNLLTGELPAEVGQLPELSFLALSGNHLTGRIPGDLCGGGGGGAESTSLEHLMLSTNNFS  363

Query  1252  GEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTN  1431
             GEIP  LS+CR L QLDL+NN+L G IP  L EL  LTDL+LNNNTL G + P + NLT 
Sbjct  364   GEIPGGLSRCRALTQLDLANNSLTGVIPAALGELGNLTDLLLNNNTLSGELPPELFNLTE  423

Query  1432  LQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFT  1611
             L+ L+L+HN L G +P  +G L +L+++FLYEN FSGEIP  IG CSSLQ +DF+GN+F 
Sbjct  424   LKVLALYHNGLTGRLPDAVGRLVNLEVLFLYENDFSGEIPETIGECSSLQMVDFFGNRFN  483

Query  1612  GKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRA  1791
             G +P ++G+L  L FLHLR+N+LSG IP  LG+C  L  LDLADN LSG IPATFG LR+
Sbjct  484   GSLPASIGKLSELAFLHLRQNELSGRIPPELGDCVNLAVLDLADNALSGEIPATFGRLRS  543

Query  1792  LTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQ  1971
             L +LMLYNNSL GD+PD +    N+TR+N++HN  +G + P+C S   LSFD TNN+F  
Sbjct  544   LEQLMLYNNSLAGDVPDGMFECRNITRVNIAHNRLAGGLLPLCGSARLLSFDATNNSFSG  603

Query  1972  EIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKL  2151
              IP+ LG S SL R+R GSN  +G IP  LG    L++LD SGN L+G IP  L+ C +L
Sbjct  604   GIPAQLGRSRSLQRVRFGSNALSGPIPAALGNAAALTMLDASGNALTGGIPDALARCARL  663

Query  2152  THLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnG  2331
             +H+ L+ N LSGP+P W+G LP LGEL LS N+ +G +P +L NCSKL+ LSL+ N +NG
Sbjct  664   SHIALSGNRLSGPVPAWVGALPELGELALSGNELTGPVPVQLSNCSKLIKLSLDGNQING  723

Query  2332  TLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDL  2511
             T+P EIG+L SLNVLNL  NQL G IP+T+  L  LYEL LSRN  SG IP ++GQL++L
Sbjct  724   TVPSEIGSLVSLNVLNLAGNQLSGEIPATLAKLINLYELNLSRNLLSGPIPPDIGQLQEL  783

Query  2512  QSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELE  2691
             QS+LD S N+L+G IP S+G+LSKLESL+LSHN L G +PPQ+A MSSL +L+LS N+L+
Sbjct  784   QSLLDLSSNDLSGSIPASLGSLSKLESLNLSHNALAGAVPPQLAGMSSLVQLDLSSNQLQ  843

Query  2692  GELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKGSMVVVISALSATVAIILLLMGA  2871
             G L   ++ WP  +F GN+ LCG PL SC   G          I+ +SA V + ++L+  
Sbjct  844   GRLGSEFSRWPRGAFAGNARLCGHPLVSCGVGGGGRSALRSATIALVSAAVTLSVVLLVI  903

Query  2872  AFFFKHNREAYRRRRGKENYAsssss----ssQAQRKPLFGNAAKKRDIRWDDIMEATNN  3039
                    R   RRR G+ N  + SSS     +    + L    + +R+ RW+ IMEAT N
Sbjct  904   VLVLIAVR---RRRSGEVNCTAFSSSLGGGGNNTNGRQLVVKGSARREFRWEAIMEATAN  960

Query  3040  LSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKD-DLFL-DKSFAREIKTLWRIRHRHL  3213
             LSD+F IGSGG  TVY+AEL  GETVA+KRI   D D+ L DKSFARE+K L R+RHRHL
Sbjct  961   LSDQFAIGSGGSGTVYRAELPTGETVAVKRIAHMDSDMLLHDKSFAREVKILGRVRHRHL  1020

Query  3214  VRLMGYCSNK------GEGSNVLIYEYMENGSVWDWLH-------NQPANNKSKKSLDWE  3354
             V+L+G+ ++       G G ++L+YEYMENGS++DWLH             + K+ L W+
Sbjct  1021  VKLLGFVASHDVGGGGGGGGSMLVYEYMENGSLYDWLHGIAAGGGGGGDGERKKRVLSWD  1080

Query  3355  ARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSL  3534
             ARLK+A GLAQGVEYLHHDCVP+++HRDIKSSNVLLD +MEAHLGDFGLAK++ DN    
Sbjct  1081  ARLKVAAGLAQGVEYLHHDCVPRVVHRDIKSSNVLLDGDMEAHLGDFGLAKSVADNRKDF  1140

Query  3535  NTESNTWFAGSYGYIAPE  3588
              T+S + FAGSYGY+APE
Sbjct  1141  -TDSASCFAGSYGYMAPE  1157



>tpg|DAA40884.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1207

 Score =   951 bits (2459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/1113 (53%), Positives = 776/1113 (70%), Gaps = 27/1113 (2%)
 Frame = +1

Query  313   VLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsis-psl  477
             V+L+VK +FV      L  W+     +CSW GV+CD +   V       +        +L
Sbjct  32    VMLQVKSAFVDDPQEVLASWNASASGFCSWGGVACDAAGLRVVGLNLSGAGLAGTVPRAL  91

Query  478   gllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIG  657
               L  L  +DLSSN L+GP+P AL  L +L+ LLL+SN+L G +P+ L  L+ LQ LR+G
Sbjct  92    ARLDALEAIDLSSNALTGPVPAALGGLPNLQVLLLYSNQLAGVLPASLVALSALQVLRLG  151

Query  658   DN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPE  834
             DN GL+G IP + G L NL  LGLASC L+G IP  LGRL  L  LNLQQN L GP+P  
Sbjct  152   DNPGLSGAIPDALGRLANLTVLGLASCNLTGPIPTSLGRLGALTALNLQQNKLSGPIPRA  211

Query  835   IANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNL  1014
             ++ ++SL   + A N L+G+IP ELG +  L  LNL NN+L G IP +LG +  L YLNL
Sbjct  212   LSGLASLQVLALAGNQLSGAIPPELGRIAGLQKLNLGNNSLVGAIPPELGALGELQYLNL  271

Query  1015  LGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKS  1194
             + N+L G +P++LA ++ ++++DLSGN L+G LP E G + +L FL L+ N L+G++P  
Sbjct  272   MNNRLSGLVPRALAAISRVRTIDLSGNMLSGALPAELGRLPELTFLVLSDNQLTGSVPGD  331

Query  1195  LC----SNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQL  1362
             LC    + A++L+ LMLS    +GEIP  LS+CR L QLDL+NN+L+G IP  + EL  L
Sbjct  332   LCGGDGAEASSLEHLMLSTNNFTGEIPEGLSRCRALTQLDLANNSLSGGIPAAIGELGNL  391

Query  1363  TDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSG  1542
             TDL+LNNN+L G + P + NL  LQTL+L+HN L G +P  IG LG+L++++LYEN F+G
Sbjct  392   TDLLLNNNSLSGELPPELFNLAELQTLALYHNKLTGRLPDAIGRLGNLEVLYLYENQFAG  451

Query  1543  EIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQL  1722
             EIP  IG+C+SLQ +DF+GN+F G IP ++G L  L FL LR+NDLSG IP  LG C QL
Sbjct  452   EIPASIGDCASLQQVDFFGNRFNGSIPASMGNLSQLIFLDLRQNDLSGVIPPELGECQQL  511

Query  1723  DTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSG  1902
             +  DLADN LSG+IP TFG LR+L + MLYNNSL G +PD +    N+TR+N++HN  SG
Sbjct  512   EIFDLADNALSGSIPETFGKLRSLEQFMLYNNSLSGAIPDGMFECRNITRVNIAHNRLSG  571

Query  1903  SIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELS  2082
             S+ P+C +   LSFD TNN+FD  IP+ LG S SL R+RLGSN  +G IP +LG I  L+
Sbjct  572   SLVPLCGTARLLSFDATNNSFDGRIPAQLGRSSSLQRVRLGSNMLSGPIPPSLGGIATLT  631

Query  2083  LLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGS  2262
             LLD+S N+L+G IP  L+ CR+L+ + L++N LSG +P WLG LP LGEL LS+N+F+G+
Sbjct  632   LLDVSSNELTGGIPAALAQCRQLSLIVLSHNRLSGAVPGWLGSLPQLGELALSNNEFTGA  691

Query  2263  LPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLY  2442
             +P +L NCS+LL LSL+NN +NGT+PPE+G L SLNVLNL  NQL G IP+T+  L  LY
Sbjct  692   IPMQLSNCSELLKLSLDNNQINGTVPPELGGLVSLNVLNLAHNQLSGPIPTTVAKLSGLY  751

Query  2443  ELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTG  2622
             EL LS+N  SG IP ++G+L+DLQS+LD S NNL+G IP S+G+L KLE+L+LSHN L G
Sbjct  752   ELNLSQNYLSGPIPPDIGKLQDLQSLLDLSSNNLSGHIPASLGSLPKLENLNLSHNALVG  811

Query  2623  EIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNK  2802
              +P Q+A MSSL +L+LS N+LEG+L   +  WP  +F  N+ LCGSPL  C    SRN 
Sbjct  812   AVPSQLAGMSSLVQLDLSSNQLEGKLGTEFGRWPQAAFADNTGLCGSPLRGCS---SRNS  868

Query  2803  GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRR---RGKENYAsssssssQAQRKP  2973
              S   + +A  A V+ ++ L+             RRR    G+ N  + SSSSS +  + 
Sbjct  869   HS--ALHAATIALVSAVVTLLIILLIIAIALMVVRRRARGSGEVNCTAFSSSSSGSANRQ  926

Query  2974  LFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKD-DL  3150
             L    + +R+ RW+ IMEAT NLSD+F IGSGG  TVY+AEL  GETVA+KRI   D D+
Sbjct  927   LVVKGSARREFRWEAIMEATANLSDQFAIGSGGSGTVYRAELSTGETVAVKRIAHMDSDM  986

Query  3151  FL-DKSFAREIKTLWRIRHRHLVRLMGYCSNK--GEGSNVLIYEYMENGSVWDWLHNQPA  3321
              L DKSFARE+K L R+RHRHLV+L+G+ +++  G G  +L+YEYMENGS++DWLH   +
Sbjct  987   LLHDKSFAREVKILGRVRHRHLVKLLGFVTSRECGGGGGMLVYEYMENGSLYDWLHGG-S  1045

Query  3322  NNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGL  3501
             + + K++L WEARL +A GLAQGVEYLHHDCVP+I+HRDIKSSNVLLD +MEAHLGDFGL
Sbjct  1046  DGRKKRTLSWEARLMVAAGLAQGVEYLHHDCVPRIVHRDIKSSNVLLDGDMEAHLGDFGL  1105

Query  3502  AKALTDN----YDSLNTESNTWFAGSYGYIAPE  3588
             AKA+ +N    +D   TES ++FAGSYGYIAPE
Sbjct  1106  AKAVAENRQAAFDKDCTESASFFAGSYGYIAPE  1138



>ref|XP_003563067.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Brachypodium distachyon]
Length=1264

 Score =   940 bits (2429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/1116 (53%), Positives = 754/1116 (68%), Gaps = 28/1116 (3%)
 Frame = +1

Query  313   VLLEVKRSFVLQ----LQGWSEKNPN---YCSWQGVSCDGslkvvslnlsdsslggsis-  468
             VLL+VK +F       L GWS        +CSW GV+CD +   VS      +       
Sbjct  36    VLLDVKAAFSQDPEGVLDGWSADAAGSLGFCSWSGVTCDAAGLRVSGLNLSGAGLAGPVP  95

Query  469   pslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGP-IPSQLGLLTNLQA  645
              +L  L  L  +DLSSN L+G IPPAL  L     +L+  +  +   IP+ +G L  LQ 
Sbjct  96    SALSRLDALQTIDLSSNRLTGSIPPALGRLGRSLEVLMLYSNDLASEIPASIGRLAALQV  155

Query  646   LRIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPql-grltqlqnlnlqqnllEG  819
             LR+GDN  L+G IP S G L NL  LGLASC L+G IP +L  RL+ L  LNLQ+N L G
Sbjct  156   LRLGDNPRLSGPIPDSLGELSNLTVLGLASCNLTGAIPRRLFARLSGLTALNLQENSLSG  215

Query  820   PLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSL  999
             P+P  I  I+ L   S A N+L G IP ELG L  L  LNL NNTL G IP +LG +  L
Sbjct  216   PIPAGIGAIAGLQVISLANNNLTGVIPPELGSLAELQKLNLGNNTLEGPIPPELGALGEL  275

Query  1000  VYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSG  1179
             +YLNL+ N L G IP++L  L+ +++LDLS N L G +P E G + +L FL L++NNL+G
Sbjct  276   LYLNLMNNSLTGRIPRTLGALSRVRTLDLSWNMLTGGIPAELGRLTELNFLVLSNNNLTG  335

Query  1180  TIPKSLCSNA-----TNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEEL  1344
              IP  LC +       +L+ LMLS   L+GEIP  LS+CR L QLDL+NN+L+G+IP  L
Sbjct  336   RIPGELCGDEEAESMMSLEHLMLSTNNLTGEIPGTLSRCRALTQLDLANNSLSGNIPPAL  395

Query  1345  YELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLY  1524
              EL  LTDL+LNNN+L G + P + NLT L TL+L+HN L G +P  IG L  L+I++ Y
Sbjct  396   GELGNLTDLLLNNNSLSGELPPELFNLTELGTLALYHNELTGRLPGSIGNLRSLRILYAY  455

Query  1525  ENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASL  1704
             EN F+GEIP  IG CS+LQ +DF+GNQ  G IP ++G L  L FLHLR+N+LSGEIP  L
Sbjct  456   ENQFTGEIPESIGECSTLQMMDFFGNQLNGSIPASIGNLSRLTFLHLRQNELSGEIPPEL  515

Query  1705  GNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLS  1884
             G+C +L+ LDLADN LSG IP TF  L++L + MLYNNSL G +PD +    N+TR+N++
Sbjct  516   GDCRRLEVLDLADNALSGEIPGTFDKLQSLEQFMLYNNSLSGAIPDGMFECRNITRVNIA  575

Query  1885  HNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLG  2064
             HN  SGS+ P+C S   LSFD TNN+F   IP+ LG S SL R+RLGSN  +G IP +LG
Sbjct  576   HNRLSGSLVPLCGSARLLSFDATNNSFQGGIPAQLGRSASLQRVRLGSNALSGPIPPSLG  635

Query  2065  LIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSS  2244
              I  L+LLD+S N L+G IP  LS C +L+H+ LNNN LSGP+P WLG LP LGEL LS+
Sbjct  636   RIAALTLLDVSCNALTGGIPDALSRCAQLSHVVLNNNRLSGPVPAWLGTLPQLGELTLST  695

Query  2245  NQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIG  2424
             N+FSG++P EL NCSKLL LSL+ N +NGT+P EIG L SLNVLNL  NQL G IP+T+ 
Sbjct  696   NEFSGAMPVELSNCSKLLKLSLDGNLINGTVPHEIGRLASLNVLNLARNQLSGPIPATVA  755

Query  2425  GLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLS  2604
              LG LYEL LS+N  SG IP ++G+L++LQS+LD S N+L G+IP S+G+LSKLE L+LS
Sbjct  756   RLGNLYELNLSQNHLSGRIPPDMGKLQELQSLLDLSSNDLIGKIPASLGSLSKLEDLNLS  815

Query  2605  HNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD  2784
             HN L G +P Q+A MSSL +L+LS N+LEG L   ++ WP D+F  N+ LCG+ L  C D
Sbjct  816   HNALVGTVPSQLAGMSSLVQLDLSSNQLEGRLGDEFSRWPEDAFSDNAALCGNHLRGCGD  875

Query  2785  KGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRR--GKENYAsssssssQ  2958
                R + ++    SA  A V+  + L            A RR R  G+ N    SSS   
Sbjct  876   GVRRGRSALH---SASIALVSTAVTLTVVLLVIVLVLMARRRGRMSGEVNCTGFSSSLGN  932

Query  2959  AQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPR  3138
               R+ +   +A +R+ RW+ IMEAT NLSD+F IGSGG  TVY+AEL  GETVA+KRI  
Sbjct  933   TNRQLVIKGSA-RREFRWEAIMEATANLSDQFAIGSGGSGTVYRAELSTGETVAVKRIAS  991

Query  3139  KD-DLFL-DKSFAREIKTLWRIRHRHLVRLMGYCSNKGE-GSNVLIYEYMENGSVWDWLH  3309
              D D+ L DKSFAREIK L R+RHRHLV+L+G+ ++  + G ++LIYEYMENGS++DWLH
Sbjct  992   MDSDMLLHDKSFAREIKILGRVRHRHLVKLLGFLAHGADRGGSMLIYEYMENGSLYDWLH  1051

Query  3310  -NQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHL  3486
                    K K++L W+ARLK+A GL QGVEYLHHDCVP+++HRDIKSSN+LLD++MEAHL
Sbjct  1052  GGGGEGGKKKRALSWDARLKVAAGLVQGVEYLHHDCVPRVVHRDIKSSNLLLDADMEAHL  1111

Query  3487  GDFGLAKALTDNYDSLN--TESNTWFAGSYGYIAPE  3588
             GDFGLAKA+ +N       TES ++FAGSYGY+APE
Sbjct  1112  GDFGLAKAVAENRQGAKECTESASFFAGSYGYMAPE  1147



>ref|XP_007214067.1| hypothetical protein PRUPE_ppa017621mg [Prunus persica]
 gb|EMJ15266.1| hypothetical protein PRUPE_ppa017621mg [Prunus persica]
Length=1186

 Score =   936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/1110 (56%), Positives = 759/1110 (68%), Gaps = 95/1110 (9%)
 Frame = +1

Query  301   STLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSC-----DGslkvvslnlsdssl  453
             +TL VLLEVKRSFV      L  WSE NPN+C+W+GVSC     DGS++VV LNLSDSSL
Sbjct  35    TTLSVLLEVKRSFVEDPEKVLHAWSESNPNFCTWRGVSCGLDSVDGSVQVVGLNLSDSSL  94

Query  454   ggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLT  633
              GSISPSLG L +LLHLDLSSN L+GPIPPALSNLSSLESLLLFSN+L GPIP+QLG L+
Sbjct  95    TGSISPSLGSLQNLLHLDLSSNGLTGPIPPALSNLSSLESLLLFSNQLSGPIPTQLGSLS  154

Query  634   NLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnll  813
             +L+ +RIGDN LTG IP SFGNL NLVTLGLASC L+G IPPQ+GRL QL+NL +Q N L
Sbjct  155   SLRVMRIGDNELTGHIPASFGNLVNLVTLGLASCSLNGPIPPQIGRLGQLENLIMQLNQL  214

Query  814   EGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMS  993
             EGP+P E+ N SSLT F+AA N LNGS+P+ELG L++L +LNL NN+L+GEIPGQLG +S
Sbjct  215   EGPIPAELGNCSSLTVFTAAQNHLNGSVPEELGLLQNLQLLNLGNNSLSGEIPGQLGRLS  274

Query  994   SLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNL  1173
              L YLNL+GNQL G IPKSLA+L NLQSLDLS N+L G +P E G+M QL +L L++NNL
Sbjct  275   QLGYLNLVGNQLEGPIPKSLAQLGNLQSLDLSMNKLTGGIPEEMGNMAQLVYLVLSNNNL  334

Query  1174  SGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYEL  1353
             SG IP++LCSN T+L+ LM+S+  + GEIP ELSQC+ ++QLDLSNN LNGSIP EL+EL
Sbjct  335   SGVIPRTLCSNTTSLEHLMISDAAIFGEIPVELSQCQSMKQLDLSNNLLNGSIPVELHEL  394

Query  1354  TQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENH  1533
               LTDL+L+NN+  G+ISP + NL+NLQTL L+HNNL G +PREIGMLG L+I++LY+N 
Sbjct  395   VGLTDLLLHNNSFVGSISPYLGNLSNLQTLVLYHNNLQGPLPREIGMLGKLEILYLYDNQ  454

Query  1534  FSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNC  1713
              SGEIP+EIGN  S++    Y N   G +P TL  + +L  ++L  N L+G I A+L + 
Sbjct  455   LSGEIPIEIGN--SMEQFMLYNNSLEGNLPDTLANMGNLTRVNLSRNKLNGSI-AALCSS  511

Query  1714  HQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNN  1893
                 + D+ DN     IP+  G   +L RL L NN   G +P  L N+  L+ +++S N+
Sbjct  512   SSFLSFDVTDNAFDHEIPSQLGNSPSLERLRLGNNQFTGPIPQTLGNISELSLLDVSGNS  571

Query  1894  FSGSI-APICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLI  2070
              +G I A + +       D+ NN     IP +LG  P L  L+L SN+FTG         
Sbjct  572   LTGPIPAELSSCKKLAHIDLNNNFLSGAIPRWLGGLPQLGELKLSSNQFTGP--------  623

Query  2071  RELSLLDLSGNKLSGFIPPQ-LSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSN  2247
                              PPQ L  C KL  L LN+N L                      
Sbjct  624   -----------------PPQELFNCSKLLVLSLNDNSL----------------------  644

Query  2248  QFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGG  2427
               +G+LP E+ N   L VL+L +N   G++PP IG L  L  L L  N   G IP  +G 
Sbjct  645   --NGTLPAEIGNLESLNVLNLNHNLFLGSIPPAIGKLGKLYELRLSQNGFDGDIPFELGQ  702

Query  2428  LGKLYE-LRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLS  2604
             L  L   L LS N  SG+IP  +G L  L++ LD S+N L GE+P  +  +  L  L+LS
Sbjct  703   LQNLQSILDLSYNNLSGQIPASIGTLTKLEA-LDLSHNQLVGEVPSPVAGMISLGKLNLS  761

Query  2605  HNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC--  2778
             +N+                        L+G+L K+ +HWP ++F GN HLCGSPLG C  
Sbjct  762   YNN------------------------LQGKLSKQLSHWPAEAFAGNLHLCGSPLGKCGV  797

Query  2779  RDKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQ  2958
             R + S    S VVVI+A+    AI LL+ GAA   +H +E +  R+  E     SSSSS 
Sbjct  798   RRQQSGPSESAVVVIAAICTLSAIALLIFGAASLLQHKQEVF--RKASEVNCLYSSSSSH  855

Query  2959  AQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPR  3138
             AQR+ LF N + K D +W DIMEAT NLS+EF+IGSGG   +YKAEL +GETVA+K+I  
Sbjct  856   AQRRLLFPNGSVKPDFKWKDIMEATKNLSNEFVIGSGGSGIIYKAELSSGETVAVKKILY  915

Query  3139  KDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQP  3318
             KDDL  +KSF REIKTL RIRHRHLV+LMGYCSNKG GSN+LIYEYMENGSVWDW+H QP
Sbjct  916   KDDLMANKSFTREIKTLGRIRHRHLVKLMGYCSNKGAGSNLLIYEYMENGSVWDWIHQQP  975

Query  3319  ANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFG  3498
             A +K KKSLDWEARLKIA+GLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFG
Sbjct  976   ATSK-KKSLDWEARLKIAVGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFG  1034

Query  3499  LAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             LAKA+ +NY+S NTESNTWFAGS+GYIAPE
Sbjct  1035  LAKAINENYES-NTESNTWFAGSFGYIAPE  1063



>ref|XP_006853528.1| hypothetical protein AMTR_s00032p00226460 [Amborella trichopoda]
 gb|ERN14995.1| hypothetical protein AMTR_s00032p00226460 [Amborella trichopoda]
Length=1261

 Score =   926 bits (2394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/1106 (51%), Positives = 748/1106 (68%), Gaps = 37/1106 (3%)
 Frame = +1

Query  313   VLLEVKRSF---VLQLQGWSEKN-PNYCSWQGVSC-DGslkvvslnlsdsslggsispsl  477
              LLE K S       L GW++   PN C W GV+C DG +  ++L+          S   
Sbjct  60    ALLEAKASLRGPWASLNGWTDSTAPNVCRWSGVTCSDGLVVGLNLSGLALEGPIPTSLLR  119

Query  478   gllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIG  657
                   L L  +       IPP LSNL+ L +L LF+N+L GPIP +LGLL+ L+ LRIG
Sbjct  120   ISSLLSLDLSSNLLSGL--IPPQLSNLTKLITLRLFTNQLSGPIPKELGLLSELEELRIG  177

Query  658   DNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEI  837
             DNGL G+IP +  N  +L +LGLASC L+G IPPQ+G L+ L+NL LQ+N L GPLP E+
Sbjct  178   DNGLEGEIPETISNCTSLTSLGLASCKLTGPIPPQIGELSALENLVLQENQLTGPLPAEL  237

Query  838   ANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLL  1017
              +   L  F+AA N ++G IP ELG LK L +LNLANN+L+G IP +LG +S L+YLNLL
Sbjct  238   DHCRRLLIFTAANNQIHGPIPSELGSLKALQLLNLANNSLSGAIPMELGGLSELIYLNLL  297

Query  1018  GNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSL  1197
             GNQL G++P+SL +L  LQ+LDLS N L G +P E G + +  F+ L+ N L G IP  +
Sbjct  298   GNQLNGALPESLGRLEKLQNLDLSSNSLIGLVPKEIGWLKEAGFIVLSDNMLGGEIPLGI  357

Query  1198  CSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVL  1377
             C+N T+L+ L+L+    SGEIP + +QC  L+ +DLS+N L G IP  L+ ++ LTDL+L
Sbjct  358   CTN-TSLEHLILAGNQFSGEIPADFAQCPSLKYIDLSDNNLEGEIPASLWGMSNLTDLLL  416

Query  1378  NNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVE  1557
             +NN+L G +   + NL++LQTL+LFHN+L G +P EIG+L  L+ +FLYEN FSGEIP E
Sbjct  417   HNNSLVGELPSFIGNLSSLQTLALFHNHLEGPIPPEIGLLESLETLFLYENQFSGEIPAE  476

Query  1558  IGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDL  1737
             IGNCSSL+ +DFYGN+F+G IP+TLGRL +L FLHLRENDL G IPASLGNC  L TLDL
Sbjct  477   IGNCSSLKQVDFYGNKFSGSIPVTLGRLANLNFLHLRENDLEGPIPASLGNCKSLKTLDL  536

Query  1738  ADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPI  1917
             ADN LSG IP TFG L +L  L+LYNNSL G LP +LRN  NLTR+NLS+N  +G I P+
Sbjct  537   ADNRLSGKIPVTFGNLESLEMLLLYNNSLSGWLPRELRNCKNLTRVNLSNNKLTGPIFPL  596

Query  1918  CTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLS  2097
             C S S+LSFD++NN+F   +P+ L  S  L+RLRLGSN+F G IP+ LG + EL +LDLS
Sbjct  597   CYSPSYLSFDLSNNSFIGVVPALLCRSKGLERLRLGSNQFAGVIPLQLGQLAELYMLDLS  656

Query  2098  GNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPEL  2277
              N+++G IP +L+ C KL+HL L++N LSG +P WLG L  LGEL+LS N   GS+PP L
Sbjct  657   NNQINGTIPSELAKCTKLSHLVLSSNGLSGEVPPWLGNLTQLGELRLSENNLVGSIPPSL  716

Query  2278  FNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIP-STIGGLGKLYELRL  2454
              +C  LL L+L++N L G +P ++G L SLN L+L  N L G I  +T+     L+ LRL
Sbjct  717   GSCKGLLTLALDHNGLAGPIPEQLGELASLNSLDLSGNHLSGPITRNTVAKWKSLFLLRL  776

Query  2455  SRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPP  2634
             S N  SG IP E+ +L+ LQS LD S NN+TGEIP S+  L  LE L+LS N L+G IP 
Sbjct  777   SENELSGPIPPEISELQALQSGLDLSQNNITGEIPSSLAGLINLERLNLSFNALSGPIPS  836

Query  2635  QVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNK----  2802
             ++  M SL  L+LS N L+G L    + WP D+   N  LCG PL  C   G  N+    
Sbjct  837   ELGRMPSLVALDLSHNALQGPLPDALSKWPADALNANPGLCGRPLEPCTTAGPNNRALTP  896

Query  2803  GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFG  2982
             GS+  + +A  +  A+ +L+            A R +   +  A   +S   + R+PL G
Sbjct  897   GSVAGISAAAVSGFALAILVATVI--------ALRCKTSAQRGAIWGASLWGSSRRPLKG  948

Query  2983  NAAKKRDIRW--DDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRI-PRKDDLF  3153
              A      +W  +DIM ATN+LS+EF++G+GG  T+Y+AE+ NG+ +A+K+I     ++ 
Sbjct  949   EA------KWTFEDIMSATNSLSEEFMVGAGGSGTIYRAEMPNGDVLAVKKIFSGTGEIM  1002

Query  3154  LDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKS  3333
             LDKSF RE++TL RIRHRHLV+L+G+CS KGE  N+L+YEYM NGS+W+W+H++      
Sbjct  1003  LDKSFGRELQTLGRIRHRHLVKLLGWCS-KGE-INILVYEYMVNGSLWEWIHSK----GG  1056

Query  3334  KKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKAL  3513
             KK +DW  RL++A GL +GVEYLHHDCVP+I+HRDIKSSNVL+D + EAHLGDFGLAK +
Sbjct  1057  KKRMDWVGRLRVAKGLVEGVEYLHHDCVPRIVHRDIKSSNVLIDGDGEAHLGDFGLAKVV  1116

Query  3514  TDNYDSLN-TESNTWFAGSYGYIAPE  3588
              D  DS+  TES + FAGSYGY+APE
Sbjct  1117  EDTVDSMGATESTSHFAGSYGYMAPE  1142



>gb|KEH37336.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1121

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/994 (53%), Positives = 672/994 (68%), Gaps = 65/994 (7%)
 Frame = +1

Query  706   NLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSL  885
             ++V L L++  L+G I P +G L  L +L+L  N + GP+PP ++ ++ L +     N L
Sbjct  70    DIVRLVLSNSKLTGSISPFIGLLQNLTHLDLSSNHIVGPIPPSLSKLTKLESLLLFSNQL  129

Query  886   NGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLG---------------  1020
                IP + G L +L  L L +N L+GEIP  LG +  LV L L                 
Sbjct  130   TSQIPADFGSLVNLRFLRLGDNQLSGEIPSSLGNLVKLVTLGLASCKLNGNCSSLINFTG  189

Query  1021  --NQLGGSIPKSLAKLTNLQ----------SLDLSGNRLAGELPGEFGSMGQLQFLALTS  1164
               N+L G+I   L++L NL+           LDLS N+ +GE+P EF +M +LQFL L+ 
Sbjct  190   AENELNGTILSQLSRLRNLEILSLAKNTLTDLDLSTNKFSGEIPREFTNMSRLQFLVLSV  249

Query  1165  NNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEEL  1344
             N L G IPK+LC N+ +L+ L++S +GL GEIP ELSQC+ L+Q+DLSNN LNG+IP E+
Sbjct  250   NPLYGNIPKTLCYNSKSLEHLIISRSGLHGEIPSELSQCKSLKQIDLSNNYLNGTIPLEI  309

Query  1345  YELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLY  1524
             Y                         L NL  + L++N+L G +   IG L ++ ++ LY
Sbjct  310   Y------------------------GLVNLTYILLYNNSLVGSISPFIGNLSNMHLLALY  345

Query  1525  ENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASL  1704
              N   G +P EIG    L+ +  Y NQF+G+IP+ +G    L  +    N   G IP ++
Sbjct  346   HNKLHGALPKEIGRLGKLEILYLYENQFSGEIPMEIGNCSELQMVDFFGNHFGGRIPITI  405

Query  1705  GNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLS  1884
             G   +L  LDLADN+LSG IPATFGYL+ L + MLYNNSLEG +P  + N+ NLTR+NLS
Sbjct  406   G---RLSVLDLADNNLSGGIPATFGYLKDLKQFMLYNNSLEGGIPQQMVNVANLTRVNLS  462

Query  1885  HNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLG  2064
              N  +GS+AP+C+S  FLSFDVT N FD EIPS LGNS SL+RLRLG N+F+G+IP TLG
Sbjct  463   KNRLNGSLAPLCSSRDFLSFDVTGNVFDGEIPSNLGNSFSLNRLRLGGNKFSGEIPWTLG  522

Query  2065  LIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSS  2244
              I ELSLLDLSGN L G IP +LSLC KL  +DL+NNLL G +P WLG LP LG++ L+ 
Sbjct  523   KITELSLLDLSGNSLIGPIPDELSLCNKLASIDLSNNLLVGQVPAWLGNLPKLGKVNLAF  582

Query  2245  NQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIG  2424
             NQFSG  P  LF    LLVLSL NNSL+G+LP  +  L+SLNVL LD N   G IP  IG
Sbjct  583   NQFSGPFPLGLFKLPMLLVLSLNNNSLDGSLPDGLDELESLNVLRLDQNNFSGPIPHAIG  642

Query  2425  GLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLS  2604
              L  LYEL LSRN FSG+IP +VG L++LQ  LD SYNNL+G++P S+GTL+KLE+LDLS
Sbjct  643   NLRNLYELNLSRNVFSGDIPDDVGSLQNLQVALDLSYNNLSGQVPFSVGTLAKLEALDLS  702

Query  2605  HNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC--  2778
             HN LTGE+P  + EM SL +L++S N  +G L+KR++ WP ++FVGN HLCG+ LGSC  
Sbjct  703   HNQLTGEVPSNIGEMISLEKLDISYNNFQGALNKRFSRWPYEAFVGNLHLCGASLGSCGA  762

Query  2779  -RDKGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssss  2955
              R++ SR     V++ISALS   AI LL++    F ++ +E    ++G E     SSSSS
Sbjct  763   SRNRLSRLSEKSVIIISALSTLAAIALLVLAVKIFLRNRQELL--KKGSELECVFSSSSS  820

Query  2956  QAQRKPLFG-NAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRI  3132
             Q Q++PLF  +   +R+ RW +IM+ATNNLSDEFIIGSGG  TVY+ EL  GETVA+K+I
Sbjct  821   QVQKRPLFPLSTGGRREYRWQEIMDATNNLSDEFIIGSGGSGTVYRVELPTGETVAVKKI  880

Query  3133  PRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSN--KGEGSNVLIYEYMENGSVWDWL  3306
               KD+  L KSF RE+KTL RI+HRHLV+L+G CSN  KG G N+LIYE+MENGSVWDWL
Sbjct  881   SLKDEYLLHKSFIREVKTLGRIKHRHLVKLVGCCSNRHKGNGCNLLIYEFMENGSVWDWL  940

Query  3307  HNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHL  3486
             H      K ++SLDW+ R KIA+GLAQG+EYLHHDCVPKIIHRDIKSSN+LLDSNM+AHL
Sbjct  941   HGNAL--KLRRSLDWDTRFKIALGLAQGMEYLHHDCVPKIIHRDIKSSNILLDSNMDAHL  998

Query  3487  GDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             GDFGLAKA+ +N DS NTES + FAGSYGYIAPE
Sbjct  999   GDFGLAKAIVENLDS-NTESTSCFAGSYGYIAPE  1031


 Score =   217 bits (553),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 186/529 (35%), Positives = 272/529 (51%), Gaps = 62/529 (12%)
 Frame = +1

Query  1273  SQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLF  1452
             S  R + +L LSN+ L GSI   +  L  LT L L++N + G I PS++ LT L++L LF
Sbjct  66    SVSRDIVRLVLSNSKLTGSISPFIGLLQNLTHLDLSSNHIVGPIPPSLSKLTKLESLLLF  125

Query  1453  HNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEI-----------------GNCSSLQ  1581
              N L  ++P + G L +L+ + L +N  SGEIP  +                 GNCSSL 
Sbjct  126   SNQLTSQIPADFGSLVNLRFLRLGDNQLSGEIPSSLGNLVKLVTLGLASCKLNGNCSSL-  184

Query  1582  FIDFYG--NQFTGKIPITLGRLKHLFFLHLRENDL----------SGEIPASLGNCHQLD  1725
              I+F G  N+  G I   L RL++L  L L +N L          SGEIP    N  +L 
Sbjct  185   -INFTGAENELNGTILSQLSRLRNLEILSLAKNTLTDLDLSTNKFSGEIPREFTNMSRLQ  243

Query  1726  TLDLADNHLSGAIPATFGY-------------------------LRALTRLMLYNNSLEG  1830
              L L+ N L G IP T  Y                          ++L ++ L NN L G
Sbjct  244   FLVLSVNPLYGNIPKTLCYNSKSLEHLIISRSGLHGEIPSELSQCKSLKQIDLSNNYLNG  303

Query  1831  DLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLS-FDVTNNAFDQEIPSFLGNSPSL  2007
              +P ++  L NLT I L +N+  GSI+P   + S +    + +N     +P  +G    L
Sbjct  304   TIPLEIYGLVNLTYILLYNNSLVGSISPFIGNLSNMHLLALYHNKLHGALPKEIGRLGKL  363

Query  2008  DRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSG  2187
             + L L  N+F+G+IPM +G   EL ++D  GN   G IP  +    +L+ LDL +N LSG
Sbjct  364   EILYLYENQFSGEIPMEIGNCSELQMVDFFGNHFGGRIPITIG---RLSVLDLADNNLSG  420

Query  2188  PIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSL  2367
              IP   G L  L +  L +N   G +P ++ N + L  ++L  N LNG+L P   +   L
Sbjct  421   GIPATFGYLKDLKQFMLYNNSLEGGIPQQMVNVANLTRVNLSKNRLNGSLAPLCSSRDFL  480

Query  2368  NVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLT  2547
             +  ++  N   G IPS +G    L  LRL  N+FSGEIP  +G++ +L S+LD S N+L 
Sbjct  481   S-FDVTGNVFDGEIPSNLGNSFSLNRLRLGGNKFSGEIPWTLGKITEL-SLLDLSGNSLI  538

Query  2548  GEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEG  2694
             G IP  +   +KL S+DLS+N L G++P  +  +  LG++NL+ N+  G
Sbjct  539   GPIPDELSLCNKLASIDLSNNLLVGQVPAWLGNLPKLGKVNLAFNQFSG  587



>gb|EYU43620.1| hypothetical protein MIMGU_mgv1a020174mg [Erythranthe guttata]
Length=793

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/727 (68%), Positives = 588/727 (81%), Gaps = 3/727 (0%)
 Frame = +1

Query  631   TNLQALRIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqn  807
             +N   + +GDN  LTG IP SFGNL NL+ LGLASC LSG IPP+LG LT LQ+L LQ N
Sbjct  67    SNQMVVVLGDNPDLTGPIPPSFGNLHNLLFLGLASCSLSGPIPPELGNLTLLQHLILQIN  126

Query  808   llEGPLPPEIANISSLTAFSAALNSLNGSIPKELGG-LKHLHILNLANNTLTGEIPGQLG  984
              LEGP+PPE+AN SSL  F+AA N LNGSIP ELG  L +L  LNLANNTL+GEIP QLG
Sbjct  127   HLEGPIPPELANCSSLIVFTAADNHLNGSIPAELGASLGNLQTLNLANNTLSGEIPPQLG  186

Query  985   EMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTS  1164
             E++ L YLNLLGNQL G IPKSLAKL NL SLDLS N L GE+PG+ GSMG+L +L L+ 
Sbjct  187   ELTQLQYLNLLGNQLRGPIPKSLAKLANLGSLDLSDNMLTGEIPGDVGSMGELVYLVLSG  246

Query  1165  NNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEEL  1344
             NNL+GTIPK +CSNAT+L+ LMLS+  L G IP EL+ C  L+QLDLSNNTL+G IP EL
Sbjct  247   NNLTGTIPKGICSNATSLEHLMLSQNRLQGPIPAELADCVSLKQLDLSNNTLDGFIPLEL  306

Query  1345  YELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLY  1524
             Y + QLTDL+L+NN+L G+ISP V+NLTNLQTL+L+ NNL G +P+EIGML +LQI+++Y
Sbjct  307   YGMLQLTDLLLHNNSLSGSISPLVSNLTNLQTLALYQNNLQGNLPKEIGMLSNLQILYVY  366

Query  1525  ENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASL  1704
             +N  SGEIPVEIGNCSSLQ IDF+GN F+G IPIT+GRLK L FLHLR+NDLSGEIPASL
Sbjct  367   DNQLSGEIPVEIGNCSSLQMIDFFGNHFSGDIPITIGRLKQLNFLHLRQNDLSGEIPASL  426

Query  1705  GNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLS  1884
             GNC QL  LDLADN LSG+IP+T G+L AL +LMLYNNSL+G LPD+L  L NLTRINLS
Sbjct  427   GNCRQLTILDLADNQLSGSIPSTLGHLVALEQLMLYNNSLQGSLPDELTALANLTRINLS  486

Query  1885  HNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLG  2064
             HN  +G+IAP+CTSH+FLSFDVT+NAFD EIP  +GNSP+L+RLRLG+N F G+IP TLG
Sbjct  487   HNKLNGTIAPLCTSHNFLSFDVTSNAFDHEIPHQIGNSPALERLRLGNNMFAGEIPWTLG  546

Query  2065  LIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSS  2244
             LI++LSLLDLSGN L+G IP QLSLCR+LTHLDL+ N LSGP+P W+GRLPLLGELKLS+
Sbjct  547   LIQQLSLLDLSGNLLTGQIPIQLSLCRRLTHLDLDRNRLSGPVPFWIGRLPLLGELKLSA  606

Query  2245  NQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIG  2424
             NQ +GSLP ELFNCS LLVLSL  NS+NGTLPP++G LK LNVL+LD NQ  G IP TIG
Sbjct  607   NQLTGSLPRELFNCSNLLVLSLNGNSINGTLPPQVGELKFLNVLDLDGNQFSGPIPPTIG  666

Query  2425  GLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLS  2604
              L KLY+LRLSRN F+GEIP E+GQL++LQS +DFSYNNLTG IPPSIGTL KLE+LDLS
Sbjct  667   QLSKLYQLRLSRNSFTGEIPSEIGQLQNLQSFMDFSYNNLTGPIPPSIGTLDKLEALDLS  726

Query  2605  HNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD  2784
             HN+L G++PPQ+ EMSSLGRLNLS N L+G+LDKR  +  +  +   +  C       R 
Sbjct  727   HNELDGQVPPQIGEMSSLGRLNLSFNRLQGKLDKRNINR-ICCYFAAARSCPVFQTQKRS  785

Query  2785  KGSRNKG  2805
              G + KG
Sbjct  786   FGRKEKG  792


 Score =   301 bits (770),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 234/582 (40%), Positives = 326/582 (56%), Gaps = 5/582 (1%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             G IPP L  L+ L+ L L  N+L GPIP  L  L NL +L + DN LTG+IP   G++G 
Sbjct  179   GEIPPQLGELTQLQYLNLLGNQLRGPIPKSLAKLANLGSLDLSDNMLTGEIPGDVGSMGE  238

Query  709   LVTLGLASCYLSGLIPP-qlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSL  885
             LV L L+   L+G IP       T L++L L QN L+GP+P E+A+  SL     + N+L
Sbjct  239   LVYLVLSGNNLTGTIPKGICSNATSLEHLMLSQNRLQGPIPAELADCVSLKQLDLSNNTL  298

Query  886   NGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLT  1065
             +G IP EL G+  L  L L NN+L+G I   +  +++L  L L  N L G++PK +  L+
Sbjct  299   DGFIPLELYGMLQLTDLLLHNNSLSGSISPLVSNLTNLQTLALYQNNLQGNLPKEIGMLS  358

Query  1066  NLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETG  1245
             NLQ L +  N+L+GE+P E G+   LQ +    N+ SG IP ++      L  L L +  
Sbjct  359   NLQILYVYDNQLSGEIPVEIGNCSSLQMIDFFGNHFSGDIPITI-GRLKQLNFLHLRQND  417

Query  1246  LSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANL  1425
             LSGEIP  L  CR L  LDL++N L+GSIP  L  L  L  L+L NN+L+G++   +  L
Sbjct  418   LSGEIPASLGNCRQLTILDLADNQLSGSIPSTLGHLVALEQLMLYNNSLQGSLPDELTAL  477

Query  1426  TNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQ  1605
              NL  ++L HN L+G +   +    +     +  N F  EIP +IGN  +L+ +    N 
Sbjct  478   ANLTRINLSHNKLNGTI-APLCTSHNFLSFDVTSNAFDHEIPHQIGNSPALERLRLGNNM  536

Query  1606  FTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYL  1785
             F G+IP TLG ++ L  L L  N L+G+IP  L  C +L  LDL  N LSG +P   G L
Sbjct  537   FAGEIPWTLGLIQQLSLLDLSGNLLTGQIPIQLSLCRRLTHLDLDRNRLSGPVPFWIGRL  596

Query  1786  RALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLS-FDVTNNA  1962
               L  L L  N L G LP +L N  NL  ++L+ N+ +G++ P      FL+  D+  N 
Sbjct  597   PLLGELKLSANQLTGSLPRELFNCSNLLVLSLNGNSINGTLPPQVGELKFLNVLDLDGNQ  656

Query  1963  FDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIREL-SLLDLSGNKLSGFIPPQLSL  2139
             F   IP  +G    L +LRL  N FTG+IP  +G ++ L S +D S N L+G IPP +  
Sbjct  657   FSGPIPPTIGQLSKLYQLRLSRNSFTGEIPSEIGQLQNLQSFMDFSYNNLTGPIPPSIGT  716

Query  2140  CRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSL  2265
               KL  LDL++N L G +P  +G +  LG L LS N+  G L
Sbjct  717   LDKLEALDLSHNELDGQVPPQIGEMSSLGRLNLSFNRLQGKL  758



>ref|NP_001168291.1| uncharacterized protein LOC100382055 [Zea mays]
 gb|ACN27712.1| unknown [Zea mays]
Length=983

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/873 (53%), Positives = 612/873 (70%), Gaps = 21/873 (2%)
 Frame = +1

Query  1015  LGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKS  1194
             + N+L G +P++LA L+ + ++DLSGN L+G LP E G + QL FL L+ N L+G++P  
Sbjct  1     MNNRLTGRVPRTLAALSRVHTIDLSGNMLSGALPAELGRLPQLTFLVLSDNQLTGSVPGD  60

Query  1195  LC----SNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQL  1362
             LC    + +++++ LMLS    +GEIP  LS+CR L QL L+NN+L+G IP  L EL  L
Sbjct  61    LCGGDEAESSSIEHLMLSMNNFTGEIPEGLSRCRALTQLGLANNSLSGVIPAALGELGNL  120

Query  1363  TDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSG  1542
             TDLVLNNN+L G + P + NLT LQTL+L+HN L G +P  IG L +L+ ++LYEN F+G
Sbjct  121   TDLVLNNNSLSGELPPELFNLTELQTLALYHNKLSGRLPDAIGRLVNLEELYLYENQFTG  180

Query  1543  EIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQL  1722
             EIP  IG+C+SLQ IDF+GN+F G IP ++G L  L FL  R+N+LSG I   LG C QL
Sbjct  181   EIPESIGDCASLQMIDFFGNRFNGSIPASMGNLSQLIFLDFRQNELSGVIAPELGECQQL  240

Query  1723  DTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSG  1902
               LDLADN LSG+IP TFG LR+L + MLYNNSL G +PD +    N+TR+N++HN  SG
Sbjct  241   KILDLADNALSGSIPETFGKLRSLEQFMLYNNSLSGAIPDGMFECRNITRVNIAHNRLSG  300

Query  1903  SIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELS  2082
             S+ P+C +   LSFD TNN+FD  IP+  G S  L R+RLGSN  +G IP +LG I  L+
Sbjct  301   SLLPLCGTARLLSFDATNNSFDGAIPAQFGRSSGLQRVRLGSNMLSGPIPPSLGGITALT  360

Query  2083  LLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGS  2262
             LLD+S N L+G  P  L+ C  L+ + L++N LSG IP WLG LP LGEL LS+N+F+G+
Sbjct  361   LLDVSSNALTGGFPATLAQCTNLSLVVLSHNRLSGAIPDWLGSLPQLGELTLSNNEFTGA  420

Query  2263  LPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLY  2442
             +P +L NCS LL LSL+NN +NGT+PPE+G+L SLNVLNL  NQL G IP+T+  L  LY
Sbjct  421   IPVQLSNCSNLLKLSLDNNQINGTVPPELGSLASLNVLNLAHNQLSGQIPTTVAKLSSLY  480

Query  2443  ELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTG  2622
             EL LS+N  SG IP ++ +L++LQS+LD S NN +G IP S+G+LSKLE L+LSHN L G
Sbjct  481   ELNLSQNYLSGPIPPDISKLQELQSLLDLSSNNFSGHIPASLGSLSKLEDLNLSHNALVG  540

Query  2623  EIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNK  2802
              +P Q+A MSSL +L+LS N+LEG L   +  WP  +F  N+ LCGSPL  C  + SR+ 
Sbjct  541   AVPSQLAGMSSLVQLDLSSNQLEGRLGIEFGRWPQAAFANNAGLCGSPLRGCSSRNSRSA  600

Query  2803  GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRR-GKE--NYAsssssssQAQRKP  2973
                  V     A V  ++ L+           A RR+  G E  N ++ SSSSS +  + 
Sbjct  601   FHAASV-----ALVTAVVTLLIVLVIIVLALMAVRRQAPGSEEMNCSAFSSSSSGSANRQ  655

Query  2974  LFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDD--  3147
             L    + +R+ RW+ IMEAT NLSD+F IGSGG  TVY+AEL  GETVA+KRI   D   
Sbjct  656   LVIKGSARREFRWEAIMEATANLSDQFAIGSGGSGTVYRAELSTGETVAVKRIADMDSGM  715

Query  3148  LFLDKSFAREIKTLWRIRHRHLVRLMGYCSNK--GEGSNVLIYEYMENGSVWDWLHNQPA  3321
             L  DKSF RE+KTL R+RHRHLV+L+G+ +++  G G  +L+YEYMENGS++DWLH   +
Sbjct  716   LLHDKSFTREVKTLGRVRHRHLVKLLGFVTSRECGGGGGMLVYEYMENGSLYDWLHGG-S  774

Query  3322  NNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGL  3501
             + + K++L W+ARLK+A GLAQGVEYLHHDCVP+I+HRDIKSSNVLLD +MEAHLGDFGL
Sbjct  775   DGRKKQTLSWDARLKVAAGLAQGVEYLHHDCVPRIVHRDIKSSNVLLDGDMEAHLGDFGL  834

Query  3502  AKALTDNYDSL----NTESNTWFAGSYGYIAPE  3588
             AKA+ +N  +      TES + FAGSYGYIAPE
Sbjct  835   AKAVRENRQAAFGKDCTESGSCFAGSYGYIAPE  867


 Score =   267 bits (683),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 196/563 (35%), Positives = 285/563 (51%), Gaps = 27/563 (5%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G +P++LG L  L  L + DN LTG +P          +  +    LS            
Sbjct  31    GALPAELGRLPQLTFLVLSDNQLTGSVPGDLCGGDEAESSSIEHLMLS------------  78

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
                     N   G +P  ++   +LT    A NSL+G IP  LG L +L  L L NN+L+
Sbjct  79    -------MNNFTGEIPEGLSRCRALTQLGLANNSLSGVIPAALGELGNLTDLVLNNNSLS  131

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             GE+P +L  ++ L  L L  N+L G +P ++ +L NL+ L L  N+  GE+P   G    
Sbjct  132   GELPPELFNLTELQTLALYHNKLSGRLPDAIGRLVNLEELYLYENQFTGEIPESIGDCAS  191

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             LQ +    N  +G+IP S+  N + L  L   +  LSG I PEL +C+ L+ LDL++N L
Sbjct  192   LQMIDFFGNRFNGSIPASM-GNLSQLIFLDFRQNELSGVIAPELGECQQLKILDLADNAL  250

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
             +GSIPE   +L  L   +L NN+L G I   +    N+  +++ HN L G +   + + G
Sbjct  251   SGSIPETFGKLRSLEQFMLYNNSLSGAIPDGMFECRNITRVNIAHNRLSGSL---LPLCG  307

Query  1501  DLQIIFL--YENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREN  1674
               +++      N F G IP + G  S LQ +    N  +G IP +LG +  L  L +  N
Sbjct  308   TARLLSFDATNNSFDGAIPAQFGRSSGLQRVRLGSNMLSGPIPPSLGGITALTLLDVSSN  367

Query  1675  DLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRN  1854
              L+G  PA+L  C  L  + L+ N LSGAIP   G L  L  L L NN   G +P  L N
Sbjct  368   ALTGGFPATLAQCTNLSLVVLSHNRLSGAIPDWLGSLPQLGELTLSNNEFTGAIPVQLSN  427

Query  1855  LGNLTRINLSHNNFSGSIAPICTSHSFLS-FDVTNNAFDQEIPSFLGNSPSLDRLRLGSN  2031
               NL +++L +N  +G++ P   S + L+  ++ +N    +IP+ +    SL  L L  N
Sbjct  428   CSNLLKLSLDNNQINGTVPPELGSLASLNVLNLAHNQLSGQIPTTVAKLSSLYELNLSQN  487

Query  2032  RFTGKIPMTLGLIREL-SLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlg  2208
               +G IP  +  ++EL SLLDLS N  SG IP  L    KL  L+L++N L G +P  L 
Sbjct  488   YLSGPIPPDISKLQELQSLLDLSSNNFSGHIPASLGSLSKLEDLNLSHNALVGAVPSQLA  547

Query  2209  rlpllgelklSSNQFSGSLPPEL  2277
              +  L +L LSSNQ  G L  E 
Sbjct  548   GMSSLVQLDLSSNQLEGRLGIEF  570


 Score =   103 bits (257),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 105/184 (57%), Gaps = 1/184 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP  LG L  L  L + +N  TG IP    N  NL+ L L +  ++G +PP+LG L  
Sbjct  395   GAIPDWLGSLPQLGELTLSNNEFTGAIPVQLSNCSNLLKLSLDNNQINGTVPPELGSLAS  454

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLH-ILNLANNTL  957
             L  LNL  N L G +P  +A +SSL   + + N L+G IP ++  L+ L  +L+L++N  
Sbjct  455   LNVLNLAHNQLSGQIPTTVAKLSSLYELNLSQNYLSGPIPPDISKLQELQSLLDLSSNNF  514

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             +G IP  LG +S L  LNL  N L G++P  LA +++L  LDLS N+L G L  EFG   
Sbjct  515   SGHIPASLGSLSKLEDLNLSHNALVGAVPSQLAGMSSLVQLDLSSNQLEGRLGIEFGRWP  574

Query  1138  QLQF  1149
             Q  F
Sbjct  575   QAAF  578



>gb|EMT29923.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Aegilops 
tauschii]
Length=1193

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 558/1114 (50%), Positives = 708/1114 (64%), Gaps = 94/1114 (8%)
 Frame = +1

Query  313   VLLEVKRSFVLQ----LQGWSEK---NPNYCSWQGVSCD-Gslkvvslnlsdsslggsis  468
             VLLEVK +F       L+GWS     + ++CSW GV+CD   L+V  LNLS +   G + 
Sbjct  35    VLLEVKSAFAEDPEGVLEGWSADGGGSSDFCSWAGVTCDPAGLRVAGLNLSGAGFAGPVP  94

Query  469   pslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQAL  648
              +L  L  L  +DLSSN L+GPIP AL  L  L+ L+L+SN+L G IP+ LG L  LQ L
Sbjct  95    GTLARLDALEVIDLSSNRLTGPIPAALGRLRRLQLLMLYSNQLAGGIPASLGRLAALQVL  154

Query  649   RIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPL  825
             R+GDN GL+G IP + G L NL  +GLASC L+G I                        
Sbjct  155   RLGDNLGLSGSIPKALGELRNLTVIGLASCNLTGAI------------------------  190

Query  826   PPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVY  1005
             P  +  +++LTA +   NSL+G IP ++G +  L  L LA N LTGEIP +LG++S L  
Sbjct  191   PGGLGRLAALTALNLQENSLSGPIPADIGAMASLEALALAGNQLTGEIPPELGKLSYLQK  250

Query  1006  LNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTI  1185
             LNL  N L G+IP  L  L  L  L+L  NRL+G          +L FL L  N+LSG  
Sbjct  251   LNLGNNSLEGAIPPELGALGELLYLNLMNNRLSG----------RLNFLVLADNHLSGRR  300

Query  1186  PKSLCSNATN------LQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELY  1347
              ++LCS +        L+ L+LS    +GEIP  LS+CR L QLDL+NN+L+G+IP  L 
Sbjct  301   SRNLCSGSNEAESSSSLEHLLLSTNNFTGEIPDGLSRCRALTQLDLANNSLSGAIPPGLG  360

Query  1348  ELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYE  1527
             EL  LT L+LNNN+L G + P + NLT L +L+L+HN L G++P  IG L +LQ ++LYE
Sbjct  361   ELGNLTGLLLNNNSLSGELPPEIFNLTELTSLALYHNQLTGQLPDAIGNLKNLQELYLYE  420

Query  1528  NHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLG  1707
             N FSGEIP  IG CSSLQ IDF+GNQF G IP ++G L  L FLHLR+N+LSG IP  LG
Sbjct  421   NQFSGEIPESIGECSSLQMIDFFGNQFNGSIPASIGNLSELIFLHLRQNELSGLIPPELG  480

Query  1708  NCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSH  1887
             +CHQL  LDLADN LSG IPATF  L AL + MLYNNSL G +PD +    N+TR     
Sbjct  481   DCHQLQVLDLADNALSGEIPATFEKLEALQQFMLYNNSLSGAVPDGMFECRNITR-----  535

Query  1888  NNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGL  2067
                                          IP+ LG S SL R+RLGSN  +G IP +LG 
Sbjct  536   ---------------------------GGIPAQLGRSSSLQRVRLGSNALSGPIPPSLGG  568

Query  2068  IRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSN  2247
             I  L+LLD+S N L+G IP  LS C +L+H+ LN+N LSGP+P WLG LP LGEL LS+N
Sbjct  569   IAALTLLDVSNNALTGVIPDALSRCTQLSHIVLNHNRLSGPVPAWLGTLPQLGELTLSAN  628

Query  2248  QFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGG  2427
             +F+G+LP +L  CSKLL LS++ N +NGT+PPEIG L SLNVLNL  NQL G +P+T+  
Sbjct  629   EFTGALPVQLTKCSKLLKLSIDGNQINGTVPPEIGRLASLNVLNLAQNQLSGPVPATVAR  688

Query  2428  LGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSH  2607
             L  LYEL LS+N+ SG IP ++G++++LQS+LD S NNL G IP SIG+LSKLE L+LSH
Sbjct  689   LSNLYELNLSQNQLSGAIPPDIGKMQELQSLLDLSSNNLVGIIPASIGSLSKLEDLNLSH  748

Query  2608  NDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDK  2787
             N L G +P Q+A MSSL  L+LS N L+G L   ++ WP D+F GN+ LCGS L      
Sbjct  749   NALVGTVPSQLARMSSLVELDLSSNRLDGRLGDEFSRWPQDAFSGNAALCGSHL----RG  804

Query  2788  GSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRR---RGKENYAsssssssQ  2958
                       + SA  A V+  + L            A RRR    G+ N    SSS   
Sbjct  805   CGSGGRGRSTMHSASIALVSAAVTLTIVILVIVLVLLAVRRRGRHSGEVNCTVFSSSQGN  864

Query  2959  AQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPR  3138
               R+ +   +A +R+ RWD I EAT NLSD+F +GSGG  TVY+AEL  GETVA+KR   
Sbjct  865   TNRQLIIKGSA-RREFRWDAIREATANLSDQFAVGSGGSGTVYRAELPTGETVAVKRFVH  923

Query  3139  KD-DLFL-DKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHN  3312
              D D+ L DKSFARE+K L R+RHRHLV+L+G+      G ++LIYEYMENGS++DWLH 
Sbjct  924   MDSDMLLQDKSFAREVKILGRVRHRHLVKLLGFVGQGEHGGSMLIYEYMENGSLYDWLHG  983

Query  3313  QPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGD  3492
                  K K+ L W+ARLK+A GL QGVEYLHHDCVP+++HRDIKSSNVLLD +MEAHLGD
Sbjct  984   GAGEGK-KRVLSWDARLKVAAGLVQGVEYLHHDCVPRVVHRDIKSSNVLLDGDMEAHLGD  1042

Query  3493  FGLAKALTDNYDSLN--TESNTWFAGSYGYIAPE  3588
             FGLAKA+ +N +     TES + FAGSYGY+APE
Sbjct  1043  FGLAKAIAENRNGGKECTESASLFAGSYGYMAPE  1076



>ref|XP_007138872.1| hypothetical protein PHAVU_009G244600g [Phaseolus vulgaris]
 gb|ESW10866.1| hypothetical protein PHAVU_009G244600g [Phaseolus vulgaris]
Length=1193

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/903 (58%), Positives = 654/903 (72%), Gaps = 22/903 (2%)
 Frame = +1

Query  286   CQNTSSTLRVLLEVKRSFVLQ----LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdssl  453
             C    ST+RVLLEVK SF       L  WSE N +YCSW+GVSC    +    +  DS  
Sbjct  25    CHGNESTMRVLLEVKSSFTEDPENVLSDWSENNTDYCSWRGVSCGSKKRHFLDDDDDSVQ  84

Query  454   ggsispslgll-----------thllhldlssnhlsGPIPPAlsnlssleslllfsnrlV  600
                ++ S   L            +LLHLDLSSN L GPIPPALSNL+SLESLLL SN+L 
Sbjct  85    VVGLNLSESSLGGSISPSLGRLQNLLHLDLSSNRLEGPIPPALSNLTSLESLLLHSNQLT  144

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IPS+L  LT L+ LRIG+N L+G IP + G + NL  +GLASC LSG IP  L RL +
Sbjct  145   GQIPSELDSLTRLRVLRIGNNQLSGPIPDTLGYMYNLRYIGLASCRLSGPIPGNLARLAE  204

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             LQ L LQ N L GP+P E+    SL  F+AA N LNGSIP+E+G +  L  LNLANN+LT
Sbjct  205   LQYLILQDNELTGPIPFEVGYFWSLVVFTAAGNRLNGSIPREMGLIWKLQTLNLANNSLT  264

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP QLG++S L YLN +GNQL G IP SLA+L NLQ+LDLS N L+GE+P E G +GQ
Sbjct  265   GSIPSQLGKLSQLTYLNFMGNQLEGRIPPSLAQLGNLQNLDLSNNTLSGEIPKELGKLGQ  324

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             LQ+L L+ NNL GTIP+++CSNAT+L+ LM+++  L GEIP EL QC+ L+QLDLS+N L
Sbjct  325   LQYLVLSGNNLYGTIPRTICSNATSLEHLMIADNVLYGEIPAELGQCQSLKQLDLSSNYL  384

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
             NGSIP E+Y L  LTDL+L+NNTL G+ISP + NLT +Q L+LFHNNL G +PREIGMLG
Sbjct  385   NGSIPTEVYGLVGLTDLLLHNNTLVGSISPFIGNLTEMQNLALFHNNLQGNLPREIGMLG  444

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
              L+I++LY+N  SG+IP+EIGNCSSLQ +D +GN F+G IP T+GRLK L FLHLR+N+L
Sbjct  445   KLEIMYLYDNQLSGKIPLEIGNCSSLQMVDLFGNHFSGAIPFTIGRLKELNFLHLRQNEL  504

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
              G IP +LGNCH+L  LDLADN L G IPATFG+L+ L + MLYNNSLEG LP  L N+ 
Sbjct  505   VGVIPPTLGNCHKLAVLDLADNRLPGGIPATFGFLKELKQFMLYNNSLEGSLPHQLVNVA  564

Query  1861  NLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFT  2040
             NLTR+NLS+N  +GS+A +C+S SFLSFDVT+N FD EIP  LGNSPSL+RLRLG+N+F+
Sbjct  565   NLTRVNLSNNRLNGSLAALCSSSSFLSFDVTDNEFDGEIPFLLGNSPSLERLRLGNNKFS  624

Query  2041  GKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpl  2220
             G+IP TLG I  LSLLD+SGN L+G IP +LSLC  LTH+DLNNNLL+G IP WLG LP 
Sbjct  625   GEIPRTLGKITTLSLLDVSGNSLTGRIPDELSLCTNLTHVDLNNNLLTGHIPTWLGSLPQ  684

Query  2221  lgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLC  2400
             LGE+KLS NQFSGS+P  L     LLVLSL NNSL+G+LP +IG+L SLN L LD N   
Sbjct  685   LGEVKLSFNQFSGSIPLGLLKQPNLLVLSLNNNSLSGSLPGDIGDLVSLNTLRLDHNNFS  744

Query  2401  GSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLS  2580
             G IP  IG L  LYEL+LS N FSGEIP E+G L+++QS+LD SYNNL+G IP S+G LS
Sbjct  745   GPIPQAIGKLNNLYELQLSNNGFSGEIPIELGSLQNVQSILDLSYNNLSGHIPSSLGMLS  804

Query  2581  KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCG  2760
             KLE+L++SHN+L+GE+P  V EM+SL  L++SCN L+G LDK+++ WP +SF GN HLCG
Sbjct  805   KLEALNISHNELSGEVPSVVGEMTSLQELDISCNNLQGALDKKFSRWPNESFEGN-HLCG  863

Query  2761  SPLGSCRD-KGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNRE-----AYRRRRGK  2922
             + L SC    GS NK    ++ S  + +   ++ + G+   ++         A ++  GK
Sbjct  864   ASLASCNSGDGSNNKRWQDIMSSTNNLSDEFVVGIGGSGTVYRVELPSGEIVAVKKISGK  923

Query  2923  ENY  2931
             ++Y
Sbjct  924   DDY  926


 Score =   293 bits (750),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 161/196 (82%), Gaps = 5/196 (3%)
 Frame = +1

Query  3007  RWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDDLFLDKSFAREIKT  3186
             RW DIM +TNNLSDEF++G GG  TVY+ EL +GE VA+K+I  KDD  L+KSF REIKT
Sbjct  879   RWQDIMSSTNNLSDEFVVGIGGSGTVYRVELPSGEIVAVKKISGKDDYLLNKSFIREIKT  938

Query  3187  LWRIRHRHLVRLMGYCS--NKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKKSLDWEAR  3360
             L RI+HRHLV+LMG CS  N+G G N+LIYEYMENG+VWDWLH  P   K KK LDW+ R
Sbjct  939   LGRIKHRHLVKLMGCCSNRNRGTGWNLLIYEYMENGNVWDWLHEVPL--KEKKILDWDTR  996

Query  3361  LKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSLNT  3540
              KIA+GL   VEYLHHDCVPKIIHRDIKSSN+LLDSNMEAHLGDFGLAK+L +N +S NT
Sbjct  997   FKIAIGLTHAVEYLHHDCVPKIIHRDIKSSNILLDSNMEAHLGDFGLAKSLVENPES-NT  1055

Query  3541  ESNTWFAGSYGYIAPE  3588
             ESN+ FAGSYGY+APE
Sbjct  1056  ESNSGFAGSYGYMAPE  1071



>emb|CDX78976.1| BnaA01g10430D [Brassica napus]
Length=942

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/849 (52%), Positives = 539/849 (63%), Gaps = 143/849 (17%)
 Frame = +1

Query  1198  CSNATNLQLLMLSETGL---SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTD  1368
             C +    +++ L+ +GL   +G IP  LS    L+ L L +N L G IP +L  L  L  
Sbjct  69    CDDTGLFRVVALNLSGLGLTAGPIPTALSNLSSLESLFLFSNQLTGEIPSQLGSLLNLRS  128

Query  1369  LVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEI  1548
             L + +N L GTI  ++ +L NLQ L+L    L G VP ++G L  +Q + L +N+  G I
Sbjct  129   LRIGDNELVGTIPETLGSLANLQMLALASCRLTGPVPSQLGRLARVQSLILQDNNLEGPI  188

Query  1549  PVE-----------------------------------------------IGNCSSLQFI  1587
             P E                                               IGNC+SL+ I
Sbjct  189   PAELANCSDLTVFAAAANRLNGTIPAELGRLENLEILNLASNGLSGEIPKIGNCTSLKMI  248

Query  1588  DFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIP  1767
             D +GN F G+IP ++G LK L  LHLR+N+  G +PA+LGNCHQL  LDLADN LSG+IP
Sbjct  249   DLFGNHFEGEIPSSIGALKELNLLHLRQNEFVGGLPATLGNCHQLKILDLADNQLSGSIP  308

Query  1768  ATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFD  1947
              +FG L+ L + MLYNNSL+G LPD L NL NLTRIN+SHN                   
Sbjct  309   PSFGSLKGLEQFMLYNNSLQGSLPDSLTNLKNLTRINISHNK------------------  350

Query  1948  VTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPP  2127
                   + EIP  LGNS +LDRLRLG N+FTG+IP T G IRELSLLD+S N L+G IP 
Sbjct  351   -----LNDEIPLQLGNSLNLDRLRLGKNQFTGRIPWTFGKIRELSLLDISSNSLTGTIPL  405

Query  2128  QLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvls  2307
             QL LC+KLTH+DLNNN LSGPIP WLG+L  LGELKLSSNQF GSLP EL NC+KLL   
Sbjct  406   QLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFDGSLPTELLNCTKLL---  462

Query  2308  lennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPR  2487
                         EIG+L +LNVLNLD NQ  G +P  IG L KLYELRLSRN  +GEIP 
Sbjct  463   ------------EIGSLGALNVLNLDKNQFSGLLPQGIGKLSKLYELRLSRNSLAGEIPL  510

Query  2488  EVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRL  2667
             E+GQL+DLQS LD SYNN TG IP +IGTL+KLE+LDLSHN LTGE+P            
Sbjct  511   EIGQLQDLQSSLDLSYNNFTGGIPSTIGTLTKLETLDLSHNQLTGEVPGA----------  560

Query  2668  NLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKGSMVVVISALSATVA  2847
                         K+++ WP DSF+GN+           +K        VV ISA+SA  A
Sbjct  561   ------------KQFSKWPTDSFIGNTD----------NKQQGLSPRSVVTISAISALAA  598

Query  2848  IILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGN-AAKKRDIRWDDIM  3024
             I L+++    FFK   + +                    +KPLF   A+ K DI+WDDIM
Sbjct  599   IALMILVIVLFFKQRHDFF--------------------KKPLFRTGASSKSDIKWDDIM  638

Query  3025  EATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDDLFLDKSFAREIKTLWRIRH  3204
             +AT+NLS+EF+IGSGG   +YKAEL NG+ VA+K+I  KDDL  +KSF+RE+KTL RI+H
Sbjct  639   DATHNLSEEFMIGSGGSGKIYKAELENGQIVAVKKILWKDDLMSNKSFSREVKTLGRIKH  698

Query  3205  RHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKKS-LDWEARLKIAMGL  3381
             RHLV+LMGYCS+K EG N+LIYEYMENGSVWDW H++    + KK  LDWEARL+IA+GL
Sbjct  699   RHLVKLMGYCSSKSEGLNLLIYEYMENGSVWDWFHDEKPEIEKKKKVLDWEARLRIAVGL  758

Query  3382  AQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSLNTESNTWFA  3561
             AQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEAHLGDFGLAK LT+NYD+ NTESNTWFA
Sbjct  759   AQGVEYLHHDCVPPILHRDIKSSNVLLDSNMEAHLGDFGLAKVLTENYDT-NTESNTWFA  817

Query  3562  GSYGYIAPE  3588
             GSYGYIAPE
Sbjct  818   GSYGYIAPE  826


 Score =   296 bits (758),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 238/592 (40%), Positives = 319/592 (54%), Gaps = 75/592 (13%)
 Frame = +1

Query  307   LRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsis  468
             L+ LLE+K+SFV        L  W+  N NYCSW GV+CD +     + L+ S LG +  
Sbjct  31    LQNLLELKKSFVTNPGEDDPLPQWNSVNINYCSWTGVTCDDTGLFRVVALNLSGLGLTA-  89

Query  469   pslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQAL  648
                                 GPIP ALSNLSSLESL LFSN+L G IPSQLG L NL++L
Sbjct  90    --------------------GPIPTALSNLSSLESLFLFSNQLTGEIPSQLGSLLNLRSL  129

Query  649   RIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLP  828
             RIGDN L G IP + G+L NL  L LASC L+G +P QLGRL ++Q+L LQ N LEGP+P
Sbjct  130   RIGDNELVGTIPETLGSLANLQMLALASCRLTGPVPSQLGRLARVQSLILQDNNLEGPIP  189

Query  829   PEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYL  1008
              E+AN S LT F+AA N LNG+IP ELG L++L ILNLA+N L+GEIP ++G  +SL  +
Sbjct  190   AELANCSDLTVFAAAANRLNGTIPAELGRLENLEILNLASNGLSGEIP-KIGNCTSLKMI  248

Query  1009  NLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIP  1188
             +L GN   G IP S+  L  L  L L  N   G LP   G+  QL+ L L  N LSG+  
Sbjct  249   DLFGNHFEGEIPSSIGALKELNLLHLRQNEFVGGLPATLGNCHQLKILDLADNQLSGS--  306

Query  1189  KSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTD  1368
                                    IPP     + L+Q  L NN+L GS+P+ L  L  LT 
Sbjct  307   -----------------------IPPSFGSLKGLEQFMLYNNSLQGSLPDSLTNLKNLTR  343

Query  1369  LVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEI  1548
             + +++N L   I   + N  NL  L L  N   G +P   G + +L ++ +  N  +G I
Sbjct  344   INISHNKLNDEIPLQLGNSLNLDRLRLGKNQFTGRIPWTFGKIRELSLLDISSNSLTGTI  403

Query  1549  PVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQ---  1719
             P+++  C  L  ID   N  +G IP  LG+L  L  L L  N   G +P  L NC +   
Sbjct  404   PLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFDGSLPTELLNCTKLLE  463

Query  1720  ------LDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL-TRIN  1878
                   L+ L+L  N  SG +P   G L  L  L L  NSL G++P ++  L +L + ++
Sbjct  464   IGSLGALNVLNLDKNQFSGLLPQGIGKLSKLYELRLSRNSLAGEIPLEIGQLQDLQSSLD  523

Query  1879  LSHNNFSGSI-APICTSHSFLSFDVTNNAFDQEIP-----------SFLGNS  1998
             LS+NNF+G I + I T     + D+++N    E+P           SF+GN+
Sbjct  524   LSYNNFTGGIPSTIGTLTKLETLDLSHNQLTGEVPGAKQFSKWPTDSFIGNT  575


 Score =   249 bits (637),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 168/461 (36%), Positives = 244/461 (53%), Gaps = 17/461 (4%)
 Frame = +1

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             G +P ++ ++ +L +     N L G+IP+ LG L +L +L LA+  LTG +P QLG ++ 
Sbjct  114   GEIPSQLGSLLNLRSLRIGDNELVGTIPETLGSLANLQMLALASCRLTGPVPSQLGRLAR  173

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             +  L L  N L G IP  LA  ++L     + NRL G +P E G +  L+ L L SN LS
Sbjct  174   VQSLILQDNNLEGPIPAELANCSDLTVFAAAANRLNGTIPAELGRLENLEILNLASNGLS  233

Query  1177  GTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
             G IPK    N T+L+++ L      GEIP  +   + L  L L  N   G +P  L    
Sbjct  234   GEIPK--IGNCTSLKMIDLFGNHFEGEIPSSIGALKELNLLHLRQNEFVGGLPATLGNCH  291

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
             QL  L L +N L G+I PS  +L  L+   L++N+L G +P  +  L +L  I +  N  
Sbjct  292   QLKILDLADNQLSGSIPPSFGSLKGLEQFMLYNNSLQGSLPDSLTNLKNLTRINISHNKL  351

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
             + EIP+++GN  +L  +    NQFTG+IP T G+++ L  L +  N L+G IP  L  C 
Sbjct  352   NDEIPLQLGNSLNLDRLRLGKNQFTGRIPWTFGKIRELSLLDISSNSLTGTIPLQLVLCK  411

Query  1717  QLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNF  1896
             +L  +DL +N LSG IP   G L  L  L L +N  +G LP +L N   L  I       
Sbjct  412   KLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFDGSLPTELLNCTKLLEI-------  464

Query  1897  SGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRE  2076
              GS+  +    + L+ D   N F   +P  +G    L  LRL  N   G+IP+ +G +++
Sbjct  465   -GSLGAL----NVLNLD--KNQFSGLLPQGIGKLSKLYELRLSRNSLAGEIPLEIGQLQD  517

Query  2077  L-SLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIP  2196
             L S LDLS N  +G IP  +    KL  LDL++N L+G +P
Sbjct  518   LQSSLDLSYNNFTGGIPSTIGTLTKLETLDLSHNQLTGEVP  558



>ref|XP_002978200.1| hypothetical protein SELMODRAFT_50240, partial [Selaginella moellendorffii]
 gb|EFJ20857.1| hypothetical protein SELMODRAFT_50240, partial [Selaginella moellendorffii]
Length=1254

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/1038 (46%), Positives = 637/1038 (61%), Gaps = 33/1038 (3%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             GP+P +++N + L  LL++SN L G IPS++G L+ LQ LR GDN  +G IP S   L +
Sbjct  128   GPLPASIANATLLTELLVYSNLLSGSIPSEIGRLSTLQVLRAGDNLFSGPIPDSIAGLHS  187

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L  LGLA+C LSG IP  +G+L  L++L L  N L G +PPE+     LT    + N L 
Sbjct  188   LQILGLANCELSGGIPRGIGQLVALESLMLHYNNLSGGIPPEVTQCRQLTVLGLSENRLT  247

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             G IP+ +  L  L  L++ NN+L+G +P ++G+   LVYLNL GN L G +P SLAKL  
Sbjct  248   GPIPRGISDLAALQTLSIFNNSLSGSVPEEVGQCRQLVYLNLQGNDLTGQLPDSLAKLAA  307

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             L++LDLS N ++G +P   GS+  L+ LAL+ N LSG IP S+   A  L+ L L    L
Sbjct  308   LETLDLSENSISGPIPDWIGSLASLENLALSMNQLSGEIPSSIGGLA-RLEQLFLGSNRL  366

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
             SGEIP E+ +CR LQ+LDLS+N L G+IP  +  L+ LTDLVL +N+L G+I   + +  
Sbjct  367   SGEIPGEIGECRSLQRLDLSSNRLTGTIPASIGRLSMLTDLVLQSNSLTGSIPEEIGSCK  426

Query  1429  NLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQF  1608
             NL  L+L+ N L+G +P  IG L  L  ++LY N  SG IP  IG+CS L  +D   N  
Sbjct  427   NLAVLALYENQLNGSIPASIGSLEQLDELYLYRNKLSGNIPASIGSCSKLTLLDLSENLL  486

Query  1609  TGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLR  1788
              G IP ++G L  L FLHLR N LSG IPA +  C ++  LDLA+N LSGAIP       
Sbjct  487   DGAIPSSIGGLGALTFLHLRRNRLSGSIPAPMARCAKMRKLDLAENSLSGAIPQDLTSAM  546

Query  1789  A-LTRLMLYNNSLEGDLPDDLRNL-GNLTRINLSHNNFSGSIAPICTSHSFLS-FDVTNN  1959
             A L  L+LY N+L G +P+ + +   NLT INLS N   G I P+  S   L   D+T+N
Sbjct  547   ADLEMLLLYQNNLTGAVPESIASCCHNLTTINLSDNLLGGKIPPLLGSSGALQVLDLTDN  606

Query  1960  AFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSL  2139
                  IP  LG S +L RLRLG N+  G IP  LG I  LS +DLS N+L+G IP  L+ 
Sbjct  607   GIGGNIPPSLGISSTLWRLRLGGNKIEGLIPAELGNITALSFVDLSFNRLAGAIPSILAS  666

Query  2140  CRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFN-Cskllvlslen  2316
             C+ LTH+ LN N L G IP  +G L  LGEL LS N+  G +P  + + C K+  L L  
Sbjct  667   CKNLTHIKLNGNRLQGRIPEEIGGLKQLGELDLSQNELIGEIPGSIISGCPKISTLKLAE  726

Query  2317  nslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVG  2496
             N L+G +P  +G L+SL  L L  N L G IP++IG  G L E+ LSRN   G IPRE+G
Sbjct  727   NRLSGRIPAALGILQSLQFLELQGNDLEGQIPASIGNCGLLLEVNLSRNSLQGGIPRELG  786

Query  2497  QLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVA-EMSSLGRLNL  2673
             +L++LQ+ LD S+N L G IPP +G LSKLE L+LS N ++G IP  +A  M SL  LNL
Sbjct  787   KLQNLQTSLDLSFNRLNGSIPPELGMLSKLEVLNLSSNAISGTIPESLANNMISLLSLNL  846

Query  2674  SCNELEGELDK--RYAHWPVDSFVGNSHLCGSPL-----GSCRDKGSR---NKGSMVVVI  2823
             S N L G +     +      SF  N  LC   L     GS    GSR    K   +V+I
Sbjct  847   SSNNLSGPVPSGPVFDRMTQSSFSNNRDLCSESLSSSDPGSTTSSGSRPPHRKKHRIVLI  906

Query  2824  SALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGNAAKKRD  3003
             ++L  ++  ++ L  A +        Y+R RG+   A+S+      +  P+       R 
Sbjct  907   ASLVCSLVALVTLGSAIYILVF----YKRDRGRIRLAASTKFYKDHRLFPML-----SRQ  957

Query  3004  IRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKR--IPRKDDLFLDKSFARE  3177
             + + D+M+AT++LSD  IIGSGG  TVYKA L +GE +A+K+  +    D   DKSF RE
Sbjct  958   LTFSDLMQATDSLSDLNIIGSGGFGTVYKAILPSGEVLAVKKVDVAGDGDPTQDKSFLRE  1017

Query  3178  IKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKKS-LDWE  3354
             + TL +IRHRHLVRL+G+CS+K  G N+L+Y+YM NGS++D LH      K+    LDWE
Sbjct  1018  VSTLGKIRHRHLVRLVGFCSHK--GVNLLVYDYMPNGSLFDRLHGSACTEKNNAGVLDWE  1075

Query  3355  ARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSL  3534
             +R +IA+G+A+G+ YLHHDC P+I+HRDIKS+NVLLDS  E HLGDFGLAK + D+  S 
Sbjct  1076  SRHRIAVGIAEGIAYLHHDCAPRIVHRDIKSNNVLLDSRDEPHLGDFGLAK-IIDSSSSS  1134

Query  3535  NTESNTWFAGSYGYIAPE  3588
             +T S   FAGSYGYIAPE
Sbjct  1135  HTLS--VFAGSYGYIAPE  1150


 Score =   144 bits (362),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 119/344 (35%), Positives = 176/344 (51%), Gaps = 16/344 (5%)
 Frame = +1

Query  1864  LTRINLSHNNFSGSIAPICTSH--SFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRF  2037
             +T INL+  + +GSI+    +H       D++NN+F   +PS L    SL  LRL  N  
Sbjct  69    VTAINLTSTSLTGSISSSAIAHLDKLELLDLSNNSFSGPMPSQL--PASLRSLRLNENSL  126

Query  2038  TGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlp  2217
             TG +P ++     L+ L +  N LSG IP ++     L  L   +NL SGPIP  +  L 
Sbjct  127   TGPLPASIANATLLTELLVYSNLLSGSIPSEIGRLSTLQVLRAGDNLFSGPIPDSIAGLH  186

Query  2218  llgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQL  2397
              L  L L++ + SG +P  +     L  L L  N+L+G +PPE+   + L VL L +N+L
Sbjct  187   SLQILGLANCELSGGIPRGIGQLVALESLMLHYNNLSGGIPPEVTQCRQLTVLGLSENRL  246

Query  2398  CGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTL  2577
              G IP  I  L  L  L +  N  SG +P EVGQ + L   L+   N+LTG++P S+  L
Sbjct  247   TGPIPRGISDLAALQTLSIFNNSLSGSVPEEVGQCRQL-VYLNLQGNDLTGQLPDSLAKL  305

Query  2578  SKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPV--DSFVGNSH  2751
             + LE+LDLS N ++G IP  +  ++SL  L LS N+L GE+             F+G++ 
Sbjct  306   AALETLDLSENSISGPIPDWIGSLASLENLALSMNQLSGEIPSSIGGLARLEQLFLGSNR  365

Query  2752  LCGS---PLGSCRD------KGSRNKGSMVVVISALSATVAIIL  2856
             L G     +G CR         +R  G++   I  LS    ++L
Sbjct  366   LSGEIPGEIGECRSLQRLDLSSNRLTGTIPASIGRLSMLTDLVL  409



>ref|XP_010656224.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1, partial [Vitis vinifera]
Length=683

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/569 (67%), Positives = 443/569 (78%), Gaps = 12/569 (2%)
 Frame = +1

Query  1900  GSIAPICTSHSFL-SFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRE  2076
             GSIA +C+SHSFL SFDVTNNAFD +IP  LG SPSL RLRLG N FTG I  TLG I +
Sbjct  2     GSIAALCSSHSFLLSFDVTNNAFDGQIPRELGFSPSLQRLRLGINHFTGAILRTLGEIYQ  61

Query  2077  LSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFS  2256
             LSL+D SGN L+G +P +LSLC+KLTH+DLNNN LSGPIP WLG LP LGELKLS   FS
Sbjct  62    LSLVDFSGNSLTGSVPAELSLCKKLTHIDLNNNFLSGPIPSWLGSLPNLGELKLSFTLFS  121

Query  2257  GSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGK  2436
             G LP ELF CS LLVLSL+NN LNGTLP E GNL SLNVLNL+ NQ  G IP  IG L K
Sbjct  122   GPLPHELFKCSNLLVLSLDNNLLNGTLPLETGNLASLNVLNLNQNQFYGPIPPAIGNLSK  181

Query  2437  LYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDL  2616
             LYELRLSRN F+GEIP E+ +L++L+SVLD SYNNLTGEIPPSIGTLSKLE+LDLSHN L
Sbjct  182   LYELRLSRNSFNGEIPIELRELQNLRSVLDLSYNNLTGEIPPSIGTLSKLEALDLSHNQL  241

Query  2617  TGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSR  2796
              GEI  QV  MSSLG+LN S N LEG+LDK + HWP ++F+GN  LCG PLG C  + S 
Sbjct  242   -GEILFQVGAMSSLGKLNFSYNNLEGKLDKEFLHWPAETFMGNLRLCGGPLGRCNSEESS  300

Query  2797  N-----KGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQA  2961
             +     K S VV+ISA S   AI+LL++G A F K  RE+       E     SSSSS  
Sbjct  301   HHNSGLKLSSVVIISAFSTIAAIVLLMIGVALFLKGKRESL-----NEVKCVYSSSSSIV  355

Query  2962  QRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRK  3141
              R+PL  NAA KRD +W DIM+ATNNLSD FIIGSGG  T+YKAEL + ETVA+K+I RK
Sbjct  356   HRRPLLPNAAGKRDFKWGDIMQATNNLSDNFIIGSGGSGTIYKAELSSEETVAVKKILRK  415

Query  3142  DDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPA  3321
             DDL L+KSF REI+TL R+RHRHL +L+G C NK  G N+L+YEYMENGS+WDWLH +  
Sbjct  416   DDLLLNKSFEREIRTLERVRHRHLAKLLGCCVNKEAGFNLLVYEYMENGSLWDWLHPESV  475

Query  3322  NNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGL  3501
             ++K +KSLDWEARL++A GLA+GVEYLHHDCV +IIHRDIKSSNVLLDSNMEAHLGDF L
Sbjct  476   SSKKRKSLDWEARLRVAAGLAKGVEYLHHDCVLRIIHRDIKSSNVLLDSNMEAHLGDFEL  535

Query  3502  AKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             AK L +N++S NT+SN+WFAGSYGYIAPE
Sbjct  536   AKTLVENHNSFNTDSNSWFAGSYGYIAPE  564


 Score =   139 bits (350),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 102/269 (38%), Positives = 142/269 (53%), Gaps = 3/269 (1%)
 Frame = +1

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             GSI         L   ++ NN   G+IP +LG   SL  L L  N   G+I ++L ++  
Sbjct  2     GSIAALCSSHSFLLSFDVTNNAFDGQIPRELGFSPSLQRLRLGINHFTGAILRTLGEIYQ  61

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             L  +D SGN L G +P E     +L  + L +N LSG IP  L S   NL  L LS T  
Sbjct  62    LSLVDFSGNSLTGSVPAELSLCKKLTHIDLNNNFLSGPIPSWLGS-LPNLGELKLSFTLF  120

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
             SG +P EL +C  L  L L NN LNG++P E   L  L  L LN N   G I P++ NL+
Sbjct  121   SGPLPHELFKCSNLLVLSLDNNLLNGTLPLETGNLASLNVLNLNQNQFYGPIPPAIGNLS  180

Query  1429  NLQTLSLFHNNLHGEVPREIGMLGDLQ-IIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQ  1605
              L  L L  N+ +GE+P E+  L +L+ ++ L  N+ +GEIP  IG  S L+ +D   NQ
Sbjct  181   KLYELRLSRNSFNGEIPIELRELQNLRSVLDLSYNNLTGEIPPSIGTLSKLEALDLSHNQ  240

Query  1606  FTGKIPITLGRLKHLFFLHLRENDLSGEI  1692
               G+I   +G +  L  L+   N+L G++
Sbjct  241   L-GEILFQVGAMSSLGKLNFSYNNLEGKL  268


 Score =   130 bits (326),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 99/293 (34%), Positives = 144/293 (49%), Gaps = 27/293 (9%)
 Frame = +1

Query  1033  GSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNAT  1212
             GSI    +  + L S D++ N   G++P E G    LQ L L  N+ +G I ++L     
Sbjct  2     GSIAALCSSHSFLLSFDVTNNAFDGQIPRELGFSPSLQRLRLGINHFTGAILRTL-----  56

Query  1213  NLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTL  1392
                          GEI         L  +D S N+L GS+P EL    +LT + LNNN L
Sbjct  57    -------------GEI-------YQLSLVDFSGNSLTGSVPAELSLCKKLTHIDLNNNFL  96

Query  1393  EGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCS  1572
              G I   + +L NL  L L      G +P E+    +L ++ L  N  +G +P+E GN +
Sbjct  97    SGPIPSWLGSLPNLGELKLSFTLFSGPLPHELFKCSNLLVLSLDNNLLNGTLPLETGNLA  156

Query  1573  SLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQL-DTLDLADNH  1749
             SL  ++   NQF G IP  +G L  L+ L L  N  +GEIP  L     L   LDL+ N+
Sbjct  157   SLNVLNLNQNQFYGPIPPAIGNLSKLYELRLSRNSFNGEIPIELRELQNLRSVLDLSYNN  216

Query  1750  LSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSI  1908
             L+G IP + G L  L  L L +N L G++   +  + +L ++N S+NN  G +
Sbjct  217   LTGEIPPSIGTLSKLEALDLSHNQL-GEILFQVGAMSSLGKLNFSYNNLEGKL  268


 Score =   114 bits (285),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 125/268 (47%), Gaps = 3/268 (1%)
 Frame = +1

Query  1252  GEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTN  1431
             G I    S    L   D++NN  +G IP EL     L  L L  N   G I  ++  +  
Sbjct  2     GSIAALCSSHSFLLSFDVTNNAFDGQIPRELGFSPSLQRLRLGINHFTGAILRTLGEIYQ  61

Query  1432  LQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFT  1611
             L  +    N+L G VP E+ +   L  I L  N  SG IP  +G+  +L  +      F+
Sbjct  62    LSLVDFSGNSLTGSVPAELSLCKKLTHIDLNNNFLSGPIPSWLGSLPNLGELKLSFTLFS  121

Query  1612  GKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRA  1791
             G +P  L +  +L  L L  N L+G +P   GN   L+ L+L  N   G IP   G L  
Sbjct  122   GPLPHELFKCSNLLVLSLDNNLLNGTLPLETGNLASLNVLNLNQNQFYGPIPPAIGNLSK  181

Query  1792  LTRLMLYNNSLEGDLPDDLRNLGNLTRI-NLSHNNFSGSIAP-ICTSHSFLSFDVTNNAF  1965
             L  L L  NS  G++P +LR L NL  + +LS+NN +G I P I T     + D+++N  
Sbjct  182   LYELRLSRNSFNGEIPIELRELQNLRSVLDLSYNNLTGEIPPSIGTLSKLEALDLSHNQL  241

Query  1966  DQEIPSFLGNSPSLDRLRLGSNRFTGKI  2049
               EI   +G   SL +L    N   GK+
Sbjct  242   G-EILFQVGAMSSLGKLNFSYNNLEGKL  268


 Score =   105 bits (262),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 134/278 (48%), Gaps = 10/278 (4%)
 Frame = +1

Query  1192  SLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDL  1371
             +LCS+ + L    ++     G+IP EL     LQ+L L  N   G+I   L E+ QL+ +
Sbjct  6     ALCSSHSFLLSFDVTNNAFDGQIPRELGFSPSLQRLRLGINHFTGAILRTLGEIYQLSLV  65

Query  1372  VLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIP  1551
               + N+L G++   ++    L  + L +N L G +P  +G L +L  + L    FSG +P
Sbjct  66    DFSGNSLTGSVPAELSLCKKLTHIDLNNNFLSGPIPSWLGSLPNLGELKLSFTLFSGPLP  125

Query  1552  VEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTL  1731
              E+  CS+L  +    N   G +P+  G L  L  L+L +N   G IP ++GN  +L  L
Sbjct  126   HELFKCSNLLVLSLDNNLLNGTLPLETGNLASLNVLNLNQNQFYGPIPPAIGNLSKLYEL  185

Query  1732  DLADNHLSGAIPATFGYLRALTRLM-LYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSI  1908
              L+ N  +G IP     L+ L  ++ L  N+L G++P  +  L  L  ++LSHN     +
Sbjct  186   RLSRNSFNGEIPIELRELQNLRSVLDLSYNNLTGEIPPSIGTLSKLEALDLSHNQLGEIL  245

Query  1909  APICTSHSF----LSFDVTNNAFDQEI-----PSFLGN  1995
               +    S      S++      D+E       +F+GN
Sbjct  246   FQVGAMSSLGKLNFSYNNLEGKLDKEFLHWPAETFMGN  283


 Score =   105 bits (261),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 86/268 (32%), Positives = 132/268 (49%), Gaps = 25/268 (9%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP +LG   +LQ LR+G N  TG I  + G +  L  +  +   L+G +P +L    +
Sbjct  26    GQIPRELGFSPSLQRLRLGINHFTGAILRTLGEIYQLSLVDFSGNSLTGSVPAELSLCKK  85

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L +++L  N L GP+P  + ++ +L     +    +G +P EL    +L +L+L NN L 
Sbjct  86    LTHIDLNNNFLSGPIPSWLGSLPNLGELKLSFTLFSGPLPHELFKCSNLLVLSLDNNLLN  145

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G +P + G ++SL  LNL  NQ  G IP ++  L+ L  L LS N   GE+P E   +  
Sbjct  146   GTLPLETGNLASLNVLNLNQNQFYGPIPPAIGNLSKLYELRLSRNSFNGEIPIELRELQN  205

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L+                         +L LS   L+GEIPP +     L+ LDLS+N L
Sbjct  206   LR------------------------SVLDLSYNNLTGEIPPSIGTLSKLEALDLSHNQL  241

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTI  1404
              G I  ++  ++ L  L  + N LEG +
Sbjct  242   -GEILFQVGAMSSLGKLNFSYNNLEGKL  268



>ref|XP_002966360.1| hypothetical protein SELMODRAFT_60230, partial [Selaginella moellendorffii]
 gb|EFJ32387.1| hypothetical protein SELMODRAFT_60230, partial [Selaginella moellendorffii]
Length=1238

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/1038 (46%), Positives = 636/1038 (61%), Gaps = 33/1038 (3%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             GP+P +++N + L  LL++SN L G IPS++G L+ L+ LR GDN  +G IP S   L +
Sbjct  112   GPLPASIANATLLTELLVYSNLLSGSIPSEIGRLSKLRVLRAGDNLFSGPIPDSIAGLHS  171

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L  LGLA+C LSG IP  +G+L  L++L L  N L G +PPE+     LT    + N L 
Sbjct  172   LQILGLANCELSGGIPRGIGQLAALESLMLHYNNLSGGIPPEVTQCRQLTVLGLSENRLT  231

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             G IP+ +  L  L  L++ NN+L+G +P ++G+   L+YLNL GN L G +P SLAKL  
Sbjct  232   GPIPRGISDLAALQTLSIFNNSLSGSVPEEVGQCRQLLYLNLQGNDLTGQLPDSLAKLAA  291

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             L++LDLS N ++G +P   GS+  L+ LAL+ N LSG IP S+   A  L+ L L    L
Sbjct  292   LETLDLSENSISGPIPDWIGSLASLENLALSMNQLSGEIPSSIGGLA-RLEQLFLGSNRL  350

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
             SGEIP E+ +CR LQ+LDLS+N L G+IP  +  L+ LTDLVL +N+L G+I   + +  
Sbjct  351   SGEIPGEIGECRSLQRLDLSSNRLTGTIPASIGRLSMLTDLVLQSNSLTGSIPEEIGSCK  410

Query  1429  NLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQF  1608
             NL  L+L+ N L+G +P  IG L  L  ++LY N  SG IP  IG+CS L  +D   N  
Sbjct  411   NLAVLALYENQLNGSIPASIGSLEQLDELYLYRNKLSGNIPASIGSCSKLTLLDLSENLL  470

Query  1609  TGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLR  1788
              G IP ++G L  L FLHLR N LSG IPA +  C ++  LDLA+N LSGAIP       
Sbjct  471   DGAIPSSIGGLGALTFLHLRRNRLSGSIPAPMARCAKMRKLDLAENSLSGAIPQDLTSAM  530

Query  1789  A-LTRLMLYNNSLEGDLPDDLRNL-GNLTRINLSHNNFSGSIAPICTSHSFLS-FDVTNN  1959
             A L  L+LY N+L G +P+ + +   NLT INLS N   G I P+  S   L   D+T+N
Sbjct  531   ADLEMLLLYQNNLTGAVPESIASCCHNLTTINLSDNLLGGKIPPLLGSSGALQVLDLTDN  590

Query  1960  AFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSL  2139
                  IP  LG S +L RLRLG N+  G IP  LG I  LS +DLS N+L+G IP  L+ 
Sbjct  591   GIGGNIPPSLGISSTLWRLRLGGNKIEGLIPAELGNITALSFVDLSFNRLAGAIPSILAS  650

Query  2140  CRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFN-Cskllvlslen  2316
             C+ LTH+ LN N L G IP  +G L  LGEL LS N+  G +P  + + C K+  L L  
Sbjct  651   CKNLTHIKLNGNRLQGRIPEEIGGLKQLGELDLSQNELIGEIPGSIISGCPKISTLKLAE  710

Query  2317  nslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVG  2496
             N L+G +P  +G L+SL  L L  N L G IP++IG  G L E+ LS N   G IPRE+G
Sbjct  711   NRLSGRIPAALGILQSLQFLELQGNDLEGQIPASIGNCGLLLEVNLSHNSLQGGIPRELG  770

Query  2497  QLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVA-EMSSLGRLNL  2673
             +L++LQ+ LD S+N L G IPP +G LSKLE L+LS N ++G IP  +A  M SL  LNL
Sbjct  771   KLQNLQTSLDLSFNRLNGSIPPELGMLSKLEVLNLSSNAISGMIPESLANNMISLLSLNL  830

Query  2674  SCNELEGELDK--RYAHWPVDSFVGNSHLCGSPL-----GSCRDKGSR---NKGSMVVVI  2823
             S N L G +     +      SF  N  LC   L     GS    GSR    K   +V+I
Sbjct  831   SSNNLSGPVPSGPVFDRMTQSSFSNNRDLCSESLSSSDPGSTTSSGSRPPHRKKHRIVLI  890

Query  2824  SALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGNAAKKRD  3003
             ++L  ++  ++ L  A +        Y+R RG+   A+S+      +  P+       R 
Sbjct  891   ASLVCSLVALVTLGSAIYILVF----YKRDRGRIRLAASTKFYKDHRLFPML-----SRQ  941

Query  3004  IRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKR--IPRKDDLFLDKSFARE  3177
             + + D+M+AT++LSD  IIGSGG  TVYKA L +GE +A+K+  +    D   DKSF RE
Sbjct  942   LTFSDLMQATDSLSDLNIIGSGGFGTVYKAILPSGEVLAVKKVDVAGDGDPTQDKSFLRE  1001

Query  3178  IKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKKS-LDWE  3354
             + TL +IRHRHLVRL+G+CS+K  G N+L+Y+YM NGS++D LH      K+    LDWE
Sbjct  1002  VSTLGKIRHRHLVRLVGFCSHK--GVNLLVYDYMPNGSLFDRLHGSACTEKNNAGVLDWE  1059

Query  3355  ARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSL  3534
             +R +IA+G+A+G+ YLHHDC P+I+HRDIKS+NVLLDS  E HLGDFGLAK + D+  S 
Sbjct  1060  SRHRIAVGIAEGIAYLHHDCAPRIVHRDIKSNNVLLDSRDEPHLGDFGLAK-IIDSSSSS  1118

Query  3535  NTESNTWFAGSYGYIAPE  3588
             +T S   FAGSYGYIAPE
Sbjct  1119  HTLS--VFAGSYGYIAPE  1134


 Score =   145 bits (366),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 120/344 (35%), Positives = 178/344 (52%), Gaps = 16/344 (5%)
 Frame = +1

Query  1864  LTRINLSHNNFSGSIAPICTSH--SFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRF  2037
             +T INL+  + +GSI+    +H       D++NN+F   +PS L    SL  LRL  N  
Sbjct  53    VTAINLTSTSLTGSISSSAIAHLDKLELLDLSNNSFSGPMPSQL--PASLRSLRLNENSL  110

Query  2038  TGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlp  2217
             TG +P ++     L+ L +  N LSG IP ++    KL  L   +NL SGPIP  +  L 
Sbjct  111   TGPLPASIANATLLTELLVYSNLLSGSIPSEIGRLSKLRVLRAGDNLFSGPIPDSIAGLH  170

Query  2218  llgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQL  2397
              L  L L++ + SG +P  +   + L  L L  N+L+G +PPE+   + L VL L +N+L
Sbjct  171   SLQILGLANCELSGGIPRGIGQLAALESLMLHYNNLSGGIPPEVTQCRQLTVLGLSENRL  230

Query  2398  CGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTL  2577
              G IP  I  L  L  L +  N  SG +P EVGQ + L   L+   N+LTG++P S+  L
Sbjct  231   TGPIPRGISDLAALQTLSIFNNSLSGSVPEEVGQCRQLL-YLNLQGNDLTGQLPDSLAKL  289

Query  2578  SKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPV--DSFVGNSH  2751
             + LE+LDLS N ++G IP  +  ++SL  L LS N+L GE+             F+G++ 
Sbjct  290   AALETLDLSENSISGPIPDWIGSLASLENLALSMNQLSGEIPSSIGGLARLEQLFLGSNR  349

Query  2752  LCGS---PLGSCRD------KGSRNKGSMVVVISALSATVAIIL  2856
             L G     +G CR         +R  G++   I  LS    ++L
Sbjct  350   LSGEIPGEIGECRSLQRLDLSSNRLTGTIPASIGRLSMLTDLVL  393



>emb|CDY50061.1| BnaCnng18680D [Brassica napus]
Length=904

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/736 (56%), Positives = 513/736 (70%), Gaps = 37/736 (5%)
 Frame = +1

Query  1390  LEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNC  1569
             L G+ISPS   L NLQ L+L    L G VP ++G L  +Q + L +N+  G IP E+ NC
Sbjct  87    LTGSISPSFGRLANLQMLALASCRLTGPVPSQLGQLARVQSLILQDNNLEGPIPAELANC  146

Query  1570  SSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNH  1749
             S L       N+  G IP  LGRL++L  L+L  N LSGEIP+ LG   QL+ L+L +N 
Sbjct  147   SDLTVFTAAANRLNGTIPAELGRLENLEILNLASNGLSGEIPSQLGEMSQLEYLNLMENK  206

Query  1750  LSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSH  1929
             L G +P +   L+ L  L L  N+L G++P+++ N+  L  + L++N FSGS+       
Sbjct  207   LQGLVPKSLTNLKNLQTLDLSANNLTGEIPEEIWNMSQLLDLALANNGFSGSL-------  259

Query  1930  SFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKL  2109
                             P  + N   L  L L  N+ +G IP + G ++ L    L  N L
Sbjct  260   ----------------PKSMCNCHQLKILDLADNQLSGSIPSSYGSLKGLEQFMLYNNSL  303

Query  2110  SGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCs  2289
              G +P  LS  + +T ++L++N L+GPIP WLG+L  LGELKLSSNQF GSLP ELFNC+
Sbjct  304   QGSLPDSLSNLKNITRINLSHNHLNGPIPPWLGKLSQLGELKLSSNQFDGSLPAELFNCT  363

Query  2290  kllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRF  2469
             KLLVLSL+ N LNGT+P EIGNL +LNVLNLD NQ  GS+P  IG L KLYELR+SRN  
Sbjct  364   KLLVLSLDGNFLNGTIPQEIGNLGALNVLNLDKNQFSGSLPQGIGKLSKLYELRVSRNSL  423

Query  2470  SGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEM  2649
              GEIP E+GQL+DLQS LD SYNN TG++P +IGTL+KLE+LDLSHN LTGE+P  V +M
Sbjct  424   VGEIPLEIGQLQDLQSALDLSYNNFTGDVPSTIGTLTKLETLDLSHNQLTGEVPGAVGDM  483

Query  2650  SSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKGSMVVVISA  2829
              SLG LNLS N  +G+L K+++ WP DSF+GN+          + +G   +   VV ISA
Sbjct  484   KSLGYLNLSFNNFKGKLKKQFSRWPADSFIGNT--------DNKQQGLSPRS--VVTISA  533

Query  2830  LSATVAIILLLMGAAFFFKHNREAYRR-RRGKENYAsssssssQAQRKPLFGN-AAKKRD  3003
             +SA  AI L+++  A FFK   + +++ R G   Y+SSSSSSSQA  KPLF   A+ K D
Sbjct  534   ISALAAIALMILVIALFFKQRHDFFKKVRDGSTAYSSSSSSSSQATHKPLFRTGASSKSD  593

Query  3004  IRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPRKDDLFLDKSFAREIK  3183
             I+WDDIM+AT NLS+EF+IGSGG   +YKAEL NGETVA+K+I  KDDL  +KSF+RE+K
Sbjct  594   IKWDDIMDATRNLSEEFMIGSGGSGKIYKAELENGETVAVKKILWKDDLMSNKSFSREVK  653

Query  3184  TLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHN-QPANNKSKKSLDWEAR  3360
             TL RI+HRHLV+LMGYCS+K EG N+LIYEYMENGSVWDW H+ +P   K KK LDWEAR
Sbjct  654   TLGRIKHRHLVKLMGYCSSKSEGLNLLIYEYMENGSVWDWFHDEKPEVEKKKKVLDWEAR  713

Query  3361  LKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSLNT  3540
             L+IA+GLAQGVEYLHHDCVP I+HRDIKSSNVLLDSNMEAHLGDFGLAK LT+NYD+ NT
Sbjct  714   LRIAVGLAQGVEYLHHDCVPPILHRDIKSSNVLLDSNMEAHLGDFGLAKVLTENYDT-NT  772

Query  3541  ESNTWFAGSYGYIAPE  3588
             ESNTWFAGSYGYIAPE
Sbjct  773   ESNTWFAGSYGYIAPE  788


 Score =   318 bits (816),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 198/423 (47%), Positives = 268/423 (63%), Gaps = 2/423 (0%)
 Frame = +1

Query  643   ALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGP  822
             AL +   GLTG I  SFG L NL  L LASC L+G +P QLG+L ++Q+L LQ N LEGP
Sbjct  79    ALNLSGLGLTGSISPSFGRLANLQMLALASCRLTGPVPSQLGQLARVQSLILQDNNLEGP  138

Query  823   LPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLV  1002
             +P E+AN S LT F+AA N LNG+IP ELG L++L ILNLA+N L+GEIP QLGEMS L 
Sbjct  139   IPAELANCSDLTVFTAAANRLNGTIPAELGRLENLEILNLASNGLSGEIPSQLGEMSQLE  198

Query  1003  YLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGT  1182
             YLNL+ N+L G +PKSL  L NLQ+LDLS N L GE+P E  +M QL  LAL +N  SG+
Sbjct  199   YLNLMENKLQGLVPKSLTNLKNLQTLDLSANNLTGEIPEEIWNMSQLLDLALANNGFSGS  258

Query  1183  IPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQL  1362
             +PKS+C N   L++L L++  LSG IP      + L+Q  L NN+L GS+P+ L  L  +
Sbjct  259   LPKSMC-NCHQLKILDLADNQLSGSIPSSYGSLKGLEQFMLYNNSLQGSLPDSLSNLKNI  317

Query  1363  TDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSG  1542
             T + L++N L G I P +  L+ L  L L  N   G +P E+     L ++ L  N  +G
Sbjct  318   TRINLSHNHLNGPIPPWLGKLSQLGELKLSSNQFDGSLPAELFNCTKLLVLSLDGNFLNG  377

Query  1543  EIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQL  1722
              IP EIGN  +L  ++   NQF+G +P  +G+L  L+ L +  N L GEIP  +G    L
Sbjct  378   TIPQEIGNLGALNVLNLDKNQFSGSLPQGIGKLSKLYELRVSRNSLVGEIPLEIGQLQDL  437

Query  1723  DT-LDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFS  1899
              + LDL+ N+ +G +P+T G L  L  L L +N L G++P  + ++ +L  +NLS NNF 
Sbjct  438   QSALDLSYNNFTGDVPSTIGTLTKLETLDLSHNQLTGEVPGAVGDMKSLGYLNLSFNNFK  497

Query  1900  GSI  1908
             G +
Sbjct  498   GKL  500


 Score =   258 bits (660),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 171/452 (38%), Positives = 238/452 (53%), Gaps = 27/452 (6%)
 Frame = +1

Query  1150  LALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGS  1329
             L L+   L+G+I  S    A NLQ+L L+   L+G +P +L Q   +Q L L +N L G 
Sbjct  80    LNLSGLGLTGSISPSFGRLA-NLQMLALASCRLTGPVPSQLGQLARVQSLILQDNNLEGP  138

Query  1330  IPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQ  1509
             IP EL   + LT      N L GTI   +  L NL+ L+L  N L GE+P ++G +  L+
Sbjct  139   IPAELANCSDLTVFTAAANRLNGTIPAELGRLENLEILNLASNGLSGEIPSQLGEMSQLE  198

Query  1510  IIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGE  1689
              + L EN   G +P  + N  +LQ +D   N  TG+IP  +  +  L  L L  N  SG 
Sbjct  199   YLNLMENKLQGLVPKSLTNLKNLQTLDLSANNLTGEIPEEIWNMSQLLDLALANNGFSGS  258

Query  1690  IPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLT  1869
             +P S+ NCHQL  LDLADN LSG+IP+++G L+ L + MLYNNSL+G LPD L NL N+T
Sbjct  259   LPKSMCNCHQLKILDLADNQLSGSIPSSYGSLKGLEQFMLYNNSLQGSLPDSLSNLKNIT  318

Query  1870  RINLSHNNFSGSIAPICTSHSFL-SFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
             RINLSHN+ +G I P     S L    +++N FD  +P+ L N   L  L L  N   G 
Sbjct  319   RINLSHNHLNGPIPPWLGKLSQLGELKLSSNQFDGSLPAELFNCTKLLVLSLDGNFLNGT  378

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWl-grlpll  2223
             IP  +G +  L++L+L  N+ SG +P  +    KL  L ++ N L G IP+ +     L 
Sbjct  379   IPQEIGNLGALNVLNLDKNQFSGSLPQGIGKLSKLYELRVSRNSLVGEIPLEIGQLQDLQ  438

Query  2224  gelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCG  2403
               L LS N F+G                         +P  IG L  L  L+L  NQL G
Sbjct  439   SALDLSYNNFTGD------------------------VPSTIGTLTKLETLDLSHNQLTG  474

Query  2404  SIPSTIGGLGKLYELRLSRNRFSGEIPREVGQ  2499
              +P  +G +  L  L LS N F G++ ++  +
Sbjct  475   EVPGAVGDMKSLGYLNLSFNNFKGKLKKQFSR  506


 Score =   256 bits (653),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 193/500 (39%), Positives = 273/500 (55%), Gaps = 30/500 (6%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslgg  459
             ++ L+ LLE K+SFV        L  W+  N NYCSW GV+C+ +     + L+ S LG 
Sbjct  28    TNDLQNLLEAKKSFVTNPGEDDPLPQWNSVNINYCSWTGVTCEDTGLFRVVALNLSGLGL  87

Query  460   sispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNL  639
             +                      G I P+   L++L+ L L S RL GP+PSQLG L  +
Sbjct  88    T----------------------GSISPSFGRLANLQMLALASCRLTGPVPSQLGQLARV  125

Query  640   QALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEG  819
             Q+L + DN L G IP    N  +L     A+  L+G IP +LGRL  L+ LNL  N L G
Sbjct  126   QSLILQDNNLEGPIPAELANCSDLTVFTAAANRLNGTIPAELGRLENLEILNLASNGLSG  185

Query  820   PLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSL  999
              +P ++  +S L   +   N L G +PK L  LK+L  L+L+ N LTGEIP ++  MS L
Sbjct  186   EIPSQLGEMSQLEYLNLMENKLQGLVPKSLTNLKNLQTLDLSANNLTGEIPEEIWNMSQL  245

Query  1000  VYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSG  1179
             + L L  N   GS+PKS+     L+ LDL+ N+L+G +P  +GS+  L+   L +N+L G
Sbjct  246   LDLALANNGFSGSLPKSMCNCHQLKILDLADNQLSGSIPSSYGSLKGLEQFMLYNNSLQG  305

Query  1180  TIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQ  1359
             ++P SL SN  N+  + LS   L+G IPP L +   L +L LS+N  +GS+P EL+  T+
Sbjct  306   SLPDSL-SNLKNITRINLSHNHLNGPIPPWLGKLSQLGELKLSSNQFDGSLPAELFNCTK  364

Query  1360  LTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFS  1539
             L  L L+ N L GTI   + NL  L  L+L  N   G +P+ IG L  L  + +  N   
Sbjct  365   LLVLSLDGNFLNGTIPQEIGNLGALNVLNLDKNQFSGSLPQGIGKLSKLYELRVSRNSLV  424

Query  1540  GEIPVEIGNCSSLQ-FIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
             GEIP+EIG    LQ  +D   N FTG +P T+G L  L  L L  N L+GE+P ++G+  
Sbjct  425   GEIPLEIGQLQDLQSALDLSYNNFTGDVPSTIGTLTKLETLDLSHNQLTGEVPGAVGDMK  484

Query  1717  QLDTLDLADNHLSGAIPATF  1776
              L  L+L+ N+  G +   F
Sbjct  485   SLGYLNLSFNNFKGKLKKQF  504


 Score =   221 bits (563),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 152/429 (35%), Positives = 219/429 (51%), Gaps = 3/429 (1%)
 Frame = +1

Query  913   GLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSG  1092
             GL  +  LNL+   LTG I    G +++L  L L   +L G +P  L +L  +QSL L  
Sbjct  73    GLFRVVALNLSGLGLTGSISPSFGRLANLQMLALASCRLTGPVPSQLGQLARVQSLILQD  132

Query  1093  NRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPEL  1272
             N L G +P E  +   L      +N L+GTIP  L     NL++L L+  GLSGEIP +L
Sbjct  133   NNLEGPIPAELANCSDLTVFTAAANRLNGTIPAEL-GRLENLEILNLASNGLSGEIPSQL  191

Query  1273  SQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLF  1452
              +   L+ L+L  N L G +P+ L  L  L  L L+ N L G I   + N++ L  L+L 
Sbjct  192   GEMSQLEYLNLMENKLQGLVPKSLTNLKNLQTLDLSANNLTGEIPEEIWNMSQLLDLALA  251

Query  1453  HNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITL  1632
             +N   G +P+ +     L+I+ L +N  SG IP   G+   L+    Y N   G +P +L
Sbjct  252   NNGFSGSLPKSMCNCHQLKILDLADNQLSGSIPSSYGSLKGLEQFMLYNNSLQGSLPDSL  311

Query  1633  GRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLY  1812
               LK++  ++L  N L+G IP  LG   QL  L L+ N   G++PA       L  L L 
Sbjct  312   SNLKNITRINLSHNHLNGPIPPWLGKLSQLGELKLSSNQFDGSLPAELFNCTKLLVLSLD  371

Query  1813  NNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP-ICTSHSFLSFDVTNNAFDQEIPSFL  1989
              N L G +P ++ NLG L  +NL  N FSGS+   I          V+ N+   EIP  +
Sbjct  372   GNFLNGTIPQEIGNLGALNVLNLDKNQFSGSLPQGIGKLSKLYELRVSRNSLVGEIPLEI  431

Query  1990  GNSPSLDR-LRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDL  2166
             G    L   L L  N FTG +P T+G + +L  LDLS N+L+G +P  +   + L +L+L
Sbjct  432   GQLQDLQSALDLSYNNFTGDVPSTIGTLTKLETLDLSHNQLTGEVPGAVGDMKSLGYLNL  491

Query  2167  NNNLLSGPI  2193
             + N   G +
Sbjct  492   SFNNFKGKL  500


 Score =   205 bits (521),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 149/393 (38%), Positives = 214/393 (54%), Gaps = 2/393 (1%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             GPIP  L+N S L      +NRL G IP++LG L NL+ L +  NGL+G+IP+  G +  
Sbjct  137   GPIPAELANCSDLTVFTAAANRLNGTIPAELGRLENLEILNLASNGLSGEIPSQLGEMSQ  196

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L  L L    L GL+P  L  L  LQ L+L  N L G +P EI N+S L   + A N  +
Sbjct  197   LEYLNLMENKLQGLVPKSLTNLKNLQTLDLSANNLTGEIPEEIWNMSQLLDLALANNGFS  256

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             GS+PK +     L IL+LA+N L+G IP   G +  L    L  N L GS+P SL+ L N
Sbjct  257   GSLPKSMCNCHQLKILDLADNQLSGSIPSSYGSLKGLEQFMLYNNSLQGSLPDSLSNLKN  316

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             +  ++LS N L G +P   G + QL  L L+SN   G++P  L  N T L +L L    L
Sbjct  317   ITRINLSHNHLNGPIPPWLGKLSQLGELKLSSNQFDGSLPAELF-NCTKLLVLSLDGNFL  375

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
             +G IP E+     L  L+L  N  +GS+P+ + +L++L +L ++ N+L G I   +  L 
Sbjct  376   NGTIPQEIGNLGALNVLNLDKNQFSGSLPQGIGKLSKLYELRVSRNSLVGEIPLEIGQLQ  435

Query  1429  NLQT-LSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQ  1605
             +LQ+ L L +NN  G+VP  IG L  L+ + L  N  +GE+P  +G+  SL +++   N 
Sbjct  436   DLQSALDLSYNNFTGDVPSTIGTLTKLETLDLSHNQLTGEVPGAVGDMKSLGYLNLSFNN  495

Query  1606  FTGKIPITLGRLKHLFFLHLRENDLSGEIPASL  1704
             F GK+     R     F+   +N   G  P S+
Sbjct  496   FKGKLKKQFSRWPADSFIGNTDNKQQGLSPRSV  528



>ref|XP_006658581.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Oryza brachyantha]
Length=966

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/730 (55%), Positives = 517/730 (71%), Gaps = 6/730 (1%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDN-GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrl  774
              G +P  LG LT LQ LR+G+N  L+  IP + G L NL  L LASC L+G IP  LGRL
Sbjct  63    AGELPPSLGALTALQVLRLGNNPALSAPIPAALGKLANLTVLALASCNLTGAIPRSLGRL  122

Query  775   tqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNT  954
               L  LNLQ N L GP+PPE   ++ L   S A N L G IP ELG L  L  LNLANN+
Sbjct  123   AALTALNLQDNSLSGPIPPEFGAMAGLEVLSLADNQLTGVIPPELGKLAALQKLNLANNS  182

Query  955   LTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSM  1134
             L G +P +LG++  LVYLNL+ N+L G +P++LA L+ ++++DLSGN L+GELP E G +
Sbjct  183   LEGAVPPELGKLGELVYLNLMNNRLSGRVPRTLAALSRVRTIDLSGNMLSGELPAEVGQL  242

Query  1135  GQLQFLALTSNNLSGTIPKSLC-----SNATNLQLLMLSETGLSGEIPPELSQCRVLQQL  1299
              +L FL LT N+L+G IP  LC     + +T+L+ LMLS    SGEIP  LS+CR L QL
Sbjct  243   PELNFLVLTGNHLTGRIPGDLCGGGDRAESTSLEHLMLSTNNFSGEIPEGLSRCRALTQL  302

Query  1300  DLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVP  1479
             DL+NN+L+G IP  L EL  LTDL+LNNNTL G + P + NLT L+ L+L+HN L G +P
Sbjct  303   DLANNSLSGPIPAALGELGNLTDLLLNNNTLSGELPPELFNLTELKVLALYHNELTGRLP  362

Query  1480  REIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFL  1659
               IG LG L+++FLYEN FSGEIP  IG CSSLQ +DF+GN+F+G +P ++G+L  L FL
Sbjct  363   DAIGRLGSLEVLFLYENDFSGEIPETIGECSSLQMVDFFGNRFSGSLPASIGKLPELVFL  422

Query  1660  HLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLP  1839
             HLR+N+LSG IP  LGNC  L+ LDLADN LSG IPATFG LR+L + MLYNNSL G +P
Sbjct  423   HLRQNELSGSIPPELGNCVNLEILDLADNALSGEIPATFGKLRSLEQFMLYNNSLTGAVP  482

Query  1840  DDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLR  2019
             D +    N+ R N +HN  +G+  P+C S   LSFD TNN+F+  IP+ LG SPSL R+R
Sbjct  483   DGMFECRNIPRGNPAHNRLAGAPLPLCGSARLLSFDATNNSFEGGIPAQLGRSPSLQRVR  542

Query  2020  LGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPV  2199
             LGSN  +G IP TLG    L+++D S N L+G IP  LS C +L+H+ L+NN LSGP+P 
Sbjct  543   LGSNALSGAIPPTLGNAAALTMIDASNNALTGGIPDALSRCAQLSHIALSNNRLSGPVPA  602

Query  2200  WlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLN  2379
             W+G LP LGEL LS N+ +G +P +L NCSKL+ LSL+ N +NGT+PPEIG+L SLNVLN
Sbjct  603   WVGVLPELGELTLSGNELTGPVPVQLSNCSKLIKLSLDGNQINGTVPPEIGSLASLNVLN  662

Query  2380  LDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIP  2559
             L  NQL G IP+TI  L  LYEL LS+N  SG IP ++GQL++LQS+LD S N+L+G IP
Sbjct  663   LAHNQLSGEIPATIAKLINLYELNLSQNLLSGPIPPDIGQLQELQSLLDLSSNDLSGSIP  722

Query  2560  PSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFV  2739
              S+G+LSKLESL+LSHN L G +P Q+A MSSL  ++LS N+L+G L   ++ WP ++F 
Sbjct  723   ASLGSLSKLESLNLSHNALAGPVPSQLAGMSSLVHVDLSSNQLQGRLGNEFSRWPREAFA  782

Query  2740  GNSHLCGSPL  2769
             GN+ LCG PL
Sbjct  783   GNARLCGHPL  792


 Score =   314 bits (804),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 234/585 (40%), Positives = 309/585 (53%), Gaps = 11/585 (2%)
 Frame = +1

Query  964   EIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGN-RLAGELPGEFGSMGQ  1140
             E PG LG +  L  L L  NQL G +P SL  LT LQ L L  N  L+  +P   G +  
Sbjct  41    EDPGALGALERLTALMLHSNQLAGELPPSLGALTALQVLRLGNNPALSAPIPAALGKLAN  100

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L  LAL S NL+G IP+SL   A  L  L L +  LSG IPPE      L+ L L++N L
Sbjct  101   LTVLALASCNLTGAIPRSLGRLAA-LTALNLQDNSLSGPIPPEFGAMAGLEVLSLADNQL  159

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
              G IP EL +L  L  L L NN+LEG + P +  L  L  L+L +N L G VPR +  L 
Sbjct  160   TGVIPPELGKLAALQKLNLANNSLEGAVPPELGKLGELVYLNLMNNRLSGRVPRTLAALS  219

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITL------GRLKHLFFLH  1662
              ++ I L  N  SGE+P E+G    L F+   GN  TG+IP  L           L  L 
Sbjct  220   RVRTIDLSGNMLSGELPAEVGQLPELNFLVLTGNHLTGRIPGDLCGGGDRAESTSLEHLM  279

Query  1663  LRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPD  1842
             L  N+ SGEIP  L  C  L  LDLA+N LSG IPA  G L  LT L+L NN+L G+LP 
Sbjct  280   LSTNNFSGEIPEGLSRCRALTQLDLANNSLSGPIPAALGELGNLTDLLLNNNTLSGELPP  339

Query  1843  DLRNLGNLTRINLSHNNFSGSIA-PICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLR  2019
             +L NL  L  + L HN  +G +   I    S     +  N F  EIP  +G   SL  + 
Sbjct  340   ELFNLTELKVLALYHNELTGRLPDAIGRLGSLEVLFLYENDFSGEIPETIGECSSLQMVD  399

Query  2020  LGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPV  2199
                NRF+G +P ++G + EL  L L  N+LSG IPP+L  C  L  LDL +N LSG IP 
Sbjct  400   FFGNRFSGSLPASIGKLPELVFLHLRQNELSGSIPPELGNCVNLEILDLADNALSGEIPA  459

Query  2200  WlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLN  2379
               G+L  L +  L +N  +G++P  +F C  +   +  +N L G   P  G+ + L+  +
Sbjct  460   TFGKLRSLEQFMLYNNSLTGAVPDGMFECRNIPRGNPAHNRLAGAPLPLCGSARLLS-FD  518

Query  2380  LDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIP  2559
               +N   G IP+ +G    L  +RL  N  SG IP  +G    L +++D S N LTG IP
Sbjct  519   ATNNSFEGGIPAQLGRSPSLQRVRLGSNALSGAIPPTLGNAAAL-TMIDASNNALTGGIP  577

Query  2560  PSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEG  2694
              ++   ++L  + LS+N L+G +P  V  +  LG L LS NEL G
Sbjct  578   DALSRCAQLSHIALSNNRLSGPVPAWVGVLPELGELTLSGNELTG  622


 Score = 83.2 bits (204),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 47/61 (77%), Gaps = 1/61 (2%)
 Frame = +1

Query  3406  HDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAP  3585
             H    +++ RDIKSSNVLLD +MEAHLGDFGLAKA+ DN     T+S + FAGSYGY+AP
Sbjct  790   HPLTTRVVPRDIKSSNVLLDGDMEAHLGDFGLAKAVADNRKDC-TDSASCFAGSYGYMAP  848

Query  3586  E  3588
             E
Sbjct  849   E  849



>ref|XP_006476817.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like isoform X1 [Citrus sinensis]
Length=970

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/859 (51%), Positives = 561/859 (65%), Gaps = 10/859 (1%)
 Frame = +1

Query  316   LLEVKRSFVLQ---LQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdsslggsispslgl  483
             LL +K+  V     L+ WS +  + CSW GV+C D    VV LNLS S L GSIS     
Sbjct  30    LLRIKQELVDPTGILENWSAR-AHMCSWHGVTCSDDQKHVVGLNLSSSGLSGSISRDFLN  88

Query  484   lthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDN  663
             LT L  LDLSSN LSG IP  L  L +L  LLL+SN   G IP ++G L  LQ LRIGDN
Sbjct  89    LTSLETLDLSSNSLSGLIPAELGQLQNLRILLLYSNSFSGKIPPEIGFLNKLQVLRIGDN  148

Query  664   GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIAN  843
              L G+IP   GNL  L  L +A C L+G IP ++G L  L +L+LQ N L G +P  I  
Sbjct  149   LLWGEIPPHIGNLTELRELAIAYCQLNGSIPVEIGNLKHLTSLDLQMNKLSGLIPEAIHG  208

Query  844   ISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGN  1023
                L  F+A+ N L G+IP  +  LK L ILNLANN+L+G IP +L  + +L YLNLLGN
Sbjct  209   CEELQKFAASNNMLEGTIPSSIVLLKSLQILNLANNSLSGSIPVELSHLFNLRYLNLLGN  268

Query  1024  QLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCS  1203
                G IP  L KL  L+ LDLS N L+G +      +  L+ L L+ N  +G+IP   C 
Sbjct  269   IFDGEIPSELNKLAQLEELDLSKNNLSGSISLLNTQLKNLETLVLSDNAFTGSIPIKFCL  328

Query  1204  NATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNN  1383
             N ++LQ L+L+   LSGE P EL +C  LQQLDLS+N+  G +P  L +L +LTDL+LNN
Sbjct  329   NNSSLQQLILARNKLSGEFPLELLRCSSLQQLDLSDNSFKGELPRSLDKLEELTDLLLNN  388

Query  1384  NTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIG  1563
             N+  G+  P + NL+ L+ L LF N + G++P EIG L  L+ I+LY+N  SG IP E+ 
Sbjct  389   NSFTGSFPPEIGNLSKLENLFLFDNMITGKIPVEIGKLQSLRAIYLYDNQMSGSIPRELT  448

Query  1564  NCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLAD  1743
             NCS L  IDF+GN F+G IP T+G+LK+L  L LR+NDLSG IPASLG C +L  + LAD
Sbjct  449   NCSGLTEIDFFGNHFSGSIPETMGKLKNLVILQLRQNDLSGPIPASLGYCKRLQQIALAD  508

Query  1744  NHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICT  1923
             N LSG++P TF +L  L  + LYNNS +G LP  L  L  L  IN SHN FSGSI P+  
Sbjct  509   NKLSGSVPLTFRFLSELYLITLYNNSFKGPLPPSLFQLKKLRIINFSHNKFSGSIYPLTG  568

Query  1924  SHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGN  2103
             S+S  + D+TNN+F   IPS L  S +L RLRL  N  TG IP   G + EL+ LDLS N
Sbjct  569   SNSLTALDLTNNSFSGPIPSELAMSRNLSRLRLAHNHLTGNIPSEFGKLTELNFLDLSFN  628

Query  2104  KLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFN  2283
               +G I PQLS C KL HL L+NN L+G IP WLG L  +GEL LSSN F+G++P E+ N
Sbjct  629   SFTGQIAPQLSKCAKLAHLLLSNNELTGTIPFWLGSLQEIGELDLSSNNFNGTVPAEIGN  688

Query  2284  CskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRN  2463
             CSKLL LSL  N+L+G +PPEIGNL +LNVLNL  N L G+IPSTI    KLYELRLS N
Sbjct  689   CSKLLKLSLRGNNLSGKIPPEIGNLTALNVLNLQRNSLSGNIPSTIQQCKKLYELRLSEN  748

Query  2464  RFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVA  2643
              F+G IP ++G+L +LQ +LD S NN +GEIPPS+G+L KLE L++S+N L G++P  + 
Sbjct  749   FFTGSIPADLGRLTELQVILDLSKNNFSGEIPPSLGSLLKLERLNISYNQLQGQVPASLG  808

Query  2644  EMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD-KGSRNK----GS  2808
             +++SL  LNLS N L+G+L   ++ +P+ SF+GN+ LCG PL SC +  G + K     +
Sbjct  809   KLTSLHVLNLSNNHLQGQLPLTFSGFPLSSFLGNAKLCGPPLLSCSELSGQKVKRLSNTA  868

Query  2809  MVVVISALSATVAIILLLM  2865
             +VV+I+A+  T A+I L+M
Sbjct  869   VVVIITAILFTSAVICLIM  887



>gb|KDO69577.1| hypothetical protein CISIN_1g036729mg [Citrus sinensis]
Length=970

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/859 (50%), Positives = 560/859 (65%), Gaps = 10/859 (1%)
 Frame = +1

Query  316   LLEVKRSFVLQ---LQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdsslggsispslgl  483
             LL +K+  V     L+ WS +  + CSW GV+C D    VV LNLS S L GSIS     
Sbjct  30    LLRIKQELVDPTGILENWSAR-AHMCSWHGVTCSDDQKHVVGLNLSSSGLSGSISRDFLN  88

Query  484   lthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDN  663
             LT L  LDLSSN L+G IP  L  L +L  LLL+SN   G IP ++G L  LQ LRIGDN
Sbjct  89    LTSLETLDLSSNSLTGLIPSELGQLQNLRILLLYSNSFSGKIPPEIGFLNKLQVLRIGDN  148

Query  664   GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIAN  843
              L G+IP   GNL  L  L +A C L+G IP ++G L  L +L+LQ N L G +P  I  
Sbjct  149   LLWGEIPPHIGNLTELRELAIAYCQLNGSIPVEIGNLKHLTSLDLQMNKLSGLIPEAIHG  208

Query  844   ISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGN  1023
                L  F+A+ N L G+IP  +  LK L ILNLANN+L+G IP +L  + +L YLNLLGN
Sbjct  209   CEELQKFAASNNMLEGTIPSSIVLLKSLQILNLANNSLSGSIPVELSHLFNLRYLNLLGN  268

Query  1024  QLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCS  1203
                G IP  L KL  L+ LDLS N L+G +      +  L+ L L+ N  +G+IP   C 
Sbjct  269   IFDGEIPSELNKLAQLEELDLSKNNLSGSISLLNTQLKNLETLVLSDNAFTGSIPIKFCL  328

Query  1204  NATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNN  1383
             N ++LQ L+L+   LSGE P EL +C  LQQLDLS+N+  G +P  L +L +LTDL+LNN
Sbjct  329   NNSSLQQLILARNKLSGEFPLELLRCSSLQQLDLSDNSFKGELPRSLDKLEELTDLLLNN  388

Query  1384  NTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIG  1563
             N+  G+  P + NL+ L+ L LF N + G++P EIG L  L  I+LY+N  SG IP E+ 
Sbjct  389   NSFTGSFPPEIGNLSKLENLFLFDNMITGKIPVEIGKLQTLSAIYLYDNQMSGSIPRELT  448

Query  1564  NCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLAD  1743
             NCS L  IDF+GN F+G IP T+G+LK+L  L LR+NDLSG IPASLG C +L  + LAD
Sbjct  449   NCSGLTEIDFFGNHFSGSIPETMGKLKNLVILQLRQNDLSGPIPASLGYCKRLQQIALAD  508

Query  1744  NHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICT  1923
             N LSG++P TF +L  L  + LYNNS +G LP  L  L  L  IN SHN FSGSI P+  
Sbjct  509   NKLSGSVPLTFRFLSELYLITLYNNSFKGPLPPSLFQLKKLRIINFSHNKFSGSIYPLTG  568

Query  1924  SHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGN  2103
             S+S  + D+TNN+F   IPS L  S +L RLRL  N  TG IP   G + EL+ LDLS N
Sbjct  569   SNSLTALDLTNNSFSGPIPSELAMSRNLSRLRLAHNHLTGNIPSEFGKLTELNFLDLSFN  628

Query  2104  KLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFN  2283
               +G I PQLS C KL HL L+NN L+G IP WLG L  +GEL LSSN F+G++P E+ N
Sbjct  629   SFTGQIAPQLSKCAKLAHLLLSNNELTGTIPFWLGSLQEIGELDLSSNNFNGTVPAEIGN  688

Query  2284  CskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRN  2463
             CSKLL LSL  N+L+G +PPEIGNL +LNVLNL  N L G+IPSTI    KLYELRLS N
Sbjct  689   CSKLLKLSLRGNNLSGKIPPEIGNLTALNVLNLQRNSLSGNIPSTIQQCKKLYELRLSEN  748

Query  2464  RFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVA  2643
              F+G IP ++G+L +LQ +LD S NN +GEIPPS+G+L KLE L++S+N L G++P  + 
Sbjct  749   FFTGSIPADLGRLTELQVILDLSKNNFSGEIPPSLGSLLKLERLNISYNQLQGQVPASLG  808

Query  2644  EMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD-KGSRNK----GS  2808
             +++SL  LNLS N L+G+L   ++ +P+ SF+GN+ LCG PL SC +  G + K     +
Sbjct  809   KLTSLHVLNLSNNHLQGQLPLTFSGFPLSSFLGNAKLCGPPLLSCSELSGQKVKRLSNTA  868

Query  2809  MVVVISALSATVAIILLLM  2865
             +VV+I+A+  T A+I L+M
Sbjct  869   VVVIITAILFTSAVICLIM  887



>ref|XP_006439859.1| hypothetical protein CICLE_v10024596mg [Citrus clementina]
 gb|ESR53099.1| hypothetical protein CICLE_v10024596mg [Citrus clementina]
Length=965

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/859 (50%), Positives = 557/859 (65%), Gaps = 10/859 (1%)
 Frame = +1

Query  316   LLEVKRSFVLQ---LQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdsslggsispslgl  483
             LL +K+  V     L+ WS +  + CSW GV+C D    VV LNLS S L GSIS     
Sbjct  25    LLRIKQELVDPTGILENWSAR-AHMCSWHGVTCSDDQKHVVGLNLSSSRLSGSISRDFLN  83

Query  484   lthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDN  663
             LT L  LDLSSN L+G IP  L  L +L  LLL+SN   G IP ++G L  LQ LRIGDN
Sbjct  84    LTSLETLDLSSNSLTGLIPSELGQLQNLRILLLYSNSFSGKIPPEIGFLNKLQVLRIGDN  143

Query  664   GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIAN  843
              L G+IP   GNL  L  L +A C L+G IP ++G L  L +L+LQ N L G +P  I  
Sbjct  144   LLWGEIPPHIGNLTELRELAIAYCQLNGSIPVEIGNLKHLTSLDLQMNKLSGLIPEAIHG  203

Query  844   ISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGN  1023
                L  F+A+ N L G+IP  +  LK L ILNLANN+L+G IP +L  + +L YLNLLGN
Sbjct  204   CEELQKFAASNNMLEGTIPSSIVLLKSLQILNLANNSLSGSIPVELSHLFNLRYLNLLGN  263

Query  1024  QLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCS  1203
                G IP  L KL  L+ LDLS N L+G +      +  L+ L L+ N  +G+IP   C 
Sbjct  264   IFDGEIPSELNKLAQLEELDLSKNNLSGSISLLNTQLKNLETLVLSDNAFTGSIPIKFCL  323

Query  1204  NATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNN  1383
             N ++LQ L+L+   LSGE P EL +C  LQQLDLS+N+  G +P  L +L +LTDL+LNN
Sbjct  324   NNSSLQQLILARNKLSGEFPLELLRCSSLQQLDLSDNSFKGELPRSLDKLEELTDLLLNN  383

Query  1384  NTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIG  1563
             N+  G+  P + NL+ L+ L LF N + G++P EIG L  L  I+LY+N  SG IP E+ 
Sbjct  384   NSFTGSFPPEIGNLSKLENLFLFDNMITGKIPVEIGKLQTLSAIYLYDNQMSGSIPRELT  443

Query  1564  NCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLAD  1743
             NCS L  IDF+GN F+G IP T+G+LK+L  L LR+NDLSG IPASLG C +L  + LAD
Sbjct  444   NCSGLTEIDFFGNHFSGSIPETMGKLKNLVILQLRQNDLSGPIPASLGYCKRLQQIALAD  503

Query  1744  NHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICT  1923
             N LSG++P TF +L  L  + LYNNS +G LP  L  L  L  IN SHN FSGSI P+  
Sbjct  504   NKLSGSVPLTFRFLSELYLITLYNNSFKGPLPPSLFQLKKLRIINFSHNKFSGSIYPLTG  563

Query  1924  SHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGN  2103
             S+S  + D+TNN+F   IPS L  S +L RLRL  N  TG IP   G + EL+ LDLS N
Sbjct  564   SNSLTALDLTNNSFSGPIPSELAMSRNLSRLRLAHNHLTGNIPSEFGKLTELNFLDLSFN  623

Query  2104  KLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFN  2283
               +G I PQLS C KL HL L+NN L+G IP WLG L  +GEL LSSN F+G++P E+ N
Sbjct  624   SFTGQIAPQLSKCAKLAHLLLSNNELTGTIPFWLGSLQEIGELDLSSNNFNGTVPAEIGN  683

Query  2284  CskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRN  2463
             CSKLL LSL  N+L+G +PPEIGNL +LNVLNL  N   G+IPSTI    KLYELRLS N
Sbjct  684   CSKLLKLSLRGNNLSGKIPPEIGNLTALNVLNLQRNSFSGNIPSTIQQCKKLYELRLSEN  743

Query  2464  RFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVA  2643
              F+G IP ++G+L +LQ +LD S NN +GEIPPS+G L KLE L++S+N L G++P  + 
Sbjct  744   FFTGSIPADLGRLTELQVILDLSKNNFSGEIPPSLGNLLKLERLNISYNQLQGQVPASLG  803

Query  2644  EMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD-KGSRNK----GS  2808
             +++SL  LNLS N L+G+L   ++ +P  SF+GN+ LCG PL SC +  G + K     +
Sbjct  804   KLTSLHVLNLSNNHLQGQLPLTFSGFPPSSFLGNAKLCGPPLLSCSELSGQKVKRLSNTA  863

Query  2809  MVVVISALSATVAIILLLM  2865
             +VV+I+A+  T A+I L+M
Sbjct  864   VVVIITAIVFTSAVICLIM  882



>gb|KHN34330.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=962

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/760 (51%), Positives = 497/760 (65%), Gaps = 5/760 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IPS++G L  LQ LRIGDN LTG+IP S  N+  L  L L  C+L+G IP  +G+L  
Sbjct  132   GNIPSEIGNLRKLQVLRIGDNMLTGEIPPSVANMSELTVLTLGYCHLNGSIPFGIGKLKH  191

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L +L+LQ N L GP+P EI     L  F+A+ N L G +P  +G LK L ILNL NN+L+
Sbjct  192   LISLDLQMNSLSGPIPEEIQGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLVNNSLS  251

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP  L  +S+L YLNLLGN+L G IP  L  L  LQ LDLS N L+G +P     +  
Sbjct  252   GSIPTALSHLSNLTYLNLLGNKLHGEIPSELNSLIQLQKLDLSKNNLSGSIPLLNVKLQS  311

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L+ L L+ N L+G+IP + C   + LQ L L+   LSG+ P EL  C  +QQLDLS+N+ 
Sbjct  312   LETLVLSDNALTGSIPSNFCLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQLDLSDNSF  371

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
              G +P  L +L  LTDLVLNNN+  G++ P + N+++L++L LF N   G++P EIG L 
Sbjct  372   EGELPSSLDKLQNLTDLVLNNNSFVGSLPPEIGNISSLESLFLFGNFFKGKIPLEIGRLQ  431

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
              L  I+LY+N  SG IP E+ NC+SL+ +DF+GN FTG IP T+G+LK L  LHLR+NDL
Sbjct  432   RLSSIYLYDNQISGPIPRELTNCTSLKEVDFFGNHFTGPIPETIGKLKGLVVLHLRQNDL  491

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
             SG IP S+G C  L  L LADN LSG+IP TF YL  LT++ LYNNS EG +P  L +L 
Sbjct  492   SGPIPPSMGYCKSLQILALADNMLSGSIPPTFSYLSELTKITLYNNSFEGPIPHSLSSLK  551

Query  1861  NLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFT  2040
             +L  IN SHN FSGS  P+  S+S    D+TNN+F   IPS L NS +L RLRLG N  T
Sbjct  552   SLKIINFSHNKFSGSFFPLTGSNSLTLLDLTNNSFSGPIPSTLTNSRNLSRLRLGENYLT  611

Query  2041  GKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpl  2220
             G IP   G +  L+ LDLS N L+G +PPQLS  +K+ H+ +NNN LSG IP WLG L  
Sbjct  612   GSIPSEFGHLTVLNFLDLSFNNLTGEVPPQLSNSKKMEHMLMNNNGLSGKIPDWLGSLQE  671

Query  2221  lgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLC  2400
             LGEL LS N F G +P EL NCSKLL LSL +N+L+G +P EIGNL SLNVLNL  N   
Sbjct  672   LGELDLSYNNFRGKIPSELGNCSKLLKLSLHHNNLSGEIPQEIGNLTSLNVLNLQRNSFS  731

Query  2401  GSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLS  2580
             G IP TI    KLYELRLS N  +G IP E+G L +LQ +LD S N  TGEIPPS+G L 
Sbjct  732   GIIPPTIQRCTKLYELRLSENLLTGAIPVELGGLAELQVILDLSKNLFTGEIPPSLGNLM  791

Query  2581  KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCG  2760
             KLE L+LS N L G++PP +  ++SL  LNLS N LEG++   ++ +P+ SF+ N+ LCG
Sbjct  792   KLERLNLSFNQLEGKVPPSLGRLTSLHVLNLSNNHLEGQIPSIFSGFPLSSFLNNNGLCG  851

Query  2761  SPLGSCRDKGSRNK-----GSMVVVISALSATVAIILLLM  2865
              PL SC +  ++ K       + V+I A+  T  +I L+M
Sbjct  852   PPLSSCSESTAQGKMQLSNTQVAVIIVAIVFTSTVICLVM  891


 Score =   317 bits (813),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 226/604 (37%), Positives = 324/604 (54%), Gaps = 11/604 (2%)
 Frame = +1

Query  904   ELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLD  1083
             EL     L  L+L++N+L+G IP +LG++ +L  L L  N L G+IP  +  L  LQ L 
Sbjct  89    ELSHFTSLRTLDLSSNSLSGSIPSELGQLQNLRILQLHSNDLSGNIPSEIGNLRKLQVLR  148

Query  1084  LSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIP  1263
             +  N L GE+P    +M +L  L L   +L+G+IP  +     +L  L L    LSG IP
Sbjct  149   IGDNMLTGEIPPSVANMSELTVLTLGYCHLNGSIPFGI-GKLKHLISLDLQMNSLSGPIP  207

Query  1264  PELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTL  1443
              E+  C  LQ    SNN L G +P  +  L  L  L L NN+L G+I  ++++L+NL  L
Sbjct  208   EEIQGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLVNNSLSGSIPTALSHLSNLTYL  267

Query  1444  SLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIP  1623
             +L  N LHGE+P E+  L  LQ + L +N+ SG IP+      SL+ +    N  TG IP
Sbjct  268   NLLGNKLHGEIPSELNSLIQLQKLDLSKNNLSGSIPLLNVKLQSLETLVLSDNALTGSIP  327

Query  1624  ITL----GRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRA  1791
                     +L+ LF   L  N LSG+ P  L NC  +  LDL+DN   G +P++   L+ 
Sbjct  328   SNFCLRGSKLQQLF---LARNMLSGKFPLELLNCSSIQQLDLSDNSFEGELPSSLDKLQN  384

Query  1792  LTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIA-PICTSHSFLSFDVTNNAFD  1968
             LT L+L NNS  G LP ++ N+ +L  + L  N F G I   I       S  + +N   
Sbjct  385   LTDLVLNNNSFVGSLPPEIGNISSLESLFLFGNFFKGKIPLEIGRLQRLSSIYLYDNQIS  444

Query  1969  QEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRK  2148
               IP  L N  SL  +    N FTG IP T+G ++ L +L L  N LSG IPP +  C+ 
Sbjct  445   GPIPRELTNCTSLKEVDFFGNHFTGPIPETIGKLKGLVVLHLRQNDLSGPIPPSMGYCKS  504

Query  2149  LTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsln  2328
             L  L L +N+LSG IP     L  L ++ L +N F G +P  L +   L +++  +N  +
Sbjct  505   LQILALADNMLSGSIPPTFSYLSELTKITLYNNSFEGPIPHSLSSLKSLKIINFSHNKFS  564

Query  2329  GTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKD  2508
             G+  P  G+  SL +L+L +N   G IPST+     L  LRL  N  +G IP E G L  
Sbjct  565   GSFFPLTGS-NSLTLLDLTNNSFSGPIPSTLTNSRNLSRLRLGENYLTGSIPSEFGHLTV  623

Query  2509  LQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNEL  2688
             L + LD S+NNLTGE+PP +    K+E + +++N L+G+IP  +  +  LG L+LS N  
Sbjct  624   L-NFLDLSFNNLTGEVPPQLSNSKKMEHMLMNNNGLSGKIPDWLGSLQELGELDLSYNNF  682

Query  2689  EGEL  2700
              G++
Sbjct  683   RGKI  686


 Score =   257 bits (656),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 195/539 (36%), Positives = 287/539 (53%), Gaps = 28/539 (5%)
 Frame = +1

Query  1201  SNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLN  1380
             S+ T+L+ L LS   LSG IP EL Q + L+ L L +N L+G+IP E+  L +L  L + 
Sbjct  91    SHFTSLRTLDLSSNSLSGSIPSELGQLQNLRILQLHSNDLSGNIPSEIGNLRKLQVLRIG  150

Query  1381  NNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEI  1560
             +N L G I PSVAN++ L  L+L + +L+G +P  IG L  L  + L  N  SG IP EI
Sbjct  151   DNMLTGEIPPSVANMSELTVLTLGYCHLNGSIPFGIGKLKHLISLDLQMNSLSGPIPEEI  210

Query  1561  GNC------------------------SSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLR  1668
               C                         SL+ ++   N  +G IP  L  L +L +L+L 
Sbjct  211   QGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLVNNSLSGSIPTALSHLSNLTYLNLL  270

Query  1669  ENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDL  1848
              N L GEIP+ L +  QL  LDL+ N+LSG+IP     L++L  L+L +N+L G +P + 
Sbjct  271   GNKLHGEIPSELNSLIQLQKLDLSKNNLSGSIPLLNVKLQSLETLVLSDNALTGSIPSNF  330

Query  1849  RNLGN-LTRINLSHNNFSGSIA-PICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRL  2022
                G+ L ++ L+ N  SG     +    S    D+++N+F+ E+PS L    +L  L L
Sbjct  331   CLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQLDLSDNSFEGELPSSLDKLQNLTDLVL  390

Query  2023  GSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVW  2202
              +N F G +P  +G I  L  L L GN   G IP ++   ++L+ + L +N +SGPIP  
Sbjct  391   NNNSFVGSLPPEIGNISSLESLFLFGNFFKGKIPLEIGRLQRLSSIYLYDNQISGPIPRE  450

Query  2203  lgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNL  2382
             L     L E+    N F+G +P  +     L+VL L  N L+G +PP +G  KSL +L L
Sbjct  451   LTNCTSLKEVDFFGNHFTGPIPETIGKLKGLVVLHLRQNDLSGPIPPSMGYCKSLQILAL  510

Query  2383  DDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPP  2562
              DN L GSIP T   L +L ++ L  N F G IP  +  LK L+ +++FS+N  +G   P
Sbjct  511   ADNMLSGSIPPTFSYLSELTKITLYNNSFEGPIPHSLSSLKSLK-IINFSHNKFSGSFFP  569

Query  2563  SIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFV  2739
               G+ + L  LDL++N  +G IP  +    +L RL L  N L G +   + H  V +F+
Sbjct  570   LTGS-NSLTLLDLTNNSFSGPIPSTLTNSRNLSRLRLGENYLTGSIPSEFGHLTVLNFL  627


 Score =   245 bits (625),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 179/497 (36%), Positives = 250/497 (50%), Gaps = 27/497 (5%)
 Frame = +1

Query  1267  ELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLS  1446
             ELS    L+ LDLS+N+L+GSIP EL +L  L  L L++N L G I   + NL  LQ L 
Sbjct  89    ELSHFTSLRTLDLSSNSLSGSIPSELGQLQNLRILQLHSNDLSGNIPSEIGNLRKLQVLR  148

Query  1447  LFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPI  1626
             +  N L GE+P  +  + +L ++ L   H +G IP  IG    L  +D   N  +G IP 
Sbjct  149   IGDNMLTGEIPPSVANMSELTVLTLGYCHLNGSIPFGIGKLKHLISLDLQMNSLSGPIPE  208

Query  1627  TLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLM  1806
              +   + L       N L G++P+S+G+   L  L+L +N LSG+IP    +L  LT L 
Sbjct  209   EIQGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLVNNSLSGSIPTALSHLSNLTYLN  268

Query  1807  LYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTS-HSFLSFDVTNNAFDQEIPS  1983
             L  N L G++P +L +L  L +++LS NN SGSI  +     S  +  +++NA    IPS
Sbjct  269   LLGNKLHGEIPSELNSLIQLQKLDLSKNNLSGSIPLLNVKLQSLETLVLSDNALTGSIPS  328

Query  1984  -FLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHL  2160
              F      L +L L  N  +GK P+ L     +  LDLS N   G +P  L   + LT L
Sbjct  329   NFCLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQLDLSDNSFEGELPSSLDKLQNLTDL  388

Query  2161  DLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLP  2340
              LNN                        N F GSLPPE+ N S L  L L  N   G +P
Sbjct  389   VLNN------------------------NSFVGSLPPEIGNISSLESLFLFGNFFKGKIP  424

Query  2341  PEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSV  2520
              EIG L+ L+ + L DNQ+ G IP  +     L E+    N F+G IP  +G+LK L  V
Sbjct  425   LEIGRLQRLSSIYLYDNQISGPIPRELTNCTSLKEVDFFGNHFTGPIPETIGKLKGL-VV  483

Query  2521  LDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGEL  2700
             L    N+L+G IPPS+G    L+ L L+ N L+G IPP  + +S L ++ L  N  EG +
Sbjct  484   LHLRQNDLSGPIPPSMGYCKSLQILALADNMLSGSIPPTFSYLSELTKITLYNNSFEGPI  543

Query  2701  DKRYAHWPVDSFVGNSH  2751
                 +       +  SH
Sbjct  544   PHSLSSLKSLKIINFSH  560


 Score =   244 bits (624),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 171/450 (38%), Positives = 242/450 (54%), Gaps = 3/450 (1%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
             VG +P ++G +++L++L +  N   G+IP   G L  L ++ L    +SG IP +L   T
Sbjct  396   VGSLPPEIGNISSLESLFLFGNFFKGKIPLEIGRLQRLSSIYLYDNQISGPIPRELTNCT  455

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
              L+ ++   N   GP+P  I  +  L       N L+G IP  +G  K L IL LA+N L
Sbjct  456   SLKEVDFFGNHFTGPIPETIGKLKGLVVLHLRQNDLSGPIPPSMGYCKSLQILALADNML  515

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             +G IP     +S L  + L  N   G IP SL+ L +L+ ++ S N+ +G      GS  
Sbjct  516   SGSIPPTFSYLSELTKITLYNNSFEGPIPHSLSSLKSLKIINFSHNKFSGSFFPLTGS-N  574

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
              L  L LT+N+ SG IP +L +N+ NL  L L E  L+G IP E     VL  LDLS N 
Sbjct  575   SLTLLDLTNNSFSGPIPSTL-TNSRNLSRLRLGENYLTGSIPSEFGHLTVLNFLDLSFNN  633

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
             L G +P +L    ++  +++NNN L G I   + +L  L  L L +NN  G++P E+G  
Sbjct  634   LTGEVPPQLSNSKKMEHMLMNNNGLSGKIPDWLGSLQELGELDLSYNNFRGKIPSELGNC  693

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
               L  + L+ N+ SGEIP EIGN +SL  ++   N F+G IP T+ R   L+ L L EN 
Sbjct  694   SKLLKLSLHHNNLSGEIPQEIGNLTSLNVLNLQRNSFSGIIPPTIQRCTKLYELRLSENL  753

Query  1678  LSGEIPASLGNCHQLDT-LDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRN  1854
             L+G IP  LG   +L   LDL+ N  +G IP + G L  L RL L  N LEG +P  L  
Sbjct  754   LTGAIPVELGGLAELQVILDLSKNLFTGEIPPSLGNLMKLERLNLSFNQLEGKVPPSLGR  813

Query  1855  LGNLTRINLSHNNFSGSIAPICTSHSFLSF  1944
             L +L  +NLS+N+  G I  I +     SF
Sbjct  814   LTSLHVLNLSNNHLEGQIPSIFSGFPLSSF  843


 Score =   157 bits (396),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 144/456 (32%), Positives = 208/456 (46%), Gaps = 97/456 (21%)
 Frame = +1

Query  1642  KHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNS  1821
             +H+  L+L  + +SG I A L +   L TLDL+ N LSG+IP+  G L+ L  L L++N 
Sbjct  70    EHIIGLNLSGSGISGSISAELSHFTSLRTLDLSSNSLSGSIPSELGQLQNLRILQLHSND  129

Query  1822  LEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLS--------------------  1941
             L G++P ++ NL  L  + +  N  +G I P   + S L+                    
Sbjct  130   LSGNIPSEIGNLRKLQVLRIGDNMLTGEIPPSVANMSELTVLTLGYCHLNGSIPFGIGKL  189

Query  1942  -----------------------------FDVTNNAFDQEIPSFLGNSPSLDRLRLGSNR  2034
                                          F  +NN  + ++PS +G+  SL  L L +N 
Sbjct  190   KHLISLDLQMNSLSGPIPEEIQGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLVNNS  249

Query  2035  FTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrl  2214
              +G IP  L  +  L+ L+L GNKL G IP +L+   +L  LDL+ N LSG IP+   +L
Sbjct  250   LSGSIPTALSHLSNLTYLNLLGNKLHGEIPSELNSLIQLQKLDLSKNNLSGSIPLLNVKL  309

Query  2215  pllgelklSSNQFSGSLPP-------------------------ELFNCskllvlslenn  2319
               L  L LS N  +GS+P                          EL NCS +  L L +N
Sbjct  310   QSLETLVLSDNALTGSIPSNFCLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQLDLSDN  369

Query  2320  slnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQ  2499
             S  G LP  +  L++L  L L++N   GS+P  IG +  L  L L  N F G+IP E+G+
Sbjct  370   SFEGELPSSLDKLQNLTDLVLNNNSFVGSLPPEIGNISSLESLFLFGNFFKGKIPLEIGR  429

Query  2500  LKDLQSV-----------------------LDFSYNNLTGEIPPSIGTLSKLESLDLSHN  2610
             L+ L S+                       +DF  N+ TG IP +IG L  L  L L  N
Sbjct  430   LQRLSSIYLYDNQISGPIPRELTNCTSLKEVDFFGNHFTGPIPETIGKLKGLVVLHLRQN  489

Query  2611  DLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAH  2718
             DL+G IPP +    SL  L L+ N L G +   +++
Sbjct  490   DLSGPIPPSMGYCKSLQILALADNMLSGSIPPTFSY  525



>ref|XP_003525510.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=988

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/760 (51%), Positives = 497/760 (65%), Gaps = 5/760 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IPS++G L  LQ LRIGDN LTG+IP S  N+  L  L L  C+L+G IP  +G+L  
Sbjct  142   GNIPSEIGNLRKLQVLRIGDNMLTGEIPPSVANMSELTVLTLGYCHLNGSIPFGIGKLKH  201

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L +L+LQ N L GP+P EI     L  F+A+ N L G +P  +G LK L ILNL NN+L+
Sbjct  202   LISLDLQMNSLSGPIPEEIQGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLVNNSLS  261

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP  L  +S+L YLNLLGN+L G IP  L  L  LQ LDLS N L+G +P     +  
Sbjct  262   GSIPTALSHLSNLTYLNLLGNKLHGEIPSELNSLIQLQKLDLSKNNLSGSIPLLNVKLQS  321

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L+ L L+ N L+G+IP + C   + LQ L L+   LSG+ P EL  C  +QQLDLS+N+ 
Sbjct  322   LETLVLSDNALTGSIPSNFCLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQLDLSDNSF  381

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
              G +P  L +L  LTDLVLNNN+  G++ P + N+++L++L LF N   G++P EIG L 
Sbjct  382   EGELPSSLDKLQNLTDLVLNNNSFVGSLPPEIGNISSLESLFLFGNFFKGKIPLEIGRLQ  441

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
              L  I+LY+N  SG IP E+ NC+SL+ +DF+GN FTG IP T+G+LK L  LHLR+NDL
Sbjct  442   RLSSIYLYDNQISGPIPRELTNCTSLKEVDFFGNHFTGPIPETIGKLKGLVVLHLRQNDL  501

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
             SG IP S+G C  L  L LADN LSG+IP TF YL  LT++ LYNNS EG +P  L +L 
Sbjct  502   SGPIPPSMGYCKSLQILALADNMLSGSIPPTFSYLSELTKITLYNNSFEGPIPHSLSSLK  561

Query  1861  NLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFT  2040
             +L  IN SHN FSGS  P+  S+S    D+TNN+F   IPS L NS +L RLRLG N  T
Sbjct  562   SLKIINFSHNKFSGSFFPLTGSNSLTLLDLTNNSFSGPIPSTLTNSRNLSRLRLGENYLT  621

Query  2041  GKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpl  2220
             G IP   G +  L+ LDLS N L+G +PPQLS  +K+ H+ +NNN LSG IP WLG L  
Sbjct  622   GSIPSEFGHLTVLNFLDLSFNNLTGEVPPQLSNSKKMEHMLMNNNGLSGKIPDWLGSLQE  681

Query  2221  lgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLC  2400
             LGEL LS N F G +P EL NCSKLL LSL +N+L+G +P EIGNL SLNVLNL  N   
Sbjct  682   LGELDLSYNNFRGKIPSELGNCSKLLKLSLHHNNLSGEIPQEIGNLTSLNVLNLQRNSFS  741

Query  2401  GSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLS  2580
             G IP TI    KLYELRLS N  +G IP E+G L +LQ +LD S N  TGEIPPS+G L 
Sbjct  742   GIIPPTIQRCTKLYELRLSENLLTGAIPVELGGLAELQVILDLSKNLFTGEIPPSLGNLM  801

Query  2581  KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCG  2760
             KLE L+LS N L G++PP +  ++SL  LNLS N LEG++   ++ +P+ SF+ N+ LCG
Sbjct  802   KLERLNLSFNQLEGKVPPSLGRLTSLHVLNLSNNHLEGQIPSIFSGFPLSSFLNNNGLCG  861

Query  2761  SPLGSCRDKGSRNK-----GSMVVVISALSATVAIILLLM  2865
              PL SC +  ++ K       + V+I A+  T  +I L+M
Sbjct  862   PPLSSCSESTAQGKMQLSNTQVAVIIVAIVFTSTVICLVM  901


 Score =   317 bits (813),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 226/604 (37%), Positives = 324/604 (54%), Gaps = 11/604 (2%)
 Frame = +1

Query  904   ELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLD  1083
             EL     L  L+L++N+L+G IP +LG++ +L  L L  N L G+IP  +  L  LQ L 
Sbjct  99    ELSHFTSLRTLDLSSNSLSGSIPSELGQLQNLRILQLHSNDLSGNIPSEIGNLRKLQVLR  158

Query  1084  LSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIP  1263
             +  N L GE+P    +M +L  L L   +L+G+IP  +     +L  L L    LSG IP
Sbjct  159   IGDNMLTGEIPPSVANMSELTVLTLGYCHLNGSIPFGI-GKLKHLISLDLQMNSLSGPIP  217

Query  1264  PELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTL  1443
              E+  C  LQ    SNN L G +P  +  L  L  L L NN+L G+I  ++++L+NL  L
Sbjct  218   EEIQGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLVNNSLSGSIPTALSHLSNLTYL  277

Query  1444  SLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIP  1623
             +L  N LHGE+P E+  L  LQ + L +N+ SG IP+      SL+ +    N  TG IP
Sbjct  278   NLLGNKLHGEIPSELNSLIQLQKLDLSKNNLSGSIPLLNVKLQSLETLVLSDNALTGSIP  337

Query  1624  ITL----GRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRA  1791
                     +L+ LF   L  N LSG+ P  L NC  +  LDL+DN   G +P++   L+ 
Sbjct  338   SNFCLRGSKLQQLF---LARNMLSGKFPLELLNCSSIQQLDLSDNSFEGELPSSLDKLQN  394

Query  1792  LTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIA-PICTSHSFLSFDVTNNAFD  1968
             LT L+L NNS  G LP ++ N+ +L  + L  N F G I   I       S  + +N   
Sbjct  395   LTDLVLNNNSFVGSLPPEIGNISSLESLFLFGNFFKGKIPLEIGRLQRLSSIYLYDNQIS  454

Query  1969  QEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRK  2148
               IP  L N  SL  +    N FTG IP T+G ++ L +L L  N LSG IPP +  C+ 
Sbjct  455   GPIPRELTNCTSLKEVDFFGNHFTGPIPETIGKLKGLVVLHLRQNDLSGPIPPSMGYCKS  514

Query  2149  LTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsln  2328
             L  L L +N+LSG IP     L  L ++ L +N F G +P  L +   L +++  +N  +
Sbjct  515   LQILALADNMLSGSIPPTFSYLSELTKITLYNNSFEGPIPHSLSSLKSLKIINFSHNKFS  574

Query  2329  GTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKD  2508
             G+  P  G+  SL +L+L +N   G IPST+     L  LRL  N  +G IP E G L  
Sbjct  575   GSFFPLTGS-NSLTLLDLTNNSFSGPIPSTLTNSRNLSRLRLGENYLTGSIPSEFGHLTV  633

Query  2509  LQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNEL  2688
             L + LD S+NNLTGE+PP +    K+E + +++N L+G+IP  +  +  LG L+LS N  
Sbjct  634   L-NFLDLSFNNLTGEVPPQLSNSKKMEHMLMNNNGLSGKIPDWLGSLQELGELDLSYNNF  692

Query  2689  EGEL  2700
              G++
Sbjct  693   RGKI  696


 Score =   257 bits (656),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 195/539 (36%), Positives = 287/539 (53%), Gaps = 28/539 (5%)
 Frame = +1

Query  1201  SNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLN  1380
             S+ T+L+ L LS   LSG IP EL Q + L+ L L +N L+G+IP E+  L +L  L + 
Sbjct  101   SHFTSLRTLDLSSNSLSGSIPSELGQLQNLRILQLHSNDLSGNIPSEIGNLRKLQVLRIG  160

Query  1381  NNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEI  1560
             +N L G I PSVAN++ L  L+L + +L+G +P  IG L  L  + L  N  SG IP EI
Sbjct  161   DNMLTGEIPPSVANMSELTVLTLGYCHLNGSIPFGIGKLKHLISLDLQMNSLSGPIPEEI  220

Query  1561  GNC------------------------SSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLR  1668
               C                         SL+ ++   N  +G IP  L  L +L +L+L 
Sbjct  221   QGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLVNNSLSGSIPTALSHLSNLTYLNLL  280

Query  1669  ENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDL  1848
              N L GEIP+ L +  QL  LDL+ N+LSG+IP     L++L  L+L +N+L G +P + 
Sbjct  281   GNKLHGEIPSELNSLIQLQKLDLSKNNLSGSIPLLNVKLQSLETLVLSDNALTGSIPSNF  340

Query  1849  RNLGN-LTRINLSHNNFSGSIA-PICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRL  2022
                G+ L ++ L+ N  SG     +    S    D+++N+F+ E+PS L    +L  L L
Sbjct  341   CLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQLDLSDNSFEGELPSSLDKLQNLTDLVL  400

Query  2023  GSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVW  2202
              +N F G +P  +G I  L  L L GN   G IP ++   ++L+ + L +N +SGPIP  
Sbjct  401   NNNSFVGSLPPEIGNISSLESLFLFGNFFKGKIPLEIGRLQRLSSIYLYDNQISGPIPRE  460

Query  2203  lgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNL  2382
             L     L E+    N F+G +P  +     L+VL L  N L+G +PP +G  KSL +L L
Sbjct  461   LTNCTSLKEVDFFGNHFTGPIPETIGKLKGLVVLHLRQNDLSGPIPPSMGYCKSLQILAL  520

Query  2383  DDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPP  2562
              DN L GSIP T   L +L ++ L  N F G IP  +  LK L+ +++FS+N  +G   P
Sbjct  521   ADNMLSGSIPPTFSYLSELTKITLYNNSFEGPIPHSLSSLKSLK-IINFSHNKFSGSFFP  579

Query  2563  SIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFV  2739
               G+ + L  LDL++N  +G IP  +    +L RL L  N L G +   + H  V +F+
Sbjct  580   LTGS-NSLTLLDLTNNSFSGPIPSTLTNSRNLSRLRLGENYLTGSIPSEFGHLTVLNFL  637


 Score =   245 bits (625),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 179/497 (36%), Positives = 250/497 (50%), Gaps = 27/497 (5%)
 Frame = +1

Query  1267  ELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLS  1446
             ELS    L+ LDLS+N+L+GSIP EL +L  L  L L++N L G I   + NL  LQ L 
Sbjct  99    ELSHFTSLRTLDLSSNSLSGSIPSELGQLQNLRILQLHSNDLSGNIPSEIGNLRKLQVLR  158

Query  1447  LFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPI  1626
             +  N L GE+P  +  + +L ++ L   H +G IP  IG    L  +D   N  +G IP 
Sbjct  159   IGDNMLTGEIPPSVANMSELTVLTLGYCHLNGSIPFGIGKLKHLISLDLQMNSLSGPIPE  218

Query  1627  TLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLM  1806
              +   + L       N L G++P+S+G+   L  L+L +N LSG+IP    +L  LT L 
Sbjct  219   EIQGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLVNNSLSGSIPTALSHLSNLTYLN  278

Query  1807  LYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTS-HSFLSFDVTNNAFDQEIPS  1983
             L  N L G++P +L +L  L +++LS NN SGSI  +     S  +  +++NA    IPS
Sbjct  279   LLGNKLHGEIPSELNSLIQLQKLDLSKNNLSGSIPLLNVKLQSLETLVLSDNALTGSIPS  338

Query  1984  -FLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHL  2160
              F      L +L L  N  +GK P+ L     +  LDLS N   G +P  L   + LT L
Sbjct  339   NFCLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQLDLSDNSFEGELPSSLDKLQNLTDL  398

Query  2161  DLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLP  2340
              LNN                        N F GSLPPE+ N S L  L L  N   G +P
Sbjct  399   VLNN------------------------NSFVGSLPPEIGNISSLESLFLFGNFFKGKIP  434

Query  2341  PEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSV  2520
              EIG L+ L+ + L DNQ+ G IP  +     L E+    N F+G IP  +G+LK L  V
Sbjct  435   LEIGRLQRLSSIYLYDNQISGPIPRELTNCTSLKEVDFFGNHFTGPIPETIGKLKGL-VV  493

Query  2521  LDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGEL  2700
             L    N+L+G IPPS+G    L+ L L+ N L+G IPP  + +S L ++ L  N  EG +
Sbjct  494   LHLRQNDLSGPIPPSMGYCKSLQILALADNMLSGSIPPTFSYLSELTKITLYNNSFEGPI  553

Query  2701  DKRYAHWPVDSFVGNSH  2751
                 +       +  SH
Sbjct  554   PHSLSSLKSLKIINFSH  570


 Score =   245 bits (625),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 171/450 (38%), Positives = 242/450 (54%), Gaps = 3/450 (1%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
             VG +P ++G +++L++L +  N   G+IP   G L  L ++ L    +SG IP +L   T
Sbjct  406   VGSLPPEIGNISSLESLFLFGNFFKGKIPLEIGRLQRLSSIYLYDNQISGPIPRELTNCT  465

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
              L+ ++   N   GP+P  I  +  L       N L+G IP  +G  K L IL LA+N L
Sbjct  466   SLKEVDFFGNHFTGPIPETIGKLKGLVVLHLRQNDLSGPIPPSMGYCKSLQILALADNML  525

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             +G IP     +S L  + L  N   G IP SL+ L +L+ ++ S N+ +G      GS  
Sbjct  526   SGSIPPTFSYLSELTKITLYNNSFEGPIPHSLSSLKSLKIINFSHNKFSGSFFPLTGS-N  584

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
              L  L LT+N+ SG IP +L +N+ NL  L L E  L+G IP E     VL  LDLS N 
Sbjct  585   SLTLLDLTNNSFSGPIPSTL-TNSRNLSRLRLGENYLTGSIPSEFGHLTVLNFLDLSFNN  643

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
             L G +P +L    ++  +++NNN L G I   + +L  L  L L +NN  G++P E+G  
Sbjct  644   LTGEVPPQLSNSKKMEHMLMNNNGLSGKIPDWLGSLQELGELDLSYNNFRGKIPSELGNC  703

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
               L  + L+ N+ SGEIP EIGN +SL  ++   N F+G IP T+ R   L+ L L EN 
Sbjct  704   SKLLKLSLHHNNLSGEIPQEIGNLTSLNVLNLQRNSFSGIIPPTIQRCTKLYELRLSENL  763

Query  1678  LSGEIPASLGNCHQLDT-LDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRN  1854
             L+G IP  LG   +L   LDL+ N  +G IP + G L  L RL L  N LEG +P  L  
Sbjct  764   LTGAIPVELGGLAELQVILDLSKNLFTGEIPPSLGNLMKLERLNLSFNQLEGKVPPSLGR  823

Query  1855  LGNLTRINLSHNNFSGSIAPICTSHSFLSF  1944
             L +L  +NLS+N+  G I  I +     SF
Sbjct  824   LTSLHVLNLSNNHLEGQIPSIFSGFPLSSF  853


 Score =   157 bits (396),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 144/456 (32%), Positives = 208/456 (46%), Gaps = 97/456 (21%)
 Frame = +1

Query  1642  KHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNS  1821
             +H+  L+L  + +SG I A L +   L TLDL+ N LSG+IP+  G L+ L  L L++N 
Sbjct  80    EHIIGLNLSGSGISGSISAELSHFTSLRTLDLSSNSLSGSIPSELGQLQNLRILQLHSND  139

Query  1822  LEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLS--------------------  1941
             L G++P ++ NL  L  + +  N  +G I P   + S L+                    
Sbjct  140   LSGNIPSEIGNLRKLQVLRIGDNMLTGEIPPSVANMSELTVLTLGYCHLNGSIPFGIGKL  199

Query  1942  -----------------------------FDVTNNAFDQEIPSFLGNSPSLDRLRLGSNR  2034
                                          F  +NN  + ++PS +G+  SL  L L +N 
Sbjct  200   KHLISLDLQMNSLSGPIPEEIQGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLVNNS  259

Query  2035  FTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrl  2214
              +G IP  L  +  L+ L+L GNKL G IP +L+   +L  LDL+ N LSG IP+   +L
Sbjct  260   LSGSIPTALSHLSNLTYLNLLGNKLHGEIPSELNSLIQLQKLDLSKNNLSGSIPLLNVKL  319

Query  2215  pllgelklSSNQFSGSLPP-------------------------ELFNCskllvlslenn  2319
               L  L LS N  +GS+P                          EL NCS +  L L +N
Sbjct  320   QSLETLVLSDNALTGSIPSNFCLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQLDLSDN  379

Query  2320  slnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQ  2499
             S  G LP  +  L++L  L L++N   GS+P  IG +  L  L L  N F G+IP E+G+
Sbjct  380   SFEGELPSSLDKLQNLTDLVLNNNSFVGSLPPEIGNISSLESLFLFGNFFKGKIPLEIGR  439

Query  2500  LKDLQSV-----------------------LDFSYNNLTGEIPPSIGTLSKLESLDLSHN  2610
             L+ L S+                       +DF  N+ TG IP +IG L  L  L L  N
Sbjct  440   LQRLSSIYLYDNQISGPIPRELTNCTSLKEVDFFGNHFTGPIPETIGKLKGLVVLHLRQN  499

Query  2611  DLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAH  2718
             DL+G IPP +    SL  L L+ N L G +   +++
Sbjct  500   DLSGPIPPSMGYCKSLQILALADNMLSGSIPPTFSY  535



>gb|KEH31821.1| LRR receptor-like kinase [Medicago truncatula]
Length=977

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/762 (51%), Positives = 490/762 (64%), Gaps = 9/762 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP ++G L  LQ LRIGDN LTG IP S  NL  L  LG+  C+L+G IP  +G+L  
Sbjct  137   GNIPKEIGNLNKLQVLRIGDNFLTGGIPPSIINLKELTVLGVGYCHLNGTIPVGIGKLKN  196

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L +L+LQ N   G +P EI    +L  F+A+ N L G+IP  +G LK L I+NLANNTL+
Sbjct  197   LTSLDLQMNSFSGHIPEEIQGCENLQNFAASNNMLEGNIPSSIGSLKSLKIINLANNTLS  256

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP  L  +S+L YLN LGN+L G IP  L  L  LQ LDLSGN  +G +P     +  
Sbjct  257   GPIPSSLSYLSNLTYLNFLGNKLNGEIPYELNSLIQLQKLDLSGNNFSGSIPLLNSKLKS  316

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L+ L L+ N L+GTIP+S C   + LQ L L+   LSG+ P EL  C  +QQLDLS N+ 
Sbjct  317   LETLVLSDNALTGTIPRSFCFKGSKLQQLFLARNILSGKFPLELLSCSSIQQLDLSGNSF  376

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
                IP  + +L  LTDLVLNNNT  G++   + N++ L+ L LF N+L GE+P EIG L 
Sbjct  377   ESEIPSTIDKLQNLTDLVLNNNTFVGSLPREIGNISTLEGLFLFGNSLKGEIPVEIGKLK  436

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
             +L  I+LY+N  SG IP E+ NC+SL+ IDF+GN FTG IP T+G+LK+L  LHLR+ND 
Sbjct  437   NLNTIYLYDNQMSGFIPRELTNCTSLREIDFFGNHFTGHIPETIGKLKNLVLLHLRQNDF  496

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
              G IP SLG C  L  L LADN LSG+IP TF YL  L ++ LYNNS EG +P  L +L 
Sbjct  497   HGPIPPSLGYCKSLQILALADNKLSGSIPHTFSYLSELFKITLYNNSFEGPIPHSLSSLK  556

Query  1861  NLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFT  2040
             NL  IN SHN FSGS  P+  S+S    D+TNN+F   IPS L NS +L RLRL  N  T
Sbjct  557   NLKIINFSHNKFSGSFFPLTASNSLTLLDLTNNSFSGSIPSNLANSSNLRRLRLAYNNLT  616

Query  2041  GKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpl  2220
             G IP   G + +L   DLS N L+G +PPQ S  RK+ H+ L+NN LSG IP WLG    
Sbjct  617   GTIPSEFGQLNDLDFFDLSHNSLTGEVPPQFSNSRKIEHILLSNNRLSGEIPPWLGDFQQ  676

Query  2221  lgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLC  2400
             LGEL LS N FSG +P E+ NCS LL LSL +N+L+G +P EIGNL SLNV N+  N L 
Sbjct  677   LGELDLSYNNFSGKVPAEIGNCSNLLKLSLHHNNLSGEIPQEIGNLISLNVFNIQSNSLS  736

Query  2401  GSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLS  2580
             G IPSTI    KLYELRLS+N  +G IP E+G L +LQ +LD S N  +GEIP S+G L 
Sbjct  737   GLIPSTIHQCKKLYELRLSQNFLTGTIPIELGGLDELQVILDLSKNLFSGEIPSSLGNLM  796

Query  2581  KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCG  2760
             KLE L+LS N L G+IP  + +++SL  LNLS N LEG++   ++ +P  SF+ NS LCG
Sbjct  797   KLERLNLSSNQLQGKIPTSLGKLTSLHVLNLSNNHLEGQIPSTFSGFPRSSFLNNSRLCG  856

Query  2761  SPLGSCRDKGSRNKGSM-------VVVISALSATVAIILLLM  2865
              PL SC   GS ++G M        V+I A+  T  +I L+M
Sbjct  857   PPLVSC--SGSTSEGKMQLSNTQVAVIIVAIVFTSTMICLVM  896


 Score =   313 bits (801),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 224/620 (36%), Positives = 325/620 (52%), Gaps = 29/620 (5%)
 Frame = +1

Query  919   KHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNR  1098
             KH+  LNL ++ ++G I  +L  + SL  L+L  N L GSIP  L KL NL++L L  N 
Sbjct  75    KHVIGLNLYDSGISGSISVELSNLISLQILDLSSNSLNGSIPSELGKLQNLRTLQLYSNY  134

Query  1099  LAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQ  1278
             L+G +P E G++ +LQ L +  N L+G IP S+  N   L +L +    L+G IP  + +
Sbjct  135   LSGNIPKEIGNLNKLQVLRIGDNFLTGGIPPSII-NLKELTVLGVGYCHLNGTIPVGIGK  193

Query  1279  CRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHN  1458
              + L  LDL  N+ +G IPEE+     L +   +NN LEG I  S+ +L +L+ ++L +N
Sbjct  194   LKNLTSLDLQMNSFSGHIPEEIQGCENLQNFAASNNMLEGNIPSSIGSLKSLKIINLANN  253

Query  1459  NLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGR  1638
              L G +P  +  L +L  +    N  +GEIP E+ +   LQ +D  GN F+G IP+   +
Sbjct  254   TLSGPIPSSLSYLSNLTYLNFLGNKLNGEIPYELNSLIQLQKLDLSGNNFSGSIPLLNSK  313

Query  1639  LKHLFFLHLRENDLSGEIPAS-------------------------LGNCHQLDTLDLAD  1743
             LK L  L L +N L+G IP S                         L +C  +  LDL+ 
Sbjct  314   LKSLETLVLSDNALTGTIPRSFCFKGSKLQQLFLARNILSGKFPLELLSCSSIQQLDLSG  373

Query  1744  NHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSI-APIC  1920
             N     IP+T   L+ LT L+L NN+  G LP ++ N+  L  + L  N+  G I   I 
Sbjct  374   NSFESEIPSTIDKLQNLTDLVLNNNTFVGSLPREIGNISTLEGLFLFGNSLKGEIPVEIG  433

Query  1921  TSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSG  2100
                +  +  + +N     IP  L N  SL  +    N FTG IP T+G ++ L LL L  
Sbjct  434   KLKNLNTIYLYDNQMSGFIPRELTNCTSLREIDFFGNHFTGHIPETIGKLKNLVLLHLRQ  493

Query  2101  NKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELF  2280
             N   G IPP L  C+ L  L L +N LSG IP     L  L ++ L +N F G +P  L 
Sbjct  494   NDFHGPIPPSLGYCKSLQILALADNKLSGSIPHTFSYLSELFKITLYNNSFEGPIPHSLS  553

Query  2281  NCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSR  2460
             +   L +++  +N  +G+  P   +  SL +L+L +N   GSIPS +     L  LRL+ 
Sbjct  554   SLKNLKIINFSHNKFSGSFFPLTAS-NSLTLLDLTNNSFSGSIPSNLANSSNLRRLRLAY  612

Query  2461  NRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQV  2640
             N  +G IP E GQL DL    D S+N+LTGE+PP      K+E + LS+N L+GEIPP +
Sbjct  613   NNLTGTIPSEFGQLNDLD-FFDLSHNSLTGEVPPQFSNSRKIEHILLSNNRLSGEIPPWL  671

Query  2641  AEMSSLGRLNLSCNELEGEL  2700
              +   LG L+LS N   G++
Sbjct  672   GDFQQLGELDLSYNNFSGKV  691


 Score =   246 bits (627),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 166/438 (38%), Positives = 240/438 (55%), Gaps = 3/438 (1%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
             VG +P ++G ++ L+ L +  N L G+IP   G L NL T+ L    +SG IP +L   T
Sbjct  401   VGSLPREIGNISTLEGLFLFGNSLKGEIPVEIGKLKNLNTIYLYDNQMSGFIPRELTNCT  460

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
              L+ ++   N   G +P  I  + +L       N  +G IP  LG  K L IL LA+N L
Sbjct  461   SLREIDFFGNHFTGHIPETIGKLKNLVLLHLRQNDFHGPIPPSLGYCKSLQILALADNKL  520

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             +G IP     +S L  + L  N   G IP SL+ L NL+ ++ S N+ +G       +  
Sbjct  521   SGSIPHTFSYLSELFKITLYNNSFEGPIPHSLSSLKNLKIINFSHNKFSGSF-FPLTASN  579

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
              L  L LT+N+ SG+IP +L +N++NL+ L L+   L+G IP E  Q   L   DLS+N+
Sbjct  580   SLTLLDLTNNSFSGSIPSNL-ANSSNLRRLRLAYNNLTGTIPSEFGQLNDLDFFDLSHNS  638

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
             L G +P +     ++  ++L+NN L G I P + +   L  L L +NN  G+VP EIG  
Sbjct  639   LTGEVPPQFSNSRKIEHILLSNNRLSGEIPPWLGDFQQLGELDLSYNNFSGKVPAEIGNC  698

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
              +L  + L+ N+ SGEIP EIGN  SL   +   N  +G IP T+ + K L+ L L +N 
Sbjct  699   SNLLKLSLHHNNLSGEIPQEIGNLISLNVFNIQSNSLSGLIPSTIHQCKKLYELRLSQNF  758

Query  1678  LSGEIPASLGNCHQLDT-LDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRN  1854
             L+G IP  LG   +L   LDL+ N  SG IP++ G L  L RL L +N L+G +P  L  
Sbjct  759   LTGTIPIELGGLDELQVILDLSKNLFSGEIPSSLGNLMKLERLNLSSNQLQGKIPTSLGK  818

Query  1855  LGNLTRINLSHNNFSGSI  1908
             L +L  +NLS+N+  G I
Sbjct  819   LTSLHVLNLSNNHLEGQI  836



>gb|KHN18441.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=938

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/760 (51%), Positives = 496/760 (65%), Gaps = 5/760 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IPS++G L  LQ LRIGDN LTG+IP S  N+  L  L L  C+L+G IP  +G+L  
Sbjct  109   GNIPSEIGNLRKLQVLRIGDNMLTGEIPPSVANMSELKVLALGYCHLNGSIPFGIGKLKH  168

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L +L++Q N + G +P EI     L  F+A+ N L G +P  +G LK L ILNLANN+L+
Sbjct  169   LISLDVQMNSINGHIPEEIEGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLANNSLS  228

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP  L  +S+L YLNLLGN+L G IP  L  L  +Q LDLS N L+G +P     +  
Sbjct  229   GSIPTALSHLSNLTYLNLLGNKLHGEIPSELNSLIQMQKLDLSKNNLSGSIPLLNVKLQS  288

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L+ L L+ N L+G+IP + C   + LQ L L+   LSG+ P EL  C  +QQLDLS+N+ 
Sbjct  289   LETLVLSDNALTGSIPSNFCLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQLDLSDNSF  348

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
              G +P  L +L  LTDLVLNNN+  G++ P + N+++L+ L LF N   G++P EIG L 
Sbjct  349   EGKLPSILDKLQNLTDLVLNNNSFVGSLPPEIGNISSLENLFLFGNFFKGKIPLEIGRLQ  408

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
              L  I+LY+N  SG IP E+ NC+SL+ IDF+GN FTG IP T+G+LK L  LHLR+NDL
Sbjct  409   RLSSIYLYDNQMSGLIPRELTNCTSLKEIDFFGNHFTGPIPETIGKLKDLVVLHLRQNDL  468

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
             SG IP S+G C  L  L LADN LSG+IP TF YL  LT++ LYNNS EG +P  L +L 
Sbjct  469   SGPIPPSMGYCKSLQILALADNMLSGSIPPTFSYLSELTKITLYNNSFEGPIPHSLSSLK  528

Query  1861  NLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFT  2040
             +L  IN SHN FSGS  P+  S+S    D+TNN+F   IPS L NS +L RLRLG N  T
Sbjct  529   SLKIINFSHNKFSGSFFPLTCSNSLTLLDLTNNSFSGPIPSTLANSRNLGRLRLGQNYLT  588

Query  2041  GKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpl  2220
             G IP   G + EL+ LDLS N L+G +PPQLS  +K+ H+ +NNN LSG I  WLG L  
Sbjct  589   GTIPSEFGQLTELNFLDLSFNNLTGEVPPQLSNSKKMEHILMNNNRLSGEISDWLGSLQE  648

Query  2221  lgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLC  2400
             LGEL LS N FSG +P EL NCSKLL LSL +N+L+G +P EIGNL SLNVLNL  N   
Sbjct  649   LGELDLSYNNFSGKVPSELGNCSKLLKLSLHHNNLSGEIPQEIGNLTSLNVLNLQRNGFS  708

Query  2401  GSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLS  2580
             G IP TI    KLYELRLS N  +G IP E+G L +LQ +LD S N  TGEIPPS+G L 
Sbjct  709   GLIPPTIQQCTKLYELRLSENLLTGVIPVELGGLAELQVILDLSKNLFTGEIPPSLGNLM  768

Query  2581  KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCG  2760
             KLE L+LS N L G++P  + +++SL  LNLS N LEG++   ++ +P+ +F+ NS LCG
Sbjct  769   KLERLNLSFNQLEGKVPSSLGKLTSLHVLNLSNNHLEGKIPSTFSGFPLSTFLNNSGLCG  828

Query  2761  SPLGSCRDKGSRNK-----GSMVVVISALSATVAIILLLM  2865
              PL SC +   + K       + ++I A+  T  +I L+M
Sbjct  829   PPLRSCSESMVQGKIQLSNTQVAIIIVAIVFTSTVICLVM  868


 Score =   247 bits (631),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 180/497 (36%), Positives = 251/497 (51%), Gaps = 27/497 (5%)
 Frame = +1

Query  1267  ELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLS  1446
             EL     LQ LDLS+N+L+GSIP EL +L  L  L L++N L G I   + NL  LQ L 
Sbjct  66    ELGNFTSLQTLDLSSNSLSGSIPSELGQLQNLRILQLHSNDLSGNIPSEIGNLRKLQVLR  125

Query  1447  LFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPI  1626
             +  N L GE+P  +  + +L+++ L   H +G IP  IG    L  +D   N   G IP 
Sbjct  126   IGDNMLTGEIPPSVANMSELKVLALGYCHLNGSIPFGIGKLKHLISLDVQMNSINGHIPE  185

Query  1627  TLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLM  1806
              +   + L       N L G++P+S+G+   L  L+LA+N LSG+IP    +L  LT L 
Sbjct  186   EIEGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLANNSLSGSIPTALSHLSNLTYLN  245

Query  1807  LYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTS-HSFLSFDVTNNAFDQEIPS  1983
             L  N L G++P +L +L  + +++LS NN SGSI  +     S  +  +++NA    IPS
Sbjct  246   LLGNKLHGEIPSELNSLIQMQKLDLSKNNLSGSIPLLNVKLQSLETLVLSDNALTGSIPS  305

Query  1984  -FLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHL  2160
              F      L +L L  N  +GK P+ L     +  LDLS N   G +P  L   + LT L
Sbjct  306   NFCLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQLDLSDNSFEGKLPSILDKLQNLTDL  365

Query  2161  DLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLP  2340
              LNN                        N F GSLPPE+ N S L  L L  N   G +P
Sbjct  366   VLNN------------------------NSFVGSLPPEIGNISSLENLFLFGNFFKGKIP  401

Query  2341  PEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSV  2520
              EIG L+ L+ + L DNQ+ G IP  +     L E+    N F+G IP  +G+LKDL  V
Sbjct  402   LEIGRLQRLSSIYLYDNQMSGLIPRELTNCTSLKEIDFFGNHFTGPIPETIGKLKDL-VV  460

Query  2521  LDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGEL  2700
             L    N+L+G IPPS+G    L+ L L+ N L+G IPP  + +S L ++ L  N  EG +
Sbjct  461   LHLRQNDLSGPIPPSMGYCKSLQILALADNMLSGSIPPTFSYLSELTKITLYNNSFEGPI  520

Query  2701  DKRYAHWPVDSFVGNSH  2751
                 +       +  SH
Sbjct  521   PHSLSSLKSLKIINFSH  537


 Score =   238 bits (608),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 167/438 (38%), Positives = 237/438 (54%), Gaps = 3/438 (1%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
             VG +P ++G +++L+ L +  N   G+IP   G L  L ++ L    +SGLIP +L   T
Sbjct  373   VGSLPPEIGNISSLENLFLFGNFFKGKIPLEIGRLQRLSSIYLYDNQMSGLIPRELTNCT  432

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
              L+ ++   N   GP+P  I  +  L       N L+G IP  +G  K L IL LA+N L
Sbjct  433   SLKEIDFFGNHFTGPIPETIGKLKDLVVLHLRQNDLSGPIPPSMGYCKSLQILALADNML  492

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             +G IP     +S L  + L  N   G IP SL+ L +L+ ++ S N+ +G          
Sbjct  493   SGSIPPTFSYLSELTKITLYNNSFEGPIPHSLSSLKSLKIINFSHNKFSGSF-FPLTCSN  551

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
              L  L LT+N+ SG IP +L +N+ NL  L L +  L+G IP E  Q   L  LDLS N 
Sbjct  552   SLTLLDLTNNSFSGPIPSTL-ANSRNLGRLRLGQNYLTGTIPSEFGQLTELNFLDLSFNN  610

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
             L G +P +L    ++  +++NNN L G IS  + +L  L  L L +NN  G+VP E+G  
Sbjct  611   LTGEVPPQLSNSKKMEHILMNNNRLSGEISDWLGSLQELGELDLSYNNFSGKVPSELGNC  670

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
               L  + L+ N+ SGEIP EIGN +SL  ++   N F+G IP T+ +   L+ L L EN 
Sbjct  671   SKLLKLSLHHNNLSGEIPQEIGNLTSLNVLNLQRNGFSGLIPPTIQQCTKLYELRLSENL  730

Query  1678  LSGEIPASLGNCHQLDT-LDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRN  1854
             L+G IP  LG   +L   LDL+ N  +G IP + G L  L RL L  N LEG +P  L  
Sbjct  731   LTGVIPVELGGLAELQVILDLSKNLFTGEIPPSLGNLMKLERLNLSFNQLEGKVPSSLGK  790

Query  1855  LGNLTRINLSHNNFSGSI  1908
             L +L  +NLS+N+  G I
Sbjct  791   LTSLHVLNLSNNHLEGKI  808


 Score =   160 bits (405),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 145/456 (32%), Positives = 209/456 (46%), Gaps = 97/456 (21%)
 Frame = +1

Query  1642  KHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNS  1821
             +H+  L+L  + +SG I   LGN   L TLDL+ N LSG+IP+  G L+ L  L L++N 
Sbjct  47    EHVIGLNLSGSGISGSISVELGNFTSLQTLDLSSNSLSGSIPSELGQLQNLRILQLHSND  106

Query  1822  LEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHS-----------------------  1932
             L G++P ++ NL  L  + +  N  +G I P   + S                       
Sbjct  107   LSGNIPSEIGNLRKLQVLRIGDNMLTGEIPPSVANMSELKVLALGYCHLNGSIPFGIGKL  166

Query  1933  --FLSFDV------------------------TNNAFDQEIPSFLGNSPSLDRLRLGSNR  2034
                +S DV                        +NN  + ++PS +G+  SL  L L +N 
Sbjct  167   KHLISLDVQMNSINGHIPEEIEGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLANNS  226

Query  2035  FTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrl  2214
              +G IP  L  +  L+ L+L GNKL G IP +L+   ++  LDL+ N LSG IP+   +L
Sbjct  227   LSGSIPTALSHLSNLTYLNLLGNKLHGEIPSELNSLIQMQKLDLSKNNLSGSIPLLNVKL  286

Query  2215  pllgelklSSNQFSGSLPP-------------------------ELFNCskllvlslenn  2319
               L  L LS N  +GS+P                          EL NCS +  L L +N
Sbjct  287   QSLETLVLSDNALTGSIPSNFCLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQLDLSDN  346

Query  2320  slnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQ  2499
             S  G LP  +  L++L  L L++N   GS+P  IG +  L  L L  N F G+IP E+G+
Sbjct  347   SFEGKLPSILDKLQNLTDLVLNNNSFVGSLPPEIGNISSLENLFLFGNFFKGKIPLEIGR  406

Query  2500  LKDLQSV-----------------------LDFSYNNLTGEIPPSIGTLSKLESLDLSHN  2610
             L+ L S+                       +DF  N+ TG IP +IG L  L  L L  N
Sbjct  407   LQRLSSIYLYDNQMSGLIPRELTNCTSLKEIDFFGNHFTGPIPETIGKLKDLVVLHLRQN  466

Query  2611  DLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAH  2718
             DL+G IPP +    SL  L L+ N L G +   +++
Sbjct  467   DLSGPIPPSMGYCKSLQILALADNMLSGSIPPTFSY  502



>ref|XP_009622846.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Nicotiana tomentosiformis]
Length=975

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/860 (51%), Positives = 561/860 (65%), Gaps = 12/860 (1%)
 Frame = +1

Query  316   LLEVKRSFVLQ---LQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdsslggsispslgl  483
             LL +K  FV     L+ WSE   + C+W GV+C +    +VSLNLS S L GSISP    
Sbjct  34    LLRIKSKFVDPYGVLENWSEGT-SICTWNGVACSNDQSHIVSLNLSSSGLEGSISPEFAH  92

Query  484   lthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDN  663
             LT L  +DLS N L+G IP  L  L +LE LLLFSN L G IP+++G L  LQ LRIG N
Sbjct  93    LTSLRVIDLSDNFLNGTIPLELGELQNLEELLLFSNFLTGDIPAEIGNLRKLQVLRIGAN  152

Query  664   GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIAN  843
              LTGQ+    G L  L  L LA C  SG+IP ++G L  L+NL+LQQN L GP+P  I  
Sbjct  153   MLTGQVIPEIGKLSELRILALAYCQFSGMIPNEIGNLKHLKNLDLQQNSLTGPIPESIGG  212

Query  844   ISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGN  1023
               +L  F+A+ N + G IP  +G L+ L ILNLANN+++G +P +L  +S+L YLNL GN
Sbjct  213   CKNLQNFAASNNRIRGQIPASIGQLESLEILNLANNSISGSVPVELRHLSNLKYLNLFGN  272

Query  1024  QLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCS  1203
              L G IP  L +L  L++LDLS N L+G +      +  LQ LAL+ N L+G+IP + C 
Sbjct  273   DLEGEIPFGLNQLVQLETLDLSNNNLSGIISLLNTQLKNLQTLALSGNFLTGSIPSNFCL  332

Query  1204  NATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNN  1383
               ++L LL+L+E  LSG  P EL  C  L+QLDLS+N   G +P ++  L  LTDL+LNN
Sbjct  333   RGSSLSLLILAENKLSGNFPLELLNCTSLRQLDLSSNNFGGMLPRDIDRLQSLTDLLLNN  392

Query  1384  NTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIG  1563
             N+  GTI P + NLTNL+ L LFHN + G +P EIG L  L  ++LYEN  SG IP+E+ 
Sbjct  393   NSFTGTIPPEIGNLTNLEDLYLFHNMIKGGIPVEIGNLQKLSELYLYENQLSGSIPIELT  452

Query  1564  NCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLAD  1743
             NCSSL  +DF+GNQF+G IP T+GRLK+L  L LR+N+LSG IP SLG C +L  L LAD
Sbjct  453   NCSSLTSVDFFGNQFSGSIPTTIGRLKNLVILQLRQNELSGPIPPSLGYCRKLQKLALAD  512

Query  1744  NHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICT  1923
             N LSG+IP TF +L  L  + LYNNS EG LP+    L N + IN SHN FSGSI+P+  
Sbjct  513   NKLSGSIPPTFRFLSELDLITLYNNSFEGPLPESFSLLKNFSVINFSHNKFSGSISPLAG  572

Query  1924  SHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGN  2103
             SHS    D+TNN+F   IPS L  S +L RLRL +N FTG++P   G + +L  LDLS N
Sbjct  573   SHSLTVLDLTNNSFSGPIPSELALSKNLTRLRLANNFFTGELPSEFGQLEDLRFLDLSFN  632

Query  2104  KLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFN  2283
              L+G + P  S  + L H  L +N  SG IP WLG +  LGEL LS N F+G++P EL N
Sbjct  633   NLTGDLVPAFSGLKNLGHFLLGSNQFSGKIPTWLGGIEGLGELDLSFNNFTGTVPAELGN  692

Query  2284  CskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRN  2463
             C +LL LSL +N L+GT+PPE+GNL SLNVL+L  N L GSIPST+    KLYELRLS N
Sbjct  693   CPRLLKLSLSSNKLSGTIPPELGNLTSLNVLDLQSNNLSGSIPSTLQQCKKLYELRLSEN  752

Query  2464  RFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVA  2643
               SG IP E+G L +LQ +LD S N+L+GEIP S+G L KLE L+LS N L G+IP  + 
Sbjct  753   NLSGSIPFEIGTLSELQVILDLSKNHLSGEIPSSLGNLVKLERLNLSFNQLQGKIPLSLE  812

Query  2644  EMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD-KGSR-----NKG  2805
             ++SSL RLNLS N  +G++   ++ +P+ SF+GN+ LCG PL SC + KG       N G
Sbjct  813   KLSSLHRLNLSYNHFQGQIPSTFSGFPLSSFIGNNKLCGPPLLSCSELKGQETKRLSNAG  872

Query  2806  SM-VVVISALSATVAIILLL  2862
              + + V   L+ATV  ++LL
Sbjct  873   VVGITVAIVLTATVICMVLL  892



>emb|CDY39388.1| BnaAnng05190D [Brassica napus]
Length=934

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/819 (49%), Positives = 500/819 (61%), Gaps = 89/819 (11%)
 Frame = +1

Query  1150  LALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQ-CRVLQQLDLSNNTLNG  1326
             L L+  NL+G+I  S+     N+  L LS   L G IP  LS     L+ L L +N L+G
Sbjct  75    LNLSGLNLTGSISPSI-GRFDNIIDLDLSSNSLVGPIPAALSNLSSSLETLHLFSNLLSG  133

Query  1327  SIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDL  1506
              IP +L  L Q   L L +N LEG I P + N TNL   S   N L+G +P E+  LG+L
Sbjct  134   EIPSQLGSLMQY--LYLRHNYLEGPIPPELGNCTNLVMFSAEANRLNGSLPAELSRLGNL  191

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
             + + L  N  SGEIP ++G+  SL  +   GN+  G IP TL  LK+L  L L +N L+G
Sbjct  192   ESLNLANNSLSGEIPSQLGDLRSLNHLYLIGNKLQGSIPKTLTELKNLRILDLSKNSLTG  251

Query  1687  EIPASLGNCHQLDTL-DLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGN  1863
              I     N +QL+ L +L++N L+G IP +  +L  LT     +N+LEG LP ++  L  
Sbjct  252   GIHEEFWNMNQLEYLLNLSNNTLTGLIPDSLFHLVELT-FGPSHNALEGKLPKEIGFLSK  310

Query  1864  LTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTG  2043
             L R+ L  N FSG                       +IP  +GN  +L  L L  N F+G
Sbjct  311   LERLLLHDNRFSG-----------------------QIPVEIGNCTNLTWLHLRENEFSG  347

Query  2044  KIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpll  2223
              IP TLG  ++L+LLDL+ N L+G IP        L  L L NN L G +P  L  L  L
Sbjct  348   NIPATLGNCQQLTLLDLADNHLTGSIPSSFGFLTALDQLHLYNNSLQGNLPSSLMNLKKL  407

Query  2224  gelklSSNQFSGSLPP-ELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLC  2400
               +  S+N  +GS+ P ++FN SKLLVLSL+ NSLNG++P EIGNL++LNVLNLD NQ+ 
Sbjct  408   TRINFSNNTLNGSISPFDIFNLSKLLVLSLDGNSLNGSIPQEIGNLEALNVLNLDKNQIS  467

Query  2401  GSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLS  2580
             G +PS IG L KLYELRLSRN   G+IP E+GQL+DLQS LD SYNN TG IP +I TL 
Sbjct  468   GQLPSAIGKLSKLYELRLSRNSLIGDIPVEIGQLQDLQSALDLSYNNFTGHIPSTIWTLH  527

Query  2581  KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCG  2760
             KLESLDLSHN L G++P  + +M                          ++FVGN+ LCG
Sbjct  528   KLESLDLSHNHLVGDVPGPIGDMK-------------------------NAFVGNADLCG  562

Query  2761  SPLGSCRDKGSRNKG---SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENY  2931
             SPL  C+  GS+ +G     VV+ISALS+  AI L ++    F K               
Sbjct  563   SPLSPCKRAGSKQQGLSAKTVVIISALSSVAAIALTVLVVVLFCK---------------  607

Query  2932  AsssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGE  3111
                        + PLF N A K DI+W+DIMEAT+ L DEF+IGSGG   VYKA+L NGE
Sbjct  608   -----------QAPLFRNGAAKTDIKWEDIMEATHRLDDEFMIGSGGSGKVYKADLKNGE  656

Query  3112  TVAIKRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGS  3291
             T+A+K+I  KDDL  +KSF RE+KTL  IRHRHLV+LMGYC++K EG N+LIYEYMENGS
Sbjct  657   TIAVKKILWKDDLMSNKSFNREVKTLGTIRHRHLVKLMGYCTSKEEGLNLLIYEYMENGS  716

Query  3292  VWDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSN  3471
             VWDWLH      K K+ L WE RLKIA+GLAQGVEYLH DC P I+HRDIK+SNVLLDSN
Sbjct  717   VWDWLH-----EKKKQVLGWETRLKIALGLAQGVEYLHFDCAPPIVHRDIKTSNVLLDSN  771

Query  3472  MEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             MEAHLGDFGLAK LT+  +  NT S++ FAGSYGYIAPE
Sbjct  772   MEAHLGDFGLAKILTEESNDTNTGSHSLFAGSYGYIAPE  810


 Score =   285 bits (729),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 212/581 (36%), Positives = 302/581 (52%), Gaps = 72/581 (12%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslgg  459
             S+ L+ LLE+K+S V        L+ W+  +PNYC+W GV+C G   +       +    
Sbjct  26    SNDLQTLLELKKSLVANPKDETVLRSWNSDDPNYCNWTGVTCGGREVIGLNLSGLNLT--  83

Query  460   sispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLG-LLTN  636
                                    G I P++    ++  L L SN LVGPIP+ L  L ++
Sbjct  84    -----------------------GSISPSIGRFDNIIDLDLSSNSLVGPIPAALSNLSSS  120

Query  637   LQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllE  816
             L+ L +  N L+G+IP+  G+L  +  L L   YL                        E
Sbjct  121   LETLHLFSNLLSGEIPSQLGSL--MQYLYLRHNYL------------------------E  154

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             GP+PPE+ N ++L  FSA  N LNGS+P EL  L +L  LNLANN+L+GEIP QLG++ S
Sbjct  155   GPIPPELGNCTNLVMFSAEANRLNGSLPAELSRLGNLESLNLANNSLSGEIPSQLGDLRS  214

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLA-LTSNNL  1173
             L +L L+GN+L GSIPK+L +L NL+ LDLS N L G +  EF +M QL++L  L++N L
Sbjct  215   LNHLYLIGNKLQGSIPKTLTELKNLRILDLSKNSLTGGIHEEFWNMNQLEYLLNLSNNTL  274

Query  1174  SGTIPKSLCSNATNLQLLML----SETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEE  1341
             +G IP SL        L+ L    S   L G++P E+     L++L L +N  +G IP E
Sbjct  275   TGLIPDSL------FHLVELTFGPSHNALEGKLPKEIGFLSKLERLLLHDNRFSGQIPVE  328

Query  1342  LYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFL  1521
             +   T LT L L  N   G I  ++ N   L  L L  N+L G +P   G L  L  + L
Sbjct  329   IGNCTNLTWLHLRENEFSGNIPATLGNCQQLTLLDLADNHLTGSIPSSFGFLTALDQLHL  388

Query  1522  YENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKI-PITLGRLKHLFFLHLRENDLSGEIPA  1698
             Y N   G +P  + N   L  I+F  N   G I P  +  L  L  L L  N L+G IP 
Sbjct  389   YNNSLQGNLPSSLMNLKKLTRINFSNNTLNGSISPFDIFNLSKLLVLSLDGNSLNGSIPQ  448

Query  1699  SLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL-TRI  1875
              +GN   L+ L+L  N +SG +P+  G L  L  L L  NSL GD+P ++  L +L + +
Sbjct  449   EIGNLEALNVLNLDKNQISGQLPSAIGKLSKLYELRLSRNSLIGDIPVEIGQLQDLQSAL  508

Query  1876  NLSHNNFSGSI-APICTSHSFLSFDVTNNAFDQEIPSFLGN  1995
             +LS+NNF+G I + I T H   S D+++N    ++P  +G+
Sbjct  509   DLSYNNFTGHIPSTIWTLHKLESLDLSHNHLVGDVPGPIGD  549


 Score =   247 bits (630),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 172/473 (36%), Positives = 253/473 (53%), Gaps = 55/473 (12%)
 Frame = +1

Query  934   LNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKL-TNLQSLDLSGNRLAGE  1110
             LNL+   LTG I   +G   +++ L+L  N L G IP +L+ L ++L++L L  N L+GE
Sbjct  75    LNLSGLNLTGSISPSIGRFDNIIDLDLSSNSLVGPIPAALSNLSSSLETLHLFSNLLSGE  134

Query  1111  LPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVL  1290
             +P + GS+  +Q+L L  N L G IP  L  N TNL +       L+G +P ELS+   L
Sbjct  135   IPSQLGSL--MQYLYLRHNYLEGPIPPEL-GNCTNLVMFSAEANRLNGSLPAELSRLGNL  191

Query  1291  QQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTL---------  1443
             + L+L+NN+L+G IP +L +L  L  L L  N L+G+I  ++  L NL+ L         
Sbjct  192   ESLNLANNSLSGEIPSQLGDLRSLNHLYLIGNKLQGSIPKTLTELKNLRILDLSKNSLTG  251

Query  1444  -----------------------------SLF----------HNNLHGEVPREIGMLGDL  1506
                                          SLF          HN L G++P+EIG L  L
Sbjct  252   GIHEEFWNMNQLEYLLNLSNNTLTGLIPDSLFHLVELTFGPSHNALEGKLPKEIGFLSKL  311

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
             + + L++N FSG+IPVEIGNC++L ++    N+F+G IP TLG  + L  L L +N L+G
Sbjct  312   ERLLLHDNRFSGQIPVEIGNCTNLTWLHLRENEFSGNIPATLGNCQQLTLLDLADNHLTG  371

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDL-PDDLRNLGN  1863
              IP+S G    LD L L +N L G +P++   L+ LTR+   NN+L G + P D+ NL  
Sbjct  372   SIPSSFGFLTALDQLHLYNNSLQGNLPSSLMNLKKLTRINFSNNTLNGSISPFDIFNLSK  431

Query  1864  LTRINLSHNNFSGSI-APICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFT  2040
             L  ++L  N+ +GSI   I    +    ++  N    ++PS +G    L  LRL  N   
Sbjct  432   LLVLSLDGNSLNGSIPQEIGNLEALNVLNLDKNQISGQLPSAIGKLSKLYELRLSRNSLI  491

Query  2041  GKIPMTLGLIREL-SLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIP  2196
             G IP+ +G +++L S LDLS N  +G IP  +    KL  LDL++N L G +P
Sbjct  492   GDIPVEIGQLQDLQSALDLSYNNFTGHIPSTIWTLHKLESLDLSHNHLVGDVP  544


 Score =   237 bits (604),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 181/516 (35%), Positives = 256/516 (50%), Gaps = 100/516 (19%)
 Frame = +1

Query  1078  LDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGE  1257
             L+LSG  L G +    G    +  L L+SN+L G IP +L + +++L+ L L    LSGE
Sbjct  75    LNLSGLNLTGSISPSIGRFDNIIDLDLSSNSLVGPIPAALSNLSSSLETLHLFSNLLSGE  134

Query  1258  ----------------------IPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDL  1371
                                   IPPEL  C  L       N LNGS+P EL  L  L  L
Sbjct  135   IPSQLGSLMQYLYLRHNYLEGPIPPELGNCTNLVMFSAEANRLNGSLPAELSRLGNLESL  194

Query  1372  VLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFS----  1539
              L NN+L G I   + +L +L  L L  N L G +P+ +  L +L+I+ L +N  +    
Sbjct  195   NLANNSLSGEIPSQLGDLRSLNHLYLIGNKLQGSIPKTLTELKNLRILDLSKNSLTGGIH  254

Query  1540  --------------------------------------------GEIPVEIGNCSSLQFI  1587
                                                         G++P EIG  S L+ +
Sbjct  255   EEFWNMNQLEYLLNLSNNTLTGLIPDSLFHLVELTFGPSHNALEGKLPKEIGFLSKLERL  314

Query  1588  DFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIP  1767
               + N+F+G+IP+ +G   +L +LHLREN+ SG IPA+LGNC QL  LDLADNHL+G+IP
Sbjct  315   LLHDNRFSGQIPVEIGNCTNLTWLHLRENEFSGNIPATLGNCQQLTLLDLADNHLTGSIP  374

Query  1768  ATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP--ICTSHSFLS  1941
             ++FG+L AL +L LYNNSL+G+LP  L NL  LTRIN S+N  +GSI+P  I      L 
Sbjct  375   SSFGFLTALDQLHLYNNSLQGNLPSSLMNLKKLTRINFSNNTLNGSISPFDIFNLSKLLV  434

Query  1942  FDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFI  2121
               +  N+ +  IP  +GN  +L+ L L  N+ +G++P  +G + +L  L LS N L G I
Sbjct  435   LSLDGNSLNGSIPQEIGNLEALNVLNLDKNQISGQLPSAIGKLSKLYELRLSRNSLIGDI  494

Query  2122  PPQLSLCRKL-THLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskll  2298
             P ++   + L + LDL                        S N F+G +P  ++   KL 
Sbjct  495   PVEIGQLQDLQSALDL------------------------SYNNFTGHIPSTIWTLHKLE  530

Query  2299  vlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
              L L +N L G +P  IG++K+  V N D   LCGS
Sbjct  531   SLDLSHNHLVGDVPGPIGDMKNAFVGNAD---LCGS  563


 Score =   102 bits (253),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 107/204 (52%), Gaps = 26/204 (13%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP+ LG    L  L + DN LTG IP+SFG L  L  L L +  L G +P  L  L +
Sbjct  347   GNIPATLGNCQQLTLLDLADNHLTGSIPSSFGFLTALDQLHLYNNSLQGNLPSSLMNLKK  406

Query  781   lqnlnlqqnllEGPLPP-EIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
             L  +N   N L G + P +I N+S L   S   NSLNGSIP+E+G L+ L++LNL  N +
Sbjct  407   LTRINFSNNTLNGSISPFDIFNLSKLLVLSLDGNSLNGSIPQEIGNLEALNVLNLDKNQI  466

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQS--------------------  1077
             +G++P  +G++S L  L L  N L G IP  + +L +LQS                    
Sbjct  467   SGQLPSAIGKLSKLYELRLSRNSLIGDIPVEIGQLQDLQSALDLSYNNFTGHIPSTIWTL  526

Query  1078  -----LDLSGNRLAGELPGEFGSM  1134
                  LDLS N L G++PG  G M
Sbjct  527   HKLESLDLSHNHLVGDVPGPIGDM  550


 Score = 99.0 bits (245),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 90/237 (38%), Positives = 124/237 (52%), Gaps = 26/237 (11%)
 Frame = +1

Query  2071  RELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIP------------------  2196
             RE+  L+LSG  L+G I P +     +  LDL++N L GPIP                  
Sbjct  70    REVIGLNLSGLNLTGSISPSIGRFDNIIDLDLSSNSLVGPIPAALSNLSSSLETLHLFSN  129

Query  2197  -----VWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLK  2361
                  +      L+  L L  N   G +PPEL NC+ L++ S E N LNG+LP E+  L 
Sbjct  130   LLSGEIPSQLGSLMQYLYLRHNYLEGPIPPELGNCTNLVMFSAEANRLNGSLPAELSRLG  189

Query  2362  SLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNN  2541
             +L  LNL +N L G IPS +G L  L  L L  N+  G IP+ + +LK+L+ +LD S N+
Sbjct  190   NLESLNLANNSLSGEIPSQLGDLRSLNHLYLIGNKLQGSIPKTLTELKNLR-ILDLSKNS  248

Query  2542  LTGEIPPSIGTLSKLES-LDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKR  2709
             LTG I      +++LE  L+LS+N LTG IP  +  +  L     S N LEG+L K 
Sbjct  249   LTGGIHEEFWNMNQLEYLLNLSNNTLTGLIPDSLFHLVEL-TFGPSHNALEGKLPKE  304



>ref|XP_008796001.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Phoenix dactylifera]
Length=977

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/896 (49%), Positives = 570/896 (64%), Gaps = 15/896 (2%)
 Frame = +1

Query  286   CQNTSSTLRVLLEVKRSFVLQLQG----WSEKNPNYCSWQGVSC-DGslkvvslnlsdss  450
             C + S+    LL++K  F+  L+G    WS    + CSW GV+C      V+ LNLS   
Sbjct  24    CGDASTNSEALLQIKSEFI-DLEGVLSNWSLGGGDICSWNGVACLASRSHVLGLNLSGHG  82

Query  451   lggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLL  630
             L GSIS  +G L  L  LDLSSN L+G IPP L  L +L  L L+SN L GPIP +LGLL
Sbjct  83    LSGSISSKIGSLVSLQTLDLSSNSLTGAIPPELGLLKNLRELFLYSNSLSGPIPPELGLL  142

Query  631   TNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnl  810
               L+ LRIG+NGL+G+IP   G+   L  LGLASC L+G IP ++G L  L++LNLQ N 
Sbjct  143   KKLKILRIGNNGLSGEIPPHLGSCTELEILGLASCQLNGTIPKEMGNLKHLKSLNLQNNR  202

Query  811   lEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEM  990
             L G +PPE+     L   SAA N L G IP  +GGL  L ILNL NN L+G IP +LG +
Sbjct  203   LGGLIPPELGGCGELQVLSAAANRLEGGIPSTVGGLNALQILNLMNNQLSGSIPIELGNL  262

Query  991   SSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNN  1170
             SSL YLNLLGN+L G+IP  L +L  LQ LDLS N L+G +      +  L++L L+ N+
Sbjct  263   SSLTYLNLLGNRLSGAIPPELNQLRQLQILDLSDNDLSGAIDLSTRHLNSLEYLVLSKNS  322

Query  1171  LSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYE  1350
             L G I ++LC  + +L+ L L+E  L+G +   L  C  L+ LDLSNN+L+GSIP ++  
Sbjct  323   LHGGIDENLCPESASLRNLFLAENNLTGTME-GLLNCASLRSLDLSNNSLSGSIPSDIDR  381

Query  1351  LTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYEN  1530
             L  L DLVL+NN+L G + P V N+++L+ LS+FHN L GE+P EIG L  L +++LYEN
Sbjct  382   LANLVDLVLHNNSLVGVLPPQVGNMSDLEMLSVFHNGLTGEIPAEIGRLQRLTLLYLYEN  441

Query  1531  HFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGN  1710
               +G IP E+ NCS L+ IDF+GN FTG IP T+GRL++L  L LR+N+LSG IP SLG 
Sbjct  442   QMAGTIPRELTNCSRLEEIDFFGNHFTGPIPETMGRLENLVVLQLRQNELSGPIPPSLGY  501

Query  1711  CHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHN  1890
             C +L  L LADN LSGA+P T G+L  L  + LYNNSLEG LP+ +  L NL  IN SHN
Sbjct  502   CRRLQALALADNQLSGALPRTLGFLAELRLVTLYNNSLEGPLPESVFRLKNLAIINFSHN  561

Query  1891  NFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLI  2070
              F+GSI+P+  S +    D+TNN+F   IP  LG + +L RLRLG N  +G +P  +G +
Sbjct  562   RFAGSISPLLGSRALAKMDLTNNSFSGAIPPVLGEARNLTRLRLGRNLLSGTVPAEVGRL  621

Query  2071  RELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQ  2250
               L  LDLS N L+G IP +LS CR+LTHL L  N L+G IP W G L  LGEL LSSN 
Sbjct  622   EGLGFLDLSSNNLTGGIPLELSECRQLTHLLLGGNRLTGTIPRWFGSLRSLGELDLSSND  681

Query  2251  FSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGL  2430
             F G +P EL NCS LL +SL +N L+G +PPE+G L SLNVL L  N L G IPS I   
Sbjct  682   FRGDVPAELGNCSGLLKISLHDNRLSGIIPPEMGRLTSLNVLALQRNHLSGPIPSAIQHC  741

Query  2431  GKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHN  2610
              KLYELRLS N  SG IP E+GQL +LQ +LD S N+L+G IPPS+G L KLE LD+S N
Sbjct  742   DKLYELRLSDNFLSGWIPPELGQLTELQVILDLSRNHLSGGIPPSLGHLIKLERLDVSFN  801

Query  2611  DLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD-K  2787
              L G IPP +  ++SL +LNLS N L+G +    +++P  SF+G + LCG+PL SC    
Sbjct  802   RLQGPIPPSLERLTSLHQLNLSNNLLQGPIPTALSNFPSSSFLGGNQLCGAPLASCTPLS  861

Query  2788  GSRNK-------GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYA  2934
             GS  K         +   I+ +SA V ++LL +    +      +     G+E  A
Sbjct  862   GSDAKRLSNAQVAGITAAIAFVSAAVCLVLLYIIIRMWSDWREVSVSNSDGEEQEA  917



>ref|XP_003550728.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=971

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/760 (51%), Positives = 496/760 (65%), Gaps = 5/760 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IPS++G L  LQ LRIGDN LTG+IP S  N+  L  L L  C+L+G IP  +G+L  
Sbjct  142   GNIPSEIGNLRKLQVLRIGDNMLTGEIPPSVANMSELKVLALGYCHLNGSIPFGIGKLKH  201

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L +L++Q N + G +P EI     L  F+A+ N L G +P  +G LK L ILNLANN+L+
Sbjct  202   LISLDVQMNSINGHIPEEIEGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLANNSLS  261

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP  L  +S+L YLNLLGN+L G IP  L  L  +Q LDLS N L+G +P     +  
Sbjct  262   GSIPTALSHLSNLTYLNLLGNKLHGEIPSELNSLIQMQKLDLSKNNLSGSIPLLNVKLQS  321

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L+ L L+ N L+G+IP + C   + LQ L L+   LSG+ P EL  C  +QQLDLS+N+ 
Sbjct  322   LETLVLSDNALTGSIPSNFCLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQLDLSDNSF  381

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
              G +P  L +L  LTDLVLNNN+  G++ P + N+++L+ L LF N   G++P EIG L 
Sbjct  382   EGKLPSILDKLQNLTDLVLNNNSFVGSLPPEIGNISSLENLFLFGNFFKGKIPLEIGRLQ  441

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
              L  I+LY+N  SG IP E+ NC+SL+ IDF+GN FTG IP T+G+LK L  LHLR+NDL
Sbjct  442   RLSSIYLYDNQMSGLIPRELTNCTSLKEIDFFGNHFTGPIPETIGKLKDLVVLHLRQNDL  501

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
             SG IP S+G C  L  L LADN LSG+IP TF YL  LT++ LYNNS EG +P  L +L 
Sbjct  502   SGPIPPSMGYCKSLQILALADNMLSGSIPPTFSYLSELTKITLYNNSFEGPIPHSLSSLK  561

Query  1861  NLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFT  2040
             +L  IN SHN FSGS  P+  S+S    D+TNN+F   IPS L NS +L RLRLG N  T
Sbjct  562   SLKIINFSHNKFSGSFFPLTCSNSLTLLDLTNNSFSGPIPSTLANSRNLGRLRLGQNYLT  621

Query  2041  GKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpl  2220
             G IP   G + EL+ LDLS N L+G +PPQLS  +K+ H+ +NNN LSG I  WLG L  
Sbjct  622   GTIPSEFGQLTELNFLDLSFNNLTGEVPPQLSNSKKMEHILMNNNRLSGEISDWLGSLQE  681

Query  2221  lgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLC  2400
             LGEL LS N FSG +P EL NCSKLL LSL +N+L+G +P EIGNL SLNVLNL  N   
Sbjct  682   LGELDLSYNNFSGKVPSELGNCSKLLKLSLHHNNLSGEIPQEIGNLTSLNVLNLQRNGFS  741

Query  2401  GSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLS  2580
             G IP TI    KLYELRLS N  +G IP E+G L +LQ +LD S N  TGEIPPS+G L 
Sbjct  742   GLIPPTIQQCTKLYELRLSENLLTGVIPVELGGLAELQVILDLSKNLFTGEIPPSLGNLM  801

Query  2581  KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCG  2760
             KLE L+LS N L G++P  + +++SL  LNLS N LEG++   ++ +P+ +F+ NS LCG
Sbjct  802   KLERLNLSFNQLEGKVPSSLGKLTSLHVLNLSNNHLEGKIPSTFSGFPLSTFLNNSGLCG  861

Query  2761  SPLGSCRDKGSRNK-----GSMVVVISALSATVAIILLLM  2865
              PL SC +   + K       + ++I A+  T  +I L+M
Sbjct  862   PPLRSCSESMVQGKIQLSNTQVAIIIVAIVFTSTVICLVM  901


 Score =   246 bits (628),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 181/497 (36%), Positives = 255/497 (51%), Gaps = 27/497 (5%)
 Frame = +1

Query  1267  ELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLS  1446
             EL     LQ LDLS+N+L+GSIP EL                          L NL+ L 
Sbjct  99    ELGNFTSLQTLDLSSNSLSGSIPSEL------------------------GQLQNLRILQ  134

Query  1447  LFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPI  1626
             L+ N+L G +P EIG L  LQ++ + +N  +GEIP  + N S L+ +        G IP 
Sbjct  135   LYSNDLSGNIPSEIGNLRKLQVLRIGDNMLTGEIPPSVANMSELKVLALGYCHLNGSIPF  194

Query  1627  TLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLM  1806
              +G+LKHL  L ++ N ++G IP  +  C +L     ++N L G +P++ G L++L  L 
Sbjct  195   GIGKLKHLISLDVQMNSINGHIPEEIEGCEELQNFAASNNMLEGDLPSSMGSLKSLKILN  254

Query  1807  LYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSI-APICTSHSFLSFDVTNNAFDQEIPS  1983
             L NNSL G +P  L +L NLT +NL  N   G I + + +       D++ N     IP 
Sbjct  255   LANNSLSGSIPTALSHLSNLTYLNLLGNKLHGEIPSELNSLIQMQKLDLSKNNLSGSIPL  314

Query  1984  FLGNSPSLDRLRLGSNRFTGKIPMTLGLI-RELSLLDLSGNKLSGFIPPQLSLCRKLTHL  2160
                   SL+ L L  N  TG IP    L   +L  L L+ N LSG  P +L  C  +  L
Sbjct  315   LNVKLQSLETLVLSDNALTGSIPSNFCLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQL  374

Query  2161  DLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLP  2340
             DL++N   G +P  L +L  L +L L++N F GSLPPE+ N S L  L L  N   G +P
Sbjct  375   DLSDNSFEGKLPSILDKLQNLTDLVLNNNSFVGSLPPEIGNISSLENLFLFGNFFKGKIP  434

Query  2341  PEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSV  2520
              EIG L+ L+ + L DNQ+ G IP  +     L E+    N F+G IP  +G+LKDL  V
Sbjct  435   LEIGRLQRLSSIYLYDNQMSGLIPRELTNCTSLKEIDFFGNHFTGPIPETIGKLKDL-VV  493

Query  2521  LDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGEL  2700
             L    N+L+G IPPS+G    L+ L L+ N L+G IPP  + +S L ++ L  N  EG +
Sbjct  494   LHLRQNDLSGPIPPSMGYCKSLQILALADNMLSGSIPPTFSYLSELTKITLYNNSFEGPI  553

Query  2701  DKRYAHWPVDSFVGNSH  2751
                 +       +  SH
Sbjct  554   PHSLSSLKSLKIINFSH  570


 Score =   238 bits (607),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 167/438 (38%), Positives = 237/438 (54%), Gaps = 3/438 (1%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
             VG +P ++G +++L+ L +  N   G+IP   G L  L ++ L    +SGLIP +L   T
Sbjct  406   VGSLPPEIGNISSLENLFLFGNFFKGKIPLEIGRLQRLSSIYLYDNQMSGLIPRELTNCT  465

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
              L+ ++   N   GP+P  I  +  L       N L+G IP  +G  K L IL LA+N L
Sbjct  466   SLKEIDFFGNHFTGPIPETIGKLKDLVVLHLRQNDLSGPIPPSMGYCKSLQILALADNML  525

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             +G IP     +S L  + L  N   G IP SL+ L +L+ ++ S N+ +G          
Sbjct  526   SGSIPPTFSYLSELTKITLYNNSFEGPIPHSLSSLKSLKIINFSHNKFSGSF-FPLTCSN  584

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
              L  L LT+N+ SG IP +L +N+ NL  L L +  L+G IP E  Q   L  LDLS N 
Sbjct  585   SLTLLDLTNNSFSGPIPSTL-ANSRNLGRLRLGQNYLTGTIPSEFGQLTELNFLDLSFNN  643

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
             L G +P +L    ++  +++NNN L G IS  + +L  L  L L +NN  G+VP E+G  
Sbjct  644   LTGEVPPQLSNSKKMEHILMNNNRLSGEISDWLGSLQELGELDLSYNNFSGKVPSELGNC  703

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
               L  + L+ N+ SGEIP EIGN +SL  ++   N F+G IP T+ +   L+ L L EN 
Sbjct  704   SKLLKLSLHHNNLSGEIPQEIGNLTSLNVLNLQRNGFSGLIPPTIQQCTKLYELRLSENL  763

Query  1678  LSGEIPASLGNCHQLDT-LDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRN  1854
             L+G IP  LG   +L   LDL+ N  +G IP + G L  L RL L  N LEG +P  L  
Sbjct  764   LTGVIPVELGGLAELQVILDLSKNLFTGEIPPSLGNLMKLERLNLSFNQLEGKVPSSLGK  823

Query  1855  LGNLTRINLSHNNFSGSI  1908
             L +L  +NLS+N+  G I
Sbjct  824   LTSLHVLNLSNNHLEGKI  841


 Score =   162 bits (409),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 146/456 (32%), Positives = 209/456 (46%), Gaps = 97/456 (21%)
 Frame = +1

Query  1642  KHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNS  1821
             +H+  L+L  + +SG I   LGN   L TLDL+ N LSG+IP+  G L+ L  L LY+N 
Sbjct  80    EHVIGLNLSGSGISGSISVELGNFTSLQTLDLSSNSLSGSIPSELGQLQNLRILQLYSND  139

Query  1822  LEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHS-----------------------  1932
             L G++P ++ NL  L  + +  N  +G I P   + S                       
Sbjct  140   LSGNIPSEIGNLRKLQVLRIGDNMLTGEIPPSVANMSELKVLALGYCHLNGSIPFGIGKL  199

Query  1933  --FLSFDV------------------------TNNAFDQEIPSFLGNSPSLDRLRLGSNR  2034
                +S DV                        +NN  + ++PS +G+  SL  L L +N 
Sbjct  200   KHLISLDVQMNSINGHIPEEIEGCEELQNFAASNNMLEGDLPSSMGSLKSLKILNLANNS  259

Query  2035  FTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrl  2214
              +G IP  L  +  L+ L+L GNKL G IP +L+   ++  LDL+ N LSG IP+   +L
Sbjct  260   LSGSIPTALSHLSNLTYLNLLGNKLHGEIPSELNSLIQMQKLDLSKNNLSGSIPLLNVKL  319

Query  2215  pllgelklSSNQFSGSLPP-------------------------ELFNCskllvlslenn  2319
               L  L LS N  +GS+P                          EL NCS +  L L +N
Sbjct  320   QSLETLVLSDNALTGSIPSNFCLRGSKLQQLFLARNMLSGKFPLELLNCSSIQQLDLSDN  379

Query  2320  slnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQ  2499
             S  G LP  +  L++L  L L++N   GS+P  IG +  L  L L  N F G+IP E+G+
Sbjct  380   SFEGKLPSILDKLQNLTDLVLNNNSFVGSLPPEIGNISSLENLFLFGNFFKGKIPLEIGR  439

Query  2500  LKDLQSV-----------------------LDFSYNNLTGEIPPSIGTLSKLESLDLSHN  2610
             L+ L S+                       +DF  N+ TG IP +IG L  L  L L  N
Sbjct  440   LQRLSSIYLYDNQMSGLIPRELTNCTSLKEIDFFGNHFTGPIPETIGKLKDLVVLHLRQN  499

Query  2611  DLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAH  2718
             DL+G IPP +    SL  L L+ N L G +   +++
Sbjct  500   DLSGPIPPSMGYCKSLQILALADNMLSGSIPPTFSY  535



>ref|XP_007036300.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY20801.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=969

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/830 (49%), Positives = 528/830 (64%), Gaps = 2/830 (0%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             G IPP +  L +L +LLL+SN L G IP ++GLL  LQ LRIGDN L GQIP + GNL  
Sbjct  108   GSIPPEIGQLQNLRTLLLYSNSLSGKIPPEIGLLKKLQVLRIGDNMLAGQIPPNIGNLTE  167

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L  LGLA C L+G IP ++G L  L +L+LQ+N L G +P EI     L  F+A+ N L+
Sbjct  168   LRVLGLAYCQLNGSIPAEIGNLKNLISLDLQENSLSGLIPTEIHGCDELQNFAASNNKLD  227

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             G IP  +G L+ L ILNLANN+++G IP +L  +S+L YLNLLGN+L G IP  L  L  
Sbjct  228   GEIPASIGKLQSLQILNLANNSISGLIPTELSHLSNLQYLNLLGNRLNGEIPSELNHLVQ  287

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             LQ LDLS N L+G +      +  L+ L L  N  +G+IP + C   +NLQ L L++  L
Sbjct  288   LQKLDLSSNNLSGSINLFNIQLQNLEVLVLADNAFTGSIPSNFCLKNSNLQQLFLAQNKL  347

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
             SG  P EL  C +LQQLDLSNN   G +P    +L  LTDL+LNNN+  G++ P + N++
Sbjct  348   SGGFPLELLNCSLLQQLDLSNNNFEGELPPSFDKLQNLTDLLLNNNSFSGSLPPGIGNMS  407

Query  1429  NLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQF  1608
             NL+ L LF N + G +P EIG L  L  I+LY+N  SG IP+++ NC+SL  IDF+GN F
Sbjct  408   NLENLYLFDNMITGSIPVEIGKLQRLSTIYLYDNQMSGSIPMQLTNCTSLAAIDFFGNHF  467

Query  1609  TGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLR  1788
             +G IP T+G+LK+L  L LR+NDLSG IP SLG C +L  L LADN LSG +P TF +L 
Sbjct  468   SGSIPETIGKLKNLVLLQLRQNDLSGPIPPSLGYCKRLQQLALADNKLSGVLPPTFRFLS  527

Query  1789  ALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFD  1968
              L+ + LYNNS EG LP+ L  L NL  IN SHN FSG+I P+  S+S  + D+TNN+F 
Sbjct  528   ELSTVTLYNNSFEGPLPESLSYLKNLKIINFSHNKFSGTIFPLTGSNSLTALDLTNNSFS  587

Query  1969  QEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRK  2148
               IPS L  S +L RLRL +N  TG IP  LG + +L+ LDLS N L+G +P QLS C+K
Sbjct  588   GSIPSTLAISKTLTRLRLATNLLTGNIPSELGQLTKLAFLDLSFNHLTGEVPSQLSSCQK  647

Query  2149  LTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsln  2328
             L HL LNNN  +G +P WLG L  LGEL LSSN F G +P EL NCS+LL LSL+ N+L+
Sbjct  648   LQHLLLNNNQFTGKMPNWLGSLQELGELHLSSNNFHGPVPAELGNCSRLLKLSLDTNNLS  707

Query  2329  GTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKD  2508
             G +P EIG L SLNVLNL  N L GSIP TI    KLYELRLS N F+G IP E+G+L +
Sbjct  708   GEIPQEIGELTSLNVLNLQRNNLSGSIPPTIQQCKKLYELRLSENFFTGSIPSELGRLTE  767

Query  2509  LQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNEL  2688
             LQ +LD S N L GEIP S+G L KLE L+LS N L GE+P  + +++SL  LNLS N L
Sbjct  768   LQVILDLSRNLLCGEIPSSLGNLLKLERLNLSFNRLQGEVPSSLGKLTSLDMLNLSNNHL  827

Query  2689  EGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKG--SRNKGSMVVVISALSATVAIILLL  2862
             +GEL   ++ +P+ SF GN  LCG PL SC D     +NK S   VI  + A V    ++
Sbjct  828   QGELPSTFSGFPLSSFSGNDKLCGPPLSSCMDSAGHEKNKLSNTAVICIIVAIVFTSTVI  887

Query  2863  MGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGNAAKKRDIRW  3012
                  +         R+    N   +     + + K ++G+  K++   W
Sbjct  888   CLVLIYIMLRIWCNWRKVSISNSEGAGIEQKREEEKWVYGDEKKRKGEYW  937


 Score =   293 bits (751),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 233/640 (36%), Positives = 328/640 (51%), Gaps = 76/640 (12%)
 Frame = +1

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             ++ LNL  ++L GS+P     L++LQ+LDLS N L G +P E G +  L+ L L SN+LS
Sbjct  72    VIGLNLSASRLSGSLPPEFWNLSSLQTLDLSLNFLTGSIPPEIGQLQNLRTLLLYSNSLS  131

Query  1177  GTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
             G IP  +      LQ+L + +  L+G+IPP +     L+ L L+   LNGSIP E+  L 
Sbjct  132   GKIPPEI-GLLKKLQVLRIGDNMLAGQIPPNIGNLTELRVLGLAYCQLNGSIPAEIGNLK  190

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
              L  L L  N+L G I   +     LQ  +  +N L GE+P  IG L  LQI+ L  N  
Sbjct  191   NLISLDLQENSLSGLIPTEIHGCDELQNFAASNNKLDGEIPASIGKLQSLQILNLANNSI  250

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
             SG IP E+ + S+LQ+++  GN+  G+IP  L  L  L  L L  N+LSG I        
Sbjct  251   SGLIPTELSHLSNLQYLNLLGNRLNGEIPSELNHLVQLQKLDLSSNNLSGSINLFNIQLQ  310

Query  1717  QLDTLDLADNHLSGAIPATFGYLRA-LTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNN  1893
              L+ L LADN  +G+IP+ F    + L +L L  N L G  P +L N   L +++LS+NN
Sbjct  311   NLEVLVLADNAFTGSIPSNFCLKNSNLQQLFLAQNKLSGGFPLELLNCSLLQQLDLSNNN  370

Query  1894  FSGSIAPICTSHSFLSFD---------VTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
             F G + P        SFD         + NN+F   +P  +GN  +L+ L L  N  TG 
Sbjct  371   FEGELPP--------SFDKLQNLTDLLLNNNSFSGSLPPGIGNMSNLENLYLFDNMITGS  422

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             IP+ +G ++ LS + L  N++SG IP QL+ C  L  +D   N  SG IP  +G+L  L 
Sbjct  423   IPVEIGKLQRLSTIYLYDNQMSGSIPMQLTNCTSLAAIDFFGNHFSGSIPETIGKLKNLV  482

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPE--------------------  2346
              L+L  N  SG +PP L  C +L  L+L +N L+G LPP                     
Sbjct  483   LLQLRQNDLSGPIPPSLGYCKRLQQLALADNKLSGVLPPTFRFLSELSTVTLYNNSFEGP  542

Query  2347  -------IGNLK--------------------SLNVLNLDDNQLCGSIPSTIGGLGKLYE  2445
                    + NLK                    SL  L+L +N   GSIPST+     L  
Sbjct  543   LPESLSYLKNLKIINFSHNKFSGTIFPLTGSNSLTALDLTNNSFSGSIPSTLAISKTLTR  602

Query  2446  LRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGE  2625
             LRL+ N  +G IP E+GQL  L + LD S+N+LTGE+P  + +  KL+ L L++N  TG+
Sbjct  603   LRLATNLLTGNIPSELGQLTKL-AFLDLSFNHLTGEVPSQLSSCQKLQHLLLNNNQFTGK  661

Query  2626  IPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGN  2745
             +P  +  +  LG L+LS N           H PV + +GN
Sbjct  662   MPNWLGSLQELGELHLSSNNF---------HGPVPAELGN  692



>ref|XP_010037542.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Eucalyptus grandis]
Length=969

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/782 (50%), Positives = 515/782 (66%), Gaps = 3/782 (0%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             G IPP LS L +L+SLLL SN L G IP +LGLL  LQ LRIG+N L+G+I    GNL  
Sbjct  108   GSIPPELSKLQNLKSLLLHSNSLSGEIPVELGLLKKLQVLRIGNNLLSGKITPDIGNLSE  167

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L  LGLA C  +G IPP++G L  L  L+L+ N L G +P EI++   L  F+A+ N L 
Sbjct  168   LRVLGLAYCQFNGSIPPEIGSLKNLMYLDLETNGLSGRIPQEISSCEVLEIFAASNNKLE  227

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             G I   +G LK L  LNLANN+LTG IP ++G +S+L YLNLLGN+L G IP+ L  L  
Sbjct  228   GEILSWVGSLKELQTLNLANNSLTGPIPTEIGGLSNLRYLNLLGNKLTGEIPRELNGLVQ  287

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             L++LDLS N L+G +      +  L  L L+ N L G +P + CS+ ++L  L+L+   L
Sbjct  288   LETLDLSKNNLSGSISLSATQLKNLSALFLSDNKLMGGVPNNFCSSTSSLIQLVLARNEL  347

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
             SGE P EL  C  LQQLDLS+N+  GS+P  L  L +LTDL+LNNN+  G + P + N++
Sbjct  348   SGEFPMELINCSSLQQLDLSDNSFEGSLPSSLDRLQELTDLILNNNSFTGVLPPEIGNIS  407

Query  1429  NLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQF  1608
              ++ L L HN   G +P ++G L  L I+ L+EN  +G IP E+ +C+SL  IDF+GN F
Sbjct  408   TMENLYLSHNMFMGSIPEQLGKLDKLSILHLFENQMNGSIPRELTDCTSLTEIDFFGNYF  467

Query  1609  TGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLR  1788
             +G IP T+G+LK+L  LHLR+N+LSG +P SLG C +L  L LADN LSG +P TF +L 
Sbjct  468   SGSIPATIGKLKNLVVLHLRQNELSGPVPPSLGYCTKLQLLALADNKLSGFLPPTFQFLS  527

Query  1789  ALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFD  1968
              L+ L LYNNSLEG LP+    L +L +INLSHN F G+I  +C  H   + D+TNN+F 
Sbjct  528   ELSTLTLYNNSLEGPLPESFSLLKSLRKINLSHNRFEGTITALCGLHLLTAIDLTNNSFS  587

Query  1969  QEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRK  2148
               IPS LG S +L R+RL  N  TG IP  LG + EL  LDLS N L G +P QLS C K
Sbjct  588   GPIPSTLGMSMNLARIRLAHNHLTGNIPSQLGQLTELIFLDLSFNNLDGNVPSQLSNCGK  647

Query  2149  LTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsln  2328
             L HL L+NN  +G IP WLG L  LGEL LS N   GS+P EL NCSKLL LSL +N+L+
Sbjct  648   LEHLLLSNNNFTGAIPSWLGGLEELGELDLSFNALKGSIPGELGNCSKLLKLSLHSNNLS  707

Query  2329  GTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKD  2508
             G +PPEIGNL +LNVL+L  N L G+IPSTI    KL+ELRLS N  +G IP E+G+L +
Sbjct  708   GLIPPEIGNLIALNVLDLQKNNLSGTIPSTIKQCTKLFELRLSENFLTGPIPSELGRLTE  767

Query  2509  LQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNEL  2688
             LQ +LD S+N+ +GEIP S+G + KLE L+LS N L GE+PP + E++SL  LNLS N L
Sbjct  768   LQVILDLSWNSFSGEIPSSLGNMVKLERLNLSSNQLQGEVPPSLGELTSLHMLNLSNNHL  827

Query  2689  EGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKG---SRNKGSMVVVISALSATVAIILL  2859
             +G L   ++ + + SF+GN  LCG PL SC  +    S +KG +  +++A+    A+I L
Sbjct  828   QGRLPPTFSKFRLSSFLGNKDLCGPPLASCSSQAMEKSLSKGEVAGIVAAIVFISALICL  887

Query  2860  LM  2865
              M
Sbjct  888   AM  889


 Score =   300 bits (767),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 234/615 (38%), Positives = 329/615 (53%), Gaps = 29/615 (5%)
 Frame = +1

Query  934   LNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGEL  1113
             LNL+N+ L+G I    G ++SL  L+L  N L GSIP  L+KL NL+SL L  N L+GE+
Sbjct  75    LNLSNSGLSGPISPDYGFLTSLEMLDLSSNSLTGSIPPELSKLQNLKSLLLHSNSLSGEI  134

Query  1114  PGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQ  1293
             P E G + +LQ L + +N LSG I   +  N + L++L L+    +G IPPE+   + L 
Sbjct  135   PVELGLLKKLQVLRIGNNLLSGKITPDI-GNLSELRVLGLAYCQFNGSIPPEIGSLKNLM  193

Query  1294  QLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGE  1473
              LDL  N L+G IP+E+     L     +NN LEG I   V +L  LQTL+L +N+L G 
Sbjct  194   YLDLETNGLSGRIPQEISSCEVLEIFAASNNKLEGEILSWVGSLKELQTLNLANNSLTGP  253

Query  1474  VPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLF  1653
             +P EIG L +L+ + L  N  +GEIP E+     L+ +D   N  +G I ++  +LK+L 
Sbjct  254   IPTEIGGLSNLRYLNLLGNKLTGEIPRELNGLVQLETLDLSKNNLSGSISLSATQLKNLS  313

Query  1654  FLHLRE-------------------------NDLSGEIPASLGNCHQLDTLDLADNHLSG  1758
              L L +                         N+LSGE P  L NC  L  LDL+DN   G
Sbjct  314   ALFLSDNKLMGGVPNNFCSSTSSLIQLVLARNELSGEFPMELINCSSLQQLDLSDNSFEG  373

Query  1759  AIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFL  1938
             ++P++   L+ LT L+L NNS  G LP ++ N+  +  + LSHN F GSI         L
Sbjct  374   SLPSSLDRLQELTDLILNNNSFTGVLPPEIGNISTMENLYLSHNMFMGSIPEQLGKLDKL  433

Query  1939  S-FDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSG  2115
             S   +  N  +  IP  L +  SL  +    N F+G IP T+G ++ L +L L  N+LSG
Sbjct  434   SILHLFENQMNGSIPRELTDCTSLTEIDFFGNYFSGSIPATIGKLKNLVVLHLRQNELSG  493

Query  2116  FIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskl  2295
              +PP L  C KL  L L +N LSG +P     L  L  L L +N   G LP        L
Sbjct  494   PVPPSLGYCTKLQLLALADNKLSGFLPPTFQFLSELSTLTLYNNSLEGPLPESFSLLKSL  553

Query  2296  lvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSG  2475
               ++L +N   GT+    G L  L  ++L +N   G IPST+G    L  +RL+ N  +G
Sbjct  554   RKINLSHNRFEGTITALCG-LHLLTAIDLTNNSFSGPIPSTLGMSMNLARIRLAHNHLTG  612

Query  2476  EIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSS  2655
              IP ++GQL +L   LD S+NNL G +P  +    KLE L LS+N+ TG IP  +  +  
Sbjct  613   NIPSQLGQLTELI-FLDLSFNNLDGNVPSQLSNCGKLEHLLLSNNNFTGAIPSWLGGLEE  671

Query  2656  LGRLNLSCNELEGEL  2700
             LG L+LS N L+G +
Sbjct  672   LGELDLSFNALKGSI  686


 Score =   254 bits (648),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 197/553 (36%), Positives = 295/553 (53%), Gaps = 52/553 (9%)
 Frame = +1

Query  1210  TNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNT  1389
             T+L++L LS   L+G IPPELS+ + L+ L L +N+L+G IP EL  L +L  L + NN 
Sbjct  94    TSLEMLDLSSNSLTGSIPPELSKLQNLKSLLLHSNSLSGEIPVELGLLKKLQVLRIGNNL  153

Query  1390  LEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNC  1569
             L G I+P + NL+ L+ L L +   +G +P EIG L +L  + L  N  SG IP EI +C
Sbjct  154   LSGKITPDIGNLSELRVLGLAYCQFNGSIPPEIGSLKNLMYLDLETNGLSGRIPQEISSC  213

Query  1570  ------------------------SSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
                                       LQ ++   N  TG IP  +G L +L +L+L  N 
Sbjct  214   EVLEIFAASNNKLEGEILSWVGSLKELQTLNLANNSLTGPIPTEIGGLSNLRYLNLLGNK  273

Query  1678  LSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLR-----------------------  1788
             L+GEIP  L    QL+TLDL+ N+LSG+I  +   L+                       
Sbjct  274   LTGEIPRELNGLVQLETLDLSKNNLSGSISLSATQLKNLSALFLSDNKLMGGVPNNFCSS  333

Query  1789  --ALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSI-APICTSHSFLSFDVTNN  1959
               +L +L+L  N L G+ P +L N  +L +++LS N+F GS+ + +          + NN
Sbjct  334   TSSLIQLVLARNELSGEFPMELINCSSLQQLDLSDNSFEGSLPSSLDRLQELTDLILNNN  393

Query  1960  AFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSL  2139
             +F   +P  +GN  +++ L L  N F G IP  LG + +LS+L L  N+++G IP +L+ 
Sbjct  394   SFTGVLPPEIGNISTMENLYLSHNMFMGSIPEQLGKLDKLSILHLFENQMNGSIPRELTD  453

Query  2140  CRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslenn  2319
             C  LT +D   N  SG IP  +G+L  L  L L  N+ SG +PP L  C+KL +L+L +N
Sbjct  454   CTSLTEIDFFGNYFSGSIPATIGKLKNLVVLHLRQNELSGPVPPSLGYCTKLQLLALADN  513

Query  2320  slnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQ  2499
              L+G LPP    L  L+ L L +N L G +P +   L  L ++ LS NRF G I    G 
Sbjct  514   KLSGFLPPTFQFLSELSTLTLYNNSLEGPLPESFSLLKSLRKINLSHNRFEGTITALCGL  573

Query  2500  LKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSC  2679
                L + +D + N+ +G IP ++G    L  + L+HN LTG IP Q+ +++ L  L+LS 
Sbjct  574   --HLLTAIDLTNNSFSGPIPSTLGMSMNLARIRLAHNHLTGNIPSQLGQLTELIFLDLSF  631

Query  2680  NELEGELDKRYAH  2718
             N L+G +  + ++
Sbjct  632   NNLDGNVPSQLSN  644


 Score =   114 bits (285),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 113/314 (36%), Positives = 165/314 (53%), Gaps = 16/314 (5%)
 Frame = +1

Query  1819  SLEGDLPDDLRNLGNLTRINLSHNNFSGSI------APICTSH---------SFLSFDVT  1953
             +L+  L DDL     L ++    N+ SG +      A +C  +           +  +++
Sbjct  19    ALDVSLGDDLSEALQLLKVKAQLNDPSGVLNNWSPEAHVCKWYGVTCSDDQSKVVGLNLS  78

Query  1954  NNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQL  2133
             N+     I    G   SL+ L L SN  TG IP  L  ++ L  L L  N LSG IP +L
Sbjct  79    NSGLSGPISPDYGFLTSLEMLDLSSNSLTGSIPPELSKLQNLKSLLLHSNSLSGEIPVEL  138

Query  2134  SLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlsle  2313
              L +KL  L + NNLLSG I   +G L  L  L L+  QF+GS+PPE+ +   L+ L LE
Sbjct  139   GLLKKLQVLRIGNNLLSGKITPDIGNLSELRVLGLAYCQFNGSIPPEIGSLKNLMYLDLE  198

Query  2314  nnslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREV  2493
              N L+G +P EI + + L +    +N+L G I S +G L +L  L L+ N  +G IP E+
Sbjct  199   TNGLSGRIPQEISSCEVLEIFAASNNKLEGEILSWVGSLKELQTLNLANNSLTGPIPTEI  258

Query  2494  GQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNL  2673
             G L +L+  L+   N LTGEIP  +  L +LE+LDLS N+L+G I     ++ +L  L L
Sbjct  259   GGLSNLR-YLNLLGNKLTGEIPRELNGLVQLETLDLSKNNLSGSISLSATQLKNLSALFL  317

Query  2674  SCNELEGELDKRYA  2715
             S N+L G +   + 
Sbjct  318   SDNKLMGGVPNNFC  331



>ref|XP_003522390.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=996

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/859 (50%), Positives = 547/859 (64%), Gaps = 9/859 (1%)
 Frame = +1

Query  316   LLEVKRSFVL---QLQGWSEKNPNYCSWQGVSCD-Gslkvvslnlsdsslggsispslgl  483
             LL +K   V     L+ WS      CSW G++C     +VV LNLS S L GSIS     
Sbjct  66    LLRIKSELVDPLGALRNWSPTTTQICSWNGLTCALDQARVVGLNLSGSGLSGSISGEFSH  125

Query  484   lthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDN  663
             L  L  LDLSSN L+G IP  L  L +L +LLL+SN L G IP ++G L+ LQ LR+GDN
Sbjct  126   LISLQSLDLSSNSLTGSIPSELGKLQNLRTLLLYSNYLSGAIPKEIGNLSKLQVLRLGDN  185

Query  664   GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIAN  843
              L G+I  S GNL  L   G+A+C L+G IP ++G+L  L +L+LQ N L G +P EI  
Sbjct  186   MLEGEITPSIGNLSELTVFGVANCNLNGSIPVEVGKLKNLVSLDLQVNSLSGYIPEEIQG  245

Query  844   ISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGN  1023
                L  F+A+ N L G IP  LG LK L ILNLANNTL+G IP  L  +S+L YLNLLGN
Sbjct  246   CEGLQNFAASNNMLEGEIPSSLGSLKSLRILNLANNTLSGSIPTSLSLLSNLTYLNLLGN  305

Query  1024  QLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCS  1203
              L G IP  L  L+ LQ LDLS N L+G L      +  L+ + L+ N L+G+IP + C 
Sbjct  306   MLNGEIPSELNSLSQLQKLDLSRNSLSGPLALLNVKLQNLETMVLSDNALTGSIPYNFCL  365

Query  1204  NATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNN  1383
               + LQ L L+   LSG  P EL  C  +QQ+DLS+N+  G +P  L +L  LTDLVLNN
Sbjct  366   RGSKLQQLFLARNKLSGRFPLELLNCSSIQQVDLSDNSFEGELPSSLDKLQNLTDLVLNN  425

Query  1384  NTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIG  1563
             N+  G++ P + N+++L++L LF N   G++P EIG L  L  I+LY+N  SG IP E+ 
Sbjct  426   NSFSGSLPPGIGNISSLRSLFLFGNFFTGKLPVEIGRLKRLNTIYLYDNQMSGPIPRELT  485

Query  1564  NCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLAD  1743
             NC+ L  IDF+GN F+G IP T+G+LK L  LHLR+NDLSG IP S+G C +L  L LAD
Sbjct  486   NCTRLTEIDFFGNHFSGPIPKTIGKLKDLTILHLRQNDLSGPIPPSMGYCKRLQLLALAD  545

Query  1744  NHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICT  1923
             N LSG+IP TF YL  +  + LYNNS EG LPD L  L NL  IN S+N FSGSI P+  
Sbjct  546   NKLSGSIPPTFSYLSQIRTITLYNNSFEGPLPDSLSLLRNLKIINFSNNKFSGSIFPLTG  605

Query  1924  SHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGN  2103
             S+S    D+TNN+F   IPS LGNS  L RLRLG+N  TG IP  LG + EL+ LDLS N
Sbjct  606   SNSLTVLDLTNNSFSGSIPSILGNSRDLTRLRLGNNYLTGTIPSELGHLTELNFLDLSFN  665

Query  2104  KLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFN  2283
              L+G + PQLS C+K+ HL LNNN LSG +  WLG L  LGEL LS N F G +PPEL  
Sbjct  666   NLTGHVLPQLSNCKKIEHLLLNNNRLSGEMSPWLGSLQELGELDLSFNNFHGRVPPELGG  725

Query  2284  CskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRN  2463
             CSKLL L L +N+L+G +P EIGNL SLNV NL  N L G IPSTI    KLYE+RLS N
Sbjct  726   CSKLLKLFLHHNNLSGEIPQEIGNLTSLNVFNLQKNGLSGLIPSTIQQCTKLYEIRLSEN  785

Query  2464  RFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVA  2643
               SG IP E+G + +LQ +LD S N+ +GEIP S+G L KLE LDLS N L G++PP + 
Sbjct  786   FLSGTIPAELGGVTELQVILDLSRNHFSGEIPSSLGNLMKLERLDLSFNHLQGQVPPSLG  845

Query  2644  EMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC-----RDKGSRNKGS  2808
             +++SL  LNLS N L G +   ++ +P+ SF+ N HLCG PL  C     +++   +   
Sbjct  846   QLTSLHMLNLSYNHLNGLIPSTFSGFPLSSFLNNDHLCGPPLTLCLEATGKERMQLSNAQ  905

Query  2809  MVVVISALSATVAIILLLM  2865
             +  +I A+  T  +I L+M
Sbjct  906   VAAIIVAIVLTSTLICLVM  924



>ref|XP_003568840.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Brachypodium distachyon]
Length=965

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/892 (49%), Positives = 563/892 (63%), Gaps = 11/892 (1%)
 Frame = +1

Query  286   CQNTSSTLRV-LLEVKRSFVLQ---LQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdss  450
             C  T +T  V LL+VK  F      L GWS +  + CSW GV+C  G   V  LNLS   
Sbjct  22    CVATPATASVTLLQVKSGFTDPQGVLSGWSPE-ADVCSWHGVTCLQGEGIVSGLNLSGYG  80

Query  451   lggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLL  630
             L G+ISP+L  L  +  +DLSSN  +GPIPP L NL +L +LLL+SN L G IP +LGLL
Sbjct  81    LSGTISPALSGLISIELIDLSSNSFTGPIPPELGNLQNLRTLLLYSNFLTGTIPMELGLL  140

Query  631   TNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnl  810
              NL+ LRIGDN L G+IP   GN   L TL LA C LSG IP Q+G L  LQ L L  N 
Sbjct  141   GNLKVLRIGDNKLRGEIPPQLGNCTELETLALAYCQLSGSIPYQIGNLKNLQQLVLDNNT  200

Query  811   lEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEM  990
             L G +P ++   ++L   S A N L G IP  +G L  L  LNLANN  +G IP ++G +
Sbjct  201   LTGSIPEQLGGCANLCVLSVADNRLGGIIPSFIGSLSPLQSLNLANNQFSGVIPAEIGNL  260

Query  991   SSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNN  1170
             SSL YLNLLGN L G+IP+ L KL+ LQ LDLS N ++GE+      +  L++L L+ N 
Sbjct  261   SSLTYLNLLGNSLTGAIPEDLNKLSQLQVLDLSKNNISGEISISTSQLKNLKYLVLSDNL  320

Query  1171  LSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYE  1350
             L GTIP+ LC   ++L+ L L+   L G I  EL  C  L+ +D SNN+L G IP E+  
Sbjct  321   LEGTIPEGLCPGNSSLENLFLAGNNLEGGIE-ELLSCISLRSIDASNNSLTGEIPSEIDR  379

Query  1351  LTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYEN  1530
             L+ L +LVL+NN+L G + P + NL+NL+ LSL+HN L G +P EIG L  L ++FLYEN
Sbjct  380   LSNLVNLVLHNNSLTGILPPQIGNLSNLEVLSLYHNGLTGVIPPEIGRLQRLTMLFLYEN  439

Query  1531  HFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGN  1710
               SG IP EI NC+SL+ +DF+GN F G IP  +G LK+L  L LR+NDLSG IPASLG 
Sbjct  440   QMSGTIPDEITNCTSLEEVDFFGNHFHGSIPERIGNLKNLAVLQLRQNDLSGLIPASLGE  499

Query  1711  CHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHN  1890
             C +L  L LADN LSG +PATF +L  L+ + LYNNSLEG LP++L  + NLT IN+SHN
Sbjct  500   CRRLQALALADNRLSGTLPATFRHLTQLSVITLYNNSLEGPLPEELFEIKNLTVINISHN  559

Query  1891  NFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLI  2070
              F+GS+ P+  S S     +T+N+F   IP+ +  S ++ RL+L  NR  G IP  LG +
Sbjct  560   RFNGSVVPLLGSSSLAVLVLTDNSFSGIIPTAVARSRNMVRLQLAGNRLAGAIPAELGNL  619

Query  2071  RELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQ  2250
              +L +LDLS N LSG IP +LS C +LT L+L  N L+G +P WLG L  LGEL LSSN 
Sbjct  620   TQLKMLDLSSNNLSGDIPEELSNCLQLTRLNLEGNSLTGAVPSWLGSLRSLGELDLSSNA  679

Query  2251  FSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGL  2430
              +G++P EL NCS L+ LSL +N L+G +P EIG L SLNVLNL  N+L G IP T+   
Sbjct  680   LTGNIPVELGNCSSLIKLSLRDNHLSGNIPQEIGRLTSLNVLNLQKNRLTGVIPPTLRQC  739

Query  2431  GKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHN  2610
              KLYEL LS N   G IP E+GQL +LQ +LD S N L+G+IP S+G L KLE L+LS N
Sbjct  740   NKLYELSLSENSLEGPIPPELGQLSELQVMLDLSRNRLSGQIPTSLGNLIKLERLNLSSN  799

Query  2611  DLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKG  2790
              L G+IP  + +++SL  LNLS N L G +    + +P  S+ GN  LCG+PL +C   G
Sbjct  800   QLHGQIPSSLLQLTSLNHLNLSDNLLSGAIPTVLSSFPAASYAGNDELCGTPLPACGANG  859

Query  2791  SRNKGSM----VVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYA  2934
              R   +M    V  I+ +SATV + LL +    +      +     G+E  A
Sbjct  860   RRLPSAMVSGIVAAIAIVSATVCMALLYIMLRMWSTWREVSVSSSDGEEPAA  911



>ref|XP_002318086.2| hypothetical protein POPTR_0012s09070g [Populus trichocarpa]
 gb|EEE96306.2| hypothetical protein POPTR_0012s09070g [Populus trichocarpa]
Length=975

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/761 (50%), Positives = 504/761 (66%), Gaps = 6/761 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP ++GLL NLQ LR+GDN L+G+I  S GNL  L  LGLA C  +G IP  +G L  
Sbjct  133   GKIPEEIGLLKNLQVLRVGDNLLSGEITPSIGNLTQLRVLGLAYCQFNGSIPSGIGNLKH  192

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L +L+LQ+N L+G +P EI     L   +A  N L G IP  +G L+ L ILNLANN+L+
Sbjct  193   LVSLDLQKNSLDGHIPEEIRGCEELQNLAALNNKLEGDIPASIGMLRSLQILNLANNSLS  252

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP +LG++S+L YL+LLGN+L G IP  L +L  L++LDLS N  +G +      +  
Sbjct  253   GSIPVELGQLSNLTYLSLLGNRLSGRIPSQLNQLVQLETLDLSVNNFSGAISLFNAQLKN  312

Query  1141  LQFLALTSNNLSGTIPKSLC-SNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
             L+ L L++N+L+G+IP + C SN++ LQ L L+   LSG+   +L  CR LQQLDLS+N 
Sbjct  313   LRTLVLSNNDLTGSIPSNFCLSNSSKLQQLFLARNSLSGKFQLDLLNCRSLQQLDLSDNN  372

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
               G +P  L +L  LTDL+LNNN+  G +   + N++NL+TL LF N + G +P EIG L
Sbjct  373   FEGGLPSGLEKLEHLTDLLLNNNSFSGNLPSEIGNMSNLETLILFDNMITGRLPPEIGKL  432

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
               L  I+LY+N  SG IP E+ NC+S+  IDF+GN FTG IP T+G+LK+L  L LR+ND
Sbjct  433   QRLSTIYLYDNQMSGGIPRELTNCTSMTKIDFFGNHFTGSIPATIGKLKNLNMLQLRQND  492

Query  1678  LSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNL  1857
             LSG IP SLG C +L  + LADN +SG +P TF +L  L ++ LYNNS EG LP  L  L
Sbjct  493   LSGPIPPSLGYCKRLQIMALADNKISGTLPETFRFLTELNKITLYNNSFEGPLPASLFLL  552

Query  1858  GNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRF  2037
              NL  IN SHN FSGSI+P+  S+S  + D+TNN+F   IPS L  S +L RLRL  N  
Sbjct  553   KNLKIINFSHNRFSGSISPLLGSNSLTALDLTNNSFSGPIPSELTQSRNLSRLRLAHNHL  612

Query  2038  TGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlp  2217
             +G+IP   G + +L+  DLS N L+G +PPQLS C+K+ H  LNNN L+G +P WLG L 
Sbjct  613   SGEIPSEFGSLTKLNFFDLSFNNLTGEVPPQLSNCKKIQHFLLNNNQLAGTMPPWLGSLE  672

Query  2218  llgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQL  2397
              LGEL  S N F G++P EL NCS LL LSL +N L+G +P EIGNL SLNVLNL  N L
Sbjct  673   ELGELDFSFNNFHGNIPAELGNCSGLLKLSLHSNKLSGNIPQEIGNLTSLNVLNLQRNNL  732

Query  2398  CGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTL  2577
              G IPSTI    K++ELRLS N  +G IP E+G+L +LQ +LD S N+ +GEIP S+G L
Sbjct  733   SGLIPSTIQECEKIFELRLSENFLTGSIPPELGKLTELQVILDLSENSFSGEIPSSLGNL  792

Query  2578  SKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLC  2757
              KLE L+LS N L GE+P  + +++SL  LNLS N+L+G+L   ++ +P+ SF+GN  LC
Sbjct  793   MKLEGLNLSLNHLQGEVPFSLTKLTSLHMLNLSNNDLQGQLPSTFSGFPLSSFLGNDKLC  852

Query  2758  GSPLGSCRDKGSRNK-----GSMVVVISALSATVAIILLLM  2865
             G PL SC +   + K      ++V +I A+  T ++I L+M
Sbjct  853   GPPLVSCLESAGQEKRGLSNTAVVGIIVAIVFTSSLICLVM  893


 Score =   307 bits (786),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 216/601 (36%), Positives = 308/601 (51%), Gaps = 54/601 (9%)
 Frame = +1

Query  1051  LAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLM  1230
             L  LT+LQ LDLS N L G +P E G +  LQ L L +N+LSG IP+ +     NLQ+L 
Sbjct  91    LWHLTSLQILDLSSNSLTGSIPSELGKLQNLQMLLLYANSLSGKIPEEI-GLLKNLQVLR  149

Query  1231  LSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISP  1410
             + +  LSGEI P +     L+ L L+    NGSIP  +  L  L  L L  N+L+G I  
Sbjct  150   VGDNLLSGEITPSIGNLTQLRVLGLAYCQFNGSIPSGIGNLKHLVSLDLQKNSLDGHIPE  209

Query  1411  SVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFID  1590
              +     LQ L+  +N L G++P  IGML  LQI+ L  N  SG IPVE+G  S+L ++ 
Sbjct  210   EIRGCEELQNLAALNNKLEGDIPASIGMLRSLQILNLANNSLSGSIPVELGQLSNLTYLS  269

Query  1591  FYGNQFTGKIPITL------------------------GRLKHLFFLHLRENDLSGEIPA  1698
               GN+ +G+IP  L                         +LK+L  L L  NDL+G IP+
Sbjct  270   LLGNRLSGRIPSQLNQLVQLETLDLSVNNFSGAISLFNAQLKNLRTLVLSNNDLTGSIPS  329

Query  1699  S--------------------------LGNCHQLDTLDLADNHLSGAIPATFGYLRALTR  1800
             +                          L NC  L  LDL+DN+  G +P+    L  LT 
Sbjct  330   NFCLSNSSKLQQLFLARNSLSGKFQLDLLNCRSLQQLDLSDNNFEGGLPSGLEKLEHLTD  389

Query  1801  LMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP-ICTSHSFLSFDVTNNAFDQEI  1977
             L+L NNS  G+LP ++ N+ NL  + L  N  +G + P I       +  + +N     I
Sbjct  390   LLLNNNSFSGNLPSEIGNMSNLETLILFDNMITGRLPPEIGKLQRLSTIYLYDNQMSGGI  449

Query  1978  PSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTH  2157
             P  L N  S+ ++    N FTG IP T+G ++ L++L L  N LSG IPP L  C++L  
Sbjct  450   PRELTNCTSMTKIDFFGNHFTGSIPATIGKLKNLNMLQLRQNDLSGPIPPSLGYCKRLQI  509

Query  2158  LDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTL  2337
             + L +N +SG +P     L  L ++ L +N F G LP  LF    L +++  +N  +G++
Sbjct  510   MALADNKISGTLPETFRFLTELNKITLYNNSFEGPLPASLFLLKNLKIINFSHNRFSGSI  569

Query  2338  PPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQS  2517
              P +G+  SL  L+L +N   G IPS +     L  LRL+ N  SGEIP E G L  L +
Sbjct  570   SPLLGS-NSLTALDLTNNSFSGPIPSELTQSRNLSRLRLAHNHLSGEIPSEFGSLTKL-N  627

Query  2518  VLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGE  2697
               D S+NNLTGE+PP +    K++   L++N L G +PP +  +  LG L+ S N   G 
Sbjct  628   FFDLSFNNLTGEVPPQLSNCKKIQHFLLNNNQLAGTMPPWLGSLEELGELDFSFNNFHGN  687

Query  2698  L  2700
             +
Sbjct  688   I  688


 Score =   252 bits (644),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 179/458 (39%), Positives = 256/458 (56%), Gaps = 4/458 (1%)
 Frame = +1

Query  1336  EELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQII  1515
              EL+ LT L  L L++N+L G+I   +  L NLQ L L+ N+L G++P EIG+L +LQ++
Sbjct  89    HELWHLTSLQILDLSSNSLTGSIPSELGKLQNLQMLLLYANSLSGKIPEEIGLLKNLQVL  148

Query  1516  FLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIP  1695
              + +N  SGEI   IGN + L+ +     QF G IP  +G LKHL  L L++N L G IP
Sbjct  149   RVGDNLLSGEITPSIGNLTQLRVLGLAYCQFNGSIPSGIGNLKHLVSLDLQKNSLDGHIP  208

Query  1696  ASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRI  1875
               +  C +L  L   +N L G IPA+ G LR+L  L L NNSL G +P +L  L NLT +
Sbjct  209   EEIRGCEELQNLAALNNKLEGDIPASIGMLRSLQILNLANNSLSGSIPVELGQLSNLTYL  268

Query  1876  NLSHNNFSGSIAPICTSHSFL-SFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIP  2052
             +L  N  SG I         L + D++ N F   I  F     +L  L L +N  TG IP
Sbjct  269   SLLGNRLSGRIPSQLNQLVQLETLDLSVNNFSGAISLFNAQLKNLRTLVLSNNDLTGSIP  328

Query  2053  MTLGLIR--ELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
                 L    +L  L L+ N LSG     L  CR L  LDL++N   G +P  L +L  L 
Sbjct  329   SNFCLSNSSKLQQLFLARNSLSGKFQLDLLNCRSLQQLDLSDNNFEGGLPSGLEKLEHLT  388

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             +L L++N FSG+LP E+ N S L  L L +N + G LPPEIG L+ L+ + L DNQ+ G 
Sbjct  389   DLLLNNNSFSGNLPSEIGNMSNLETLILFDNMITGRLPPEIGKLQRLSTIYLYDNQMSGG  448

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IP  +     + ++    N F+G IP  +G+LK+L ++L    N+L+G IPPS+G   +L
Sbjct  449   IPRELTNCTSMTKIDFFGNHFTGSIPATIGKLKNL-NMLQLRQNDLSGPIPPSLGYCKRL  507

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGEL  2700
             + + L+ N ++G +P     ++ L ++ L  N  EG L
Sbjct  508   QIMALADNKISGTLPETFRFLTELNKITLYNNSFEGPL  545



>ref|XP_010678806.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Beta vulgaris subsp. vulgaris]
Length=960

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/914 (48%), Positives = 580/914 (63%), Gaps = 11/914 (1%)
 Frame = +1

Query  277   YVRCQNTSSTLRVLLEVKRSFV---LQLQGWSEKNPNYCSWQGVSC-DGslkvvslnlsd  444
             Y   QN+  +   LL +K SFV     L  WS    + CSW G++C D    V+S+NLS 
Sbjct  23    YTTAQNSGDSYW-LLRIKSSFVDPDKTLSNWSSAT-SVCSWNGLTCSDDQSHVISMNLSS  80

Query  445   sslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLG  624
             S L G +SP    LT L  LDLSSN LSG IP  L +L  L  LLL+SN L G IP +LG
Sbjct  81    SGLSGVMSPDFSHLTSLQTLDLSSNALSGRIPSELGHLEKLRELLLYSNSLSGNIPHELG  140

Query  625   LLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqq  804
             LL+ L+ LRIGDN L+G+IP S G+L  L  LGLA C L+G +P ++GRL  L +L+LQ 
Sbjct  141   LLSKLEVLRIGDNLLSGEIPRSLGSLTELKVLGLAYCQLNGSVPSEIGRLRNLVSLDLQH  200

Query  805   nllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLG  984
             N L G +P EI     L  F+A+ N L G IP  +G L  L ILNLANN+++G IP +L 
Sbjct  201   NALVGQIPKEIGEFKKLQNFAASNNLLIGDIPSSIGNLHSLEILNLANNSISGMIPTKLA  260

Query  985   EMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTS  1164
              +  L YLNLLGN+L G++P  L  L  L+ LDLSGN L+G L      M  L+ L L+ 
Sbjct  261   SLQELKYLNLLGNRLSGAVPSELNLLNQLEKLDLSGNNLSGSLNLSISEMKNLEVLILSD  320

Query  1165  NNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEEL  1344
             N+L+G IP++ C N + LQ L L+    SG  P EL  C  LQ LDLS+N   G +P E+
Sbjct  321   NHLTGGIPENFCMNNSKLQTLSLAGNSFSGNFPMELFNCFALQHLDLSDNNFQGELPSEI  380

Query  1345  YELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLY  1524
              +L  LTDL LNNN+    + P++ NL+NL+ LSL+ N L G++P EIG L  L++++LY
Sbjct  381   DKLAFLTDLYLNNNSFSEELPPAIGNLSNLEFLSLYGNKLTGKIPAEIGKLNKLRVLYLY  440

Query  1525  ENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASL  1704
             +NH SG IP E+ NC+ L  IDF+GNQF+G IP  +G+LK+L  LHLR+N+LSG+IP SL
Sbjct  441   DNHISGNIPDELTNCTGLTEIDFFGNQFSGSIPNAIGKLKNLVLLHLRQNELSGQIPPSL  500

Query  1705  GNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLS  1884
             G+C +L  L LADN LSG+IP TF  L  L+ + LYNNSLEG LP+ L  L NL+ INLS
Sbjct  501   GDCTKLQMLALADNKLSGSIPTTFSSLSELSLITLYNNSLEGPLPESLFLLKNLSIINLS  560

Query  1885  HNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLG  2064
             HN  +GS+ P+  S S    D+TNN F   IPS L  S +L R+RL SN  +G IP+   
Sbjct  561   HNKLNGSVFPLTGSTSLTVLDLTNNHFSGSIPSRLALSKNLIRVRLASNFLSGNIPLEFI  620

Query  2065  LIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSS  2244
             L+ +L  LDLS N LSG +   L+   KL HL LNNN LSG IP WL  L  LGEL LSS
Sbjct  621   LLEQLVFLDLSSNSLSGELAVSLTNSTKLEHLMLNNNHLSGNIPTWLRNLKGLGELDLSS  680

Query  2245  NQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIG  2424
             N F+G++P EL NCS LL LSL NN L+G +P E+GNL SLNVLNL  N L G+IPS I 
Sbjct  681   NNFNGTVPKELGNCSNLLKLSLHNNKLSGQIPSELGNLFSLNVLNLQSNNLSGTIPSEIQ  740

Query  2425  GLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLS  2604
              L KL+ELRLS N  +G+IP E+ +L +LQ +LD S+N L+GEIP S+G L KLE L+LS
Sbjct  741   NLQKLFELRLSDNFLTGKIPVELQKLTELQVILDLSHNQLSGEIPQSLGNLMKLERLNLS  800

Query  2605  HNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD  2784
             +N L G IP  + ++SSL  L+LS N L+G++   ++ +P+ +FVGN  LCG+PL SC  
Sbjct  801   NNHLQGRIPSSLGKLSSLHSLDLSHNRLQGKVPSTFSTFPMSAFVGNRKLCGAPLESCSS  860

Query  2785  KGSR--NKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQ  2958
                +   +  + V+I A+  T A+  L+M   +        +R+     N    + +  Q
Sbjct  861   SSRKWLPRSEVGVIIFAIVFTAAVACLVM--IYIMLRIWTTWRKVAVSNNEGFGNENKGQ  918

Query  2959  AQRKPL-FGNAAKK  2997
              Q K + +G+  +K
Sbjct  919   DQEKWVCYGDEKRK  932



>ref|XP_010248553.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X2 [Nelumbo nucifera]
Length=923

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/823 (50%), Positives = 533/823 (65%), Gaps = 23/823 (3%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             GPIPP L  L +L+ L L+SN L G I ++LGLL  LQ LR+G+N LTG+I    GNL +
Sbjct  80    GPIPPELGKLQNLKELYLYSNFLSGKISAELGLLKKLQVLRVGNNMLTGEITPHLGNLTD  139

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L  LGLA   L+G IP ++G L  L+ LNLQQN   G +P EI++   L  FSAA N L 
Sbjct  140   LRVLGLAFSLLNGSIPVEIGNLKSLKILNLQQNSFSGLIPGEISSCLELQVFSAAGNMLE  199

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             G IP  +G L+ L IL+LANNTL+G IP +LG +S+L YLNLLGN L G IP  L +L+ 
Sbjct  200   GEIPASIGKLESLEILHLANNTLSGSIPIELGSLSNLKYLNLLGNGLNGKIPVELNQLSM  259

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             L++LDLS N+L+G++      +  L+ L L+ N L+G IP  LC + +NLQ + LS   L
Sbjct  260   LETLDLSNNKLSGKINILNSRLRNLESLVLSDNFLTGGIPSDLCVSNSNLQKVFLSLNNL  319

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
             SG  P EL  C  LQQLDLSNN   G +P  L  L  LTDLVLNNN+  G +   + N++
Sbjct  320   SGTFPSELLNCSSLQQLDLSNNGFYGQLPSGLDNLRNLTDLVLNNNSFSGKLPSEIGNMS  379

Query  1429  NLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQF  1608
             +L+ L LFHN+L G +P EIG L  L +++LYEN  SG IP E+ NCSSL  ID +GN F
Sbjct  380   SLKGLYLFHNSLTGRIPVEIGKLQRLTVLYLYENQLSGSIPRELTNCSSLMEIDLFGNHF  439

Query  1609  TGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLR  1788
             TG IP T+G+LKHL FL LR+NDLSG IP  LG C +L  L LADN LSG++P TF +L 
Sbjct  440   TGSIPATIGKLKHLVFLQLRQNDLSGPIPPCLGYCKKLQKLALADNRLSGSLPPTFRFLT  499

Query  1789  ALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFD  1968
              L+ + LYNNS EG LP+ L  L NL+ IN SHN FSGSI P+  S + +  D+TNN+F 
Sbjct  500   ELSVVTLYNNSFEGPLPESLFLLKNLSIINFSHNRFSGSIFPLSGSSTLIVLDLTNNSFS  559

Query  1969  QEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRK  2148
               IP+ L  S +L RLRLG N  TG IP   G + EL+ LDLS N L+G +  +LS C +
Sbjct  560   GGIPTRLAESKNLTRLRLGHNHLTGTIPSEFGQLIELNFLDLSFNNLTGEVIQELSNCNQ  619

Query  2149  LTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsln  2328
             L HL LN+N L+G +P WLGR   LGEL LSSN F G++P EL +CSKLL LSL +N+L+
Sbjct  620   LEHLLLNDNRLTGTVPSWLGRFQGLGELDLSSNDFHGTVPAELGSCSKLLKLSLHSNNLS  679

Query  2329  GTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKD  2508
             G +PPEIGNL  LNVL+L  N L G IPST+    KLYELRLS N  +G IP E+G+L +
Sbjct  680   GWIPPEIGNLTCLNVLDLQRNNLTGPIPSTVQQCKKLYELRLSENFLTGMIPSELGKLTE  739

Query  2509  LQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNEL  2688
             LQ +LD S N L+GEIP S+G L KLE L+LS N L GE+PP +  ++SL  LNLS N L
Sbjct  740   LQVILDLSRNQLSGEIPSSLGKLMKLERLNLSFNQLQGEVPPSLGRLTSLQMLNLSNNLL  799

Query  2689  EGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDK-GSRNK-------GSMVVVISALSATV  2844
             +G++   ++ +P+ SFVGN  LCG+PL SC +  GS  K        +++V I   S  +
Sbjct  800   QGQVPSTFSGFPLSSFVGNKDLCGAPLVSCSESVGSERKWLSDNEVAAIIVAIVFTSTVI  859

Query  2845  AIILLLMGAAFFF---------------KHNREAYRRRRGKEN  2928
              ++L+ M    +F               + NRE  +   G++N
Sbjct  860   CLVLIYMMLRIWFDWRKVSVSSSDSGGLESNREEMQWFYGEDN  902


 Score =   272 bits (695),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 217/579 (37%), Positives = 307/579 (53%), Gaps = 53/579 (9%)
 Frame = +1

Query  1060  LTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSE  1239
             LT++  L+LSG+ L+G +  EF  +  LQ L L+SN L+G                    
Sbjct  41    LTHVVGLNLSGSGLSGIISPEFSCLVSLQILDLSSNYLTG--------------------  80

Query  1240  TGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVA  1419
                   IPPEL + + L++L L +N L+G I  EL  L +L  L + NN L G I+P + 
Sbjct  81    -----PIPPELGKLQNLKELYLYSNFLSGKISAELGLLKKLQVLRVGNNMLTGEITPHLG  135

Query  1420  NLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYG  1599
             NLT+L+ L L  + L+G +P EIG L  L+I+ L +N FSG IP EI +C  LQ     G
Sbjct  136   NLTDLRVLGLAFSLLNGSIPVEIGNLKSLKILNLQQNSFSGLIPGEISSCLELQVFSAAG  195

Query  1600  NQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGN-----------------------  1710
             N   G+IP ++G+L+ L  LHL  N LSG IP  LG+                       
Sbjct  196   NMLEGEIPASIGKLESLEILHLANNTLSGSIPIELGSLSNLKYLNLLGNGLNGKIPVELN  255

Query  1711  -CHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDL-RNLGNLTRINLS  1884
                 L+TLDL++N LSG I      LR L  L+L +N L G +P DL  +  NL ++ LS
Sbjct  256   QLSMLETLDLSNNKLSGKINILNSRLRNLESLVLSDNFLTGGIPSDLCVSNSNLQKVFLS  315

Query  1885  HNNFSGSI-APICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTL  2061
              NN SG+  + +    S    D++NN F  ++PS L N  +L  L L +N F+GK+P  +
Sbjct  316   LNNLSGTFPSELLNCSSLQQLDLSNNGFYGQLPSGLDNLRNLTDLVLNNNSFSGKLPSEI  375

Query  2062  GLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklS  2241
             G +  L  L L  N L+G IP ++   ++LT L L  N LSG IP  L     L E+ L 
Sbjct  376   GNMSSLKGLYLFHNSLTGRIPVEIGKLQRLTVLYLYENQLSGSIPRELTNCSSLMEIDLF  435

Query  2242  SNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTI  2421
              N F+GS+P  +     L+ L L  N L+G +PP +G  K L  L L DN+L GS+P T 
Sbjct  436   GNHFTGSIPATIGKLKHLVFLQLRQNDLSGPIPPCLGYCKKLQKLALADNRLSGSLPPTF  495

Query  2422  GGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDL  2601
               L +L  + L  N F G +P  +  LK+L S+++FS+N  +G I P  G+ S L  LDL
Sbjct  496   RFLTELSVVTLYNNSFEGPLPESLFLLKNL-SIINFSHNRFSGSIFPLSGS-STLIVLDL  553

Query  2602  SHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAH  2718
             ++N  +G IP ++AE  +L RL L  N L G +   +  
Sbjct  554   TNNSFSGGIPTRLAESKNLTRLRLGHNHLTGTIPSEFGQ  592


 Score =   213 bits (542),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 179/494 (36%), Positives = 247/494 (50%), Gaps = 27/494 (5%)
 Frame = +1

Query  1348  ELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYE  1527
             +LT +  L L+ + L G ISP  + L +LQ L L  N L G +P E+G L +L+ ++LY 
Sbjct  40    DLTHVVGLNLSGSGLSGIISPEFSCLVSLQILDLSSNYLTGPIPPELGKLQNLKELYLYS  99

Query  1528  NHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLG  1707
             N  SG+I  E+G    LQ +    N  TG+I   LG L  L  L L  + L+G IP  +G
Sbjct  100   NFLSGKISAELGLLKKLQVLRVGNNMLTGEITPHLGNLTDLRVLGLAFSLLNGSIPVEIG  159

Query  1708  NCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSH  1887
             N   L  L+L  N  SG IP        L       N LEG++P  +  L +L  ++L++
Sbjct  160   NLKSLKILNLQQNSFSGLIPGEISSCLELQVFSAAGNMLEGEIPASIGKLESLEILHLAN  219

Query  1888  NNFSGSIAPICTSHSFLSF-DVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLG  2064
             N  SGSI     S S L + ++  N  + +IP  L     L+ L L +N+ +GKI +   
Sbjct  220   NTLSGSIPIELGSLSNLKYLNLLGNGLNGKIPVELNQLSMLETLDLSNNKLSGKINILNS  279

Query  2065  LIRELSLLDLSGNKLSGFIPPQLSL-------------------------CRKLTHLDLN  2169
              +R L  L LS N L+G IP  L +                         C  L  LDL+
Sbjct  280   RLRNLESLVLSDNFLTGGIPSDLCVSNSNLQKVFLSLNNLSGTFPSELLNCSSLQQLDLS  339

Query  2170  NNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEI  2349
             NN   G +P  L  L  L +L L++N FSG LP E+ N S L  L L +NSL G +P EI
Sbjct  340   NNGFYGQLPSGLDNLRNLTDLVLNNNSFSGKLPSEIGNMSSLKGLYLFHNSLTGRIPVEI  399

Query  2350  GNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDF  2529
             G L+ L VL L +NQL GSIP  +     L E+ L  N F+G IP  +G+LK L   L  
Sbjct  400   GKLQRLTVLYLYENQLSGSIPRELTNCSSLMEIDLFGNHFTGSIPATIGKLKHL-VFLQL  458

Query  2530  SYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKR  2709
               N+L+G IPP +G   KL+ L L+ N L+G +PP    ++ L  + L  N  EG L + 
Sbjct  459   RQNDLSGPIPPCLGYCKKLQKLALADNRLSGSLPPTFRFLTELSVVTLYNNSFEGPLPES  518

Query  2710  YAHWPVDSFVGNSH  2751
                    S +  SH
Sbjct  519   LFLLKNLSIINFSH  532



>ref|XP_007155446.1| hypothetical protein PHAVU_003G202100g [Phaseolus vulgaris]
 gb|ESW27440.1| hypothetical protein PHAVU_003G202100g [Phaseolus vulgaris]
Length=960

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/781 (49%), Positives = 498/781 (64%), Gaps = 8/781 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP+++G +  LQ LRIGDN LTG+IP S  N+  L  L +  C+L+G IP  +G+L  
Sbjct  132   GNIPAEIGNMRKLQILRIGDNMLTGEIPPSIANMSELTVLAIGYCHLNGSIPVGIGKLKH  191

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L +L+LQ N L GP+P EI     L  F+A+ N   G IP  +G LK L ILNLANN+L+
Sbjct  192   LISLDLQMNSLGGPIPEEIQGCEELQNFAASNNMFEGDIPFSMGSLKSLKILNLANNSLS  251

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP  L  +S+L YLNLLGN+L G IP  L  L  LQ LDLS N L+G +P     +  
Sbjct  252   GSIPPALSHLSNLTYLNLLGNKLHGEIPSVLNSLIQLQKLDLSKNNLSGSIPLLNVKLQS  311

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L+ L L+ N L+G+IP + C   + LQ L L+   LSG+ P EL  C  +QQLDLS+N+ 
Sbjct  312   LEALVLSDNALTGSIPNNFCLRGSKLQQLFLARNMLSGKFPLELLNCPSIQQLDLSDNSF  371

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
              G +P  L +L  LT LVLNNN+  G++ P + N+++L+ L LF N L G++P EIG L 
Sbjct  372   EGELPASLDKLNSLTYLVLNNNSFVGSLPPEIGNISSLEGLFLFGNFLTGKIPMEIGRLQ  431

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
              L  I+LY+N  SG IP EI NC+SL+ IDF+GN FTG IP T+G+LK L  LHLR+NDL
Sbjct  432   RLSTIYLYDNQMSGLIPREITNCTSLEEIDFFGNHFTGPIPETIGKLKDLVVLHLRQNDL  491

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
             SG IP S+G C  L  L LADN LSG+IP TF YL  LT++ LYNNS EG LP  L +L 
Sbjct  492   SGPIPPSMGYCKSLQILALADNMLSGSIPPTFSYLSELTKITLYNNSFEGPLPHSLSSLK  551

Query  1861  NLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFT  2040
             +L  IN S+N FSGS  P+  S+S    D+TNN+F   IPS L NS +L RLRLG N  T
Sbjct  552   SLKIINFSNNKFSGSFFPLTGSNSLTILDLTNNSFSGPIPSTLANSRNLSRLRLGKNYLT  611

Query  2041  GKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpl  2220
             G IP     + EL+ LDLS N L+G +PPQL   +K+ H+ ++NN LSG +PVWLG L  
Sbjct  612   GSIPSEFHQLTELNFLDLSFNNLTGEMPPQLLNSKKIEHILMSNNRLSGKLPVWLGSLQE  671

Query  2221  lgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLC  2400
             LGEL LS N FSG +P EL NCSKLL LSL +N+L+G +P E+GNL +LNV NL  N   
Sbjct  672   LGELDLSYNSFSGRVPSELGNCSKLLKLSLHHNNLSGEIPQELGNLTALNVFNLQRNGFS  731

Query  2401  GSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLS  2580
             G IP TI    KLYELRLS N  +G IP E+G L +LQ +LD S N  TGEIPPS+G L 
Sbjct  732   GPIPPTIQQCTKLYELRLSENFLTGTIPVELGGLAELQVILDLSKNLFTGEIPPSLGNLM  791

Query  2581  KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCG  2760
             KLE L+LS N L G +PP + +++SL  LNLS N LEG++   ++ +P+ SF+ N  LCG
Sbjct  792   KLERLNLSFNQLKGNVPPSLGKLTSLHVLNLSNNHLEGQIPPTFSGFPLSSFLNNHGLCG  851

Query  2761  SPLGSCRDKGS--------RNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRR  2916
              PL SC +  +        +   +++V I   S  + +++L +    +    + A     
Sbjct  852   PPLRSCSESTALGEMQLSNKQVAAIIVAIVFTSTVICLVMLYIMLRIWCNWRKVAISSAE  911

Query  2917  G  2919
             G
Sbjct  912   G  912


 Score =   319 bits (818),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 224/604 (37%), Positives = 327/604 (54%), Gaps = 11/604 (2%)
 Frame = +1

Query  904   ELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLD  1083
             E G L  +  L+L++N+L+G IP +LGE+ +L  L L  N + G+IP  +  +  LQ L 
Sbjct  89    EFGHLASIQTLDLSSNSLSGSIPSELGELQNLRILQLYSNDISGNIPAEIGNMRKLQILR  148

Query  1084  LSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIP  1263
             +  N L GE+P    +M +L  LA+   +L+G+IP  +     +L  L L    L G IP
Sbjct  149   IGDNMLTGEIPPSIANMSELTVLAIGYCHLNGSIPVGI-GKLKHLISLDLQMNSLGGPIP  207

Query  1264  PELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTL  1443
              E+  C  LQ    SNN   G IP  +  L  L  L L NN+L G+I P++++L+NL  L
Sbjct  208   EEIQGCEELQNFAASNNMFEGDIPFSMGSLKSLKILNLANNSLSGSIPPALSHLSNLTYL  267

Query  1444  SLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIP  1623
             +L  N LHGE+P  +  L  LQ + L +N+ SG IP+      SL+ +    N  TG IP
Sbjct  268   NLLGNKLHGEIPSVLNSLIQLQKLDLSKNNLSGSIPLLNVKLQSLEALVLSDNALTGSIP  327

Query  1624  ITL----GRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRA  1791
                     +L+ LF   L  N LSG+ P  L NC  +  LDL+DN   G +PA+   L +
Sbjct  328   NNFCLRGSKLQQLF---LARNMLSGKFPLELLNCPSIQQLDLSDNSFEGELPASLDKLNS  384

Query  1792  LTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSI-APICTSHSFLSFDVTNNAFD  1968
             LT L+L NNS  G LP ++ N+ +L  + L  N  +G I   I       +  + +N   
Sbjct  385   LTYLVLNNNSFVGSLPPEIGNISSLEGLFLFGNFLTGKIPMEIGRLQRLSTIYLYDNQMS  444

Query  1969  QEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRK  2148
               IP  + N  SL+ +    N FTG IP T+G +++L +L L  N LSG IPP +  C+ 
Sbjct  445   GLIPREITNCTSLEEIDFFGNHFTGPIPETIGKLKDLVVLHLRQNDLSGPIPPSMGYCKS  504

Query  2149  LTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsln  2328
             L  L L +N+LSG IP     L  L ++ L +N F G LP  L +   L +++  NN  +
Sbjct  505   LQILALADNMLSGSIPPTFSYLSELTKITLYNNSFEGPLPHSLSSLKSLKIINFSNNKFS  564

Query  2329  GTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKD  2508
             G+  P  G+  SL +L+L +N   G IPST+     L  LRL +N  +G IP E  QL +
Sbjct  565   GSFFPLTGS-NSLTILDLTNNSFSGPIPSTLANSRNLSRLRLGKNYLTGSIPSEFHQLTE  623

Query  2509  LQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNEL  2688
             L + LD S+NNLTGE+PP +    K+E + +S+N L+G++P  +  +  LG L+LS N  
Sbjct  624   L-NFLDLSFNNLTGEMPPQLLNSKKIEHILMSNNRLSGKLPVWLGSLQELGELDLSYNSF  682

Query  2689  EGEL  2700
              G +
Sbjct  683   SGRV  686


 Score =   238 bits (608),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 166/450 (37%), Positives = 243/450 (54%), Gaps = 3/450 (1%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
             VG +P ++G +++L+ L +  N LTG+IP   G L  L T+ L    +SGLIP ++   T
Sbjct  396   VGSLPPEIGNISSLEGLFLFGNFLTGKIPMEIGRLQRLSTIYLYDNQMSGLIPREITNCT  455

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
              L+ ++   N   GP+P  I  +  L       N L+G IP  +G  K L IL LA+N L
Sbjct  456   SLEEIDFFGNHFTGPIPETIGKLKDLVVLHLRQNDLSGPIPPSMGYCKSLQILALADNML  515

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             +G IP     +S L  + L  N   G +P SL+ L +L+ ++ S N+ +G      GS  
Sbjct  516   SGSIPPTFSYLSELTKITLYNNSFEGPLPHSLSSLKSLKIINFSNNKFSGSFFPLTGS-N  574

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
              L  L LT+N+ SG IP +L +N+ NL  L L +  L+G IP E  Q   L  LDLS N 
Sbjct  575   SLTILDLTNNSFSGPIPSTL-ANSRNLSRLRLGKNYLTGSIPSEFHQLTELNFLDLSFNN  633

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
             L G +P +L    ++  ++++NN L G +   + +L  L  L L +N+  G VP E+G  
Sbjct  634   LTGEMPPQLLNSKKIEHILMSNNRLSGKLPVWLGSLQELGELDLSYNSFSGRVPSELGNC  693

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
               L  + L+ N+ SGEIP E+GN ++L   +   N F+G IP T+ +   L+ L L EN 
Sbjct  694   SKLLKLSLHHNNLSGEIPQELGNLTALNVFNLQRNGFSGPIPPTIQQCTKLYELRLSENF  753

Query  1678  LSGEIPASLGNCHQLDT-LDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRN  1854
             L+G IP  LG   +L   LDL+ N  +G IP + G L  L RL L  N L+G++P  L  
Sbjct  754   LTGTIPVELGGLAELQVILDLSKNLFTGEIPPSLGNLMKLERLNLSFNQLKGNVPPSLGK  813

Query  1855  LGNLTRINLSHNNFSGSIAPICTSHSFLSF  1944
             L +L  +NLS+N+  G I P  +     SF
Sbjct  814   LTSLHVLNLSNNHLEGQIPPTFSGFPLSSF  843


 Score = 53.9 bits (128),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 54/103 (52%), Gaps = 4/103 (4%)
 Frame = +1

Query  2488  EVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRL  2667
             E G L  +Q+ LD S N+L+G IP  +G L  L  L L  ND++G IP ++  M  L  L
Sbjct  89    EFGHLASIQT-LDLSSNSLSGSIPSELGELQNLRILQLYSNDISGNIPAEIGNMRKLQIL  147

Query  2668  NLSCNELEGELDKRYAHWPVDSF--VGNSHLCGS-PLGSCRDK  2787
              +  N L GE+    A+    +   +G  HL GS P+G  + K
Sbjct  148   RIGDNMLTGEIPPSIANMSELTVLAIGYCHLNGSIPVGIGKLK  190



>ref|XP_010248552.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X1 [Nelumbo nucifera]
Length=950

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/823 (50%), Positives = 533/823 (65%), Gaps = 23/823 (3%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             GPIPP L  L +L+ L L+SN L G I ++LGLL  LQ LR+G+N LTG+I    GNL +
Sbjct  107   GPIPPELGKLQNLKELYLYSNFLSGKISAELGLLKKLQVLRVGNNMLTGEITPHLGNLTD  166

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L  LGLA   L+G IP ++G L  L+ LNLQQN   G +P EI++   L  FSAA N L 
Sbjct  167   LRVLGLAFSLLNGSIPVEIGNLKSLKILNLQQNSFSGLIPGEISSCLELQVFSAAGNMLE  226

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             G IP  +G L+ L IL+LANNTL+G IP +LG +S+L YLNLLGN L G IP  L +L+ 
Sbjct  227   GEIPASIGKLESLEILHLANNTLSGSIPIELGSLSNLKYLNLLGNGLNGKIPVELNQLSM  286

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             L++LDLS N+L+G++      +  L+ L L+ N L+G IP  LC + +NLQ + LS   L
Sbjct  287   LETLDLSNNKLSGKINILNSRLRNLESLVLSDNFLTGGIPSDLCVSNSNLQKVFLSLNNL  346

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
             SG  P EL  C  LQQLDLSNN   G +P  L  L  LTDLVLNNN+  G +   + N++
Sbjct  347   SGTFPSELLNCSSLQQLDLSNNGFYGQLPSGLDNLRNLTDLVLNNNSFSGKLPSEIGNMS  406

Query  1429  NLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQF  1608
             +L+ L LFHN+L G +P EIG L  L +++LYEN  SG IP E+ NCSSL  ID +GN F
Sbjct  407   SLKGLYLFHNSLTGRIPVEIGKLQRLTVLYLYENQLSGSIPRELTNCSSLMEIDLFGNHF  466

Query  1609  TGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLR  1788
             TG IP T+G+LKHL FL LR+NDLSG IP  LG C +L  L LADN LSG++P TF +L 
Sbjct  467   TGSIPATIGKLKHLVFLQLRQNDLSGPIPPCLGYCKKLQKLALADNRLSGSLPPTFRFLT  526

Query  1789  ALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFD  1968
              L+ + LYNNS EG LP+ L  L NL+ IN SHN FSGSI P+  S + +  D+TNN+F 
Sbjct  527   ELSVVTLYNNSFEGPLPESLFLLKNLSIINFSHNRFSGSIFPLSGSSTLIVLDLTNNSFS  586

Query  1969  QEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRK  2148
               IP+ L  S +L RLRLG N  TG IP   G + EL+ LDLS N L+G +  +LS C +
Sbjct  587   GGIPTRLAESKNLTRLRLGHNHLTGTIPSEFGQLIELNFLDLSFNNLTGEVIQELSNCNQ  646

Query  2149  LTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsln  2328
             L HL LN+N L+G +P WLGR   LGEL LSSN F G++P EL +CSKLL LSL +N+L+
Sbjct  647   LEHLLLNDNRLTGTVPSWLGRFQGLGELDLSSNDFHGTVPAELGSCSKLLKLSLHSNNLS  706

Query  2329  GTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKD  2508
             G +PPEIGNL  LNVL+L  N L G IPST+    KLYELRLS N  +G IP E+G+L +
Sbjct  707   GWIPPEIGNLTCLNVLDLQRNNLTGPIPSTVQQCKKLYELRLSENFLTGMIPSELGKLTE  766

Query  2509  LQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNEL  2688
             LQ +LD S N L+GEIP S+G L KLE L+LS N L GE+PP +  ++SL  LNLS N L
Sbjct  767   LQVILDLSRNQLSGEIPSSLGKLMKLERLNLSFNQLQGEVPPSLGRLTSLQMLNLSNNLL  826

Query  2689  EGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDK-GSRNK-------GSMVVVISALSATV  2844
             +G++   ++ +P+ SFVGN  LCG+PL SC +  GS  K        +++V I   S  +
Sbjct  827   QGQVPSTFSGFPLSSFVGNKDLCGAPLVSCSESVGSERKWLSDNEVAAIIVAIVFTSTVI  886

Query  2845  AIILLLMGAAFFF---------------KHNREAYRRRRGKEN  2928
              ++L+ M    +F               + NRE  +   G++N
Sbjct  887   CLVLIYMMLRIWFDWRKVSVSSSDSGGLESNREEMQWFYGEDN  929


 Score =   272 bits (695),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 217/579 (37%), Positives = 307/579 (53%), Gaps = 53/579 (9%)
 Frame = +1

Query  1060  LTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSE  1239
             LT++  L+LSG+ L+G +  EF  +  LQ L L+SN L+G                    
Sbjct  68    LTHVVGLNLSGSGLSGIISPEFSCLVSLQILDLSSNYLTG--------------------  107

Query  1240  TGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVA  1419
                   IPPEL + + L++L L +N L+G I  EL  L +L  L + NN L G I+P + 
Sbjct  108   -----PIPPELGKLQNLKELYLYSNFLSGKISAELGLLKKLQVLRVGNNMLTGEITPHLG  162

Query  1420  NLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYG  1599
             NLT+L+ L L  + L+G +P EIG L  L+I+ L +N FSG IP EI +C  LQ     G
Sbjct  163   NLTDLRVLGLAFSLLNGSIPVEIGNLKSLKILNLQQNSFSGLIPGEISSCLELQVFSAAG  222

Query  1600  NQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGN-----------------------  1710
             N   G+IP ++G+L+ L  LHL  N LSG IP  LG+                       
Sbjct  223   NMLEGEIPASIGKLESLEILHLANNTLSGSIPIELGSLSNLKYLNLLGNGLNGKIPVELN  282

Query  1711  -CHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDL-RNLGNLTRINLS  1884
                 L+TLDL++N LSG I      LR L  L+L +N L G +P DL  +  NL ++ LS
Sbjct  283   QLSMLETLDLSNNKLSGKINILNSRLRNLESLVLSDNFLTGGIPSDLCVSNSNLQKVFLS  342

Query  1885  HNNFSGSI-APICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTL  2061
              NN SG+  + +    S    D++NN F  ++PS L N  +L  L L +N F+GK+P  +
Sbjct  343   LNNLSGTFPSELLNCSSLQQLDLSNNGFYGQLPSGLDNLRNLTDLVLNNNSFSGKLPSEI  402

Query  2062  GLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklS  2241
             G +  L  L L  N L+G IP ++   ++LT L L  N LSG IP  L     L E+ L 
Sbjct  403   GNMSSLKGLYLFHNSLTGRIPVEIGKLQRLTVLYLYENQLSGSIPRELTNCSSLMEIDLF  462

Query  2242  SNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTI  2421
              N F+GS+P  +     L+ L L  N L+G +PP +G  K L  L L DN+L GS+P T 
Sbjct  463   GNHFTGSIPATIGKLKHLVFLQLRQNDLSGPIPPCLGYCKKLQKLALADNRLSGSLPPTF  522

Query  2422  GGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDL  2601
               L +L  + L  N F G +P  +  LK+L S+++FS+N  +G I P  G+ S L  LDL
Sbjct  523   RFLTELSVVTLYNNSFEGPLPESLFLLKNL-SIINFSHNRFSGSIFPLSGS-STLIVLDL  580

Query  2602  SHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAH  2718
             ++N  +G IP ++AE  +L RL L  N L G +   +  
Sbjct  581   TNNSFSGGIPTRLAESKNLTRLRLGHNHLTGTIPSEFGQ  619


 Score =   213 bits (542),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 179/494 (36%), Positives = 247/494 (50%), Gaps = 27/494 (5%)
 Frame = +1

Query  1348  ELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYE  1527
             +LT +  L L+ + L G ISP  + L +LQ L L  N L G +P E+G L +L+ ++LY 
Sbjct  67    DLTHVVGLNLSGSGLSGIISPEFSCLVSLQILDLSSNYLTGPIPPELGKLQNLKELYLYS  126

Query  1528  NHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLG  1707
             N  SG+I  E+G    LQ +    N  TG+I   LG L  L  L L  + L+G IP  +G
Sbjct  127   NFLSGKISAELGLLKKLQVLRVGNNMLTGEITPHLGNLTDLRVLGLAFSLLNGSIPVEIG  186

Query  1708  NCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSH  1887
             N   L  L+L  N  SG IP        L       N LEG++P  +  L +L  ++L++
Sbjct  187   NLKSLKILNLQQNSFSGLIPGEISSCLELQVFSAAGNMLEGEIPASIGKLESLEILHLAN  246

Query  1888  NNFSGSIAPICTSHSFLSF-DVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLG  2064
             N  SGSI     S S L + ++  N  + +IP  L     L+ L L +N+ +GKI +   
Sbjct  247   NTLSGSIPIELGSLSNLKYLNLLGNGLNGKIPVELNQLSMLETLDLSNNKLSGKINILNS  306

Query  2065  LIRELSLLDLSGNKLSGFIPPQLSL-------------------------CRKLTHLDLN  2169
              +R L  L LS N L+G IP  L +                         C  L  LDL+
Sbjct  307   RLRNLESLVLSDNFLTGGIPSDLCVSNSNLQKVFLSLNNLSGTFPSELLNCSSLQQLDLS  366

Query  2170  NNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEI  2349
             NN   G +P  L  L  L +L L++N FSG LP E+ N S L  L L +NSL G +P EI
Sbjct  367   NNGFYGQLPSGLDNLRNLTDLVLNNNSFSGKLPSEIGNMSSLKGLYLFHNSLTGRIPVEI  426

Query  2350  GNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDF  2529
             G L+ L VL L +NQL GSIP  +     L E+ L  N F+G IP  +G+LK L   L  
Sbjct  427   GKLQRLTVLYLYENQLSGSIPRELTNCSSLMEIDLFGNHFTGSIPATIGKLKHL-VFLQL  485

Query  2530  SYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKR  2709
               N+L+G IPP +G   KL+ L L+ N L+G +PP    ++ L  + L  N  EG L + 
Sbjct  486   RQNDLSGPIPPCLGYCKKLQKLALADNRLSGSLPPTFRFLTELSVVTLYNNSFEGPLPES  545

Query  2710  YAHWPVDSFVGNSH  2751
                    S +  SH
Sbjct  546   LFLLKNLSIINFSH  559



>ref|XP_002511369.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF51971.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=976

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/784 (51%), Positives = 510/784 (65%), Gaps = 5/784 (1%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             G IPP L  L +L  LLL+SN + G IP  L  L  LQ LR+GDN L G+I  S GNL  
Sbjct  111   GLIPPELGKLHNLRILLLYSNYISGRIPEDLYSLKKLQVLRLGDNMLFGEITPSIGNLTE  170

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L  L +A C  +G IP Q+G L  L +L+LQ+N L G +P EI     L  FSA+ N L 
Sbjct  171   LRVLAVAFCQFNGSIPVQIGNLKHLLSLDLQKNSLTGLVPEEIHGCEELQYFSASNNRLE  230

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             G IP  +G L+ L ILNLANN+L+G IP +LG++SSL YLNLLGN+L G IP  L +L  
Sbjct  231   GDIPASIGKLRALQILNLANNSLSGSIPVELGQLSSLKYLNLLGNKLSGQIPLELNQLVQ  290

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             L+ LDLS N L+G +      +  L+ L L+ N  +G+IP + C   +NLQ L L++  +
Sbjct  291   LEKLDLSVNNLSGPISLFNTQLKNLETLVLSYNEFTGSIPSNFCFRNSNLQQLFLNQNNM  350

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
             SG+ P  L  C  LQQLDLS+N   G +P  + +L  LTDL LNNN+  G + P + N++
Sbjct  351   SGKFPLGLLNCSSLQQLDLSDNNFEGKLPSGIDKLENLTDLKLNNNSFRGKLPPEIGNMS  410

Query  1429  NLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQF  1608
             NL TL LF N + G++P EIG L  L  I+LY+N FSG IP E+ NC+SL  +DF+GN F
Sbjct  411   NLVTLYLFDNIIMGKLPPEIGKLQRLSTIYLYDNQFSGAIPRELTNCTSLTEVDFFGNHF  470

Query  1609  TGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLR  1788
             TG IP T+G+LK+L  L LR+NDLSG IP SLG C +L  + LADN  SG +P TF +L 
Sbjct  471   TGSIPPTIGKLKNLIILQLRQNDLSGPIPPSLGYCRRLQIIALADNKFSGTLPPTFRFLS  530

Query  1789  ALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFD  1968
              L ++ LYNNS EG LP  L  L NL  IN SHN FSGSI+P+  S+S  + D+TNN+F 
Sbjct  531   ELYKVTLYNNSFEGPLPPSLSLLKNLQIINFSHNRFSGSISPLLGSNSLTALDLTNNSFS  590

Query  1969  QEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRK  2148
               IP+ L  S +L RLRL  N  TG I    G + EL  LDLS N L+G + PQLS CRK
Sbjct  591   GPIPARLAMSRNLSRLRLAYNHLTGNISSEFGKLTELRFLDLSFNNLTGDVVPQLSNCRK  650

Query  2149  LTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsln  2328
             L H  L NN L+G +P WLG L  LGEL  SSN F G +P +L NCSKLL LSL +N+L+
Sbjct  651   LEHFLLGNNQLTGIMPSWLGSLEELGELDFSSNNFHGEIPAQLGNCSKLLKLSLHSNNLS  710

Query  2329  GTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKD  2508
             G +P EIGNL SLNVLNL  N L GSIP TI    KL+ELRLS N  +G IP EVG+L +
Sbjct  711   GRIPEEIGNLTSLNVLNLQGNNLSGSIPGTIQECRKLFELRLSENFLTGSIPPEVGRLTE  770

Query  2509  LQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNEL  2688
             LQ +LD S N+L+GEIP S+G L KLE L+LS N   GEIP  +A+++SL  LNLS N+L
Sbjct  771   LQVILDLSKNSLSGEIPSSLGNLMKLERLNLSFNHFRGEIPFSLAKLTSLHMLNLSNNDL  830

Query  2689  EGELDKRYAHWPVDSFVGNSHLCGSPLGSC-----RDKGSRNKGSMVVVISALSATVAII  2853
             +G+L   ++ +P+ SFVGN  LCG PL SC     +++ S +  ++V +I A+  T  +I
Sbjct  831   QGQLPSTFSGFPLSSFVGNGKLCGPPLESCSESRGQERKSLSSTAVVGIIVAIVFTSTLI  890

Query  2854  LLLM  2865
              L+M
Sbjct  891   CLVM  894


 Score =   288 bits (738),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 211/600 (35%), Positives = 301/600 (50%), Gaps = 53/600 (9%)
 Frame = +1

Query  1051  LAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLM  1230
             L+ L++L +LDLS N L G +P E G +  L+ L L SN +SG IP+ L S    LQ+L 
Sbjct  93    LSHLSSLVTLDLSSNFLTGLIPPELGKLHNLRILLLYSNYISGRIPEDLYS-LKKLQVLR  151

Query  1231  LSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISP  1410
             L +  L GEI P +     L+ L ++    NGSIP ++  L  L  L L  N+L G +  
Sbjct  152   LGDNMLFGEITPSIGNLTELRVLAVAFCQFNGSIPVQIGNLKHLLSLDLQKNSLTGLVPE  211

Query  1411  SVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFID  1590
              +     LQ  S  +N L G++P  IG L  LQI+ L  N  SG IPVE+G  SSL++++
Sbjct  212   EIHGCEELQYFSASNNRLEGDIPASIGKLRALQILNLANNSLSGSIPVELGQLSSLKYLN  271

Query  1591  FYGNQFTGKIPITLGRLKHL---------------FF-----------------------  1656
               GN+ +G+IP+ L +L  L                F                       
Sbjct  272   LLGNKLSGQIPLELNQLVQLEKLDLSVNNLSGPISLFNTQLKNLETLVLSYNEFTGSIPS  331

Query  1657  -----------LHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRL  1803
                        L L +N++SG+ P  L NC  L  LDL+DN+  G +P+    L  LT L
Sbjct  332   NFCFRNSNLQQLFLNQNNMSGKFPLGLLNCSSLQQLDLSDNNFEGKLPSGIDKLENLTDL  391

Query  1804  MLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP-ICTSHSFLSFDVTNNAFDQEIP  1980
              L NNS  G LP ++ N+ NL  + L  N   G + P I       +  + +N F   IP
Sbjct  392   KLNNNSFRGKLPPEIGNMSNLVTLYLFDNIIMGKLPPEIGKLQRLSTIYLYDNQFSGAIP  451

Query  1981  SFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHL  2160
               L N  SL  +    N FTG IP T+G ++ L +L L  N LSG IPP L  CR+L  +
Sbjct  452   RELTNCTSLTEVDFFGNHFTGSIPPTIGKLKNLIILQLRQNDLSGPIPPSLGYCRRLQII  511

Query  2161  DLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLP  2340
              L +N  SG +P     L  L ++ L +N F G LPP L     L +++  +N  +G++ 
Sbjct  512   ALADNKFSGTLPPTFRFLSELYKVTLYNNSFEGPLPPSLSLLKNLQIINFSHNRFSGSIS  571

Query  2341  PEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSV  2520
             P +G+  SL  L+L +N   G IP+ +     L  LRL+ N  +G I  E G+L +L+  
Sbjct  572   PLLGS-NSLTALDLTNNSFSGPIPARLAMSRNLSRLRLAYNHLTGNISSEFGKLTELR-F  629

Query  2521  LDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGEL  2700
             LD S+NNLTG++ P +    KLE   L +N LTG +P  +  +  LG L+ S N   GE+
Sbjct  630   LDLSFNNLTGDVVPQLSNCRKLEHFLLGNNQLTGIMPSWLGSLEELGELDFSSNNFHGEI  689


 Score =   245 bits (626),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 179/480 (37%), Positives = 248/480 (52%), Gaps = 27/480 (6%)
 Frame = +1

Query  1267  ELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLS  1446
             ELS    L  LDLS+N L G IP EL +L  L  L+L +N + G I   + +L  LQ L 
Sbjct  92    ELSHLSSLVTLDLSSNFLTGLIPPELGKLHNLRILLLYSNYISGRIPEDLYSLKKLQVLR  151

Query  1447  LFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPI  1626
             L  N L GE+   IG L +L+++ +    F+G IPV+IGN   L  +D   N  TG +P 
Sbjct  152   LGDNMLFGEITPSIGNLTELRVLAVAFCQFNGSIPVQIGNLKHLLSLDLQKNSLTGLVPE  211

Query  1627  TLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLM  1806
              +   + L +     N L G+IPAS+G    L  L+LA+N LSG+IP   G L +L  L 
Sbjct  212   EIHGCEELQYFSASNNRLEGDIPASIGKLRALQILNLANNSLSGSIPVELGQLSSLKYLN  271

Query  1807  LYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFL-SFDVTNNAFDQEIPS  1983
             L  N L G +P +L  L  L +++LS NN SG I+   T    L +  ++ N F   IPS
Sbjct  272   LLGNKLSGQIPLELNQLVQLEKLDLSVNNLSGPISLFNTQLKNLETLVLSYNEFTGSIPS  331

Query  1984  -FLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHL  2160
              F   + +L +L L  N  +GK P+ L     L  LDLS N   G +P  +     LT L
Sbjct  332   NFCFRNSNLQQLFLNQNNMSGKFPLGLLNCSSLQQLDLSDNNFEGKLPSGIDKLENLTDL  391

Query  2161  DLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLP  2340
              LNN                        N F G LPPE+ N S L+ L L +N + G LP
Sbjct  392   KLNN------------------------NSFRGKLPPEIGNMSNLVTLYLFDNIIMGKLP  427

Query  2341  PEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSV  2520
             PEIG L+ L+ + L DNQ  G+IP  +     L E+    N F+G IP  +G+LK+L  +
Sbjct  428   PEIGKLQRLSTIYLYDNQFSGAIPRELTNCTSLTEVDFFGNHFTGSIPPTIGKLKNL-II  486

Query  2521  LDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGEL  2700
             L    N+L+G IPPS+G   +L+ + L+ N  +G +PP    +S L ++ L  N  EG L
Sbjct  487   LQLRQNDLSGPIPPSLGYCRRLQIIALADNKFSGTLPPTFRFLSELYKVTLYNNSFEGPL  546



>ref|XP_008245003.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Prunus mume]
Length=946

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/901 (48%), Positives = 555/901 (62%), Gaps = 12/901 (1%)
 Frame = +1

Query  349   LQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdsslggsispslgllthllhldlssnhl  525
             L  WS +  + CSW G+SC D  + +V LNLS S L GSI   L  LT +  LDLS N L
Sbjct  43    LDNWSPR-AHICSWNGLSCSDDQMHIVGLNLSGSGLSGSIPRELWQLTSIETLDLSLNSL  101

Query  526   sGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLG  705
             +GP+PP L  L +L +LLL+SN L G IP ++GLL NLQ LRIGDN L+G IP S GNL 
Sbjct  102   TGPLPPELRQLQNLVTLLLYSNFLSGEIPPEVGLLKNLQVLRIGDNLLSGAIPPSIGNLT  161

Query  706   NLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSL  885
              L  LGLA C L+G IP  +G L  L +L+LQ N L G +P EI     L  F+A+ N L
Sbjct  162   ELRVLGLAYCQLNGSIPVYIGNLKHLISLDLQNNSLSGLIPEEIHGCEELQNFAASNNML  221

Query  886   NGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLT  1065
              G IP  +G LK L ILNLANN+L+G IP  L ++++L YLN LGN+L G IP  L +L 
Sbjct  222   EGGIPSSIGSLKLLQILNLANNSLSGSIPVVLSQLTNLKYLNFLGNRLNGDIPSELNQLV  281

Query  1066  NLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETG  1245
              L+ LDLS N L+G +      +  L+ L L+ N L+G+IP + C   +NL+ L+L+   
Sbjct  282   QLEMLDLSQNNLSGSIHLLSTQLKNLEALVLSDNALTGSIPSNFCLRNSNLRQLLLARNK  341

Query  1246  LSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANL  1425
             L+G  P E+  C  LQQLDLS+N+  G +P  L  L  LTDLVLNNN+  GT+ P + N+
Sbjct  342   LTGRFPLEVLSCYSLQQLDLSDNSFGGELPAALDNLENLTDLVLNNNSFTGTLPPEIGNM  401

Query  1426  TNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQ  1605
             + L+ L LF N + G +P EIG L  L+ I+LY+N  SG IP E+ NCS L  IDF+GN 
Sbjct  402   SYLENLYLFGNMITGGIPVEIGKLQRLKTIYLYDNQMSGSIPRELTNCSDLTGIDFFGNH  461

Query  1606  FTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYL  1785
             FTG IP T+G LK+L  L LR+N LSG IP SLG C  L  L LADN L+G +P TF ++
Sbjct  462   FTGPIPATIGNLKNLVLLQLRQNGLSGPIPPSLGYCRSLQRLALADNKLTGTLPPTFRFI  521

Query  1786  RALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAF  1965
               L+ + LYNNS EG LP  L  L NL  IN SHN FSG+I P+  S+S  + D+TNN+F
Sbjct  522   SQLSTITLYNNSFEGPLPSSLFLLKNLKIINFSHNRFSGTIFPLSGSNSLTAIDLTNNSF  581

Query  1966  DQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCR  2145
                IPS L    +L RLRL  N  TG IP   G + +L+ LDLS N L+G +PPQLS C+
Sbjct  582   SGSIPSRLSMCRNLSRLRLAHNHLTGTIPSEFGQLTQLNFLDLSYNNLTGEVPPQLSSCK  641

Query  2146  KLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsl  2325
             ++ HL L++N   G IP WLG L  LGEL  SSN F G++P EL NCS LL LSL  NSL
Sbjct  642   RVEHLLLSDNQFRGTIPPWLGSLQELGELDFSSNNFRGTVPAELGNCSNLLKLSLHGNSL  701

Query  2326  nGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLK  2505
             +  +P EIGNL SLNVLNL  N   GSIPSTI    KLYELRLS N  +G IP E+G+L 
Sbjct  702   SNMIPEEIGNLTSLNVLNLQRNNFSGSIPSTIRQCKKLYELRLSENFLTGLIPFELGELT  761

Query  2506  DLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNE  2685
             +LQ +LD S N  +GEIP S+G L KLE L+LS N L GE+P  + +++SL  LNLS N 
Sbjct  762   ELQVILDLSKNLFSGEIPSSLGNLIKLERLNLSSNQLQGEVPVSLGKLTSLHMLNLSNNH  821

Query  2686  LEGELDKRYAHWPVDSFVGNSHLCGSPLGSC-RDKGSRNK----GSMVVVISALSATVAI  2850
             L+G++   ++ +P+ SF+ N  LCG PL  C   +G R K     ++  +  A+  T  +
Sbjct  822   LQGQIPSTFSGFPLSSFLRNDKLCGPPLAKCLESQGQRKKHLSDAAVTGITVAIVLTSTV  881

Query  2851  ILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGNAAKKRDIRW--DDIM  3024
             I L+M    +         R+    N     +   + + K   GN  K+    W  D + 
Sbjct  882   ICLVM---LYIMLRMWCKWRKVSISNLDGGGAEYKREEEKWGLGNEKKRPGEYWKVDSVA  938

Query  3025  E  3027
             E
Sbjct  939   E  939



>ref|XP_011040472.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Populus euphratica]
Length=975

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/761 (50%), Positives = 500/761 (66%), Gaps = 6/761 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP ++GLL NLQ LR+GDN L+G+I    GNL  L  LGLA C  +G IP  +G L  
Sbjct  133   GKIPEEIGLLKNLQVLRVGDNLLSGEITPGIGNLTQLRVLGLAYCQFNGSIPSGIGNLKH  192

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L  L+LQ+N L+G +P EI     L   +   N L G IP  +G L+ L ILNLANN+L+
Sbjct  193   LVTLDLQKNSLDGHIPEEIHGCEELQNLAVLNNKLEGDIPASIGMLRSLQILNLANNSLS  252

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP +LG++S+L YL+LLGN+L G IP  L +L  L++LDLS N  +G +      +  
Sbjct  253   GSIPVELGQLSNLKYLSLLGNRLSGQIPSQLNQLVQLETLDLSLNNFSGAISLFNAQLKN  312

Query  1141  LQFLALTSNNLSGTIPKSLC-SNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
             L+ L L++N+L+G+IP + C SN++ LQ L L+   LSG+   +L  CR LQQLDLS+N 
Sbjct  313   LRTLVLSNNDLTGSIPSNFCLSNSSKLQQLFLARNSLSGKFQLDLLNCRSLQQLDLSDNN  372

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
               G +P  L +L  LTDL+LNNN+  G +   + N++NL+TL LF N + G +P EIG L
Sbjct  373   FEGGLPSGLEKLEHLTDLLLNNNSFSGNLPSEIGNMSNLETLFLFDNMITGRLPPEIGKL  432

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
               L  I+LY+N  SG I  E+ NC+SL  IDF+GN FTG IP T+G+LK+L  L LR+ND
Sbjct  433   QRLSTIYLYDNQMSGGIARELTNCTSLTKIDFFGNHFTGSIPATIGKLKNLNMLQLRQND  492

Query  1678  LSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNL  1857
             LSG IP SLG C +L  + LADN +SG +P TF +L  L ++ LYNNS EG LP  L  L
Sbjct  493   LSGPIPPSLGYCKRLQIMALADNKISGTLPETFRFLTELNKITLYNNSFEGPLPASLFLL  552

Query  1858  GNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRF  2037
              NL  IN SHN FSGSI+P+  S+S  + D+TNN+F   IPS L  S +L RLRL  N  
Sbjct  553   KNLKIINFSHNRFSGSISPLLGSNSLTALDLTNNSFSGPIPSELTQSRNLSRLRLAHNHL  612

Query  2038  TGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlp  2217
             +G+IP   G + +L+  DLS N L+G +PPQLS C+K+ H  LNNN LSG +P WLG L 
Sbjct  613   SGEIPSEFGSLTKLNFFDLSFNNLTGEVPPQLSNCKKIQHFLLNNNQLSGTMPPWLGSLE  672

Query  2218  llgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQL  2397
              LGEL  S N F G++P EL  CS LL LSL +N L+G +P EIGNL SLNVLNL  N L
Sbjct  673   ELGELDFSFNNFHGNIPAELGKCSGLLKLSLHSNKLSGNIPQEIGNLTSLNVLNLQRNNL  732

Query  2398  CGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTL  2577
              G IPSTI    K++ELRLS N  +G IP E+G+L +LQ +LD S N+L+GEIP S+G L
Sbjct  733   SGLIPSTIQECEKIFELRLSENFLTGSIPSELGKLTELQVILDLSENSLSGEIPSSLGNL  792

Query  2578  SKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLC  2757
              KLE L+LS N L GE+P  + +++SL  LNLS N+L+G+L   ++ +P+ SF+GN+ LC
Sbjct  793   MKLEGLNLSLNHLQGEVPFSLTKLTSLHMLNLSNNDLQGQLPPTFSGFPLSSFLGNNKLC  852

Query  2758  GSPLGSC-RDKGSRNKG----SMVVVISALSATVAIILLLM  2865
             G PL SC    G   KG    ++V +I A+  T  +I L+M
Sbjct  853   GPPLISCLESAGHEKKGLSNTAVVGIIVAIVFTSTLICLVM  893


 Score =   315 bits (806),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 225/623 (36%), Positives = 328/623 (53%), Gaps = 54/623 (9%)
 Frame = +1

Query  985   EMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTS  1164
             + + ++ +NL G  L GSI   L  LT+LQ LDLS N L G +P E G +  LQ L L +
Sbjct  69    DQTHVLGMNLSGAGLSGSISHELWHLTSLQILDLSSNSLTGSIPSELGKLQNLQMLLLYA  128

Query  1165  NNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPP---ELSQCRV----------------  1287
             N+LSG IP+ +     NLQ+L + +  LSGEI P    L+Q RV                
Sbjct  129   NSLSGKIPEEI-GLLKNLQVLRVGDNLLSGEITPGIGNLTQLRVLGLAYCQFNGSIPSGI  187

Query  1288  -----LQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLF  1452
                  L  LDL  N+L+G IPEE++   +L +L + NN LEG I  S+  L +LQ L+L 
Sbjct  188   GNLKHLVTLDLQKNSLDGHIPEEIHGCEELQNLAVLNNKLEGDIPASIGMLRSLQILNLA  247

Query  1453  HNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITL  1632
             +N+L G +P E+G L +L+ + L  N  SG+IP ++     L+ +D   N F+G I +  
Sbjct  248   NNSLSGSIPVELGQLSNLKYLSLLGNRLSGQIPSQLNQLVQLETLDLSLNNFSGAISLFN  307

Query  1633  GRLKHLFFLHLRENDLSGEIPAS--------------------------LGNCHQLDTLD  1734
              +LK+L  L L  NDL+G IP++                          L NC  L  LD
Sbjct  308   AQLKNLRTLVLSNNDLTGSIPSNFCLSNSSKLQQLFLARNSLSGKFQLDLLNCRSLQQLD  367

Query  1735  LADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP  1914
             L+DN+  G +P+    L  LT L+L NNS  G+LP ++ N+ NL  + L  N  +G + P
Sbjct  368   LSDNNFEGGLPSGLEKLEHLTDLLLNNNSFSGNLPSEIGNMSNLETLFLFDNMITGRLPP  427

Query  1915  -ICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLD  2091
              I       +  + +N     I   L N  SL ++    N FTG IP T+G ++ L++L 
Sbjct  428   EIGKLQRLSTIYLYDNQMSGGIARELTNCTSLTKIDFFGNHFTGSIPATIGKLKNLNMLQ  487

Query  2092  LSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPP  2271
             L  N LSG IPP L  C++L  + L +N +SG +P     L  L ++ L +N F G LP 
Sbjct  488   LRQNDLSGPIPPSLGYCKRLQIMALADNKISGTLPETFRFLTELNKITLYNNSFEGPLPA  547

Query  2272  ELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELR  2451
              LF    L +++  +N  +G++ P +G+  SL  L+L +N   G IPS +     L  LR
Sbjct  548   SLFLLKNLKIINFSHNRFSGSISPLLGS-NSLTALDLTNNSFSGPIPSELTQSRNLSRLR  606

Query  2452  LSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIP  2631
             L+ N  SGEIP E G L  L +  D S+NNLTGE+PP +    K++   L++N L+G +P
Sbjct  607   LAHNHLSGEIPSEFGSLTKL-NFFDLSFNNLTGEVPPQLSNCKKIQHFLLNNNQLSGTMP  665

Query  2632  PQVAEMSSLGRLNLSCNELEGEL  2700
             P +  +  LG L+ S N   G +
Sbjct  666   PWLGSLEELGELDFSFNNFHGNI  688


 Score =   256 bits (655),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 188/480 (39%), Positives = 268/480 (56%), Gaps = 5/480 (1%)
 Frame = +1

Query  1270  LSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSL  1449
             L Q  VL  ++LS   L+GSI  EL+ LT L  L L++N+L G+I   +  L NLQ L L
Sbjct  68    LDQTHVLG-MNLSGAGLSGSISHELWHLTSLQILDLSSNSLTGSIPSELGKLQNLQMLLL  126

Query  1450  FHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPIT  1629
             + N+L G++P EIG+L +LQ++ + +N  SGEI   IGN + L+ +     QF G IP  
Sbjct  127   YANSLSGKIPEEIGLLKNLQVLRVGDNLLSGEITPGIGNLTQLRVLGLAYCQFNGSIPSG  186

Query  1630  LGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLML  1809
             +G LKHL  L L++N L G IP  +  C +L  L + +N L G IPA+ G LR+L  L L
Sbjct  187   IGNLKHLVTLDLQKNSLDGHIPEEIHGCEELQNLAVLNNKLEGDIPASIGMLRSLQILNL  246

Query  1810  YNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFL-SFDVTNNAFDQEIPSF  1986
              NNSL G +P +L  L NL  ++L  N  SG I         L + D++ N F   I  F
Sbjct  247   ANNSLSGSIPVELGQLSNLKYLSLLGNRLSGQIPSQLNQLVQLETLDLSLNNFSGAISLF  306

Query  1987  LGNSPSLDRLRLGSNRFTGKIPMTLGLIR--ELSLLDLSGNKLSGFIPPQLSLCRKLTHL  2160
                  +L  L L +N  TG IP    L    +L  L L+ N LSG     L  CR L  L
Sbjct  307   NAQLKNLRTLVLSNNDLTGSIPSNFCLSNSSKLQQLFLARNSLSGKFQLDLLNCRSLQQL  366

Query  2161  DLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLP  2340
             DL++N   G +P  L +L  L +L L++N FSG+LP E+ N S L  L L +N + G LP
Sbjct  367   DLSDNNFEGGLPSGLEKLEHLTDLLLNNNSFSGNLPSEIGNMSNLETLFLFDNMITGRLP  426

Query  2341  PEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSV  2520
             PEIG L+ L+ + L DNQ+ G I   +     L ++    N F+G IP  +G+LK+L ++
Sbjct  427   PEIGKLQRLSTIYLYDNQMSGGIARELTNCTSLTKIDFFGNHFTGSIPATIGKLKNL-NM  485

Query  2521  LDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGEL  2700
             L    N+L+G IPPS+G   +L+ + L+ N ++G +P     ++ L ++ L  N  EG L
Sbjct  486   LQLRQNDLSGPIPPSLGYCKRLQIMALADNKISGTLPETFRFLTELNKITLYNNSFEGPL  545



>ref|XP_006344512.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Solanum tuberosum]
Length=974

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/864 (49%), Positives = 553/864 (64%), Gaps = 6/864 (1%)
 Frame = +1

Query  280   VRCQNTSSTLRVLLEVKRSFVLQ---LQGWSEKNPNYCSWQGVSC-DGslkvvslnlsds  447
             V   + SS    LL +K   V     L+ WSE   N C+W GV+C D    +V LNL+ S
Sbjct  22    VSSADGSSDSYRLLRIKSELVDPNGVLENWSEGT-NMCTWNGVACSDDKSHIVRLNLTSS  80

Query  448   slggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGL  627
              L G IS     LT L  +DLS N L+G I PAL  L +LE LLLFSN L G IPS +G 
Sbjct  81    GLEGQISQEFAHLTSLRVIDLSDNFLNGTISPALGELHNLEELLLFSNFLTGEIPSDIGR  140

Query  628   LTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqn  807
             L  LQ LRIG N LTGQ+    G L  L  L +A C  SG IP ++G L QL NL+LQQN
Sbjct  141   LRKLQVLRIGANMLTGQLIPEIGKLSELRVLAVAYCQFSGKIPNEIGNLKQLINLDLQQN  200

Query  808   llEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGE  987
              L GP+P  I    +L  F+A+ N + G IP  +G LK L ILNLANN+ +G IP +L  
Sbjct  201   SLSGPIPDAIGGCKNLQNFAASNNRIEGKIPASIGQLKSLEILNLANNSFSGSIPVELSH  260

Query  988   MSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSN  1167
             +S+L YLNL GN+L G IP  L KL  +++LDLS N  +G +      +  L+ L+L+ N
Sbjct  261   LSNLKYLNLFGNELEGEIPFELNKLVLVETLDLSNNNFSGTIRLLNTQLKNLETLSLSGN  320

Query  1168  NLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELY  1347
              L+G+IP + C   ++L LL+L++  LSG  P EL  C  ++QLDLS N+  G +P  L 
Sbjct  321   FLTGSIPSNFCLRDSSLSLLILADNKLSGNFPLELLNCTSIRQLDLSGNSFGGMLPRGLD  380

Query  1348  ELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYE  1527
              L  LTDL+LNNN+  GTI P + NLTNL+ L LFHN L G +P EIG L  L+ ++LYE
Sbjct  381   RLESLTDLLLNNNSFTGTIPPEIGNLTNLEDLYLFHNMLSGGIPVEIGKLQRLRELYLYE  440

Query  1528  NHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLG  1707
             N  SG IP E+ NCSSL  +DF+GNQ +G IP  +GRLK+L  L LR+N+LSG IP+SLG
Sbjct  441   NQLSGSIPRELTNCSSLTSVDFFGNQLSGSIPDNIGRLKNLVILQLRQNELSGPIPSSLG  500

Query  1708  NCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSH  1887
              C +L  L LADN LSG++P TF +L  +  + LYNNS EG LP+ L  L N+++IN SH
Sbjct  501   YCRKLQKLALADNKLSGSLPPTFRFLSEMDLITLYNNSFEGPLPESLSLLKNISKINFSH  560

Query  1888  NNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGL  2067
             N FSG+I P+    S  + D+TNN+F   IPS L  S +L RLRL +N FTG++P   G 
Sbjct  561   NKFSGNIFPLAGLDSLTALDLTNNSFSGPIPSELALSKNLTRLRLANNFFTGELPSEFGQ  620

Query  2068  IRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSN  2247
             + +L  LDLS N L+G + P L+  + L H  L++N  SG IP WLG +  LGEL LS N
Sbjct  621   LEDLRFLDLSFNNLTGNLAPSLAGLKNLGHFLLSSNQFSGEIPTWLGGIEDLGELDLSFN  680

Query  2248  QFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGG  2427
              F+G++P EL N  KLL LSL  N L+G +PPE+GNL SLNVLNL  N L GSIPST+  
Sbjct  681   NFTGTVPTELGNSPKLLKLSLSYNRLSGPIPPELGNLTSLNVLNLRRNNLSGSIPSTLQK  740

Query  2428  LGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSH  2607
               KLYELRLS N  +G IP E+G L +LQ +LD S N+++GEIP S+G L KLE L+LS 
Sbjct  741   CQKLYELRLSENNLTGSIPYELGSLSELQVILDLSKNHISGEIPSSLGNLVKLERLNLSF  800

Query  2608  NDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSH-LCGSPLGSCRD  2784
             N L G++PP +  +SSL RLNLS N L+G++   ++ +P+ SF+GN+H LCG PL SC +
Sbjct  801   NQLQGKVPPSLGRLSSLHRLNLSYNHLQGQIPSTFSGFPLSSFMGNNHNLCGPPLLSCSE  860

Query  2785  KGSRNKGSMVVVISALSATVAIIL  2856
                  +   +   S +  TVAI+L
Sbjct  861   LKEHERIWELSKASVVGITVAIVL  884



>gb|KHN30928.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Glycine 
soja]
Length=811

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/738 (51%), Positives = 479/738 (65%), Gaps = 5/738 (1%)
 Frame = +1

Query  667   LTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANI  846
             L G+I  S GNL  L   G+A+C L+G IP ++G+L  L +L+LQ N L G +P EI   
Sbjct  2     LEGEITPSIGNLSELTVFGVANCNLNGSIPVEVGKLKNLVSLDLQVNSLSGYIPEEIQGC  61

Query  847   SSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQ  1026
               L  F+A+ N L G IP  LG LK L ILNLANNTL+G IP  L  +S+L YLNLLGN 
Sbjct  62    EGLQNFAASNNMLEGEIPSSLGSLKSLRILNLANNTLSGSIPTSLSLLSNLTYLNLLGNM  121

Query  1027  LGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSN  1206
             L G IP  L  L+ LQ LDLS N L+G L      +  L+ + L+ N L+G+IP + C  
Sbjct  122   LNGEIPSELNSLSQLQKLDLSRNSLSGPLALLNVKLQNLETMVLSDNALTGSIPYNFCLR  181

Query  1207  ATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNN  1386
              + LQ L L+   LSG  P EL  C  +QQ+DLS+N+  G +P  L +L  LTDLVLNNN
Sbjct  182   GSKLQQLFLARNKLSGRFPLELLNCSSIQQVDLSDNSFEGELPSSLDKLQNLTDLVLNNN  241

Query  1387  TLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGN  1566
             +  G++ P + N+++L++L LF N   G++P EIG L  L  I+LY+N  SG IP E+ N
Sbjct  242   SFSGSLPPGIGNISSLRSLFLFGNFFTGKLPVEIGRLKRLNTIYLYDNQMSGPIPRELTN  301

Query  1567  CSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADN  1746
             C+ L  IDF+GN F+G IP T+G+LK L  LHLR+NDLSG IP S+G C +L  L LADN
Sbjct  302   CTRLTEIDFFGNHFSGPIPKTIGKLKDLTILHLRQNDLSGPIPPSMGYCKRLQLLALADN  361

Query  1747  HLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTS  1926
              LSG+IP TF YL  +  + LYNNS EG LPD L  L NL  IN S+N FSGSI P+  S
Sbjct  362   KLSGSIPPTFSYLSQIRTITLYNNSFEGPLPDSLSLLRNLKIINFSNNKFSGSIFPLTGS  421

Query  1927  HSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNK  2106
             +S    D+TNN+F   IPS LGNS  L RLRLG+N  TG IP  LG + EL+ LDLS N 
Sbjct  422   NSLTVLDLTNNSFSGSIPSILGNSRDLTRLRLGNNYLTGTIPSELGHLTELNFLDLSFNN  481

Query  2107  LSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNC  2286
             L+G +PPQLS C+K+ HL LNNN LSG +  WLG L  LGEL LS N F G +PPEL  C
Sbjct  482   LTGHVPPQLSNCKKIEHLLLNNNRLSGEMSPWLGSLQELGELDLSFNNFHGRVPPELGGC  541

Query  2287  skllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNR  2466
             SKLL LSL +N+L+G +P EIGNL SLNV NL  N L G IPSTI    KLYE+RLS N 
Sbjct  542   SKLLKLSLHHNNLSGEIPQEIGNLTSLNVFNLQKNGLSGLIPSTIQQCTKLYEIRLSENF  601

Query  2467  FSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAE  2646
              SG IP E+G + +LQ +LD S N+ +GEIP S+G L KLE LDLS N L G++PP + +
Sbjct  602   LSGTIPAELGGVTELQVILDLSRNHFSGEIPSSLGNLMKLERLDLSFNHLQGQVPPSLGQ  661

Query  2647  MSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC-----RDKGSRNKGSM  2811
             ++SL  LNLS N L G +   ++ +P+ SF+ N HLCG PL  C     +++   +   +
Sbjct  662   LTSLHMLNLSYNHLNGLIPSTFSGFPLSSFLNNDHLCGPPLTLCLEATGKERMQLSNAQV  721

Query  2812  VVVISALSATVAIILLLM  2865
               +I A+  T  +I L+M
Sbjct  722   AAIIVAIVLTSTLICLVM  739


 Score =   283 bits (724),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 237/615 (39%), Positives = 321/615 (52%), Gaps = 9/615 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IPS LG L +L+ L + +N L+G IPTS   L NL  L L    L+G IP +L  L+Q
Sbjct  76    GEIPSSLGSLKSLRILNLANNTLSGSIPTSLSLLSNLTYLNLLGNMLNGEIPSELNSLSQ  135

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKE--LGGLKHLHILNLANNT  954
             LQ L+L +N L GPL      + +L     + N+L GSIP    L G K L  L LA N 
Sbjct  136   LQKLDLSRNSLSGPLALLNVKLQNLETMVLSDNALTGSIPYNFCLRGSK-LQQLFLARNK  194

Query  955   LTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSM  1134
             L+G  P +L   SS+  ++L  N   G +P SL KL NL  L L+ N  +G LP   G++
Sbjct  195   LSGRFPLELLNCSSIQQVDLSDNSFEGELPSSLDKLQNLTDLVLNNNSFSGSLPPGIGNI  254

Query  1135  GQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNN  1314
               L+ L L  N  +G +P  +      L  + L +  +SG IP EL+ C  L ++D   N
Sbjct  255   SSLRSLFLFGNFFTGKLPVEI-GRLKRLNTIYLYDNQMSGPIPRELTNCTRLTEIDFFGN  313

Query  1315  TLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGM  1494
               +G IP+ + +L  LT L L  N L G I PS+     LQ L+L  N L G +P     
Sbjct  314   HFSGPIPKTIGKLKDLTILHLRQNDLSGPIPPSMGYCKRLQLLALADNKLSGSIPPTFSY  373

Query  1495  LGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKI-PITLGRLKHLFFLHLRE  1671
             L  ++ I LY N F G +P  +    +L+ I+F  N+F+G I P+T      L  L L  
Sbjct  374   LSQIRTITLYNNSFEGPLPDSLSLLRNLKIINFSNNKFSGSIFPLTGS--NSLTVLDLTN  431

Query  1672  NDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLR  1851
             N  SG IP+ LGN   L  L L +N+L+G IP+  G+L  L  L L  N+L G +P  L 
Sbjct  432   NSFSGSIPSILGNSRDLTRLRLGNNYLTGTIPSELGHLTELNFLDLSFNNLTGHVPPQLS  491

Query  1852  NLGNLTRINLSHNNFSGSIAPICTSHSFL-SFDVTNNAFDQEIPSFLGNSPSLDRLRLGS  2028
             N   +  + L++N  SG ++P   S   L   D++ N F   +P  LG    L +L L  
Sbjct  492   NCKKIEHLLLNNNRLSGEMSPWLGSLQELGELDLSFNNFHGRVPPELGGCSKLLKLSLHH  551

Query  2029  NRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPV-Wl  2205
             N  +G+IP  +G +  L++ +L  N LSG IP  +  C KL  + L+ N LSG IP    
Sbjct  552   NNLSGEIPQEIGNLTSLNVFNLQKNGLSGLIPSTIQQCTKLYEIRLSENFLSGTIPAELG  611

Query  2206  grlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLD  2385
             G   L   L LS N FSG +P  L N  KL  L L  N L G +PP +G L SL++LNL 
Sbjct  612   GVTELQVILDLSRNHFSGEIPSSLGNLMKLERLDLSFNHLQGQVPPSLGQLTSLHMLNLS  671

Query  2386  DNQLCGSIPSTIGGL  2430
              N L G IPST  G 
Sbjct  672   YNHLNGLIPSTFSGF  686



>ref|XP_002439362.1| hypothetical protein SORBIDRAFT_09g005150 [Sorghum bicolor]
 gb|EES17792.1| hypothetical protein SORBIDRAFT_09g005150 [Sorghum bicolor]
Length=978

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/785 (51%), Positives = 509/785 (65%), Gaps = 10/785 (1%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             GPIPP L  L +L +LLLFSN L G IP +LGLL NL+ LRIGDN L G+IP   G+   
Sbjct  115   GPIPPELGVLENLRTLLLFSNSLTGTIPPELGLLKNLKVLRIGDNRLHGEIPPQLGDCSE  174

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L TLGLA C L+G IP +LG L QLQ L L  N L G +P ++A   SL   S + N L 
Sbjct  175   LETLGLAYCQLNGTIPAELGNLKQLQKLALDNNTLTGGIPEQLAGCVSLRFLSVSDNMLQ  234

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             G+IP  LG    L  LNLANN  +GEIP ++G +SSL YLNLLGN L G+IP  L +L  
Sbjct  235   GNIPSFLGSFSDLQSLNLANNQFSGEIPVEIGNLSSLTYLNLLGNSLTGAIPAELNRLGQ  294

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATN--LQLLMLSET  1242
             LQ LDLS N ++G++      +  L++L L+ N L G IP+ LC+  ++  L+ L L+  
Sbjct  295   LQVLDLSMNNISGKVSISPAQLKNLKYLVLSGNLLDGAIPEDLCAGDSSSLLENLFLAGN  354

Query  1243  GLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVAN  1422
              L G I   L  C  LQ +D+SNN+  G IP  +  L  L +L L+NN+  G +   + N
Sbjct  355   NLEGGIE-ALLNCDALQSIDVSNNSFTGVIPPGIDRLPGLVNLALHNNSFTGGLPRQIGN  413

Query  1423  LTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGN  1602
             L+NL+ LSLFHN L G +P EIG L  L+++FLYEN  SG IP E+ NC+SL+ +DF+GN
Sbjct  414   LSNLEILSLFHNGLTGGIPSEIGRLQKLKLLFLYENQMSGTIPDELTNCTSLEEVDFFGN  473

Query  1603  QFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGY  1782
              F G IP  +G L++L  L LR+NDLSG IPASLG C  L  L LADN L+G +P TFG 
Sbjct  474   HFHGPIPERIGNLRNLAVLQLRQNDLSGPIPASLGECRSLQALALADNRLTGVLPETFGQ  533

Query  1783  LRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNA  1962
             L  L+ + LYNNSLEG LP+ L  L NLT IN SHN F+GS+ P+  S S     +T+N+
Sbjct  534   LTELSVVTLYNNSLEGPLPESLFQLKNLTVINFSHNRFAGSLVPLLGSTSLAVLALTSNS  593

Query  1963  FDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLC  2142
             F   IP+ +  S ++ RL+LG NR TG IP  LG +  LS+LDLS N LSG IP +LS C
Sbjct  594   FSGVIPAVVARSRNMVRLQLGGNRLTGAIPAELGNLTRLSMLDLSLNNLSGDIPAELSSC  653

Query  2143  RKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslenns  2322
              +LTHL L+ N L+G +P WLG L  LGEL LS N F+G +PPEL NCS LL LSL +N 
Sbjct  654   VELTHLKLDGNSLTGTVPAWLGSLRSLGELDLSWNVFTGGIPPELGNCSGLLKLSLSDNH  713

Query  2323  lnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQL  2502
             L G++PPEIG L SLNVLNL+ N L G+IP ++    KLYELRLS N   G IP E+GQL
Sbjct  714   LTGSIPPEIGRLTSLNVLNLNKNSLTGAIPPSLQQCNKLYELRLSENSLEGPIPPELGQL  773

Query  2503  KDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCN  2682
              +LQ +LD S N L+GEIP S+G+L KLE L+LS N L G+IP  + +++SL RLNLS N
Sbjct  774   SELQVILDLSRNRLSGEIPASLGSLVKLERLNLSSNRLDGQIPSSLLQLTSLHRLNLSDN  833

Query  2683  ELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC--RDKGSRNKGSMVVVISA----LSATV  2844
              L G +    + +P  SFVGN  LCG+PL  C  R    R  G+ VVVI A    +SA V
Sbjct  834   LLSGAVPAGLSSFPAASFVGN-ELCGAPLPPCGPRSPARRLSGTEVVVIVAGIALVSAVV  892

Query  2845  AIILL  2859
              + LL
Sbjct  893   CVALL  897


 Score =   257 bits (657),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 201/543 (37%), Positives = 275/543 (51%), Gaps = 53/543 (10%)
 Frame = +1

Query  1225  LMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTI  1404
             L LS  GLSG IPP +S    ++ +DLS+N+L G IP EL  L  L  L+L +N+L GTI
Sbjct  82    LNLSGYGLSGVIPPAISGLVSVESIDLSSNSLTGPIPPELGVLENLRTLLLFSNSLTGTI  141

Query  1405  SPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQF  1584
              P +  L NL+ L +  N LHGE+P ++G   +L+ + L     +G IP E+GN   LQ 
Sbjct  142   PPELGLLKNLKVLRIGDNRLHGEIPPQLGDCSELETLGLAYCQLNGTIPAELGNLKQLQK  201

Query  1585  IDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAI  1764
             +    N  TG IP  L     L FL + +N L G IP+ LG+   L +L+LA+N  SG I
Sbjct  202   LALDNNTLTGGIPEQLAGCVSLRFLSVSDNMLQGNIPSFLGSFSDLQSLNLANNQFSGEI  261

Query  1765  PATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSG--SIAP--------  1914
             P   G L +LT L L  NSL G +P +L  LG L  ++LS NN SG  SI+P        
Sbjct  262   PVEIGNLSSLTYLNLLGNSLTGAIPAELNRLGQLQVLDLSMNNISGKVSISPAQLKNLKY  321

Query  1915  ---------------ICTSHS-------FL-------------------SFDVTNNAFDQ  1971
                            +C   S       FL                   S DV+NN+F  
Sbjct  322   LVLSGNLLDGAIPEDLCAGDSSSLLENLFLAGNNLEGGIEALLNCDALQSIDVSNNSFTG  381

Query  1972  EIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKL  2151
              IP  +   P L  L L +N FTG +P  +G +  L +L L  N L+G IP ++   +KL
Sbjct  382   VIPPGIDRLPGLVNLALHNNSFTGGLPRQIGNLSNLEILSLFHNGLTGGIPSEIGRLQKL  441

Query  2152  THLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnG  2331
               L L  N +SG IP  L     L E+    N F G +P  + N   L VL L  N L+G
Sbjct  442   KLLFLYENQMSGTIPDELTNCTSLEEVDFFGNHFHGPIPERIGNLRNLAVLQLRQNDLSG  501

Query  2332  TLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDL  2511
              +P  +G  +SL  L L DN+L G +P T G L +L  + L  N   G +P  + QLK+L
Sbjct  502   PIPASLGECRSLQALALADNRLTGVLPETFGQLTELSVVTLYNNSLEGPLPESLFQLKNL  561

Query  2512  QSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELE  2691
              +V++FS+N   G + P +G+ S L  L L+ N  +G IP  VA   ++ RL L  N L 
Sbjct  562   -TVINFSHNRFAGSLVPLLGSTS-LAVLALTSNSFSGVIPAVVARSRNMVRLQLGGNRLT  619

Query  2692  GEL  2700
             G +
Sbjct  620   GAI  622



>ref|XP_004236228.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Solanum lycopersicum]
Length=974

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/838 (50%), Positives = 544/838 (65%), Gaps = 3/838 (0%)
 Frame = +1

Query  349   LQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdsslggsispslgllthllhldlssnhl  525
             L+ WSE   N C+W GV+C D    +V LNL+ S L G IS     LT L  +DLS N L
Sbjct  48    LENWSEGT-NMCTWNGVACSDDKSHIVRLNLTSSGLEGQISQEFAHLTSLRVIDLSDNFL  106

Query  526   sGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLG  705
             +G IPPA   L +LE LLLFSN L G IP ++  L  LQ LRIG N LTGQ+    G L 
Sbjct  107   NGTIPPAFGELHNLEELLLFSNFLSGEIPLEISRLRKLQVLRIGANMLTGQVIPEIGKLS  166

Query  706   NLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSL  885
              L  L +A C LSG IP ++G L QL NL+LQQN L GP+P  I    +L  F+A+ N +
Sbjct  167   ELRVLAVAYCQLSGKIPNEIGNLKQLINLDLQQNSLSGPIPEAIGGCKNLQNFAASNNRI  226

Query  886   NGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLT  1065
              G I   +G L+ L ILNLANN+ +G IP +L  +S+L YLNL GN+L G IP  L KL 
Sbjct  227   EGKILASIGQLESLEILNLANNSFSGLIPVELSHLSNLKYLNLFGNELEGEIPFELNKLV  286

Query  1066  NLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETG  1245
              L++LDLS N+L+G +      +  L+ L+L+ N L+G+IP + C   ++L LL+L++  
Sbjct  287   QLETLDLSNNKLSGTIRLLNTQLKNLETLSLSGNFLTGSIPSNFCLRDSSLSLLILADNK  346

Query  1246  LSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANL  1425
             LSG  P EL  C  ++QLDLS N+  G +P  L  L  LTDL+LNNN+  GTI P + NL
Sbjct  347   LSGNFPLELLNCMSIRQLDLSGNSFGGMLPRGLDRLKSLTDLLLNNNSFTGTIPPEIGNL  406

Query  1426  TNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQ  1605
             TNL+ L LF N L G +P EIG L  L+ ++LYEN  SG IP E+ NCS L  +DF+GNQ
Sbjct  407   TNLEDLYLFQNMLSGGIPVEIGKLQRLRELYLYENQLSGSIPRELTNCSCLTSVDFFGNQ  466

Query  1606  FTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYL  1785
              +G IP  +GRLK+L  L LR+N+LSG IP+SLG C +L  L LADN LSG++P TF +L
Sbjct  467   LSGPIPDNIGRLKNLVILQLRQNELSGPIPSSLGYCRKLQKLALADNKLSGSLPPTFRFL  526

Query  1786  RALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAF  1965
               +  + LYNNSLEG LP+ L  L NL++IN SHN FSG+I+P+    S  + D+TNN+F
Sbjct  527   SEMDLITLYNNSLEGPLPESLSLLKNLSKINFSHNKFSGNISPLAGLDSLTALDLTNNSF  586

Query  1966  DQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCR  2145
                IPS L  S +L RLRL +N FTG++P      ++L  LDLS N L+G +PP L+  +
Sbjct  587   SGPIPSKLALSKNLTRLRLANNFFTGQLPSEFRQFKDLRFLDLSFNNLTGNLPPSLAGLK  646

Query  2146  KLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsl  2325
              L H  L++N  SG IP WLG +  LGEL LS N FSG++P EL N  KLL LSL  N L
Sbjct  647   NLGHFLLSSNQFSGEIPTWLGGIEDLGELDLSFNNFSGTVPTELGNSPKLLKLSLSYNRL  706

Query  2326  nGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLK  2505
             +G +PPE+GNL SLNVLNL  N L GSIPST+    KLYELRLS N  +G IP E+G L 
Sbjct  707   SGPIPPELGNLTSLNVLNLRRNNLSGSIPSTLSKCQKLYELRLSENNLTGSIPYELGSLS  766

Query  2506  DLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNE  2685
             +LQ +LD S N+++GEIP S+G L KLE L+LS N L G++P  +  +SSL RLNLS N 
Sbjct  767   ELQVILDLSQNHISGEIPSSLGNLVKLERLNLSFNQLQGKVPQSLGRLSSLHRLNLSYNH  826

Query  2686  LEGELDKRYAHWPVDSFVGNSH-LCGSPLGSCRDKGSRNKGSMVVVISALSATVAIIL  2856
             LEG++   ++ +P+ SF+GN+H LCG PL SC +    ++   +     +  TVAI+L
Sbjct  827   LEGQIPSTFSGFPLSSFMGNNHNLCGPPLLSCSELKEHDRIWELSKAGVVGITVAIVL  884



>dbj|BAJ85489.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=894

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/803 (49%), Positives = 509/803 (63%), Gaps = 5/803 (1%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             GPIPP L  L +L++LLL+SN LVG IPS+LGLL NL+ LRIGDN L G+IP   GN   
Sbjct  36    GPIPPELGRLQNLKTLLLYSNSLVGTIPSELGLLVNLKVLRIGDNRLHGEIPPQLGNCTE  95

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L T+ LA C LSG IP Q+G L  LQ L L  N L G +P ++   ++L   S + N L 
Sbjct  96    LETMALAYCQLSGAIPYQIGNLKNLQQLVLDNNTLTGSIPEQLGGCANLRTLSLSDNRLG  155

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             G IP  +G L  L  LNLANN  +G IP  +G++SSL YLNLLGN L G+IP+ L +L+ 
Sbjct  156   GIIPSFVGSLSVLQSLNLANNQFSGAIPADIGKLSSLTYLNLLGNSLTGAIPEELNQLSQ  215

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             LQ LDLS N ++G +      +  L++L L+ N L GTIP+ LC   ++L+ L L+   L
Sbjct  216   LQVLDLSKNNISGVISISTSQLKNLKYLVLSDNLLDGTIPEGLCPGNSSLESLFLAGNNL  275

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
              G I   L  C  L+ +D SNN+  G IP E+  L  L +LVL+NN+L G + P + NL+
Sbjct  276   EGGIE-GLLNCISLRSIDASNNSFTGKIPSEIDRLPNLVNLVLHNNSLTGVLPPQIGNLS  334

Query  1429  NLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQF  1608
             NL+ LSL+HN L G +P EIG L  L+++FLYEN  SG IP EI NC SL+ +DF+GN F
Sbjct  335   NLEVLSLYHNGLTGVLPPEIGRLQRLKVLFLYENQMSGTIPDEITNCMSLEEVDFFGNHF  394

Query  1609  TGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLR  1788
              G IP  +G LK L  L LR+NDLSG IPASLG C +L  L LADN L+GA+P TF  L 
Sbjct  395   HGTIPEKIGNLKSLTVLQLRQNDLSGSIPASLGECRRLQALALADNRLTGALPDTFRLLT  454

Query  1789  ALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFD  1968
              L+ + LYNNSLEG LP+ L  L NLT IN+SHN FSGS+ P+  S S     +T+N F 
Sbjct  455   ELSIITLYNNSLEGPLPEALFELKNLTVINISHNKFSGSVVPLLGSSSLSVLVLTDNFFS  514

Query  1969  QEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRK  2148
               IP+ +  S ++ RL+L  N  TG IP  LG + +L +LDLS N LSG +P QLS C +
Sbjct  515   GVIPTAVTRSRNMVRLQLAGNHLTGAIPAKLGTLTQLKMLDLSSNNLSGDLPSQLSNCLQ  574

Query  2149  LTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsln  2328
             LTHL+L  N L+G +P WLG L  LGEL LSSN  +G +P EL NCS LL LSL  N L+
Sbjct  575   LTHLNLERNSLTGVVPSWLGSLRFLGELDLSSNALTGVIPVELGNCSSLLKLSLSGNRLS  634

Query  2329  GTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKD  2508
             G++P EIG+L SLNVLNL  N L G IP T+    KLYELRLS N   G IP E+GQL +
Sbjct  635   GSIPQEIGSLTSLNVLNLQKNSLTGVIPPTLRRCNKLYELRLSENSLEGPIPTELGQLSE  694

Query  2509  LQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNEL  2688
             LQ +LD S N L+G+IP S+G L KLE L+LS N L G+IP  + +++SL RLNLS N L
Sbjct  695   LQVMLDLSRNRLSGQIPTSLGNLVKLERLNLSSNQLHGKIPTSLLQLTSLNRLNLSDNLL  754

Query  2689  EGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSR----NKGSMVVVISALSATVAIIL  2856
              G +    + +P  S+ GN  LCG PL +C   G R        +V  I+ +SATV + L
Sbjct  755   SGAIPAVLSSFPSASYAGNDELCGVPLLTCGANGRRLPSATVSGIVAAIAIVSATVCMAL  814

Query  2857  LLMGAAFFFKHNREAYRRRRGKE  2925
             L +    +      +     G+E
Sbjct  815   LYIMLRMWSNWREVSVSNSDGEE  837


 Score =   255 bits (652),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 189/495 (38%), Positives = 268/495 (54%), Gaps = 26/495 (5%)
 Frame = +1

Query  1225  LMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTI  1404
             L LS  GLSG + P ++    ++ +DLS+N+L G IP EL  L  L  L+L +N+L GTI
Sbjct  3     LNLSGYGLSGTLSPAIAGLISVEIIDLSSNSLTGPIPPELGRLQNLKTLLLYSNSLVGTI  62

Query  1405  SPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQF  1584
                +  L NL+ L +  N LHGE+P ++G   +L+ + L     SG IP +IGN  +LQ 
Sbjct  63    PSELGLLVNLKVLRIGDNRLHGEIPPQLGNCTELETMALAYCQLSGAIPYQIGNLKNLQQ  122

Query  1585  IDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAI  1764
             +    N  TG IP  LG   +L  L L +N L G IP+ +G+   L +L+LA+N  SGAI
Sbjct  123   LVLDNNTLTGSIPEQLGGCANLRTLSLSDNRLGGIIPSFVGSLSVLQSLNLANNQFSGAI  182

Query  1765  PATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSF  1944
             PA  G L +LT L L  NSL G +P++L  L  L  ++LS NN SG I+   +    L +
Sbjct  183   PADIGKLSSLTYLNLLGNSLTGAIPEELNQLSQLQVLDLSKNNISGVISISTSQLKNLKY  242

Query  1945  DV-TNNAFDQEIPSFL--GNSP----------------------SLDRLRLGSNRFTGKI  2049
              V ++N  D  IP  L  GNS                       SL  +   +N FTGKI
Sbjct  243   LVLSDNLLDGTIPEGLCPGNSSLESLFLAGNNLEGGIEGLLNCISLRSIDASNNSFTGKI  302

Query  2050  PMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllge  2229
             P  +  +  L  L L  N L+G +PPQ+     L  L L +N L+G +P  +GRL  L  
Sbjct  303   PSEIDRLPNLVNLVLHNNSLTGVLPPQIGNLSNLEVLSLYHNGLTGVLPPEIGRLQRLKV  362

Query  2230  lklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSI  2409
             L L  NQ SG++P E+ NC  L  +    N  +GT+P +IGNLKSL VL L  N L GSI
Sbjct  363   LFLYENQMSGTIPDEITNCMSLEEVDFFGNHFHGTIPEKIGNLKSLTVLQLRQNDLSGSI  422

Query  2410  PSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLE  2589
             P+++G   +L  L L+ NR +G +P     L +L S++    N+L G +P ++  L  L 
Sbjct  423   PASLGECRRLQALALADNRLTGALPDTFRLLTEL-SIITLYNNSLEGPLPEALFELKNLT  481

Query  2590  SLDLSHNDLTGEIPP  2634
              +++SHN  +G + P
Sbjct  482   VINISHNKFSGSVVP  496


 Score =   225 bits (574),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 182/510 (36%), Positives = 258/510 (51%), Gaps = 50/510 (10%)
 Frame = +1

Query  1297  LDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEV  1476
             L+LS   L+G++   +  L  +  + L++N+L G I P +  L NL+TL L+ N+L G +
Sbjct  3     LNLSGYGLSGTLSPAIAGLISVEIIDLSSNSLTGPIPPELGRLQNLKTLLLYSNSLVGTI  62

Query  1477  PREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFF  1656
             P E+G+L +L+++ + +N   GEIP ++GNC+ L+ +     Q +G IP  +G LK+L  
Sbjct  63    PSELGLLVNLKVLRIGDNRLHGEIPPQLGNCTELETMALAYCQLSGAIPYQIGNLKNLQQ  122

Query  1657  LHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDL  1836
             L L  N L+G IP  LG C  L TL L+DN L G IP+  G L  L  L           
Sbjct  123   LVLDNNTLTGSIPEQLGGCANLRTLSLSDNRLGGIIPSFVGSLSVLQSL-----------  171

Query  1837  PDDLRNLGNLTRINLSHNNFSGSI-APICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDR  2013
                          NL++N FSG+I A I    S    ++  N+    IP  L     L  
Sbjct  172   -------------NLANNQFSGAIPADIGKLSSLTYLNLLGNSLTGAIPEELNQLSQLQV  218

Query  2014  LRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQL-----SL-------------  2139
             L L  N  +G I ++   ++ L  L LS N L G IP  L     SL             
Sbjct  219   LDLSKNNISGVISISTSQLKNLKYLVLSDNLLDGTIPEGLCPGNSSLESLFLAGNNLEGG  278

Query  2140  ------CRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllv  2301
                   C  L  +D +NN  +G IP  + RLP L  L L +N  +G LPP++ N S L V
Sbjct  279   IEGLLNCISLRSIDASNNSFTGKIPSEIDRLPNLVNLVLHNNSLTGVLPPQIGNLSNLEV  338

Query  2302  lslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEI  2481
             LSL +N L G LPPEIG L+ L VL L +NQ+ G+IP  I     L E+    N F G I
Sbjct  339   LSLYHNGLTGVLPPEIGRLQRLKVLFLYENQMSGTIPDEITNCMSLEEVDFFGNHFHGTI  398

Query  2482  PREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLG  2661
             P ++G LK L +VL    N+L+G IP S+G   +L++L L+ N LTG +P     ++ L 
Sbjct  399   PEKIGNLKSL-TVLQLRQNDLSGSIPASLGECRRLQALALADNRLTGALPDTFRLLTELS  457

Query  2662  RLNLSCNELEGELDKRYAHWPVDSFVGNSH  2751
              + L  N LEG L +        + +  SH
Sbjct  458   IITLYNNSLEGPLPEALFELKNLTVINISH  487



>ref|XP_010555502.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase GSO1 [Tarenaya hassleriana]
Length=969

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/765 (49%), Positives = 491/765 (64%), Gaps = 5/765 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G +P+++GLL NLQ LR+GDN L G+IP   G+L  L  LGL  C L+G IP ++GRL  
Sbjct  127   GGVPAEIGLLKNLQVLRLGDNMLRGEIPQHIGDLSELRVLGLGYCELNGSIPGEIGRLKN  186

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L+ L+LQ N L G +P EI +   L     + N L GSI    G ++ L ILNLANN+ +
Sbjct  187   LEILDLQSNDLSGRIPDEIQSCEVLRVIVLSNNGLEGSISTSFGSIESLEILNLANNSFS  246

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G +P QL  ++ L YLNL GN+L G IP  +  L  L +LDLS N L+G +      +  
Sbjct  247   GSVPWQLSNLTGLKYLNLAGNRLTGEIPVEINGLVGLDTLDLSDNELSGTIRILSSRLTN  306

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L+ L L+ N L+G IP   C+  +NL+    SE  L GE P E+  C  L QLDLS+N  
Sbjct  307   LRSLILSRNALTGDIPSXFCAKNSNLEQFFASENHLWGEFPLEILNCTSLLQLDLSDNNF  366

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
              G IP  +     LTDL+LNNN+  G +   + NLT+L++L LF N LHG VPREIG L 
Sbjct  367   RGGIPPSIDRFLSLTDLLLNNNSFTGNLPREIGNLTSLESLYLFDNMLHGSVPREIGKLQ  426

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
             +L+ I+LY+N FSG+IP E+ NCSSL  +DF+GN F+G IP ++G LK+L  L LR+N++
Sbjct  427   NLKTIYLYDNQFSGQIPEELTNCSSLTEVDFFGNHFSGPIPASVGNLKNLVLLQLRQNEI  486

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
             SGEIP+SLG+C +L  L LADN LSG +P TF +L  L+ + LYNNSLEG LP  L  L 
Sbjct  487   SGEIPSSLGHCSRLQQLALADNKLSGLLPLTFKFLLELSTITLYNNSLEGPLPSSLFLLK  546

Query  1861  NLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFT  2040
             NL  IN SHN  SGS+ P+  S S  + D+TNN+F+  IP  +  S +L RLRL  N  T
Sbjct  547   NLKIINFSHNRLSGSVYPLTGSTSLTALDLTNNSFEGSIPPRISMSRNLTRLRLALNHLT  606

Query  2041  GKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpl  2220
             G+IP     + +L  LDLS NKL+G    QL  C KL H+ LN N  +G +PVWLG L  
Sbjct  607   GEIPYDFSQLVQLKFLDLSSNKLTGEFSLQLKNCTKLEHILLNGNRFTGKLPVWLGSLQQ  666

Query  2221  lgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLC  2400
             LGEL LS N+F G +P E+ NCS LL L+L +N L+G +PPEIGNL+SLNVLNL  N L 
Sbjct  667   LGELDLSFNRFHGIIPQEVGNCSALLKLNLHSNILSGEIPPEIGNLQSLNVLNLQRNNLS  726

Query  2401  GSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLS  2580
             GSIP+TI    KLYELRLS N  +G IP E+G L +LQ +LD S N+L+ +IP S+G L 
Sbjct  727   GSIPATIQRCKKLYELRLSENALTGSIPIELGDLTELQVILDLSKNHLSDKIPSSLGNLL  786

Query  2581  KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCG  2760
             KLE L+LS N L GE+P  +++++SL  LN+S N L+G+L   ++ +PV SF+GNS LCG
Sbjct  787   KLERLNLSCNLLQGEVPSSLSKLTSLHMLNVSSNRLKGKLPSLFSTFPVSSFLGNSKLCG  846

Query  2761  SPLGSCR-----DKGSRNKGSMVVVISALSATVAIILLLMGAAFF  2880
              PL  CR     +K    +  + +VI A+  T ++I L M  A  
Sbjct  847   PPLAKCRGLSGKEKQRLTETEVALVIVAIVFTSSVICLAMLYAML  891


 Score =   243 bits (619),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 187/557 (34%), Positives = 281/557 (50%), Gaps = 51/557 (9%)
 Frame = +1

Query  1198  CSN-ATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLV  1374
             CS+   ++  L LS + LSG I  E      L+ LDLS+N+L G IP EL  L  L  L 
Sbjct  60    CSDDGVSVAALNLSGSCLSGSISREFQHLVSLRLLDLSSNSLTGFIPSELGRLQNLQSLF  119

Query  1375  LNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPV  1554
             L +N+L G +   +  L NLQ L L  N L GE+P+ IG L +L+++ L     +G IP 
Sbjct  120   LFSNSLSGGVPAEIGLLKNLQVLRLGDNMLRGEIPQHIGDLSELRVLGLGYCELNGSIPG  179

Query  1555  EIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLD  1734
             EIG   +L+ +D   N  +G+IP  +   + L  + L  N L G I  S G+   L+ L+
Sbjct  180   EIGRLKNLEILDLQSNDLSGRIPDEIQSCEVLRVIVLSNNGLEGSISTSFGSIESLEILN  239

Query  1735  LADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP  1914
             LA+N  SG++P     L  L  L L  N L G++P ++  L  L  ++LS N  SG+I  
Sbjct  240   LANNSFSGSVPWQLSNLTGLKYLNLAGNRLTGEIPVEINGLVGLDTLDLSDNELSGTIRI  299

Query  1915  ICTSHSFL-SFDVTNNAFDQEIPS-FLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLL  2088
             + +  + L S  ++ NA   +IPS F   + +L++     N   G+ P+ +     L  L
Sbjct  300   LSSRLTNLRSLILSRNALTGDIPSXFCAKNSNLEQFFASENHLWGEFPLEILNCTSLLQL  359

Query  2089  DLSGNKLSGFIPPQLSLCRKLTHLDLNN------------------------NLLSGPIP  2196
             DLS N   G IPP +     LT L LNN                        N+L G +P
Sbjct  360   DLSDNNFRGGIPPSIDRFLSLTDLLLNNNSFTGNLPREIGNLTSLESLYLFDNMLHGSVP  419

Query  2197  VWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVL  2376
               +G+L  L  + L  NQFSG +P EL NCS L  +    N  +G +P  +GNLK+L +L
Sbjct  420   REIGKLQNLKTIYLYDNQFSGQIPEELTNCSSLTEVDFFGNHFSGPIPASVGNLKNLVLL  479

Query  2377  NLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQS-------------  2517
              L  N++ G IPS++G   +L +L L+ N+ SG +P     L +L +             
Sbjct  480   QLRQNEISGEIPSSLGHCSRLQQLALADNKLSGLLPLTFKFLLELSTITLYNNSLEGPLP  539

Query  2518  ----------VLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRL  2667
                       +++FS+N L+G + P  G+ S L +LDL++N   G IPP+++   +L RL
Sbjct  540   SSLFLLKNLKIINFSHNRLSGSVYPLTGSTS-LTALDLTNNSFEGSIPPRISMSRNLTRL  598

Query  2668  NLSCNELEGELDKRYAH  2718
              L+ N L GE+   ++ 
Sbjct  599   RLALNHLTGEIPYDFSQ  615



>emb|CDP16927.1| unnamed protein product [Coffea canephora]
Length=952

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/916 (48%), Positives = 582/916 (64%), Gaps = 10/916 (1%)
 Frame = +1

Query  289   QNTSSTLRVLLEVKRSF---VLQLQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdsslg  456
             ++T S    LL +K      +  L+ W+    N+C+W GV+C +  + +VSLNLS S L 
Sbjct  25    EDTLSDSDTLLRIKSELEDPIGVLENWT-PGTNFCNWNGVACSNDQVNIVSLNLSGSGLI  83

Query  457   gsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTN  636
             GS+SP L  L+ L  LDLS N L+G +PP L  L  L  LLLF+N L G IP+++GLL  
Sbjct  84    GSVSPQLSQLSSLQILDLSMNSLTGMVPPDLGKLQELRQLLLFANSLSGIIPAEIGLLKK  143

Query  637   LQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllE  816
             LQ +RIGDN LTGQ+    GNL  L  LGLA C  +G IP ++G L  L+ L+LQ+N L+
Sbjct  144   LQVMRIGDNLLTGQVIPEIGNLTELRVLGLAYCQFNGSIPKEIGNLKHLKALDLQENDLD  203

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             GP+PPEI++ + L  F+A+ N L G IP  +G L+ L ILNLANN+L+G IP + G  S 
Sbjct  204   GPIPPEISSCTDLQDFAASNNRLEGKIPASIGSLESLEILNLANNSLSGGIPTKFG--SK  261

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             L YLNL GN+L G IP  L +L+ L+ LDLS N+L+G +      +  LQ LAL+ N L+
Sbjct  262   LQYLNLQGNELDGQIPVELNQLSQLEVLDLSENKLSGLINLSNSQLKNLQALALSDNFLT  321

Query  1177  GTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
             G+IP SLC   +  Q L L+   LSG  P ++  C  LQQLDLS N   GS+P  L  L 
Sbjct  322   GSIPGSLCIPDSKFQQLFLARNNLSGSFPMQILNCSSLQQLDLSGNNFQGSLPSSLERLE  381

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
             +LTDL+LNNN+  GT+SP + N++NL +  LF N + G +P EIG L  L II+LY+N  
Sbjct  382   KLTDLLLNNNSFSGTLSPEIGNMSNLVSFYLFDNMITGAIPLEIGKLQSLSIIYLYDNQM  441

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
             SG IP+E+ NCS+L  IDF GN+F+G IP T+GRLK+L FL LR+NDLSG IP SLG C 
Sbjct  442   SGSIPMELTNCSNLIEIDFSGNRFSGSIPATIGRLKNLSFLLLRQNDLSGSIPPSLGYCQ  501

Query  1717  QLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNF  1896
             +L  L LADN LSG +P TF +L  L  L LYNNS EG LP+ L  L NL  +NLSHN F
Sbjct  502   KLQKLTLADNKLSGTLPPTFRFLSQLIMLSLYNNSFEGPLPESLSLLKNLGIVNLSHNRF  561

Query  1897  SGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRE  2076
             SG+++ +  S+S    D+TNN+F   IPS L  S +L RLRL +N   G IP  LG ++E
Sbjct  562   SGTLSLLSGSNSLTLLDLTNNSFSGLIPSTLAMSKNLTRLRLANNILIGSIPPHLGQLKE  621

Query  2077  LSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFS  2256
             L  LDLS N LSG +  +LS  +KL HL LNNN  SG +P WLG +  LGEL LS N+F+
Sbjct  622   LYFLDLSFNNLSGELALELSGLKKLKHLLLNNNSFSGTVPTWLGSMEDLGELDLSFNKFN  681

Query  2257  GSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGK  2436
             G++P EL NCS LL LSL +N+L+GT+P +IGNL SLNVLNL  N L G IP TI    K
Sbjct  682   GTVPVELGNCSSLLKLSLGSNTLSGTIPSDIGNLTSLNVLNLQSNNLSGPIPPTIQQCKK  741

Query  2437  LYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDL  2616
             LYELRLS N  +G IP E+G L +LQ +LD S N+L+GE+PPS+G L KLE L+LS N L
Sbjct  742   LYELRLSENNLTGSIPSEIGTLTELQVILDLSKNSLSGEVPPSLGNLVKLERLNLSFNQL  801

Query  2617  TGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKGSR  2796
              G++P  + ++SSL RLNLS N L+GEL   ++ +P+ SF+GN  LCG PL SC +    
Sbjct  802   EGKVPSSLGKLSSLHRLNLSNNNLQGELPSTFSGFPLSSFLGN-KLCGPPLVSCLESARH  860

Query  2797  NKGSM--VVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRK  2970
              K  +    VI  + A V    L+  A  +      +  R        +S     + + +
Sbjct  861   GKKELSNTAVIGIIVAIVFTSTLICLALLYIMLRIWSNWREVSISCSETSGLEYKRGEEE  920

Query  2971  PLFGNAAKKRDIRWDD  3018
              ++G   K  +  W++
Sbjct  921   WVYGEDIKSTEDYWEE  936



>ref|XP_007138043.1| hypothetical protein PHAVU_009G176400g [Phaseolus vulgaris]
 gb|ESW10037.1| hypothetical protein PHAVU_009G176400g [Phaseolus vulgaris]
Length=955

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/756 (50%), Positives = 489/756 (65%), Gaps = 5/756 (1%)
 Frame = +1

Query  607   IPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlq  786
             IP ++G L+ LQ LR+G+N L G+IP S GNL  L  LG+A+C L+G IP ++G L  L 
Sbjct  131   IPEEIGNLSKLQVLRLGNNMLAGEIPPSIGNLSELAVLGVANCNLNGSIPIEVGNLKHLV  190

Query  787   nlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGE  966
             +L+LQ N L G +P EI     L  F+A+ N L G IP  +G LK L ILNLANNTL+G 
Sbjct  191   SLDLQVNSLSGLIPEEIQGCKELQNFAASNNMLEGEIPSSMGSLKSLRILNLANNTLSGS  250

Query  967   IPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQ  1146
             IP  L  +S+L YLNLLGN+L G IP  L  L+ LQ LDLS N L+G L      +  L+
Sbjct  251   IPTSLSLLSNLTYLNLLGNKLNGEIPPELNSLSQLQKLDLSRNNLSGSLTLLNVKLQNLE  310

Query  1147  FLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNG  1326
              + L+ N L+G IP + C   + LQ L L+   L G  P  L  C  +QQ+DLS+N+  G
Sbjct  311   TMVLSDNALTG-IPYNFCLRGSKLQQLFLARNKLYGRFPLGLLNCSSIQQVDLSDNSFEG  369

Query  1327  SIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDL  1506
              +P  L +L  LTDL+LNNN+  G++ P + N+++L++L LF N+  G++P EIG L  L
Sbjct  370   ELPSSLDKLQNLTDLMLNNNSFIGSLPPEIGNISSLRSLFLFGNSFTGKIPAEIGRLKRL  429

Query  1507  QIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSG  1686
               I+LY+N  SG IP E+ NC+SL  IDF+GN F G IP T+G+LK L  LHLR+NDLSG
Sbjct  430   NTIYLYDNQMSGPIPRELTNCTSLTGIDFFGNHFYGSIPETIGKLKGLTVLHLRQNDLSG  489

Query  1687  EIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNL  1866
              IP S+G C +L  L LADN LSG+IP TF YL  L  + LYNNS EG LP  L  L NL
Sbjct  490   PIPPSMGYCKRLQLLALADNKLSGSIPPTFSYLSQLRTITLYNNSFEGPLPHSLSLLRNL  549

Query  1867  TRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
               IN S+N FSGSI P+  S+S    D+TNN+F   IPS L NS  L RLRL +N  TG 
Sbjct  550   KIINFSNNKFSGSIVPLTGSNSLTVLDLTNNSFSGSIPSILANSGDLTRLRLANNYLTGT  609

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             IP  LG + EL+ LDLS N L+G +PPQLS C+K+ HL LNNN L G +  WLG L  LG
Sbjct  610   IPSELGHLTELNFLDLSFNNLTGHVPPQLSNCKKIEHLLLNNNRLGGEMLPWLGSLQELG  669

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             EL LS N F G +P EL  CSKLL LSL +N+L+G +P EIGNL  LNV NL  N L G 
Sbjct  670   ELDLSFNNFHGRVPAELGGCSKLLKLSLHHNNLSGEIPLEIGNLTLLNVFNLQRNSLSGH  729

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IPSTI    KLYELRLS N  SG IP  +G + +LQ +LD S N  +GEIP S+G L KL
Sbjct  730   IPSTIQQCSKLYELRLSENFLSGIIPVGLGAVTELQVILDLSRNLFSGEIPSSLGNLMKL  789

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSP  2766
             E LDLS N L G++PP + +++SL  LNLS N L G +   ++ +P+ SF+ N HLCG P
Sbjct  790   ERLDLSFNHLQGQLPPSLGQLTSLHVLNLSNNHLHGLIPSTFSGFPLSSFLNNDHLCGPP  849

Query  2767  LGSC----RDKGSRNKGSMVVVISALSATVAIILLL  2862
             L  C    R K S ++ + ++V   L++T+  ++LL
Sbjct  850   LALCSETSRMKLSNSQVAAIIVAIVLTSTLICLVLL  885


 Score =   316 bits (809),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 232/604 (38%), Positives = 328/604 (54%), Gaps = 12/604 (2%)
 Frame = +1

Query  904   ELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLD  1083
             EL  L  L  L+L++N LTG IP +LG++ +L  L L  N L  +IP+ +  L+ LQ L 
Sbjct  86    ELSHLISLQALDLSSNNLTGSIPSELGQLQNLRILLLYSNYLSHNIPEEIGNLSKLQVLR  145

Query  1084  LSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIP  1263
             L  N LAGE+P   G++ +L  L + + NL+G+IP  +  N  +L  L L    LSG IP
Sbjct  146   LGNNMLAGEIPPSIGNLSELAVLGVANCNLNGSIPIEV-GNLKHLVSLDLQVNSLSGLIP  204

Query  1264  PELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTL  1443
              E+  C+ LQ    SNN L G IP  +  L  L  L L NNTL G+I  S++ L+NL  L
Sbjct  205   EEIQGCKELQNFAASNNMLEGEIPSSMGSLKSLRILNLANNTLSGSIPTSLSLLSNLTYL  264

Query  1444  SLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIP  1623
             +L  N L+GE+P E+  L  LQ + L  N+ SG + +      +L+ +    N  TG IP
Sbjct  265   NLLGNKLNGEIPPELNSLSQLQKLDLSRNNLSGSLTLLNVKLQNLETMVLSDNALTG-IP  323

Query  1624  ITL----GRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRA  1791
                     +L+ LF   L  N L G  P  L NC  +  +DL+DN   G +P++   L+ 
Sbjct  324   YNFCLRGSKLQQLF---LARNKLYGRFPLGLLNCSSIQQVDLSDNSFEGELPSSLDKLQN  380

Query  1792  LTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSI-APICTSHSFLSFDVTNNAFD  1968
             LT LML NNS  G LP ++ N+ +L  + L  N+F+G I A I       +  + +N   
Sbjct  381   LTDLMLNNNSFIGSLPPEIGNISSLRSLFLFGNSFTGKIPAEIGRLKRLNTIYLYDNQMS  440

Query  1969  QEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRK  2148
               IP  L N  SL  +    N F G IP T+G ++ L++L L  N LSG IPP +  C++
Sbjct  441   GPIPRELTNCTSLTGIDFFGNHFYGSIPETIGKLKGLTVLHLRQNDLSGPIPPSMGYCKR  500

Query  2149  LTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsln  2328
             L  L L +N LSG IP     L  L  + L +N F G LP  L     L +++  NN  +
Sbjct  501   LQLLALADNKLSGSIPPTFSYLSQLRTITLYNNSFEGPLPHSLSLLRNLKIINFSNNKFS  560

Query  2329  GTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKD  2508
             G++ P  G+  SL VL+L +N   GSIPS +   G L  LRL+ N  +G IP E+G L +
Sbjct  561   GSIVPLTGS-NSLTVLDLTNNSFSGSIPSILANSGDLTRLRLANNYLTGTIPSELGHLTE  619

Query  2509  LQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNEL  2688
             L + LD S+NNLTG +PP +    K+E L L++N L GE+ P +  +  LG L+LS N  
Sbjct  620   L-NFLDLSFNNLTGHVPPQLSNCKKIEHLLLNNNRLGGEMLPWLGSLQELGELDLSFNNF  678

Query  2689  EGEL  2700
              G +
Sbjct  679   HGRV  682


 Score =   282 bits (722),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 241/614 (39%), Positives = 318/614 (52%), Gaps = 8/614 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IPS +G L +L+ L + +N L+G IPTS   L NL  L L    L+G IPP+L  L+Q
Sbjct  225   GEIPSSMGSLKSLRILNLANNTLSGSIPTSLSLLSNLTYLNLLGNKLNGEIPPELNSLSQ  284

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKE--LGGLKHLHILNLANNT  954
             LQ L+L +N L G L      + +L     + N+L G IP    L G K L  L LA N 
Sbjct  285   LQKLDLSRNNLSGSLTLLNVKLQNLETMVLSDNALTG-IPYNFCLRGSK-LQQLFLARNK  342

Query  955   LTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSM  1134
             L G  P  L   SS+  ++L  N   G +P SL KL NL  L L+ N   G LP E G++
Sbjct  343   LYGRFPLGLLNCSSIQQVDLSDNSFEGELPSSLDKLQNLTDLMLNNNSFIGSLPPEIGNI  402

Query  1135  GQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNN  1314
               L+ L L  N+ +G IP  +      L  + L +  +SG IP EL+ C  L  +D   N
Sbjct  403   SSLRSLFLFGNSFTGKIPAEI-GRLKRLNTIYLYDNQMSGPIPRELTNCTSLTGIDFFGN  461

Query  1315  TLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGM  1494
                GSIPE + +L  LT L L  N L G I PS+     LQ L+L  N L G +P     
Sbjct  462   HFYGSIPETIGKLKGLTVLHLRQNDLSGPIPPSMGYCKRLQLLALADNKLSGSIPPTFSY  521

Query  1495  LGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREN  1674
             L  L+ I LY N F G +P  +    +L+ I+F  N+F+G I + L     L  L L  N
Sbjct  522   LSQLRTITLYNNSFEGPLPHSLSLLRNLKIINFSNNKFSGSI-VPLTGSNSLTVLDLTNN  580

Query  1675  DLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRN  1854
               SG IP+ L N   L  L LA+N+L+G IP+  G+L  L  L L  N+L G +P  L N
Sbjct  581   SFSGSIPSILANSGDLTRLRLANNYLTGTIPSELGHLTELNFLDLSFNNLTGHVPPQLSN  640

Query  1855  LGNLTRINLSHNNFSGSIAPICTSHSFL-SFDVTNNAFDQEIPSFLGNSPSLDRLRLGSN  2031
                +  + L++N   G + P   S   L   D++ N F   +P+ LG    L +L L  N
Sbjct  641   CKKIEHLLLNNNRLGGEMLPWLGSLQELGELDLSFNNFHGRVPAELGGCSKLLKLSLHHN  700

Query  2032  RFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPV-Wlg  2208
               +G+IP+ +G +  L++ +L  N LSG IP  +  C KL  L L+ N LSG IPV    
Sbjct  701   NLSGEIPLEIGNLTLLNVFNLQRNSLSGHIPSTIQQCSKLYELRLSENFLSGIIPVGLGA  760

Query  2209  rlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDD  2388
                L   L LS N FSG +P  L N  KL  L L  N L G LPP +G L SL+VLNL +
Sbjct  761   VTELQVILDLSRNLFSGEIPSSLGNLMKLERLDLSFNHLQGQLPPSLGQLTSLHVLNLSN  820

Query  2389  NQLCGSIPSTIGGL  2430
             N L G IPST  G 
Sbjct  821   NHLHGLIPSTFSGF  834


 Score =   236 bits (602),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 171/450 (38%), Positives = 242/450 (54%), Gaps = 3/450 (1%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
             +G +P ++G +++L++L +  N  TG+IP   G L  L T+ L    +SG IP +L   T
Sbjct  392   IGSLPPEIGNISSLRSLFLFGNSFTGKIPAEIGRLKRLNTIYLYDNQMSGPIPRELTNCT  451

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
              L  ++   N   G +P  I  +  LT      N L+G IP  +G  K L +L LA+N L
Sbjct  452   SLTGIDFFGNHFYGSIPETIGKLKGLTVLHLRQNDLSGPIPPSMGYCKRLQLLALADNKL  511

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             +G IP     +S L  + L  N   G +P SL+ L NL+ ++ S N+ +G +    GS  
Sbjct  512   SGSIPPTFSYLSQLRTITLYNNSFEGPLPHSLSLLRNLKIINFSNNKFSGSIVPLTGS-N  570

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
              L  L LT+N+ SG+IP S+ +N+ +L  L L+   L+G IP EL     L  LDLS N 
Sbjct  571   SLTVLDLTNNSFSGSIP-SILANSGDLTRLRLANNYLTGTIPSELGHLTELNFLDLSFNN  629

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
             L G +P +L    ++  L+LNNN L G + P + +L  L  L L  NN HG VP E+G  
Sbjct  630   LTGHVPPQLSNCKKIEHLLLNNNRLGGEMLPWLGSLQELGELDLSFNNFHGRVPAELGGC  689

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
               L  + L+ N+ SGEIP+EIGN + L   +   N  +G IP T+ +   L+ L L EN 
Sbjct  690   SKLLKLSLHHNNLSGEIPLEIGNLTLLNVFNLQRNSLSGHIPSTIQQCSKLYELRLSENF  749

Query  1678  LSGEIPASLGNCHQLDT-LDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRN  1854
             LSG IP  LG   +L   LDL+ N  SG IP++ G L  L RL L  N L+G LP  L  
Sbjct  750   LSGIIPVGLGAVTELQVILDLSRNLFSGEIPSSLGNLMKLERLDLSFNHLQGQLPPSLGQ  809

Query  1855  LGNLTRINLSHNNFSGSIAPICTSHSFLSF  1944
             L +L  +NLS+N+  G I    +     SF
Sbjct  810   LTSLHVLNLSNNHLHGLIPSTFSGFPLSSF  839



>ref|XP_008438602.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Cucumis melo]
Length=944

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/760 (50%), Positives = 491/760 (65%), Gaps = 5/760 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G +P+++GLL NLQALRIG+N L+G+I    GNL NL  LGL  C  +G IP ++G L  
Sbjct  132   GKLPTEIGLLKNLQALRIGNNLLSGEITPFIGNLTNLTVLGLGYCEFNGSIPVEIGNLKH  191

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L +LNLQQN L G +P  I     L     + N L+G++P  LG +K L +LNLANN+L+
Sbjct  192   LISLNLQQNRLSGSIPDTIRGNEELEDLLVSNNMLDGNVPDSLGSIKSLRVLNLANNSLS  251

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP  L  +S+LVYLNLLGN+  G IP  + +L  L+ +DLS N L+G +      +  
Sbjct  252   GSIPVALSGLSNLVYLNLLGNRFSGEIPSEINQLVLLEEVDLSRNNLSGTISLLNTQLQN  311

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L  L L+ N L+G IP S C   +NLQ L L+   LSG+ P EL  C  LQQLDLS N L
Sbjct  312   LVTLVLSDNALTGNIPNSFCFKTSNLQQLFLARNKLSGKFPQELLNCSSLQQLDLSGNRL  371

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
              G +P  L +L  LT L+LNNN+  G I P + N++NL+ L LF N L G +P+EIG L 
Sbjct  372   EGDLPSGLDDLKCLTVLLLNNNSFTGFIPPQIGNMSNLEDLYLFDNKLTGTIPKEIGKLK  431

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
              L  IFLY+N  +G IP E+ NC++L  IDF+GN F G IP  +G LK+L  LHLR+N L
Sbjct  432   KLSFIFLYDNQMTGSIPNELTNCTNLMEIDFFGNHFIGPIPENIGNLKNLAVLHLRQNFL  491

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
              G IPASLG C  L  L LADN+LSG++P+T G L  L+ + LYNNSLEG  P     L 
Sbjct  492   WGPIPASLGYCKSLQLLALADNNLSGSLPSTLGLLSELSTITLYNNSLEGPFPVSFSILK  551

Query  1861  NLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFT  2040
              L  IN S+N F+G+I P+C  +S  + D+TNN+F   IPS L NS +L RLRL  NR T
Sbjct  552   RLKIINFSNNKFNGTILPLCGLNSLTALDLTNNSFSGPIPSRLINSRNLRRLRLAHNRLT  611

Query  2041  GKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpl  2220
             G IP   G ++EL+ LDLS N L+G + PQL  C KL H  LN+N L+G I   +G L  
Sbjct  612   GYIPSEFGQLKELNFLDLSHNNLTGEMSPQLFNCTKLEHFLLNDNRLTGTITPLIGNLQA  671

Query  2221  lgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLC  2400
             +GEL  SSN   G +P E+ +CSKLL LSL NN+L+G +P EIGN   LNVLNL  N L 
Sbjct  672   VGELDFSSNSLYGRIPAEIGSCSKLLKLSLHNNNLSGMIPLEIGNFTFLNVLNLQRNNLS  731

Query  2401  GSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLS  2580
             GSIPSTI    KLYEL+LS N  +GEIP+E+G+L DLQ  LD S N ++GEIP SIG L 
Sbjct  732   GSIPSTIEKCSKLYELKLSENFLTGEIPQELGKLSDLQVALDLSRNLISGEIPSSIGNLM  791

Query  2581  KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCG  2760
             KLE LDLS N LTGEIP  + +++S+  LNLS N+L+G + + ++ +P+ SF GN  LCG
Sbjct  792   KLERLDLSSNHLTGEIPTSLEQLTSIHILNLSDNQLQGSIPRFFSEFPLTSFKGNDELCG  851

Query  2761  SPLGSCRDKGSR-----NKGSMVVVISALSATVAIILLLM  2865
              PL SC    S+     +KG+++ +I A+  T  +I L+M
Sbjct  852   RPLSSCSKSASQETSRLSKGAVIGIIVAIVFTSMVICLIM  891


 Score =   251 bits (640),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 190/509 (37%), Positives = 273/509 (54%), Gaps = 28/509 (6%)
 Frame = +1

Query  1198  CSN-ATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLV  1374
             CSN  + +  L LS++ LSG +  EL     L+ LDLS+N+L+GSIP EL +L  L  L+
Sbjct  65    CSNDESQIVSLNLSQSRLSGSMWSELWHVTSLEVLDLSSNSLSGSIPSELGQLYNLRVLI  124

Query  1375  LNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPV  1554
             L++N L G +   +  L NLQ L + +N L GE+   IG L +L ++ L    F+G IPV
Sbjct  125   LHSNFLSGKLPTEIGLLKNLQALRIGNNLLSGEITPFIGNLTNLTVLGLGYCEFNGSIPV  184

Query  1555  EIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLD  1734
             EIGN   L  ++   N+ +G IP T+   + L  L +  N L G +P SLG+   L  L+
Sbjct  185   EIGNLKHLISLNLQQNRLSGSIPDTIRGNEELEDLLVSNNMLDGNVPDSLGSIKSLRVLN  244

Query  1735  LADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP  1914
             LA+N LSG+IP     L  L  L L  N   G++P ++  L  L  ++LS NN SG+I+ 
Sbjct  245   LANNSLSGSIPVALSGLSNLVYLNLLGNRFSGEIPSEINQLVLLEEVDLSRNNLSGTISL  304

Query  1915  ICTS-HSFLSFDVTNNAFDQEIP-SFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLL  2088
             + T   + ++  +++NA    IP SF   + +L +L L  N+ +GK P  L     L  L
Sbjct  305   LNTQLQNLVTLVLSDNALTGNIPNSFCFKTSNLQQLFLARNKLSGKFPQELLNCSSLQQL  364

Query  2089  DLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLP  2268
             DLSGN+L G +P  L   + LT L LNN                        N F+G +P
Sbjct  365   DLSGNRLEGDLPSGLDDLKCLTVLLLNN------------------------NSFTGFIP  400

Query  2269  PELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYEL  2448
             P++ N S L  L L +N L GT+P EIG LK L+ + L DNQ+ GSIP+ +     L E+
Sbjct  401   PQIGNMSNLEDLYLFDNKLTGTIPKEIGKLKKLSFIFLYDNQMTGSIPNELTNCTNLMEI  460

Query  2449  RLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEI  2628
                 N F G IP  +G LK+L +VL    N L G IP S+G    L+ L L+ N+L+G +
Sbjct  461   DFFGNHFIGPIPENIGNLKNL-AVLHLRQNFLWGPIPASLGYCKSLQLLALADNNLSGSL  519

Query  2629  PPQVAEMSSLGRLNLSCNELEGELDKRYA  2715
             P  +  +S L  + L  N LEG     ++
Sbjct  520   PSTLGLLSELSTITLYNNSLEGPFPVSFS  548



>ref|XP_004976158.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170-like isoform X1 [Setaria italica]
 ref|XP_004976159.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170-like isoform X2 [Setaria italica]
Length=1097

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/922 (41%), Positives = 529/922 (57%), Gaps = 30/922 (3%)
 Frame = +1

Query  856   TAFSAALNSLN--GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQL  1029
                S  LN++N  G+I   +GGL  L  L+L+ N   G IP Q+G +S L  LNL  N  
Sbjct  69    AVVSLDLNNMNLSGTIAPSIGGLAELTHLDLSFNGFGGPIPAQIGNLSKLEVLNLFNNNF  128

Query  1030  GGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNA  1209
              G IP  + KL  L +L+L  N+L G +P E G+M  L+ L   SNNL+G++P SL    
Sbjct  129   VGIIPPEVGKLAKLVTLNLCNNKLYGPIPDEIGNMASLEELVGYSNNLTGSLPHSL-GKL  187

Query  1210  TNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNT  1389
              NL+ + L +  +SG IP E+ +C  +    L+ N L G +P+E+  L+ +TDL+L  N 
Sbjct  188   KNLKNIRLGQNLISGNIPVEIGECLNITVFGLAQNKLEGPLPKEIGRLSLMTDLILWGNQ  247

Query  1390  LEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNC  1569
             L G I P + N T+L T++L+ NNL G +P  IG + +LQ ++LY N  +G IP EIGN 
Sbjct  248   LSGVIPPEIGNCTSLGTVALYDNNLFGPIPATIGNITNLQKLYLYRNSLNGTIPSEIGNL  307

Query  1570  SSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNH  1749
             S  + IDF  N  TG IP  LG +  L  L+L +N L+G IP  L     L  LDL+ N 
Sbjct  308   SLAREIDFSENFLTGGIPKELGNIPELNLLYLFQNQLTGSIPTELCGLRNLSKLDLSINS  367

Query  1750  LSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP-ICTS  1926
             L+G IP+ F Y+R L +L L+NN L G++P        L  ++ S+N+ +G I   +C  
Sbjct  368   LTGTIPSGFQYMRTLIQLQLFNNKLSGNIPPRFGIYSRLWVVDFSNNSITGQIPKDLCRQ  427

Query  1927  HSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNK  2106
              + +  ++ +N     IP  + N   L +LRLG N  TG  P  L  +  L+ ++L  NK
Sbjct  428   SNLILLNLGSNKLTGNIPRGITNCRPLVQLRLGDNSLTGSFPTDLCNLVNLTTVELGRNK  487

Query  2107  LSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNC  2286
              SG IPPQ+  C+ L  LDL NN  +  +P  +G L  L    +SSN+  G++P E+FNC
Sbjct  488   FSGPIPPQIGDCKSLQRLDLTNNYFTSELPREIGNLSKLVVFNISSNRLGGNIPLEIFNC  547

Query  2287  skllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNR  2466
             + L  L L  N+  G+LP E+G L  L +L+  DN+L G IP  +G L  L  L++  N 
Sbjct  548   TVLQRLDLSQNNFEGSLPNEVGRLPQLELLSFSDNRLAGQIPPILGKLSHLTALQIGGNL  607

Query  2467  FSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAE  2646
              SGEIP+E+G L  LQ  ++ SYNNL+G IP  +G L+ LESL L++N LTGEIP   A 
Sbjct  608   LSGEIPKELGLLSSLQIAMNLSYNNLSGNIPSELGNLALLESLFLNNNKLTGEIPTTFAN  667

Query  2647  MSSLGRLNLSCNELEGELDK--RYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKGSMVVV  2820
             +SSL  LN+S N L G L     + +     F+GN  LCG  LG C  + S +  S   V
Sbjct  668   LSSLLELNVSYNYLSGALPSIPLFDNMAATCFIGNKGLCGGQLGRCGSQSSSSSQSSNSV  727

Query  2821  ISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFG-----N  2985
                L   +AI+  ++G           Y  R+  E  A         Q K LF      +
Sbjct  728   GPPLGKIIAIVAAVIGGISLILIAIIVYHMRKPMETVA-------PLQDKQLFSGGSNMH  780

Query  2986  AAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIP-RKDDLFLDK  3162
              + K    + +++ ATNN  +  +IG G C TVY+A L  G+T+A+K++   ++    D 
Sbjct  781   VSVKEAYTFQELVAATNNFDESCVIGRGACGTVYRAILKTGQTIAVKKLASNREGSNTDN  840

Query  3163  SFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKKS  3342
             SF  EI TL +IRHR++V+L G+  +  +GSN+L+YEYM  GS+ + LH Q     S  S
Sbjct  841   SFRAEILTLGKIRHRNIVKLYGFIYH--QGSNLLLYEYMSRGSLGELLHGQ-----SSSS  893

Query  3343  LDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDN  3522
             LDWE R  IA+G A+G+ YLHHDC P+IIHRDIKS+N+LLD N EAH+GDFGLAK +   
Sbjct  894   LDWETRFMIALGAAEGLTYLHHDCKPRIIHRDIKSNNILLDENFEAHVGDFGLAKVIDMP  953

Query  3523  YDSLNTESNTWFAGSYGYIAPE  3588
             Y    ++S +  AGSYGYIAPE
Sbjct  954   Y----SKSMSAIAGSYGYIAPE  971


 Score =   312 bits (800),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 249/728 (34%), Positives = 354/728 (49%), Gaps = 74/728 (10%)
 Frame = +1

Query  313   VLLEVKRSFV---LQLQGWSEKNPNYCSWQGVSCDGslkvvslnlsdsslggsispslgl  483
             +LL +K   V     L  W  ++P  C+W+GV+C                          
Sbjct  29    LLLALKSQMVDTLHHLDSWDARHPTPCAWRGVNCS-------------------------  63

Query  484   lthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDN  663
                           S P+P  +S   +  +L        G I   +G L  L  L +  N
Sbjct  64    --------------SAPVPAVVSLDLNNMNLS-------GTIAPSIGGLAELTHLDLSFN  102

Query  664   GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIAN  843
             G  G IP   GNL  L  L L +    G+IPP++G+L +L  LNL  N L GP+P EI N
Sbjct  103   GFGGPIPAQIGNLSKLEVLNLFNNNFVGIIPPEVGKLAKLVTLNLCNNKLYGPIPDEIGN  162

Query  844   ISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGN  1023
             ++SL       N+L GS+P  LG LK+L  + L  N ++G IP ++GE  ++    L  N
Sbjct  163   MASLEELVGYSNNLTGSLPHSLGKLKNLKNIRLGQNLISGNIPVEIGECLNITVFGLAQN  222

Query  1024  QLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCS  1203
             +L G +PK + +L+ +  L L GN+L+G +P E G+   L  +AL  NNL G IP ++  
Sbjct  223   KLEGPLPKEIGRLSLMTDLILWGNQLSGVIPPEIGNCTSLGTVALYDNNLFGPIPATI-G  281

Query  1204  NATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNN  1383
             N TNLQ L L    L+G IP E+    + +++D S N L G IP+EL  + +L  L L  
Sbjct  282   NITNLQKLYLYRNSLNGTIPSEIGNLSLAREIDFSENFLTGGIPKELGNIPELNLLYLFQ  341

Query  1384  NTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIG  1563
             N L G+I   +  L NL  L L  N+L G +P     +  L  + L+ N  SG IP   G
Sbjct  342   NQLTGSIPTELCGLRNLSKLDLSINSLTGTIPSGFQYMRTLIQLQLFNNKLSGNIPPRFG  401

Query  1564  NCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLAD  1743
               S L  +DF  N  TG+IP  L R  +L  L+L  N L+G IP  + NC  L  L L D
Sbjct  402   IYSRLWVVDFSNNSITGQIPKDLCRQSNLILLNLGSNKLTGNIPRGITNCRPLVQLRLGD  461

Query  1744  NHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIA-PIC  1920
             N L+G+ P     L  LT + L  N   G +P  + +  +L R++L++N F+  +   I 
Sbjct  462   NSLTGSFPTDLCNLVNLTTVELGRNKFSGPIPPQIGDCKSLQRLDLTNNYFTSELPREIG  521

Query  1921  TSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSG  2100
                  + F++++N     IP  + N   L RL L  N F G +P  +G + +L LL  S 
Sbjct  522   NLSKLVVFNISSNRLGGNIPLEIFNCTVLQRLDLSQNNFEGSLPNEVGRLPQLELLSFSD  581

Query  2101  NKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELF  2280
             N+L+G IPP L     LT L +  NLLSG IP             LSS Q + +L     
Sbjct  582   NRLAGQIPPILGKLSHLTALQIGGNLLSGEIP--------KELGLLSSLQIAMNL-----  628

Query  2281  NCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSR  2460
                         N+L+G +P E+GNL  L  L L++N+L G IP+T   L  L EL +S 
Sbjct  629   ----------SYNNLSGNIPSELGNLALLESLFLNNNKLTGEIPTTFANLSSLLELNVSY  678

Query  2461  NRFSGEIP  2484
             N  SG +P
Sbjct  679   NYLSGALP  686


 Score =   261 bits (667),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 199/536 (37%), Positives = 271/536 (51%), Gaps = 51/536 (10%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             GPIP  + N++SLE L+ +SN L G +P  LG L NL+ +R+G N ++G IP   G   N
Sbjct  154   GPIPDEIGNMASLEELVGYSNNLTGSLPHSLGKLKNLKNIRLGQNLISGNIPVEIGECLN  213

Query  709   LVTLGLASC------------------------YLSGLIPPqlgrltqlqnlnlqqnllE  816
             +   GLA                           LSG+IPP++G  T L  + L  N L 
Sbjct  214   ITVFGLAQNKLEGPLPKEIGRLSLMTDLILWGNQLSGVIPPEIGNCTSLGTVALYDNNLF  273

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             GP+P  I NI++L       NSLNG+IP E+G L     ++ + N LTG IP +LG +  
Sbjct  274   GPIPATIGNITNLQKLYLYRNSLNGTIPSEIGNLSLAREIDFSENFLTGGIPKELGNIPE  333

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLS------------------------GNRLA  1104
             L  L L  NQL GSIP  L  L NL  LDLS                         N+L+
Sbjct  334   LNLLYLFQNQLTGSIPTELCGLRNLSKLDLSINSLTGTIPSGFQYMRTLIQLQLFNNKLS  393

Query  1105  GELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCR  1284
             G +P  FG   +L  +  ++N+++G IPK LC   +NL LL L    L+G IP  ++ CR
Sbjct  394   GNIPPRFGIYSRLWVVDFSNNSITGQIPKDLCRQ-SNLILLNLGSNKLTGNIPRGITNCR  452

Query  1285  VLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNL  1464
              L QL L +N+L GS P +L  L  LT + L  N   G I P + +  +LQ L L +N  
Sbjct  453   PLVQLRLGDNSLTGSFPTDLCNLVNLTTVELGRNKFSGPIPPQIGDCKSLQRLDLTNNYF  512

Query  1465  HGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLK  1644
               E+PREIG L  L +  +  N   G IP+EI NC+ LQ +D   N F G +P  +GRL 
Sbjct  513   TSELPREIGNLSKLVVFNISSNRLGGNIPLEIFNCTVLQRLDLSQNNFEGSLPNEVGRLP  572

Query  1645  HLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLM-LYNNS  1821
              L  L   +N L+G+IP  LG    L  L +  N LSG IP   G L +L   M L  N+
Sbjct  573   QLELLSFSDNRLAGQIPPILGKLSHLTALQIGGNLLSGEIPKELGLLSSLQIAMNLSYNN  632

Query  1822  LEGDLPDDLRNLGNLTRINLSHNNFSGSI-APICTSHSFLSFDVTNNAFDQEIPSF  1986
             L G++P +L NL  L  + L++N  +G I        S L  +V+ N     +PS 
Sbjct  633   LSGNIPSELGNLALLESLFLNNNKLTGEIPTTFANLSSLLELNVSYNYLSGALPSI  688


 Score =   205 bits (522),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 172/514 (33%), Positives = 237/514 (46%), Gaps = 74/514 (14%)
 Frame = +1

Query  1402  ISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQ  1581
             ++ S A +  + +L L + NL G +   IG L +L  + L  N F G IP +IGN S L+
Sbjct  60    VNCSSAPVPAVVSLDLNNMNLSGTIAPSIGGLAELTHLDLSFNGFGGPIPAQIGNLSKLE  119

Query  1582  FIDFYGNQF------------------------------------------------TGK  1617
              ++ + N F                                                TG 
Sbjct  120   VLNLFNNNFVGIIPPEVGKLAKLVTLNLCNNKLYGPIPDEIGNMASLEELVGYSNNLTGS  179

Query  1618  IPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALT  1797
             +P +LG+LK+L  + L +N +SG IP  +G C  +    LA N L G +P   G L  +T
Sbjct  180   LPHSLGKLKNLKNIRLGQNLISGNIPVEIGECLNITVFGLAQNKLEGPLPKEIGRLSLMT  239

Query  1798  RLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSI-APICTSHSFLSFDVTNNAFDQE  1974
              L+L+ N L G +P ++ N  +L  + L  NN  G I A I    +     +  N+ +  
Sbjct  240   DLILWGNQLSGVIPPEIGNCTSLGTVALYDNNLFGPIPATIGNITNLQKLYLYRNSLNGT  299

Query  1975  IPS------------------------FLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELS  2082
             IPS                         LGN P L+ L L  N+ TG IP  L  +R LS
Sbjct  300   IPSEIGNLSLAREIDFSENFLTGGIPKELGNIPELNLLYLFQNQLTGSIPTELCGLRNLS  359

Query  2083  LLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGS  2262
              LDLS N L+G IP      R L  L L NN LSG IP   G    L  +  S+N  +G 
Sbjct  360   KLDLSINSLTGTIPSGFQYMRTLIQLQLFNNKLSGNIPPRFGIYSRLWVVDFSNNSITGQ  419

Query  2263  LPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLY  2442
             +P +L   S L++L+L +N L G +P  I N + L  L L DN L GS P+ +  L  L 
Sbjct  420   IPKDLCRQSNLILLNLGSNKLTGNIPRGITNCRPLVQLRLGDNSLTGSFPTDLCNLVNLT  479

Query  2443  ELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTG  2622
              + L RN+FSG IP ++G  K LQ  LD + N  T E+P  IG LSKL   ++S N L G
Sbjct  480   TVELGRNKFSGPIPPQIGDCKSLQR-LDLTNNYFTSELPREIGNLSKLVVFNISSNRLGG  538

Query  2623  EIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWP  2724
              IP ++   + L RL+LS N  EG L       P
Sbjct  539   NIPLEIFNCTVLQRLDLSQNNFEGSLPNEVGRLP  572


 Score =   139 bits (350),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 110/311 (35%), Positives = 152/311 (49%), Gaps = 27/311 (9%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP + G+ + L  +   +N +TGQIP       NL+ L L S  L+G IP  +     
Sbjct  394   GNIPPRFGIYSRLWVVDFSNNSITGQIPKDLCRQSNLILLNLGSNKLTGNIPRGITNCRP  453

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L  L L  N L G  P ++ N+ +LT      N  +G IP ++G  K L  L+L NN  T
Sbjct  454   LVQLRLGDNSLTGSFPTDLCNLVNLTTVELGRNKFSGPIPPQIGDCKSLQRLDLTNNYFT  513

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLS-----------------  1089
              E+P ++G +S LV  N+  N+LGG+IP  +   T LQ LDLS                 
Sbjct  514   SELPREIGNLSKLVVFNISSNRLGGNIPLEIFNCTVLQRLDLSQNNFEGSLPNEVGRLPQ  573

Query  1090  -------GNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLM-LSETG  1245
                     NRLAG++P   G +  L  L +  N LSG IPK L    ++LQ+ M LS   
Sbjct  574   LELLSFSDNRLAGQIPPILGKLSHLTALQIGGNLLSGEIPKEL-GLLSSLQIAMNLSYNN  632

Query  1246  LSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANL  1425
             LSG IP EL    +L+ L L+NN L G IP     L+ L +L ++ N L G + PS+   
Sbjct  633   LSGNIPSELGNLALLESLFLNNNKLTGEIPTTFANLSSLLELNVSYNYLSGAL-PSIPLF  691

Query  1426  TNLQTLSLFHN  1458
              N+       N
Sbjct  692   DNMAATCFIGN  702



>ref|XP_009763846.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Nicotiana sylvestris]
Length=976

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/860 (51%), Positives = 562/860 (65%), Gaps = 12/860 (1%)
 Frame = +1

Query  316   LLEVKRSFVLQ---LQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdsslggsispslgl  483
             LL +K +FV     L+ WSE   + C+W GV+C +    +VSLNLS S L GSISP L  
Sbjct  34    LLRIKSNFVDPYGILENWSEGT-SICTWNGVACANDQSHIVSLNLSSSGLEGSISPELAH  92

Query  484   lthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDN  663
             LT L  +DLS N L+G IP  L  L +LE LLLFSN L G IP ++G L  LQ LRIG N
Sbjct  93    LTSLRVIDLSDNFLNGTIPLELGELHNLEELLLFSNFLTGEIPVEIGNLRKLQVLRIGAN  152

Query  664   GLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIAN  843
              LTGQ+    G+L  L  L LA C  SG IP ++G L  L+NL+LQQN L GP+P  I  
Sbjct  153   MLTGQLIPEIGDLSELRVLALAYCQFSGKIPNEIGNLKHLKNLDLQQNSLTGPIPESIGG  212

Query  844   ISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGN  1023
               +L  F+A+ N + G IP  +  L+ L ILNLANN+++G I  +L  +S+L YLNL GN
Sbjct  213   CKNLQNFAASNNRIRGRIPASISQLESLEILNLANNSISGSISVELRHLSNLKYLNLYGN  272

Query  1024  QLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCS  1203
              L G IP  L +L  L+ LDLS N L+G +      +  LQ LAL+ N L+G+IP + C 
Sbjct  273   DLEGEIPFELNQLVQLEKLDLSNNNLSGTISLLNTQLKNLQTLALSGNLLTGSIPSNFCL  332

Query  1204  NATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNN  1383
             + ++L LL+L+E  LSG  P EL  C  L+QLDLS+N   G +P  +  L  LTDL+LNN
Sbjct  333   HGSSLSLLILAENKLSGSFPLELLNCTSLRQLDLSSNNFGGMLPRGIDRLENLTDLLLNN  392

Query  1384  NTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIG  1563
             N+  GTI P + NLTNL+ L LFHN   G +P EIG L  L  ++LYEN  SG IP+E+ 
Sbjct  393   NSFTGTIPPEIGNLTNLEDLYLFHNMHSGGIPVEIGKLQRLSELYLYENQLSGSIPIELT  452

Query  1564  NCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLAD  1743
             NCSSL  +DF+GNQF+G IP T+GRLK+L  L LR+N+LSG IP SLG C +L  L LAD
Sbjct  453   NCSSLTSVDFFGNQFSGSIPTTIGRLKNLVILQLRQNELSGPIPPSLGYCSKLQKLALAD  512

Query  1744  NHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICT  1923
             N LSG+IP TF +L  L  + LYNNS EG LP+ L  L NL+ IN SHN FSGSI+P+ +
Sbjct  513   NKLSGSIPPTFRFLSELDLITLYNNSFEGPLPESLSLLKNLSIINFSHNKFSGSISPLAS  572

Query  1924  SHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGN  2103
             SHS    D+TNN+F   IPS L  S +L RLRL +N FTG++P  LG + +L  LDLS N
Sbjct  573   SHSLTVLDLTNNSFSGPIPSELALSKNLTRLRLANNFFTGELPSELGQLEDLRFLDLSFN  632

Query  2104  KLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFN  2283
              L+G + P  S  + L H  L++N  SG IP WLG +  LGEL LS N F+G++P EL N
Sbjct  633   NLTGDLVPSFSGLKNLGHFLLSSNQFSGKIPTWLGVIEGLGELDLSFNNFTGTVPEELGN  692

Query  2284  CskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRN  2463
             C +LL LSL +N L+G +PPE+GNL SLNVL+L  N L GSIPST+    KLYELRLS N
Sbjct  693   CPRLLKLSLSSNKLSGNIPPELGNLTSLNVLDLQSNNLSGSIPSTLQQCKKLYELRLSEN  752

Query  2464  RFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVA  2643
               SG IP E+G L +LQ +LD S N+L+GEIP S+G L KLE L+LS N L G++PP + 
Sbjct  753   NLSGSIPYEIGTLSELQVILDLSKNHLSGEIPSSLGNLVKLERLNLSFNQLEGKVPPSLE  812

Query  2644  EMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD-KGSR-----NKG  2805
             ++SSL RLNLS N  +G++   ++ +P+ SF GN+ LCG PL SC + KG       N G
Sbjct  813   KLSSLHRLNLSYNHFQGQIPSTFSGFPLSSFTGNNKLCGPPLLSCSELKGQETKRLSNAG  872

Query  2806  SM-VVVISALSATVAIILLL  2862
              + + V   L+ATV  ++LL
Sbjct  873   VVGITVAIVLTATVICMVLL  892



>ref|XP_004157832.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase GSO1-like [Cucumis sativus]
Length=944

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/760 (50%), Positives = 491/760 (65%), Gaps = 5/760 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G +P+++GLL NLQALRIG+N L+G+I    GNL NL  LGL  C  +G IP ++G L  
Sbjct  132   GKLPAEIGLLKNLQALRIGNNLLSGEITPFIGNLTNLTVLGLGYCEFNGSIPVEIGNLKH  191

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L +LNLQQN L G +P  I     L    A+ N  +G+IP  LG +K L +LNLANN+L+
Sbjct  192   LISLNLQQNRLSGSIPDTIRGNEELEDLLASNNMFDGNIPDSLGSIKSLRVLNLANNSLS  251

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP     +S+LVYLNLLGN+L G IP  + +L  L+ +DLS N L+G +      +  
Sbjct  252   GSIPVAFSGLSNLVYLNLLGNRLSGEIPPEINQLVLLEEVDLSRNNLSGTISLLNTQLQN  311

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L  L L+ N L+G IP S C   +NLQ L L+   LSG+ P EL  C  LQQLDLS N L
Sbjct  312   LTTLVLSDNALTGNIPNSFCFRTSNLQQLFLARNKLSGKFPQELLNCSSLQQLDLSGNRL  371

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
              G +P  L +L  LT L+LNNN+  G I P + N++NL+ L LF N L G +P+EIG L 
Sbjct  372   EGDLPSGLDDLEHLTVLLLNNNSFTGFIPPQIGNMSNLEDLYLFDNKLTGTIPKEIGKLK  431

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
              L  IFLY+N  +G IP E+ NCS+L  IDF+GN F G IP  +G LK+L  LHLR+N L
Sbjct  432   KLSFIFLYDNQMTGSIPNELTNCSNLMEIDFFGNHFIGPIPENIGSLKNLIVLHLRQNFL  491

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
              G IPASLG C  L  L LADN+LSG++P+T G L  L+ + LYNNSLEG LP     L 
Sbjct  492   WGPIPASLGYCKSLQLLALADNNLSGSLPSTLGLLSELSTITLYNNSLEGPLPVSFFILK  551

Query  1861  NLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFT  2040
              L  IN S+N F+G+I P+C  +S  + D+TNN+F   IPS L NS +L RLRL  NR T
Sbjct  552   RLKIINFSNNKFNGTIFPLCGLNSLTALDLTNNSFSGHIPSRLINSRNLRRLRLAHNRLT  611

Query  2041  GKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpl  2220
             G IP   G ++EL+ LDLS N L+G + PQL  C KL H  LN+N L+G I   +G L  
Sbjct  612   GYIPSEFGQLKELNFLDLSHNNLTGEMSPQLFNCTKLEHFLLNDNRLTGTITPLIGNLQA  671

Query  2221  lgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLC  2400
             +GEL  SSN   G +P E+ +CSKLL LSL NN+L+G +P EIGN   LNVLNL+ N L 
Sbjct  672   VGELDFSSNNLYGRIPAEIGSCSKLLKLSLHNNNLSGMIPLEIGNFTFLNVLNLERNNLS  731

Query  2401  GSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLS  2580
             GSIPSTI    KLYEL+LS N  +GEIP+E+G+L DLQ  LD S N ++G+IP SIG L 
Sbjct  732   GSIPSTIEKCSKLYELKLSENFLTGEIPQELGELSDLQVALDLSKNLISGKIPSSIGNLM  791

Query  2581  KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCG  2760
             KLE LDLS N L GEIP  + +++S+  LNLS N+L+G + + ++ +P+ SF GN  LCG
Sbjct  792   KLERLDLSSNHLIGEIPTSLEQLTSIHILNLSDNQLQGSIPQLFSDFPLTSFKGNDELCG  851

Query  2761  SPLGSCRDKGSR-----NKGSMVVVISALSATVAIILLLM  2865
              PL +C    S+     +K +++ +I A+  T  +I L+M
Sbjct  852   RPLSTCSKSASQETSRLSKAAVIGIIVAIXFTSMVICLIM  891


 Score =   253 bits (645),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 197/517 (38%), Positives = 273/517 (53%), Gaps = 35/517 (7%)
 Frame = +1

Query  1198  CSN-ATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLV  1374
             CSN  T +  L LS++ LSG +  EL     L+ LDLS+N+L+GSIP EL +L  L  L+
Sbjct  65    CSNDETQIVSLNLSQSRLSGSMWSELWHVTSLEVLDLSSNSLSGSIPSELGQLYNLRVLI  124

Query  1375  LNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPV  1554
             L++N L G +   +  L NLQ L + +N L GE+   IG L +L ++ L    F+G IPV
Sbjct  125   LHSNFLSGKLPAEIGLLKNLQALRIGNNLLSGEITPFIGNLTNLTVLGLGYCEFNGSIPV  184

Query  1555  EIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLD  1734
             EIGN   L  ++   N+ +G IP T+   + L  L    N   G IP SLG+   L  L+
Sbjct  185   EIGNLKHLISLNLQQNRLSGSIPDTIRGNEELEDLLASNNMFDGNIPDSLGSIKSLRVLN  244

Query  1735  LADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP  1914
             LA+N LSG+IP  F  L  L  L L  N L G++P ++  L  L  ++LS NN SG+I+ 
Sbjct  245   LANNSLSGSIPVAFSGLSNLVYLNLLGNRLSGEIPPEINQLVLLEEVDLSRNNLSGTISL  304

Query  1915  ICTS-HSFLSFDVTNNAFDQEIP-SFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLL  2088
             + T   +  +  +++NA    IP SF   + +L +L L  N+ +GK P  L     L  L
Sbjct  305   LNTQLQNLTTLVLSDNALTGNIPNSFCFRTSNLQQLFLARNKLSGKFPQELLNCSSLQQL  364

Query  2089  DLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLP  2268
             DLSGN+L G +P  L     LT L LNN                        N F+G +P
Sbjct  365   DLSGNRLEGDLPSGLDDLEHLTVLLLNN------------------------NSFTGFIP  400

Query  2269  PELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYEL  2448
             P++ N S L  L L +N L GT+P EIG LK L+ + L DNQ+ GSIP+ +     L E+
Sbjct  401   PQIGNMSNLEDLYLFDNKLTGTIPKEIGKLKKLSFIFLYDNQMTGSIPNELTNCSNLMEI  460

Query  2449  RLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEI  2628
                 N F G IP  +G LK+L  VL    N L G IP S+G    L+ L L+ N+L+G +
Sbjct  461   DFFGNHFIGPIPENIGSLKNL-IVLHLRQNFLWGPIPASLGYCKSLQLLALADNNLSGSL  519

Query  2629  PPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFV  2739
             P  +  +S L  + L  N LEG L       PV  F+
Sbjct  520   PSTLGLLSELSTITLYNNSLEGPL-------PVSFFI  549



>ref|XP_004152560.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Cucumis sativus]
 gb|KGN64324.1| hypothetical protein Csa_1G046210 [Cucumis sativus]
Length=949

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/760 (50%), Positives = 491/760 (65%), Gaps = 5/760 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G +P+++GLL NLQALRIG+N L+G+I    GNL NL  LGL  C  +G IP ++G L  
Sbjct  137   GKLPAEIGLLKNLQALRIGNNLLSGEITPFIGNLTNLTVLGLGYCEFNGSIPVEIGNLKH  196

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L +LNLQQN L G +P  I     L    A+ N  +G+IP  LG +K L +LNLANN+L+
Sbjct  197   LISLNLQQNRLSGSIPDTIRGNEELEDLLASNNMFDGNIPDSLGSIKSLRVLNLANNSLS  256

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP     +S+LVYLNLLGN+L G IP  + +L  L+ +DLS N L+G +      +  
Sbjct  257   GSIPVAFSGLSNLVYLNLLGNRLSGEIPPEINQLVLLEEVDLSRNNLSGTISLLNAQLQN  316

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L  L L+ N L+G IP S C   +NLQ L L+   LSG+ P EL  C  LQQLDLS N L
Sbjct  317   LTTLVLSDNALTGNIPNSFCFRTSNLQQLFLARNKLSGKFPQELLNCSSLQQLDLSGNRL  376

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
              G +P  L +L  LT L+LNNN+  G I P + N++NL+ L LF N L G +P+EIG L 
Sbjct  377   EGDLPPGLDDLEHLTVLLLNNNSFTGFIPPQIGNMSNLEDLYLFDNKLTGTIPKEIGKLK  436

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
              L  IFLY+N  +G IP E+ NCS+L  IDF+GN F G IP  +G LK+L  LHLR+N L
Sbjct  437   KLSFIFLYDNQMTGSIPNELTNCSNLMEIDFFGNHFIGPIPENIGSLKNLIVLHLRQNFL  496

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
              G IPASLG C  L  L LADN+LSG++P+T G L  L+ + LYNNSLEG LP     L 
Sbjct  497   WGPIPASLGYCKSLQLLALADNNLSGSLPSTLGLLSELSTITLYNNSLEGPLPVSFFILK  556

Query  1861  NLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFT  2040
              L  IN S+N F+G+I P+C  +S  + D+TNN+F   IPS L NS +L RLRL  NR T
Sbjct  557   RLKIINFSNNKFNGTILPLCGLNSLTALDLTNNSFSGHIPSRLINSRNLRRLRLAHNRLT  616

Query  2041  GKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpl  2220
             G IP   G ++EL+ LDLS N L+G + PQL  C KL H  LN+N L+G I   +G L  
Sbjct  617   GYIPSEFGQLKELNFLDLSHNNLTGEMSPQLFNCTKLEHFLLNDNRLTGTITPLIGNLQA  676

Query  2221  lgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLC  2400
             +GEL  SSN   G +P E+ +CSKLL LSL NN+L+G +P EIGN   LNVLNL+ N L 
Sbjct  677   VGELDFSSNNLYGRIPAEIGSCSKLLKLSLHNNNLSGMIPLEIGNFTFLNVLNLERNNLS  736

Query  2401  GSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLS  2580
             GSIPSTI    KLYEL+LS N  +GEIP+E+G+L DLQ  LD S N ++G+IP SIG L 
Sbjct  737   GSIPSTIEKCSKLYELKLSENFLTGEIPQELGELSDLQVALDLSKNLISGKIPSSIGNLM  796

Query  2581  KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCG  2760
             KLE LDLS N L GEIP  + +++S+  LNLS N+L+G + + ++ +P+ SF GN  LCG
Sbjct  797   KLERLDLSSNHLIGEIPTSLEQLTSIHILNLSDNQLQGSIPQLFSDFPLTSFKGNDELCG  856

Query  2761  SPLGSCRDKGSR-----NKGSMVVVISALSATVAIILLLM  2865
              PL +C    S+     +K +++ +I A+  T  +I L+M
Sbjct  857   RPLSTCSKSASQETSRLSKAAVIGIIVAIVFTSMVICLIM  896


 Score =   254 bits (649),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 197/517 (38%), Positives = 273/517 (53%), Gaps = 35/517 (7%)
 Frame = +1

Query  1198  CSN-ATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLV  1374
             CSN  T +  L LS++ LSG +  EL     L+ LDLS+N+L+GSIP EL +L  L  L+
Sbjct  70    CSNDETQIVSLNLSQSRLSGSMWSELWHVTSLEVLDLSSNSLSGSIPSELGQLYNLRVLI  129

Query  1375  LNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPV  1554
             L++N L G +   +  L NLQ L + +N L GE+   IG L +L ++ L    F+G IPV
Sbjct  130   LHSNFLSGKLPAEIGLLKNLQALRIGNNLLSGEITPFIGNLTNLTVLGLGYCEFNGSIPV  189

Query  1555  EIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLD  1734
             EIGN   L  ++   N+ +G IP T+   + L  L    N   G IP SLG+   L  L+
Sbjct  190   EIGNLKHLISLNLQQNRLSGSIPDTIRGNEELEDLLASNNMFDGNIPDSLGSIKSLRVLN  249

Query  1735  LADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP  1914
             LA+N LSG+IP  F  L  L  L L  N L G++P ++  L  L  ++LS NN SG+I+ 
Sbjct  250   LANNSLSGSIPVAFSGLSNLVYLNLLGNRLSGEIPPEINQLVLLEEVDLSRNNLSGTISL  309

Query  1915  ICTS-HSFLSFDVTNNAFDQEIP-SFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLL  2088
             +     +  +  +++NA    IP SF   + +L +L L  N+ +GK P  L     L  L
Sbjct  310   LNAQLQNLTTLVLSDNALTGNIPNSFCFRTSNLQQLFLARNKLSGKFPQELLNCSSLQQL  369

Query  2089  DLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLP  2268
             DLSGN+L G +PP L     LT L LNN                        N F+G +P
Sbjct  370   DLSGNRLEGDLPPGLDDLEHLTVLLLNN------------------------NSFTGFIP  405

Query  2269  PELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYEL  2448
             P++ N S L  L L +N L GT+P EIG LK L+ + L DNQ+ GSIP+ +     L E+
Sbjct  406   PQIGNMSNLEDLYLFDNKLTGTIPKEIGKLKKLSFIFLYDNQMTGSIPNELTNCSNLMEI  465

Query  2449  RLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEI  2628
                 N F G IP  +G LK+L  VL    N L G IP S+G    L+ L L+ N+L+G +
Sbjct  466   DFFGNHFIGPIPENIGSLKNL-IVLHLRQNFLWGPIPASLGYCKSLQLLALADNNLSGSL  524

Query  2629  PPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFV  2739
             P  +  +S L  + L  N LEG L       PV  F+
Sbjct  525   PSTLGLLSELSTITLYNNSLEGPL-------PVSFFI  554



>ref|XP_006841024.1| hypothetical protein AMTR_s00085p00116630 [Amborella trichopoda]
 gb|ERN02699.1| hypothetical protein AMTR_s00085p00116630 [Amborella trichopoda]
Length=962

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/858 (49%), Positives = 558/858 (65%), Gaps = 3/858 (0%)
 Frame = +1

Query  349   LQGWSEKNPNYCSWQGVSCD-Gslkvvslnlsdsslggsispslgllthllhldlssnhl  525
             L+ WS K  + CSW G++C     +++  NLS S L GS+S    L T +  LDLSSN L
Sbjct  56    LEDWSMK-ADTCSWNGLTCSIDKTQILGFNLSGSELSGSLSAKFSLFTSIEFLDLSSNSL  114

Query  526   sGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLG  705
             +G IPP L  L++L   LL+SN L G IP ++GLL  LQ LR+GDN L+G IP    N  
Sbjct  115   TGSIPPELGKLTNLREFLLYSNFLSGLIPPEIGLLHKLQVLRLGDNLLSGPIPNQLCNCT  174

Query  706   NLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSL  885
              L  LGLAS  LSG IP  +G+L  L++LN+Q+N + G +P E+ +   L A S A N L
Sbjct  175   ELTVLGLASLELSGSIPRDIGKLKLLKSLNVQRNNISGEIPKEVGSCRELQALSIANNGL  234

Query  886   NGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLT  1065
              G IP ++G L  L ILNLANN+L+G IP  LG + +L +LNLLGN+L G IP  L ++ 
Sbjct  235   EGRIPPDIGNLSDLEILNLANNSLSGSIPEVLGGLFNLKHLNLLGNRLTGEIPTELNQIK  294

Query  1066  NLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETG  1245
              L+ LDLS N  +G +      + +LQ+L L+SN+L+G IP +LCS+ + L+ L LS+  
Sbjct  295   LLEILDLSRNNFSGPIKIFPNVLERLQYLVLSSNSLTGDIPGNLCSSNSALENLFLSQNK  354

Query  1246  LSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANL  1425
             LSGEIPP L+ C  LQ LDLS N L+G IP  +  L  L+D+ L NN   G I   +  L
Sbjct  355   LSGEIPPGLANCCYLQHLDLSENDLSGEIPSHISSLNFLSDVFLQNNRFSGVIPSEIGTL  414

Query  1426  TNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQ  1605
              NL+T  LF N+L G +P EIG L  L  + L EN  SG+IP+E+ NCSSL  IDF+GN 
Sbjct  415   RNLETFYLFGNHLTGTIPIEIGRLQKLTELSLSENQLSGQIPIELTNCSSLSGIDFFGNH  474

Query  1606  FTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYL  1785
             F+G IP T+G+LK+L FL++R+N+L G IP+SLG C +L TL L+DN L+G +P TF +L
Sbjct  475   FSGPIPRTIGKLKNLVFLNIRQNELEGSIPSSLGFCKKLQTLALSDNRLTGKLPPTFRFL  534

Query  1786  RALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAF  1965
             R L  L LYNNSLEG +P  L  L NL  INLS+N  SGS+ P+C S S +  D+TNN F
Sbjct  535   RELQVLSLYNNSLEGPIPRSLFFLKNLNIINLSNNKLSGSMLPLCGSSSLIKLDLTNNRF  594

Query  1966  DQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCR  2145
                IP  +GNS +L RLRLG N F+  IP  LG +  L+LLDLS N L+G +P  LS C+
Sbjct  595   MGAIPPLVGNSVNLIRLRLGLNNFSEGIPPELGQLTRLTLLDLSFNSLTGELPRDLSGCK  654

Query  2146  KLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsl  2325
             KL HL+LNNN   G IP W+G +  LGEL LS N+F G +P EL NCS LL LSL+ N+L
Sbjct  655   KLGHLNLNNNKFYGKIPFWVGSISSLGELDLSFNKFLGQIPSELGNCSDLLKLSLQANNL  714

Query  2326  nGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLK  2505
             +G +PPE+G + SLNVLNL +N+L G IPS+I    KLYELRLS N  +G +P+E+G+L 
Sbjct  715   SGEIPPELGRIASLNVLNLQNNKLSGPIPSSIQYCKKLYELRLSENLLTGSVPKEIGKLT  774

Query  2506  DLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNE  2685
             DLQ +LD S N+LTGEIPPS+G L KLE L+LS N L G +P +++ ++SL  LN+S N 
Sbjct  775   DLQIMLDLSKNSLTGEIPPSLGNLIKLEGLNLSCNGLHGAVPSELSGLTSLNSLNVSNNH  834

Query  2686  LEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDK-GSRNKGSMVVVISALSATVAIILLL  2862
             LEG L + ++ W   SF GNS LCG+PL  C +  GS+      +  + ++A +  +  +
Sbjct  835   LEGMLPRGFSKWSEKSFAGNSGLCGAPLVKCLEILGSQKDRLSKMAEAGITAGIVFLTTI  894

Query  2863  MGAAFFFKHNREAYRRRR  2916
             + +   +   R  Y  RR
Sbjct  895   ICSIILWLIFRMCYELRR  912



>ref|XP_006476818.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like isoform X2 [Citrus sinensis]
 ref|XP_006476819.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like isoform X3 [Citrus sinensis]
Length=776

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/688 (51%), Positives = 460/688 (67%), Gaps = 5/688 (1%)
 Frame = +1

Query  817   GPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSS  996
             G +P  I     L  F+A+ N L G+IP  +  LK L ILNLANN+L+G IP +L  + +
Sbjct  6     GLIPEAIHGCEELQKFAASNNMLEGTIPSSIVLLKSLQILNLANNSLSGSIPVELSHLFN  65

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             L YLNLLGN   G IP  L KL  L+ LDLS N L+G +      +  L+ L L+ N  +
Sbjct  66    LRYLNLLGNIFDGEIPSELNKLAQLEELDLSKNNLSGSISLLNTQLKNLETLVLSDNAFT  125

Query  1177  GTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
             G+IP   C N ++LQ L+L+   LSGE P EL +C  LQQLDLS+N+  G +P  L +L 
Sbjct  126   GSIPIKFCLNNSSLQQLILARNKLSGEFPLELLRCSSLQQLDLSDNSFKGELPRSLDKLE  185

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
             +LTDL+LNNN+  G+  P + NL+ L+ L LF N + G++P EIG L  L+ I+LY+N  
Sbjct  186   ELTDLLLNNNSFTGSFPPEIGNLSKLENLFLFDNMITGKIPVEIGKLQSLRAIYLYDNQM  245

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCH  1716
             SG IP E+ NCS L  IDF+GN F+G IP T+G+LK+L  L LR+NDLSG IPASLG C 
Sbjct  246   SGSIPRELTNCSGLTEIDFFGNHFSGSIPETMGKLKNLVILQLRQNDLSGPIPASLGYCK  305

Query  1717  QLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNF  1896
             +L  + LADN LSG++P TF +L  L  + LYNNS +G LP  L  L  L  IN SHN F
Sbjct  306   RLQQIALADNKLSGSVPLTFRFLSELYLITLYNNSFKGPLPPSLFQLKKLRIINFSHNKF  365

Query  1897  SGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRE  2076
             SGSI P+  S+S  + D+TNN+F   IPS L  S +L RLRL  N  TG IP   G + E
Sbjct  366   SGSIYPLTGSNSLTALDLTNNSFSGPIPSELAMSRNLSRLRLAHNHLTGNIPSEFGKLTE  425

Query  2077  LSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFS  2256
             L+ LDLS N  +G I PQLS C KL HL L+NN L+G IP WLG L  +GEL LSSN F+
Sbjct  426   LNFLDLSFNSFTGQIAPQLSKCAKLAHLLLSNNELTGTIPFWLGSLQEIGELDLSSNNFN  485

Query  2257  GSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGK  2436
             G++P E+ NCSKLL LSL  N+L+G +PPEIGNL +LNVLNL  N L G+IPSTI    K
Sbjct  486   GTVPAEIGNCSKLLKLSLRGNNLSGKIPPEIGNLTALNVLNLQRNSLSGNIPSTIQQCKK  545

Query  2437  LYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDL  2616
             LYELRLS N F+G IP ++G+L +LQ +LD S NN +GEIPPS+G+L KLE L++S+N L
Sbjct  546   LYELRLSENFFTGSIPADLGRLTELQVILDLSKNNFSGEIPPSLGSLLKLERLNISYNQL  605

Query  2617  TGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD-KGS  2793
              G++P  + +++SL  LNLS N L+G+L   ++ +P+ SF+GN+ LCG PL SC +  G 
Sbjct  606   QGQVPASLGKLTSLHVLNLSNNHLQGQLPLTFSGFPLSSFLGNAKLCGPPLLSCSELSGQ  665

Query  2794  RNK----GSMVVVISALSATVAIILLLM  2865
             + K     ++VV+I+A+  T A+I L+M
Sbjct  666   KVKRLSNTAVVVIITAILFTSAVICLIM  693


 Score =   265 bits (677),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 202/549 (37%), Positives = 281/549 (51%), Gaps = 27/549 (5%)
 Frame = +1

Query  628   LTNLQALRIGDNGLTGQIPTSFG-NLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqq  804
             L NL+ L + DN  TG IP  F  N  +L  L LA   LSG  P +L R + LQ L+L  
Sbjct  111   LKNLETLVLSDNAFTGSIPIKFCLNNSSLQQLILARNKLSGEFPLELLRCSSLQQLDLSD  170

Query  805   nllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLG  984
             N  +G LP  +  +  LT      NS  GS P E+G L  L  L L +N +TG+IP ++G
Sbjct  171   NSFKGELPRSLDKLEELTDLLLNNNSFTGSFPPEIGNLSKLENLFLFDNMITGKIPVEIG  230

Query  985   EMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTS  1164
             ++ SL  + L  NQ+ GSIP+ L   + L  +D  GN  +G +P   G +  L  L L  
Sbjct  231   KLQSLRAIYLYDNQMSGSIPRELTNCSGLTEIDFFGNHFSGSIPETMGKLKNLVILQLRQ  290

Query  1165  NNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEEL  1344
             N+LSG IP SL      LQ + L++  LSG +P        L  + L NN+  G +P  L
Sbjct  291   NDLSGPIPASL-GYCKRLQQIALADNKLSGSVPLTFRFLSELYLITLYNNSFKGPLPPSL  349

Query  1345  YELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLY  1524
             ++L +L  +  ++N   G+I P   +  +L  L L +N+  G +P E+ M  +L  + L 
Sbjct  350   FQLKKLRIINFSHNKFSGSIYPLTGS-NSLTALDLTNNSFSGPIPSELAMSRNLSRLRLA  408

Query  1525  ENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASL  1704
              NH +G IP E G  + L F+D   N FTG+I   L +   L  L L  N+L+G IP  L
Sbjct  409   HNHLTGNIPSEFGKLTELNFLDLSFNSFTGQIAPQLSKCAKLAHLLLSNNELTGTIPFWL  468

Query  1705  GNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLS  1884
             G+  ++  LDL+ N+ +G +PA  G    L +L L  N+L G +P ++ NL  L  +NL 
Sbjct  469   GSLQEIGELDLSSNNFNGTVPAEIGNCSKLLKLSLRGNNLSGKIPPEIGNLTALNVLNLQ  528

Query  1885  HNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLG  2064
              N+ SG+                       IPS +     L  LRL  N FTG IP  LG
Sbjct  529   RNSLSGN-----------------------IPSTIQQCKKLYELRLSENFFTGSIPADLG  565

Query  2065  LIRELS-LLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklS  2241
              + EL  +LDLS N  SG IPP L    KL  L+++ N L G +P  LG+L  L  L LS
Sbjct  566   RLTELQVILDLSKNNFSGEIPPSLGSLLKLERLNISYNQLQGQVPASLGKLTSLHVLNLS  625

Query  2242  SNQFSGSLP  2268
             +N   G LP
Sbjct  626   NNHLQGQLP  634


 Score =   263 bits (672),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 182/517 (35%), Positives = 261/517 (50%), Gaps = 34/517 (7%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G  P +L   ++LQ L + DN   G++P S   L  L  L L +   +            
Sbjct  151   GEFPLELLRCSSLQQLDLSDNSFKGELPRSLDKLEELTDLLLNNNSFT------------  198

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
                         G  PPEI N+S L       N + G IP E+G L+ L  + L +N ++
Sbjct  199   ------------GSFPPEIGNLSKLENLFLFDNMITGKIPVEIGKLQSLRAIYLYDNQMS  246

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP +L   S L  ++  GN   GSIP+++ KL NL  L L  N L+G +P   G   +
Sbjct  247   GSIPRELTNCSGLTEIDFFGNHFSGSIPETMGKLKNLVILQLRQNDLSGPIPASLGYCKR  306

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             LQ +AL  N LSG++P +     + L L+ L      G +PP L Q + L+ ++ S+N  
Sbjct  307   LQQIALADNKLSGSVPLTF-RFLSELYLITLYNNSFKGPLPPSLFQLKKLRIINFSHNKF  365

Query  1321  NGSIPEELYELT---QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIG  1491
             +GSI    Y LT    LT L L NN+  G I   +A   NL  L L HN+L G +P E G
Sbjct  366   SGSI----YPLTGSNSLTALDLTNNSFSGPIPSELAMSRNLSRLRLAHNHLTGNIPSEFG  421

Query  1492  MLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRE  1671
              L +L  + L  N F+G+I  ++  C+ L  +    N+ TG IP  LG L+ +  L L  
Sbjct  422   KLTELNFLDLSFNSFTGQIAPQLSKCAKLAHLLLSNNELTGTIPFWLGSLQEIGELDLSS  481

Query  1672  NDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLR  1851
             N+ +G +PA +GNC +L  L L  N+LSG IP   G L AL  L L  NSL G++P  ++
Sbjct  482   NNFNGTVPAEIGNCSKLLKLSLRGNNLSGKIPPEIGNLTALNVLNLQRNSLSGNIPSTIQ  541

Query  1852  NLGNLTRINLSHNNFSGSIAPICTSHSFLS--FDVTNNAFDQEIPSFLGNSPSLDRLRLG  2025
                 L  + LS N F+GSI       + L    D++ N F  EIP  LG+   L+RL + 
Sbjct  542   QCKKLYELRLSENFFTGSIPADLGRLTELQVILDLSKNNFSGEIPPSLGSLLKLERLNIS  601

Query  2026  SNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLS  2136
              N+  G++P +LG +  L +L+LS N L G +P   S
Sbjct  602   YNQLQGQVPASLGKLTSLHVLNLSNNHLQGQLPLTFS  638


 Score =   223 bits (567),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 164/487 (34%), Positives = 234/487 (48%), Gaps = 52/487 (11%)
 Frame = +1

Query  1384  NTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIG  1563
             N L G I  ++     LQ  +  +N L G +P  I +L  LQI+ L  N  SG IPVE+ 
Sbjct  2     NKLSGLIPEAIHGCEELQKFAASNNMLEGTIPSSIVLLKSLQILNLANNSLSGSIPVELS  61

Query  1564  NCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND----------------------  1677
             +  +L++++  GN F G+IP  L +L  L  L L +N+                      
Sbjct  62    HLFNLRYLNLLGNIFDGEIPSELNKLAQLEELDLSKNNLSGSISLLNTQLKNLETLVLSD  121

Query  1678  ---------------------------LSGEIPASLGNCHQLDTLDLADNHLSGAIPATF  1776
                                        LSGE P  L  C  L  LDL+DN   G +P + 
Sbjct  122   NAFTGSIPIKFCLNNSSLQQLILARNKLSGEFPLELLRCSSLQQLDLSDNSFKGELPRSL  181

Query  1777  GYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSI-APICTSHSFLSFDVT  1953
               L  LT L+L NNS  G  P ++ NL  L  + L  N  +G I   I    S  +  + 
Sbjct  182   DKLEELTDLLLNNNSFTGSFPPEIGNLSKLENLFLFDNMITGKIPVEIGKLQSLRAIYLY  241

Query  1954  NNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQL  2133
             +N     IP  L N   L  +    N F+G IP T+G ++ L +L L  N LSG IP  L
Sbjct  242   DNQMSGSIPRELTNCSGLTEIDFFGNHFSGSIPETMGKLKNLVILQLRQNDLSGPIPASL  301

Query  2134  SLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlsle  2313
               C++L  + L +N LSG +P+    L  L  + L +N F G LPP LF   KL +++  
Sbjct  302   GYCKRLQQIALADNKLSGSVPLTFRFLSELYLITLYNNSFKGPLPPSLFQLKKLRIINFS  361

Query  2314  nnslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREV  2493
             +N  +G++ P  G+  SL  L+L +N   G IPS +     L  LRL+ N  +G IP E 
Sbjct  362   HNKFSGSIYPLTGS-NSLTALDLTNNSFSGPIPSELAMSRNLSRLRLAHNHLTGNIPSEF  420

Query  2494  GQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNL  2673
             G+L +L + LD S+N+ TG+I P +   +KL  L LS+N+LTG IP  +  +  +G L+L
Sbjct  421   GKLTEL-NFLDLSFNSFTGQIAPQLSKCAKLAHLLLSNNELTGTIPFWLGSLQEIGELDL  479

Query  2674  SCNELEG  2694
             S N   G
Sbjct  480   SSNNFNG  486



>ref|XP_008393009.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase GSO1 [Malus domestica]
Length=977

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/921 (46%), Positives = 565/921 (61%), Gaps = 9/921 (1%)
 Frame = +1

Query  313   VLLEVKRSFVLQ---LQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdsslggsispslg  480
             +LL +K   V     L  WS  + + CSW G+SC D  L ++ LNLS S L G I   L 
Sbjct  37    LLLRIKSELVDPVGVLSNWS-PSAHICSWNGLSCSDDQLHIIGLNLSGSGLAGXIPRELS  95

Query  481   llthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGD  660
              L+ +  LD SSN L+GP+PP L  L  L++LLL+SN L G IP+++GLL NLQ LRIGD
Sbjct  96    QLSSIQTLDFSSNSLAGPLPPELGQLQGLKTLLLYSNFLSGEIPAEIGLLRNLQVLRIGD  155

Query  661   NGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIA  840
             N  +G IP S GNL  L  LGLA C L+G IP ++G L +L +L+LQ N L G +P EI 
Sbjct  156   NLFSGAIPPSIGNLTELRVLGLAYCQLNGSIPVEIGDLKKLTSLDLQNNSLTGLIPEEIH  215

Query  841   NISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLG  1020
              +  +  F+A+ N L G IP  +G LK L ILNLANN+L+G IP  L ++++L YLNL G
Sbjct  216   GLEEIQNFAASNNMLEGDIPSSIGSLKSLQILNLANNSLSGTIPYALSQLANLNYLNLAG  275

Query  1021  NQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLC  1200
             N+L G IP  L +L  L+ LDLS N L+G +      +  L+ L L+ N L+GTI  + C
Sbjct  276   NRLNGDIPSGLNQLAQLEILDLSRNNLSGSIGLLSTQLKNLESLVLSDNALTGTISSNFC  335

Query  1201  SNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLN  1380
              + +NL+ L+L+   L+G+ P +L  C  LQQLDLS+NT  G +P  L +L  LTDLVLN
Sbjct  336   LSNSNLRQLLLARNKLTGKFPLDLLSCSSLQQLDLSDNTFEGELPTALDKLQNLTDLVLN  395

Query  1381  NNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEI  1560
             NN+  GT+ P + N++ L+ L LF N + G +P EIG L  L+ ++LY+N  SG IP E+
Sbjct  396   NNSFTGTLPPEIGNMSYLENLYLFGNMITGRIPAEIGKLKILKTLYLYDNQLSGSIPREL  455

Query  1561  GNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLA  1740
              NC+ L  IDF+GN FTG IP T+G+LK L  LHLR+N LSG IP SLG C  L  L LA
Sbjct  456   TNCTELIEIDFFGNHFTGSIPATIGKLKSLVLLHLRQNGLSGPIPPSLGYCRSLRLLALA  515

Query  1741  DNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPIC  1920
             DN L+G +P TF ++  L+ + LYNNS EG LP  L  L NL  IN SHN F+GS  P+ 
Sbjct  516   DNKLTGTLPPTFRFISQLSTITLYNNSFEGPLPASLFLLKNLKIINFSHNRFNGSJYPLS  575

Query  1921  TSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSG  2100
              S S    D+TNN+F   IPS L  + +L RLRL  N   G IP   G + +L  LDLS 
Sbjct  576   GSSSLTKVDLTNNSFSGSIPSRLAMARNLTRLRLAYNHLAGTIPSEFGQLTQLKFLDLSF  635

Query  2101  NKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELF  2280
             N L+G +PPQLS  + + H  L+NN   G IP WLG L  LGEL LS+N F G+LP E+ 
Sbjct  636   NNLTGEVPPQLSSAKLIEHFLLSNNRFEGKIPAWLGSLQELGELDLSTNNFQGTLPAEIG  695

Query  2281  NCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSR  2460
             NCSKLL LSL+ NSL+  +P EIGNL SLNVLNL  N   GSIPSTIG   KLYELRLS 
Sbjct  696   NCSKLLKLSLQGNSLSSMIPEEIGNLTSLNVLNLQRNSFSGSIPSTIGQCEKLYELRLSE  755

Query  2461  NRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQV  2640
             N  +G IP  +G+L +LQ +LD S N L+G+IP S+G L KLE L+LS N L GE+P  +
Sbjct  756   NNLTGSIPSGLGELTELQVILDLSENFLSGKIPSSLGNLMKLERLNLSSNQLQGEVPSSL  815

Query  2641  AEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD-KGSRNKGSMVV  2817
              +++SL  LNLS N L+G++   ++ +P  SF  N  LCG PL SC + +  R KG    
Sbjct  816   GKLTSLHMLNLSNNHLQGQIPSTFSGFPPSSFSSNPKLCGPPLASCSESERQRKKGLSXA  875

Query  2818  VISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPL---FGNA  2988
               + ++  + +   ++  A  +   R     RR   +        ++ +R+     FGN 
Sbjct  876   AETGITVAIVLTSAVICLAMLYVMLRMWCNWRRVSVSNMDGGGGGAECKREEELWGFGNE  935

Query  2989  AKKRDIRWDDIMEATNNLSDE  3051
              K+    W+    A  N  DE
Sbjct  936   KKRGGECWNVDSLALVNSKDE  956



>ref|XP_010069084.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Eucalyptus grandis]
 ref|XP_010069085.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Eucalyptus grandis]
 gb|KCW57307.1| hypothetical protein EUGRSUZ_H00104 [Eucalyptus grandis]
Length=1105

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/925 (41%), Positives = 544/925 (59%), Gaps = 42/925 (5%)
 Frame = +1

Query  865   SAALNSLN--GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGS  1038
             S  LNS+N  G++   +G L HL +L+L+ N+++G IP ++G  SSLV+L L  NQ  G 
Sbjct  81    SLDLNSMNLSGTLSPSIGSLIHLTLLDLSYNSISGNIPKEIGNCSSLVHLCLNNNQFDGE  140

Query  1039  IPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNL  1218
             IP  L KL++L +L +  N+++G LP EFGS+  L      SNN++G++P S+  N  NL
Sbjct  141   IPAELVKLSSLTTLYIHNNKISGPLPEEFGSLSSLVEFRAYSNNITGSLPNSI-GNLKNL  199

Query  1219  QLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEG  1398
                   +  +SG +PPE+  C  L+ L ++ N + G +P+EL  L  LT+L+L +N L G
Sbjct  200   TTFRAGQNAISGTLPPEIGGCTNLRYLGIAQNEIGGELPKELGMLGSLTELILWDNRLSG  259

Query  1399  TISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSL  1578
              I   + N T+L+ ++L+ N+L G++P EIG L  L+ ++LY N  +G IP EIGN S  
Sbjct  260   YIPKEIGNCTSLEIIALYQNSLQGQIPSEIGDLKSLKWLYLYSNQLNGTIPREIGNLSLA  319

Query  1579  QFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSG  1758
               IDF  N  +G+IP    ++ +L  L+L +N L+G IP  L     L  LDL+ N+L+G
Sbjct  320   TEIDFSENCLSGEIPSEFSKINNLTLLYLFQNQLTGVIPNELSGLRNLTKLDLSINNLTG  379

Query  1759  AIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP-ICTSHSF  1935
              IP+ F YL  + +L L++NSL G +P  L     L  ++ S N  SG I P +C   + 
Sbjct  380   PIPSGFQYLSRMRQLQLFDNSLTGPIPRGLGIYSPLWVVDFSDNRLSGRIPPHLCRHSNL  439

Query  1936  LSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSG  2115
                ++ +N     IP+ + N  SL +LRLGSNR TG  P  +  +  +S ++L  NK SG
Sbjct  440   FLLNLESNMLYGNIPAGILNCNSLVQLRLGSNRLTGSFPSAMCKLENMSSIELGQNKFSG  499

Query  2116  FIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskl  2295
              IPP++  CR+L  LDL  N  +  +P  +G L  L    +SSN  SG +P E+ NC+ L
Sbjct  500   PIPPEIGFCRRLQRLDLAGNFFASNLPGEIGNLSQLVFFNISSNSLSGRIPREIVNCNLL  559

Query  2296  lvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSG  2475
               L L  NS  G LP EIG    L +L L DN+  G+IPST+G L  L EL++  N FSG
Sbjct  560   QRLDLSQNSFVGDLPAEIGTFSHLELLKLSDNKFSGNIPSTLGSLSHLTELQMGGNVFSG  619

Query  2476  EIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSS  2655
             EIP E+G L  LQ  L+ SYN+LTG+IP  +G L  LE L L++N+LTGEIP     +SS
Sbjct  620   EIPSELGSLSSLQIALNVSYNSLTGKIPRQLGNLHLLEYLLLNNNNLTGEIPSSFDSLSS  679

Query  2656  LGRLNLSCNELEGELDKR--YAHWPVDSFVGNSHLCGSPLGSCRDKGSRN----------  2799
             L   N S N+L G L     + H P+ SF+GN  LCG PL +C +  S            
Sbjct  680   LLVCNFSYNDLSGPLPSASLFQHMPISSFIGNKALCGEPLVNCNENPSSQSIPPLTSVDV  739

Query  2800  -KGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPL  2976
              KG ++ +++A+   V+  LLL+    +F         RR  E  AS     S +    +
Sbjct  740   PKGKIITIVAAVVGGVS--LLLIAVIIYF--------LRRPSETVASIEDKESPSPENAI  789

Query  2977  FGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIPR-KDDLF  3153
             +     K    + D+++ATNN  D +++G G C TVYKA + +G+ +A+KR+   ++   
Sbjct  790   Y--FPPKEVFLFQDLVQATNNFHDSYVVGRGACGTVYKAVMNSGQIIAVKRLASDRESNN  847

Query  3154  LDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKS  3333
             ++ SF  EI TL +IRHR++V+L G+C +  + SN+L+YEYM  GS+ + LH        
Sbjct  848   IENSFRAEISTLGKIRHRNIVKLFGFCHH--QCSNLLLYEYMAKGSLGELLHGPTC----  901

Query  3334  KKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKAL  3513
               SLDW  R  IA+G A+G+ YLHHDC P+IIHRDIKS+N+LLD N EAH+GDFGLAK +
Sbjct  902   --SLDWPTRFGIALGSAEGLAYLHHDCKPRIIHRDIKSNNILLDENFEAHVGDFGLAKVI  959

Query  3514  TDNYDSLNTESNTWFAGSYGYIAPE  3588
                 D   ++S +  AGSYGYIAPE
Sbjct  960   ----DMPQSKSMSAVAGSYGYIAPE  980


 Score =   282 bits (722),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 191/534 (36%), Positives = 286/534 (54%), Gaps = 3/534 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP ++G  ++L  L + +N   G+IP     L +L TL + +  +SG +P + G L+ 
Sbjct  115   GNIPKEIGNCSSLVHLCLNNNQFDGEIPAELVKLSSLTTLYIHNNKISGPLPEEFGSLSS  174

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L       N + G LP  I N+ +LT F A  N+++G++P E+GG  +L  L +A N + 
Sbjct  175   LVEFRAYSNNITGSLPNSIGNLKNLTTFRAGQNAISGTLPPEIGGCTNLRYLGIAQNEIG  234

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             GE+P +LG + SL  L L  N+L G IPK +   T+L+ + L  N L G++P E G +  
Sbjct  235   GELPKELGMLGSLTELILWDNRLSGYIPKEIGNCTSLEIIALYQNSLQGQIPSEIGDLKS  294

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L++L L SN L+GTIP+ +  N +    +  SE  LSGEIP E S+   L  L L  N L
Sbjct  295   LKWLYLYSNQLNGTIPREI-GNLSLATEIDFSENCLSGEIPSEFSKINNLTLLYLFQNQL  353

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
              G IP EL  L  LT L L+ N L G I      L+ ++ L LF N+L G +PR +G+  
Sbjct  354   TGVIPNELSGLRNLTKLDLSINNLTGPIPSGFQYLSRMRQLQLFDNSLTGPIPRGLGIYS  413

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
              L ++   +N  SG IP  +   S+L  ++   N   G IP  +     L  L L  N L
Sbjct  414   PLWVVDFSDNRLSGRIPPHLCRHSNLFLLNLESNMLYGNIPAGILNCNSLVQLRLGSNRL  473

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
             +G  P+++     + +++L  N  SG IP   G+ R L RL L  N    +LP ++ NL 
Sbjct  474   TGSFPSAMCKLENMSSIELGQNKFSGPIPPEIGFCRRLQRLDLAGNFFASNLPGEIGNLS  533

Query  1861  NLTRINLSHNNFSGSIA-PICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRF  2037
              L   N+S N+ SG I   I   +     D++ N+F  ++P+ +G    L+ L+L  N+F
Sbjct  534   QLVFFNISSNSLSGRIPREIVNCNLLQRLDLSQNSFVGDLPAEIGTFSHLELLKLSDNKF  593

Query  2038  TGKIPMTLGLIRELSLLDLSGNKLSGFIPPQL-SLCRKLTHLDLNNNLLSGPIP  2196
             +G IP TLG +  L+ L + GN  SG IP +L SL      L+++ N L+G IP
Sbjct  594   SGNIPSTLGSLSHLTELQMGGNVFSGEIPSELGSLSSLQIALNVSYNSLTGKIP  647


 Score =   124 bits (311),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 103/294 (35%), Positives = 139/294 (47%), Gaps = 26/294 (9%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             GPIP     LS +  L LF N L GPIP  LG+ + L  +   DN L+G+IP       N
Sbjct  379   GPIPSGFQYLSRMRQLQLFDNSLTGPIPRGLGIYSPLWVVDFSDNRLSGRIPPHLCRHSN  438

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L  L L S  L G IP  +     L  L L  N L G  P  +  + ++++     N  +
Sbjct  439   LFLLNLESNMLYGNIPAGILNCNSLVQLRLGSNRLTGSFPSAMCKLENMSSIELGQNKFS  498

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             G IP E+G  + L  L+LA N     +PG++G +S LV+ N+  N L G IP+ +     
Sbjct  499   GPIPPEIGFCRRLQRLDLAGNFFASNLPGEIGNLSQLVFFNISSNSLSGRIPREIVNCNL  558

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             LQ LDLS N   G+LP E G+   L+ L L+ N  SG IP +L S  ++L  L +     
Sbjct  559   LQRLDLSQNSFVGDLPAEIGTFSHLELLKLSDNKFSGNIPSTLGS-LSHLTELQMGGNVF  617

Query  1249  SGEIPPELSQCRVLQ-QLDLSNNTL------------------------NGSIP  1335
             SGEIP EL     LQ  L++S N+L                         G IP
Sbjct  618   SGEIPSELGSLSSLQIALNVSYNSLTGKIPRQLGNLHLLEYLLLNNNNLTGEIP  671



>ref|XP_008649415.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Zea mays]
 gb|AFW77353.1| hypothetical protein ZEAMMB73_143555 [Zea mays]
Length=977

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/876 (49%), Positives = 546/876 (62%), Gaps = 21/876 (2%)
 Frame = +1

Query  286   CQNTSSTL-RVLLEVKRSFVLQ---LQGWSEKNPNYCSWQGVSC----DGslkvvslnls  441
             C  T +T   VLL+VK         L GWS +  + CSW G++C         V  LNLS
Sbjct  30    CSATPATAPAVLLQVKSGLTDPGGVLSGWSLE-ADVCSWHGITCLPGEVSPGIVTGLNLS  88

Query  442   dsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQL  621
                L G I P++  L  +  +DLSSN L+GPIPP L  L +L +LLLFSN L G IP +L
Sbjct  89    GHGLSGVIPPAMSGLVSIESIDLSSNSLTGPIPPELGALENLRTLLLFSNSLTGTIPPEL  148

Query  622   GLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlq  801
             GLL NL+ LRIGDNGL G+IP   GN   L TLGLA C+L+G IP +LG L  LQ L L 
Sbjct  149   GLLKNLKVLRIGDNGLHGEIPPHLGNCSELETLGLAYCHLNGTIPAELGNLKLLQKLALD  208

Query  802   qnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQL  981
              N L G +P +IA   SL   S + N L G+IP  +G    L  LNLANN  +G IP ++
Sbjct  209   NNALTGGIPEQIAGCVSLRFLSVSDNMLQGNIPSFVGSFSDLQSLNLANNQFSGGIPAEI  268

Query  982   GEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALT  1161
             G +SSL YLNLLGN L GSIP  L +L  LQ LDLS N ++G++      +  L++L L+
Sbjct  269   GNLSSLTYLNLLGNSLTGSIPAELNRLGQLQVLDLSVNNISGKVSISAAQLKNLKYLVLS  328

Query  1162  SNNLSGTIPKSLCSNATN--LQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIP  1335
              N L G IP+ LC+  ++  L+ L L+   L G I   LS C  LQ +D+SNN+  G IP
Sbjct  329   GNLLDGAIPEDLCAGDSSSLLENLFLAGNNLEGGIQALLS-CTALQSIDVSNNSFTGVIP  387

Query  1336  EELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQII  1515
               +  L  L +L L+NN+  G +   + +L NL+ LSLFHN L G +P EIG L  L+++
Sbjct  388   PGIDRLPGLINLALHNNSFTGALPSQIGSLGNLEVLSLFHNGLTGGIPPEIGRLQKLKLL  447

Query  1516  FLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIP  1695
             FLYEN  SG IP E+ NC+SL+ +DF+GN F G IP  +G L++L  L LR+NDLSG IP
Sbjct  448   FLYENQMSGTIPDELTNCTSLEEVDFFGNHFHGPIPERIGNLRNLTVLQLRQNDLSGPIP  507

Query  1696  ASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRI  1875
             ASLG C  L  L LADN L+G++P TFG L  L+ + LYNNSL G LP+ L  L NLT I
Sbjct  508   ASLGECRSLQALALADNRLTGSLPETFGQLAELSVITLYNNSLAGPLPESLFQLKNLTVI  567

Query  1876  NLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPM  2055
             N SHN F+ SI P+  S S     +T+N+F   IP+ +  S ++ RL+LG NR TG IP 
Sbjct  568   NFSHNQFTDSIVPLLGSTSLAVLALTDNSFSGVIPAVVARSRNMVRLQLGGNRLTGAIPA  627

Query  2056  TLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelk  2235
              LG +  LS+LDLS NKLS  IP +LS C +L HL L+ N L+G +  WLG L  LGEL 
Sbjct  628   ELGNLTRLSMLDLSLNKLSSDIPAELSNCVQLAHLKLDGNSLTGTVSAWLGSLRSLGELD  687

Query  2236  lSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPS  2415
             LS N  +G +PPEL NCS LL LSL +N L G++PPEIG L SLNVLNL+ N L G+IP 
Sbjct  688   LSWNALTGGIPPELGNCSDLLKLSLSDNHLTGSIPPEIGRLTSLNVLNLNKNSLTGAIPP  747

Query  2416  TIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESL  2595
              +    KLYELRLS N   G IP E+GQL +LQ +LD S N L+GEIP S+G L KLE L
Sbjct  748   ALHQCDKLYELRLSENSLEGPIPPELGQLSELQVILDLSRNRLSGEIPASLGGLVKLERL  807

Query  2596  DLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGS  2775
             +LS N L G+IP  + +++SL RLNLS N L G +    + +P  SFVGN  LC +PL  
Sbjct  808   NLSSNRLDGQIPSSLLQLTSLHRLNLSGNHLSGAVPAGLSGFPAASFVGN-ELCAAPLQP  866

Query  2776  CRDK----GSRNKGSMVVVISA----LSATVAIILL  2859
             C  +      R  G+ VV+I A    +SA V + LL
Sbjct  867   CGPRSPATARRLSGTEVVMIVAGIALVSAVVCVALL  902



>ref|XP_010656659.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Vitis vinifera]
Length=1260

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/1005 (41%), Positives = 574/1005 (57%), Gaps = 35/1005 (3%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
              G IP Q+GLLT+L  L +  N L GQIP S GNL NL +L L S    G IP ++G L 
Sbjct  160   AGLIPHQVGLLTSLIFLALPSNHLRGQIPPSIGNLRNLTSLYLYSNEFYGFIPQEIGLLR  219

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
              L NL L  N L GP+PP I N+ +LT      N L+GSIPKE+G L+ L+ L L+ N L
Sbjct  220   SLNNLVLSTNNLSGPIPPSIGNLRNLTTLYLHTNKLSGSIPKEIGLLRSLNDLELSANNL  279

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             +G IP  +G + +L  L L  N+L GSIP+ +  L +L +L LS N L+G +P   G++ 
Sbjct  280   SGPIPHSIGNLRNLTTLYLHTNKLSGSIPQEIGLLRSLNNLKLSTNNLSGPIPPSIGNLR  339

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
              L  L L +N LSG+IP+ +     +L  L LS   LSG IPP +   R L  L L  N 
Sbjct  340   NLTTLYLHTNKLSGSIPQEI-GLLRSLNDLELSANNLSGPIPPSIGNLRNLTTLYLHTNK  398

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
             L+GSIP+E+  L  L DL L+ N L G I PS+ NL NL TL L  N L G +P+EIGML
Sbjct  399   LSGSIPQEIGLLRSLNDLELSTNNLNGPIPPSIGNLRNLTTLYLHTNKLSGSIPKEIGML  458

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
               L  + L  N+ +G IP  IG   +L  +  + N+ +G IP+ +G L+ LF L L  N+
Sbjct  459   RSLNDLELSTNNLNGPIPPSIGKLRNLTTLYLHNNKLSGSIPLEIGLLRSLFNLSLSTNN  518

Query  1678  LSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNL  1857
             LSG IP  +GN   L  L L +N  SG+IP   G LR+L  L L  N L G +P ++ NL
Sbjct  519   LSGPIPPFIGNLRNLTKLYLDNNRFSGSIPREIGLLRSLHDLALATNKLSGPIPQEIDNL  578

Query  1858  GNLTRINLSHNNFSGSI-APICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNR  2034
              +L  ++L  NNF+G +   +C   +  +F    N F   IP  L N  SL R+RL  N+
Sbjct  579   IHLKSLHLEENNFTGHLPQQMCLGGALENFTAMGNHFTGPIPMSLRNCTSLFRVRLERNQ  638

Query  2035  FTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrl  2214
               G I    G+   L+ +DLS N L G +  +   C  LT L++++N LSG IP  LG  
Sbjct  639   LEGNITEVFGVYPNLNFMDLSSNNLYGELSHKWGQCGSLTSLNISHNNLSGIIPPQLGEA  698

Query  2215  pllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQ  2394
               L  L LSSN   G +P EL   + +  L L NN L+G +P E+GNL +L  L+L  N 
Sbjct  699   IQLHRLDLSSNHLLGKIPRELGKLTSMFHLVLSNNQLSGNIPLEVGNLFNLEHLSLTSNN  758

Query  2395  LCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGT  2574
             L GSIP  +G L KL+ L LS+N+F   IP E+G +  LQ+ LD S N L G+IP  +G 
Sbjct  759   LSGSIPKQLGMLSKLFFLNLSKNKFGESIPDEIGNMHSLQN-LDLSQNMLNGKIPQQLGE  817

Query  2575  LSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELD--KRYAHWPVDSFVGNS  2748
             L +LE+L+LSHN+L+G IP    +M SL  +++S N+LEG L   K +   P ++F+ N 
Sbjct  818   LQRLETLNLSHNELSGSIPSTFEDMLSLTSVDISSNQLEGPLPDIKAFQEAPFEAFMSNG  877

Query  2749  HLCGSPLG--SCRD-KGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRG  2919
              LCG+  G   C      +NK SM+++IS+      + LL +    +F     A R R+G
Sbjct  878   GLCGNATGLKPCIPFTQKKNKRSMILIISS-----TVFLLCISMGIYFTLYWRA-RNRKG  931

Query  2920  KENYAsssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAEL  3099
             K +         +   + LF        I + DI+E T   + ++ IGSGG  TVYKAEL
Sbjct  932   KSS---------ETPCEDLFAIWDHDGGILYQDIIEVTEEFNSKYCIGSGGQGTVYKAEL  982

Query  3100  FNGETVAIKRI--PRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYE  3273
               G  VA+K++  P+  ++   K+F  EI+ L  IRHR++V+  GYCS+     + L+Y+
Sbjct  983   PTGRVVAVKKLHPPQDGEMSSLKAFTSEIRALTEIRHRNIVKFYGYCSHARH--SFLVYK  1040

Query  3274  YMENGSVWDWLHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSN  3453
              ME GS+ + L N+    +    LDW  RL I  G+A+ + Y+HHDC P IIHRDI S+N
Sbjct  1041  LMEKGSLRNILSNE----EEAIGLDWIRRLNIVKGVAEALSYMHHDCSPPIIHRDISSNN  1096

Query  3454  VLLDSNMEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             VLLDS  EAH+ DFG A+ L  +  S    + T FAG++GY APE
Sbjct  1097  VLLDSEYEAHVSDFGTARLLKPDSSS----NWTSFAGTFGYSAPE  1137


 Score =   317 bits (813),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 236/581 (41%), Positives = 321/581 (55%), Gaps = 26/581 (4%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             GPIP ++ NL +L +L L +N+L G IP ++GLL +L  L++  N L+G IP S GNL N
Sbjct  281   GPIPHSIGNLRNLTTLYLHTNKLSGSIPQEIGLLRSLNNLKLSTNNLSGPIPPSIGNLRN  340

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L TL L +  LSG IP ++G L  L +L L  N L GP+PP I N+ +LT      N L+
Sbjct  341   LTTLYLHTNKLSGSIPQEIGLLRSLNDLELSANNLSGPIPPSIGNLRNLTTLYLHTNKLS  400

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             GSIP+E+G L+ L+ L L+ N L G IP  +G + +L  L L  N+L GSIPK +  L +
Sbjct  401   GSIPQEIGLLRSLNDLELSTNNLNGPIPPSIGNLRNLTTLYLHTNKLSGSIPKEIGMLRS  460

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             L  L+LS N L G +P   G +  L  L L +N LSG+IP  +     +L  L LS   L
Sbjct  461   LNDLELSTNNLNGPIPPSIGKLRNLTTLYLHNNKLSGSIPLEI-GLLRSLFNLSLSTNNL  519

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
             SG IPP +   R L +L L NN  +GSIP E+  L  L DL L  N L G I   + NL 
Sbjct  520   SGPIPPFIGNLRNLTKLYLDNNRFSGSIPREIGLLRSLHDLALATNKLSGPIPQEIDNLI  579

Query  1429  NLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQF  1608
             +L++L L  NN  G +P+++ + G L+      NHF+G IP+ + NC+SL  +    NQ 
Sbjct  580   HLKSLHLEENNFTGHLPQQMCLGGALENFTAMGNHFTGPIPMSLRNCTSLFRVRLERNQL  639

Query  1609  TGKIPITLGRLKHLFFLHLRENDLSGE------------------------IPASLGNCH  1716
              G I    G   +L F+ L  N+L GE                        IP  LG   
Sbjct  640   EGNITEVFGVYPNLNFMDLSSNNLYGELSHKWGQCGSLTSLNISHNNLSGIIPPQLGEAI  699

Query  1717  QLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNF  1896
             QL  LDL+ NHL G IP   G L ++  L+L NN L G++P ++ NL NL  ++L+ NN 
Sbjct  700   QLHRLDLSSNHLLGKIPRELGKLTSMFHLVLSNNQLSGNIPLEVGNLFNLEHLSLTSNNL  759

Query  1897  SGSIAPICTSHSFLSF-DVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIR  2073
             SGSI       S L F +++ N F + IP  +GN  SL  L L  N   GKIP  LG ++
Sbjct  760   SGSIPKQLGMLSKLFFLNLSKNKFGESIPDEIGNMHSLQNLDLSQNMLNGKIPQQLGELQ  819

Query  2074  ELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIP  2196
              L  L+LS N+LSG IP        LT +D+++N L GP+P
Sbjct  820   RLETLNLSHNELSGSIPSTFEDMLSLTSVDISSNQLEGPLP  860


 Score =   279 bits (714),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 213/563 (38%), Positives = 305/563 (54%), Gaps = 3/563 (1%)
 Frame = +1

Query  1057  KLTNLQSLDLSGNRLAGELPG-EFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLML  1233
             K  ++ SL+L    L G L    F S+  L  L L +N+  G IP  + + +  + +L L
Sbjct  95    KSKSVSSLNLESCGLRGTLYNLNFLSLPNLVTLDLYNNSFYGIIPTHISNLSKFITILDL  154

Query  1234  SETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPS  1413
                  +G IP ++     L  L L +N L G IP  +  L  LT L L +N   G I   
Sbjct  155   GFNNFAGLIPHQVGLLTSLIFLALPSNHLRGQIPPSIGNLRNLTSLYLYSNEFYGFIPQE  214

Query  1414  VANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDF  1593
             +  L +L  L L  NNL G +P  IG L +L  ++L+ N  SG IP EIG   SL  ++ 
Sbjct  215   IGLLRSLNNLVLSTNNLSGPIPPSIGNLRNLTTLYLHTNKLSGSIPKEIGLLRSLNDLEL  274

Query  1594  YGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPAT  1773
               N  +G IP ++G L++L  L+L  N LSG IP  +G    L+ L L+ N+LSG IP +
Sbjct  275   SANNLSGPIPHSIGNLRNLTTLYLHTNKLSGSIPQEIGLLRSLNNLKLSTNNLSGPIPPS  334

Query  1774  FGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP-ICTSHSFLSFDV  1950
              G LR LT L L+ N L G +P ++  L +L  + LS NN SG I P I    +  +  +
Sbjct  335   IGNLRNLTTLYLHTNKLSGSIPQEIGLLRSLNDLELSANNLSGPIPPSIGNLRNLTTLYL  394

Query  1951  TNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQ  2130
               N     IP  +G   SL+ L L +N   G IP ++G +R L+ L L  NKLSG IP +
Sbjct  395   HTNKLSGSIPQEIGLLRSLNDLELSTNNLNGPIPPSIGNLRNLTTLYLHTNKLSGSIPKE  454

Query  2131  LSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlsl  2310
             + + R L  L+L+ N L+GPIP  +G+L  L  L L +N+ SGS+P E+     L  LSL
Sbjct  455   IGMLRSLNDLELSTNNLNGPIPPSIGKLRNLTTLYLHNNKLSGSIPLEIGLLRSLFNLSL  514

Query  2311  ennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPRE  2490
               N+L+G +PP IGNL++L  L LD+N+  GSIP  IG L  L++L L+ N+ SG IP+E
Sbjct  515   STNNLSGPIPPFIGNLRNLTKLYLDNNRFSGSIPREIGLLRSLHDLALATNKLSGPIPQE  574

Query  2491  VGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLN  2670
             +  L  L+S L    NN TG +P  +     LE+     N  TG IP  +   +SL R+ 
Sbjct  575   IDNLIHLKS-LHLEENNFTGHLPQQMCLGGALENFTAMGNHFTGPIPMSLRNCTSLFRVR  633

Query  2671  LSCNELEGELDKRYAHWPVDSFV  2739
             L  N+LEG + + +  +P  +F+
Sbjct  634   LERNQLEGNITEVFGVYPNLNFM  656



>ref|XP_010940144.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Elaeis guineensis]
Length=972

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/896 (48%), Positives = 567/896 (63%), Gaps = 16/896 (2%)
 Frame = +1

Query  286   CQNTSSTLRVLLEVKRSFVLQLQG----WSEKNPNYCSWQGVSC-DGslkvvslnlsdss  450
             C + S+    LL++K  F+  L+G    WS  + + CSW GV+C      V  LNLS   
Sbjct  24    CGDASTNSEALLQIKSEFI-DLEGVLSNWSFGDGDICSWNGVTCLASQNHVSGLNLSGHG  82

Query  451   lggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLL  630
             L G IS  +G L  L  LDLSSN L+GPIPP +S L +L  L L+SN L G IP +LGLL
Sbjct  83    LSGLISSKIGSLVFLQTLDLSSNSLTGPIPPEISLLKNLRELFLYSNALSGSIPPELGLL  142

Query  631   TNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnl  810
               L+ LRIGDN L+G+IP+  G    L  LGLASC L+G IP + G L  L++LNLQ N 
Sbjct  143   KKLKILRIGDNLLSGEIPSQLGGCTQLEILGLASCRLNGTIPEETGNLKHLKSLNLQNNR  202

Query  811   lEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEM  990
             L G +P E+     L   SAA N L G IP  +GGL  L  LNL +N L+G IP +LG +
Sbjct  203   LGGLIPQELGGCGELQVLSAADNGLEGEIPSTIGGLNALQTLNLMSNKLSGSIPVELGNL  262

Query  991   SSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNN  1170
             SSL YLNLLGN+L G+IP  L +L  LQ LDLS N L+G +      +  L++L L++N 
Sbjct  263   SSLTYLNLLGNRLSGTIPLELNQLRQLQILDLSNNDLSGTIDISTVHLDSLEYLVLSNNF  322

Query  1171  LSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYE  1350
             L G I K+LC   T+LQ L L+E  L+G I   L+ C  L+ LDLSNN+L+G+IP  +  
Sbjct  323   LEGGISKNLCPERTSLQNLFLAENNLTGTIEGLLN-CTSLRSLDLSNNSLSGNIPSHIDR  381

Query  1351  LTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYEN  1530
             L  L +LVL+NN+L G + P + N++NL+ LS+FHN L G++P EIG L  L +++LYEN
Sbjct  382   LANLVNLVLHNNSLVGVLPPQIGNMSNLEMLSVFHNGLIGDIPAEIGKLRRLTLLYLYEN  441

Query  1531  HFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGN  1710
               +G IP  + NCSSL+ IDF+GN F G+IP T+GRL++L  L LR+N+LSG IP SLG 
Sbjct  442   QMTGRIPSVLTNCSSLEEIDFFGNHFRGRIPETMGRLENLVVLQLRQNELSGPIPPSLGY  501

Query  1711  CHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHN  1890
             C +L +L LADN LSG +P TFG+L  L  + LYNNS +G LP+ + +L NLT IN SHN
Sbjct  502   CRKLQSLALADNQLSGTLPHTFGFLSELRLITLYNNSFQGPLPESIFSLRNLTIINFSHN  561

Query  1891  NFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLI  2070
              F+G I+P+  S S    D+TNN+F   IPS LG   +L RLRLG N  +G++P  LG  
Sbjct  562   RFTGCISPLLGSSSLAKMDLTNNSFSGRIPSALGEKRNLTRLRLGHNLLSGEVPAELGRP  621

Query  2071  RELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQ  2250
               L  LDLS N L+G IP +LS C++LTHL L  N L+G IP W G L  +GEL LSSN 
Sbjct  622   EGLEFLDLSSNNLTGGIPIELSQCKQLTHLLLGGNRLTGTIPSWFGSLRSIGELDLSSND  681

Query  2251  FSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGL  2430
             F G +P EL +C+ LL LSL +N L+G +P E+G L SLNVL L  N L G IPS +   
Sbjct  682   FHGEVPAELGSCTGLLKLSLHDNKLSGIIPQELGRLTSLNVLALQRNNLSGPIPSALQHC  741

Query  2431  GKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHN  2610
              KLYELRLS N  +G IP E+GQL +LQ +LD S N+L+G IPPS+G L KLE L+LS N
Sbjct  742   NKLYELRLSENFLTGSIPPELGQLTELQVILDLSRNHLSGGIPPSLGQLIKLERLNLSFN  801

Query  2611  DLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSC----  2778
              L G IPP +  ++SL +LNLS N L+G +    +++P  SFVGN  LCG+PL SC    
Sbjct  802   RLQGPIPPSLDRLTSLHQLNLSNNLLQGPIPAALSNFPSSSFVGN-QLCGAPLASCTGLS  860

Query  2779  -RDKGSRNKGSMVVVISAL---SATVAIILLLMGAAFFFKHNREAYRRRRGKENYA  2934
               D    + G +  + +A+   SA V ++LL +    +      +     G+E  A
Sbjct  861   GSDMKRLSNGQVAAITAAIVFVSAVVCLVLLYIMIRMWSNWREASVSNSDGEEQEA  916



>gb|EMT16678.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Aegilops 
tauschii]
Length=987

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/905 (47%), Positives = 551/905 (61%), Gaps = 33/905 (4%)
 Frame = +1

Query  313   VLLEVKRSFVLQ---LQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdsslggsispslg  480
              LL+VK   +     L GWS +  + CSW GVSC  G   V  LNLS   L G+ISP++ 
Sbjct  31    TLLQVKSDLIDPQGILSGWSPE-ADVCSWHGVSCLPGEGIVTGLNLSGYGLSGTISPAIS  89

Query  481   llthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGD  660
              L  +  +D SSN L+GPIPP L  L +L++LLL+SN LVG IP +LGLL NL+ LR+GD
Sbjct  90    GLMSVEVIDFSSNSLTGPIPPELGMLQNLKTLLLYSNSLVGTIPPELGLLGNLKVLRLGD  149

Query  661   NGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIA  840
             N L G+IP   GN   L T+ LA C LSG IP Q+G L  LQ L L  N L G +P ++ 
Sbjct  150   NMLHGEIPLQLGNCTELETMALAYCQLSGTIPHQIGNLKNLQQLVLDNNTLTGSIPEQLV  209

Query  841   NISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLG  1020
               ++L + S + N L G+IP  +G L  L  LNLANN  +G IP  +G++SSL YLNLLG
Sbjct  210   GCANLRSLSVSDNRLGGTIPSFIGSLSVLQSLNLANNQFSGAIPADIGKLSSLTYLNLLG  269

Query  1021  NQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLC  1200
             N+L G+IP+ L +L+ LQ LDLS N ++G +      +  L++L L+ N L GTIP  LC
Sbjct  270   NRLTGAIPEELNQLSQLQVLDLSKNNISGVISISTSQLKNLKYLVLSDNLLDGTIPGDLC  329

Query  1201  SNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLN  1380
                ++L+ L L+   L G I   L  C  L+ +D SNN+  G IP E+  L  L DLVL+
Sbjct  330   PGNSSLENLFLAGNNLEGGIE-GLLNCISLRSIDASNNSFTGKIPSEIDRLANLVDLVLH  388

Query  1381  NNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEI  1560
             NN+L G + P + NL+NL+ LSL+HN L G +P EIG L  L+ +FLYEN  SG IP EI
Sbjct  389   NNSLTGVLPPEIVNLSNLEMLSLYHNGLTGVLPPEIGRLQRLKALFLYENQMSGTIPDEI  448

Query  1561  GNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLA  1740
              +C+SL+ +DF+GN F G IP  +G LK L  L LR+NDLSG IPASLG C +L  L LA
Sbjct  449   TDCTSLEEVDFFGNHFHGTIPEKIGNLKSLTVLQLRQNDLSGSIPASLGECRRLQALALA  508

Query  1741  DNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPIC  1920
             DN LSGA+P TF  L  L+ + LYNNSLEG LP+ L  L NLT IN+SHN FSGS+ P+ 
Sbjct  509   DNRLSGALPDTFRLLTELSIITLYNNSLEGPLPEALFELKNLTVINISHNRFSGSVVPLL  568

Query  1921  TSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSG  2100
              S S     +T+N F   IP+ +  S ++ RL+L  N  TG IP  LG + +L +LDLS 
Sbjct  569   GSSSLSVLVLTDNNFSGVIPTAVTRSRNMVRLQLAGNCLTGAIPAELGSLTQLKMLDLSS  628

Query  2101  NKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg------------------  2226
             N LSG IP QLS C +LTHL+L  N L+G +P WLG L L                    
Sbjct  629   NNLSGDIPAQLSNCLQLTHLNLERNSLTGAVPSWLGGLRLTQLNLERNSLTGAVPSWLGG  688

Query  2227  -----elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDN  2391
                  EL LSSN  +G +P EL NCS LL LSL  N L+G++P EIG L SLNVLNL  N
Sbjct  689   LRFLGELDLSSNALTGVIPVELGNCSSLLKLSLSGNRLSGSIPQEIGRLTSLNVLNLQKN  748

Query  2392  QLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIG  2571
              L G IP T+    KLYELRLS N   G IP E+GQL +LQ +LD S N L+G+IP S+G
Sbjct  749   SLTGIIPPTLRRCNKLYELRLSENSLEGPIPMELGQLSELQVMLDLSRNRLSGQIPTSLG  808

Query  2572  TLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSH  2751
              L KLE L+LS N L G+IP  + +++SL RLNLS N L G +    + +P  S+ GN  
Sbjct  809   NLVKLERLNLSSNQLHGQIPTSLLQLTSLNRLNLSDNLLSGAIPAMLSSFPAASYAGNGE  868

Query  2752  LCGSPLGSCRDKGSR----NKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRG  2919
             LCG PL +C   G R        +V  I+ +SATV + LL +    +      +     G
Sbjct  869   LCGVPLPTCGANGRRLASATVSGIVAAIAIVSATVCMALLYIMLRMWSNWREVSVSSSDG  928

Query  2920  KENYA  2934
             +E  A
Sbjct  929   EEPEA  933



>ref|XP_004298963.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Fragaria vesca subsp. vesca]
Length=967

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/766 (49%), Positives = 488/766 (64%), Gaps = 12/766 (2%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP ++G L N++ LR+GDN ++G+IP S GNL  L  L LA C L+G IP ++G+L  
Sbjct  136   GEIPEEIGALKNMRVLRVGDNFISGEIPPSIGNLTELRVLALAYCQLNGSIPVEIGKLKH  195

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             LQ+L+LQ N L G +P EI     L  F+A+ N L G IP  LG L+ L ILNLANN+L+
Sbjct  196   LQSLDLQNNSLSGLIPEEIRGCKELVNFAASNNKLEGDIPL-LGSLESLQILNLANNSLS  254

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP  L ++ +L YLNLLGN+L G+IP  L +L  L+ LD S N L+G +      +  
Sbjct  255   GSIPTALSQLRNLKYLNLLGNRLSGAIPSELNQLVQLEMLDFSMNNLSGSIQLLSTQLKN  314

Query  1141  LQFLALTSNNLSGTIPKSLC-SNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
             L  L L+ N L+G IP + C S+++NL+ L+L+   LSG+ P  +  C  LQQLDLS N 
Sbjct  315   LAALVLSDNALTGNIPSNFCLSSSSNLRQLLLARNKLSGQFPLAVLSCSSLQQLDLSENH  374

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
               G +P  L +L  LTDLVLNNN   GT+ P + NL++L+ L LF N + G +P EIG L
Sbjct  375   FVGELPTSLDKLGNLTDLVLNNNNFTGTLLPEIGNLSSLENLFLFDNMITGGIPVEIGKL  434

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLREND  1677
               L+ I+LY+N  SG IP E+ NCSSL  IDF+GN F+G IP T+G+LK+L  L LR+ND
Sbjct  435   QRLKAIYLYDNQMSGPIPSELTNCSSLTAIDFFGNHFSGSIPATIGKLKNLVVLQLRQND  494

Query  1678  LSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNL  1857
             LSG IP SLG C  L  L LADN LSG +P TF ++  L+ + LYNNS +G LP  L  L
Sbjct  495   LSGPIPPSLGYCRSLQLLALADNKLSGTLPPTFRFISQLSTITLYNNSFQGPLPQSLFLL  554

Query  1858  GNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRF  2037
              NL +IN SHN FSG+I P+  S    + D+TNN+F   IPS L    +L RLRL  N+ 
Sbjct  555   KNLKKINFSHNRFSGTIFPLSGSSYLTAMDLTNNSFSGSIPSRLSMCRNLTRLRLAHNQL  614

Query  2038  TGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlp  2217
             TG +P   G + +L+ LDLS N  +  IPPQLS C++L H  +NNN  +G IP WLG L 
Sbjct  615   TGTLPSEFGQLTQLNFLDLSFNNFTDEIPPQLSSCKELEHFLVNNNQFTGAIPPWLGSLQ  674

Query  2218  llgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQL  2397
              LGEL  S N F G++P  L NCSKLL LSL +NSL+ T+P EIGNL SLNVLNL  N  
Sbjct  675   ELGELDFSCNNFHGTVPANLGNCSKLLKLSLHDNSLSSTIPEEIGNLSSLNVLNLQKNNF  734

Query  2398  CGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTL  2577
              GSIPSTI    KLYELRLS N  SG IP E+G+L +LQ +LD S N  +GEIP S+G L
Sbjct  735   TGSIPSTIQNCKKLYELRLSENLLSGLIPYELGELTELQVILDLSRNLFSGEIPSSLGNL  794

Query  2578  SKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSH-L  2754
              KLE L+LS N L G++P  + +++SL  LNLS N LEG++   ++ +P  SF+GN   L
Sbjct  795   MKLEELNLSFNQLQGKVPTSLGKLTSLHMLNLSNNHLEGQIPSTFSGFPRSSFLGNDQKL  854

Query  2755  CGSPLGSC---------RDKGSRNKGSMVVVISALSATVAIILLLM  2865
             CG PL  C         R   +   G  V ++   SA   II+ +M
Sbjct  855   CGPPLAPCGESEVQRVKRLSRTAATGITVAIVLTSSAICLIIIYIM  900


 Score =   325 bits (834),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 228/620 (37%), Positives = 337/620 (54%), Gaps = 31/620 (5%)
 Frame = +1

Query  922   HLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRL  1101
             H+  LNL+ + L+G IP +L  ++S+  L+L  N   GS+P  L +L NL++L L  N L
Sbjct  75    HIISLNLSGSGLSGPIPHELWNLTSIQTLDLSSNSFIGSLPPELGQLQNLEALLLYSNFL  134

Query  1102  AGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQC  1281
             +GE+P E G++  ++ L +  N +SG IP S+  N T L++L L+   L+G IP E+ + 
Sbjct  135   SGEIPEEIGALKNMRVLRVGDNFISGEIPPSI-GNLTELRVLALAYCQLNGSIPVEIGKL  193

Query  1282  RVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNN  1461
             + LQ LDL NN+L+G IPEE+    +L +   +NN LEG I P + +L +LQ L+L +N+
Sbjct  194   KHLQSLDLQNNSLSGLIPEEIRGCKELVNFAASNNKLEGDI-PLLGSLESLQILNLANNS  252

Query  1462  LHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRL  1641
             L G +P  +  L +L+ + L  N  SG IP E+     L+ +DF  N  +G I +   +L
Sbjct  253   LSGSIPTALSQLRNLKYLNLLGNRLSGAIPSELNQLVQLEMLDFSMNNLSGSIQLLSTQL  312

Query  1642  KHLFFLHLRENDLSGEIPAS--LGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYN  1815
             K+L  L L +N L+G IP++  L +   L  L LA N LSG  P       +L +L L  
Sbjct  313   KNLAALVLSDNALTGNIPSNFCLSSSSNLRQLLLARNKLSGQFPLAVLSCSSLQQLDLSE  372

Query  1816  NSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP----ICTSHSFLSFD------------  1947
             N   G+LP  L  LGNLT + L++NNF+G++ P    + +  +   FD            
Sbjct  373   NHFVGELPTSLDKLGNLTDLVLNNNNFTGTLLPEIGNLSSLENLFLFDNMITGGIPVEIG  432

Query  1948  ---------VTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSG  2100
                      + +N     IPS L N  SL  +    N F+G IP T+G ++ L +L L  
Sbjct  433   KLQRLKAIYLYDNQMSGPIPSELTNCSSLTAIDFFGNHFSGSIPATIGKLKNLVVLQLRQ  492

Query  2101  NKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELF  2280
             N LSG IPP L  CR L  L L +N LSG +P     +  L  + L +N F G LP  LF
Sbjct  493   NDLSGPIPPSLGYCRSLQLLALADNKLSGTLPPTFRFISQLSTITLYNNSFQGPLPQSLF  552

Query  2281  NCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSR  2460
                 L  ++  +N  +GT+ P  G+   L  ++L +N   GSIPS +     L  LRL+ 
Sbjct  553   LLKNLKKINFSHNRFSGTIFPLSGS-SYLTAMDLTNNSFSGSIPSRLSMCRNLTRLRLAH  611

Query  2461  NRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQV  2640
             N+ +G +P E GQL  L + LD S+NN T EIPP + +  +LE   +++N  TG IPP +
Sbjct  612   NQLTGTLPSEFGQLTQL-NFLDLSFNNFTDEIPPQLSSCKELEHFLVNNNQFTGAIPPWL  670

Query  2641  AEMSSLGRLNLSCNELEGEL  2700
               +  LG L+ SCN   G +
Sbjct  671   GSLQELGELDFSCNNFHGTV  690


 Score =   249 bits (637),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 188/507 (37%), Positives = 261/507 (51%), Gaps = 30/507 (6%)
 Frame = +1

Query  1198  CSN-ATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLV  1374
             CSN   ++  L LS +GLSG IP EL     +Q LDLS+N+  GS+P EL +L  L  L+
Sbjct  69    CSNDQMHIISLNLSGSGLSGPIPHELWNLTSIQTLDLSSNSFIGSLPPELGQLQNLEALL  128

Query  1375  LNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPV  1554
             L +N L G I   +  L N++ L +  N + GE+P  IG L +L+++ L     +G IPV
Sbjct  129   LYSNFLSGEIPEEIGALKNMRVLRVGDNFISGEIPPSIGNLTELRVLALAYCQLNGSIPV  188

Query  1555  EIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLD  1734
             EIG    LQ +D   N  +G IP  +   K L       N L G+IP  LG+   L  L+
Sbjct  189   EIGKLKHLQSLDLQNNSLSGLIPEEIRGCKELVNFAASNNKLEGDIPL-LGSLESLQILN  247

Query  1735  LADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP  1914
             LA+N LSG+IP     LR L  L L  N L G +P +L  L  L  ++ S NN SGSI  
Sbjct  248   LANNSLSGSIPTALSQLRNLKYLNLLGNRLSGAIPSELNQLVQLEMLDFSMNNLSGSIQL  307

Query  1915  ICTS-HSFLSFDVTNNAFDQEIPS--FLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSL  2085
             + T   +  +  +++NA    IPS   L +S +L +L L  N+ +G+ P+ +     L  
Sbjct  308   LSTQLKNLAALVLSDNALTGNIPSNFCLSSSSNLRQLLLARNKLSGQFPLAVLSCSSLQQ  367

Query  2086  LDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSL  2265
             LDLS N   G +P  L     LT L LNN                        N F+G+L
Sbjct  368   LDLSENHFVGELPTSLDKLGNLTDLVLNN------------------------NNFTGTL  403

Query  2266  PPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYE  2445
              PE+ N S L  L L +N + G +P EIG L+ L  + L DNQ+ G IPS +     L  
Sbjct  404   LPEIGNLSSLENLFLFDNMITGGIPVEIGKLQRLKAIYLYDNQMSGPIPSELTNCSSLTA  463

Query  2446  LRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGE  2625
             +    N FSG IP  +G+LK+L  VL    N+L+G IPPS+G    L+ L L+ N L+G 
Sbjct  464   IDFFGNHFSGSIPATIGKLKNL-VVLQLRQNDLSGPIPPSLGYCRSLQLLALADNKLSGT  522

Query  2626  IPPQVAEMSSLGRLNLSCNELEGELDK  2706
             +PP    +S L  + L  N  +G L +
Sbjct  523   LPPTFRFISQLSTITLYNNSFQGPLPQ  549



>ref|XP_004960812.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Setaria italica]
Length=972

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/870 (49%), Positives = 557/870 (64%), Gaps = 15/870 (2%)
 Frame = +1

Query  286   CQNTSSTL-RVLLEVKRSFVLQ---LQGWSEKNPNYCSWQGVSC--DGslkvvslnlsds  447
             C  T +T    LL++K S       L GWS +  + CSW G++C       V  LNLS  
Sbjct  28    CSATPATAPATLLQLKSSLTDPEGVLSGWSPE-ADVCSWHGITCLPGEVGIVTGLNLSGY  86

Query  448   slggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGL  627
              L G I P++G L  +  +DLSSN L+GPIP  L  L +L +LLLFSN L G +P +LGL
Sbjct  87    GLSGVIPPAIGGLISVESIDLSSNSLTGPIPLELGLLENLRTLLLFSNSLTGTVPPELGL  146

Query  628   LTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqn  807
             L NL+ LRIGDN L G+IP   GN   L TLGLA C L+G IP +LG+L++LQ L L  N
Sbjct  147   LKNLEVLRIGDNRLHGEIPPHLGNCSQLETLGLAYCQLNGTIPAELGKLSRLQQLALDNN  206

Query  808   llEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGE  987
              L G +P  +   +SL   S + N L G+IP  +G    L  LNLANN  +G IP ++G 
Sbjct  207   TLTGGIPEHLTGCASLRVLSVSDNMLQGNIPSFIGSFSDLQSLNLANNQFSGGIPSEIGN  266

Query  988   MSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSN  1167
             +SSL YLNLLGN L G+IP+ + +L+ LQ LDLS N ++G+L      +  L++L L+ N
Sbjct  267   LSSLTYLNLLGNSLTGAIPEEVNRLSQLQVLDLSMNNISGKLSISGAQLKSLKYLVLSGN  326

Query  1168  NLSGTIPKSLCS-NATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEEL  1344
              L GTIP+ LC+ ++++L+ L L+   L G I   L  C  L+ +D+SNN+  G+IP  +
Sbjct  327   LLDGTIPEELCTGDSSSLENLFLAGNNLGGGIE-ALLNCSALRSIDVSNNSFTGAIPPSI  385

Query  1345  YELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLY  1524
               L+ L +L L+NN+  G + P + NL+NL+ LSLFHN L GE+P EIG L  L+++FLY
Sbjct  386   DRLSGLINLALHNNSFIGALPPQIGNLSNLEILSLFHNGLTGEIPPEIGRLQKLKLLFLY  445

Query  1525  ENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASL  1704
             EN  SG IP E+ NC+SL+ +DF+GN F G IP  +G LK+L  L LR+NDLSG IPASL
Sbjct  446   ENQMSGTIPDELTNCTSLEEVDFFGNGFHGPIPERIGNLKNLAVLQLRQNDLSGPIPASL  505

Query  1705  GNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLS  1884
               C  L  L LADN LSGA+P TFG L  L+ + LYNNSLEG LP+ L  L NLT IN S
Sbjct  506   SECRNLQALALADNRLSGALPETFGQLAELSVVTLYNNSLEGPLPESLFQLKNLTVINFS  565

Query  1885  HNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLG  2064
             HN FSG + P+  S S     +T+N+F   IP+ +  S ++ RL+LG NR  G IP  LG
Sbjct  566   HNRFSGGLVPLLGSSSLAVLALTSNSFSGVIPAAVARSRNMVRLQLGGNRLAGAIPAELG  625

Query  2065  LIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSS  2244
              +  LS+LDLS N LSG IP +LS C +LTHL L+ N L+G +P WLG L  LGEL LSS
Sbjct  626   NLTRLSMLDLSFNNLSGDIPAELSNCAQLTHLKLDGNSLTGTVPSWLGGLRSLGELDLSS  685

Query  2245  NQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIG  2424
             N  +G +P +L NCS LL LSL +N L+G++PPEIG L SLNVLNL+ N L G+IP  + 
Sbjct  686   NALAGGIPADLGNCSGLLKLSLSDNHLSGSIPPEIGRLTSLNVLNLNKNGLAGAIPPALR  745

Query  2425  GLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLS  2604
                KLYELRLS N   G IP E+G+L +LQ +LD S N L+GEIP S+G L KLE L+LS
Sbjct  746   QCNKLYELRLSENALEGPIPPELGELSELQVILDLSRNRLSGEIPASLGDLVKLERLNLS  805

Query  2605  HNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRD  2784
              N L G+IPP + +++SL  LN+S N L G +    + +P  SF GN  LCG+PL  C  
Sbjct  806   SNRLEGQIPPSLLQLTSLHLLNMSDNLLSGAVPAGLSSFPAASFAGN-ELCGAPLPRCVP  864

Query  2785  KGSRN-KGSMVVVISA----LSATVAIILL  2859
               +R   G+ V VI A    +SA V +++L
Sbjct  865   SSTRRLPGTEVAVIVAGIAVISAAVCVVML  894



>ref|XP_010248554.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X3 [Nelumbo nucifera]
Length=917

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/823 (47%), Positives = 501/823 (61%), Gaps = 56/823 (7%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             GPIPP L  L +L+ L L+SN L G I ++LGLL  LQ LR+G+N LTG+I    GNL +
Sbjct  107   GPIPPELGKLQNLKELYLYSNFLSGKISAELGLLKKLQVLRVGNNMLTGEITPHLGNLTD  166

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             L  LGLA   L+G I                        P EI N+ SL   +   NS +
Sbjct  167   LRVLGLAFSLLNGSI------------------------PVEIGNLKSLKILNLQQNSFS  202

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             G IP E+     L + + A N L GEIP  +G++ SL  L+L  N L GSIP  L     
Sbjct  203   GLIPGEISSCLELQVFSAAGNMLEGEIPASIGKLESLEILHLANNTLSGSIPIEL-----  257

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
                 DLS N+L+G++      +  L+ L L+ N L+G IP  LC + +NLQ + LS   L
Sbjct  258   ----DLSNNKLSGKINILNSRLRNLESLVLSDNFLTGGIPSDLCVSNSNLQKVFLSLNNL  313

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
             SG  P EL  C  LQQLDLSNN   G +P  L  L  LTDLVLNNN+  G +   + N++
Sbjct  314   SGTFPSELLNCSSLQQLDLSNNGFYGQLPSGLDNLRNLTDLVLNNNSFSGKLPSEIGNMS  373

Query  1429  NLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQF  1608
             +L+ L LFHN+L G +P EIG L  L +++LYEN  SG IP E+ NCSSL  ID +GN F
Sbjct  374   SLKGLYLFHNSLTGRIPVEIGKLQRLTVLYLYENQLSGSIPRELTNCSSLMEIDLFGNHF  433

Query  1609  TGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLR  1788
             TG IP T+G+LKHL FL LR+NDLSG IP  LG C +L  L LADN LSG++P TF +L 
Sbjct  434   TGSIPATIGKLKHLVFLQLRQNDLSGPIPPCLGYCKKLQKLALADNRLSGSLPPTFRFLT  493

Query  1789  ALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFD  1968
              L+ + LYNNS EG LP+ L  L NL+ IN SHN FSGSI P+  S + +  D+TNN+F 
Sbjct  494   ELSVVTLYNNSFEGPLPESLFLLKNLSIINFSHNRFSGSIFPLSGSSTLIVLDLTNNSFS  553

Query  1969  QEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRK  2148
               IP+ L  S +L RLRLG N  TG IP   G + EL+ LDLS N L+G +  +LS C +
Sbjct  554   GGIPTRLAESKNLTRLRLGHNHLTGTIPSEFGQLIELNFLDLSFNNLTGEVIQELSNCNQ  613

Query  2149  LTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsln  2328
             L HL LN+N L+G +P WLGR   LGEL LSSN F G++P EL +CSKLL LSL +N+L+
Sbjct  614   LEHLLLNDNRLTGTVPSWLGRFQGLGELDLSSNDFHGTVPAELGSCSKLLKLSLHSNNLS  673

Query  2329  GTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKD  2508
             G +PPEIGNL  LNVL+L  N L G IPST+    KLYELRLS N  +G IP E+G+L +
Sbjct  674   GWIPPEIGNLTCLNVLDLQRNNLTGPIPSTVQQCKKLYELRLSENFLTGMIPSELGKLTE  733

Query  2509  LQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNEL  2688
             LQ +LD S N L+GEIP S+G L KLE L+LS N L GE+PP +  ++SL  LNLS N L
Sbjct  734   LQVILDLSRNQLSGEIPSSLGKLMKLERLNLSFNQLQGEVPPSLGRLTSLQMLNLSNNLL  793

Query  2689  EGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDK-GSRNK-------GSMVVVISALSATV  2844
             +G++   ++ +P+ SFVGN  LCG+PL SC +  GS  K        +++V I   S  +
Sbjct  794   QGQVPSTFSGFPLSSFVGNKDLCGAPLVSCSESVGSERKWLSDNEVAAIIVAIVFTSTVI  853

Query  2845  AIILLLMGAAFFF---------------KHNREAYRRRRGKEN  2928
              ++L+ M    +F               + NRE  +   G++N
Sbjct  854   CLVLIYMMLRIWFDWRKVSVSSSDSGGLESNREEMQWFYGEDN  896


 Score =   255 bits (651),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 204/525 (39%), Positives = 284/525 (54%), Gaps = 20/525 (4%)
 Frame = +1

Query  1198  CS-NATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLV  1374
             CS + T++  L LS +GLSG I PE S    LQ LDLS+N L G IP EL +L  L +L 
Sbjct  64    CSEDLTHVVGLNLSGSGLSGIISPEFSCLVSLQILDLSSNYLTGPIPPELGKLQNLKELY  123

Query  1375  LNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPV  1554
             L +N L G IS  +  L  LQ L + +N L GE+   +G L DL+++ L  +  +G IPV
Sbjct  124   LYSNFLSGKISAELGLLKKLQVLRVGNNMLTGEITPHLGNLTDLRVLGLAFSLLNGSIPV  183

Query  1555  EIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLD  1734
             EIGN  SL+ ++   N F+G IP  +     L       N L GEIPAS+G    L+ L 
Sbjct  184   EIGNLKSLKILNLQQNSFSGLIPGEISSCLELQVFSAAGNMLEGEIPASIGKLESLEILH  243

Query  1735  LADNHLSGAIPATF---------------GYLRALTRLMLYNNSLEGDLPDDL-RNLGNL  1866
             LA+N LSG+IP                    LR L  L+L +N L G +P DL  +  NL
Sbjct  244   LANNTLSGSIPIELDLSNNKLSGKINILNSRLRNLESLVLSDNFLTGGIPSDLCVSNSNL  303

Query  1867  TRINLSHNNFSGSI-APICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTG  2043
              ++ LS NN SG+  + +    S    D++NN F  ++PS L N  +L  L L +N F+G
Sbjct  304   QKVFLSLNNLSGTFPSELLNCSSLQQLDLSNNGFYGQLPSGLDNLRNLTDLVLNNNSFSG  363

Query  2044  KIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpll  2223
             K+P  +G +  L  L L  N L+G IP ++   ++LT L L  N LSG IP  L     L
Sbjct  364   KLPSEIGNMSSLKGLYLFHNSLTGRIPVEIGKLQRLTVLYLYENQLSGSIPRELTNCSSL  423

Query  2224  gelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCG  2403
              E+ L  N F+GS+P  +     L+ L L  N L+G +PP +G  K L  L L DN+L G
Sbjct  424   MEIDLFGNHFTGSIPATIGKLKHLVFLQLRQNDLSGPIPPCLGYCKKLQKLALADNRLSG  483

Query  2404  SIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSK  2583
             S+P T   L +L  + L  N F G +P  +  LK+L S+++FS+N  +G I P  G+ S 
Sbjct  484   SLPPTFRFLTELSVVTLYNNSFEGPLPESLFLLKNL-SIINFSHNRFSGSIFPLSGS-ST  541

Query  2584  LESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAH  2718
             L  LDL++N  +G IP ++AE  +L RL L  N L G +   +  
Sbjct  542   LIVLDLTNNSFSGGIPTRLAESKNLTRLRLGHNHLTGTIPSEFGQ  586



>ref|XP_009404764.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Musa acuminata subsp. malaccensis]
Length=976

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/900 (49%), Positives = 568/900 (63%), Gaps = 18/900 (2%)
 Frame = +1

Query  274   GYVRCQNT-SSTLRVLLEVKRSFVL---QLQGWSEKNPNYCSWQGVSC-DGslkvvslnl  438
               + C  T +ST   LL +K   +     +  WS   P+ CSW GV+C D    VV+ NL
Sbjct  22    AMIACGGTPTSTAARLLAIKSDLIDPGGAMASWSPGLPDTCSWNGVTCSDDRNHVVAFNL  81

Query  439   sdsslggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQ  618
             S   L GS+S     L  L  LDLSSN L+GPIPP +  L  L  LLLFSN L G IP +
Sbjct  82    SGYGLSGSVSSKFAGLAFLETLDLSSNSLAGPIPPEIGMLKRLRELLLFSNSLSGFIPPE  141

Query  619   LGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnl  798
             +GLLT+L+ LR+GDN L+G IP   GN   L  LGLA C L+G  P Q+G L +L+ LNL
Sbjct  142   IGLLTDLKVLRLGDNMLSGTIPPHLGNCTGLEVLGLAQCQLNGSTPAQIGHLNRLKTLNL  201

Query  799   qqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQ  978
             QQN L G  P E+   S+L   S A N L G IP  +G L  L +LNLANN  +G IP  
Sbjct  202   QQNRLTGRTPGELGGCSALQVLSMADNMLQGEIPSSIGRLAFLQVLNLANNQFSGSIPTA  261

Query  979   LGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLAL  1158
             LG +SSL YLNLLGN L G+IP  L +LT L+ LDLS N L+  +      +  L++L L
Sbjct  262   LGGLSSLSYLNLLGNALNGTIPPQLNRLTLLRILDLSKNNLSDAISISTRQLKNLRYLVL  321

Query  1159  TSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPE  1338
             ++N L G+I   LC  +++LQ L L+   LSG I  EL  C  L+ LDLSNN+L+G IP 
Sbjct  322   SNNLLQGSISGDLCDESSSLQNLYLAGNHLSGTIQ-ELMDCISLRSLDLSNNSLSGGIPS  380

Query  1339  ELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIF  1518
             ++  LT L DLVL+NN+L G + P + NL++LQ LSLFHN L G +P EIG L  LQ++F
Sbjct  381   DIDRLTNLVDLVLHNNSLVGGLPPRLGNLSHLQMLSLFHNGLTGSIPAEIGKLQRLQLLF  440

Query  1519  LYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPA  1698
             LYEN  +G IP E+ NCSSL+ +DF+GN F+G IP T+G+LK+L  L LR+NDLSG IP 
Sbjct  441   LYENQMTGIIPHELTNCSSLEELDFFGNSFSGPIPETIGKLKNLVVLQLRQNDLSGPIPP  500

Query  1699  SLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDL-RNLGNLTRI  1875
             SLG+C++L  L LADN LSG +P TF +L  L  + LYNNSLEG +PD L  +L +L  I
Sbjct  501   SLGDCNKLQALALADNRLSGTLPPTFRFLTELNLITLYNNSLEGPIPDSLFSSLKHLAII  560

Query  1876  NLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPM  2055
             NLSHN F+GSI+P+  S++ +  D+TNNAF   IP  LG S +L RLRLG N   G IP 
Sbjct  561   NLSHNRFTGSISPLLGSNALVKLDLTNNAFSGVIPPTLGESTNLARLRLGHNLLQGGIPS  620

Query  2056  TLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelk  2235
              L  +R L  LD+S N L+G IP  LS C +LTHL L  N ++G I  WLG L  LGEL 
Sbjct  621   ELSRLRWLDFLDMSSNNLTGEIPSDLSNCTRLTHLLLGKNRVTGTIRSWLGNLHSLGELD  680

Query  2236  lSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPS  2415
             LS N+ SG +P E+ NCS LL LSL++N L+G +PPE+G L SLNVLNL  N L G+IPS
Sbjct  681   LSWNELSGQIPAEIGNCSGLLKLSLQDNHLSGMIPPELGRLTSLNVLNLQRNNLTGTIPS  740

Query  2416  TI-GGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLES  2592
              +     KLYELRLS N  +G IP E+GQL +LQ +LD S N+L+G+IP S+G L KLE 
Sbjct  741   AVLIHCKKLYELRLSENSLTGSIPSEIGQLIELQVMLDLSRNHLSGDIPSSLGNLIKLER  800

Query  2593  LDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLG  2772
             L+LS N L G IP  + +++SL RLNLS N L G +    + +PV SF   + LCG+PL 
Sbjct  801   LNLSFNHLDGRIPASLEQLTSLHRLNLSNNPLYGRIPAGLSSFPVSSFTA-TKLCGAPLT  859

Query  2773  SCRDKGSRNK---------GSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKE  2925
             +C  + S +            ++V I ++SA V ++LL +    + K    +     G+E
Sbjct  860   ACITRSSSSDMSRLSNAAVAGIIVAIVSISAVVCVVLLCIIIRLWSKWREVSVSNSDGEE  919



>gb|EYU22147.1| hypothetical protein MIMGU_mgv1a000819mg [Erythranthe guttata]
Length=973

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/870 (48%), Positives = 561/870 (64%), Gaps = 33/870 (4%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQ---LQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdsslggsi  465
             SS    L+ +K  F+     L  W + + + C+W G++C D    +++LNLS+S L G++
Sbjct  29    SSDSYFLMRIKSEFIDPFGILDSWLQ-DSSICTWNGITCTDDRHYILTLNLSNSGLSGTL  87

Query  466   spslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQA  645
             SP    L  L  +DLS N L+GPIPP  +NL +L+ LLLFSN L G IPSQ+GLL NLQ 
Sbjct  88    SPDFSNLEFLETIDLSQNQLTGPIPPDFANLRNLKKLLLFSNSLTGAIPSQIGLLKNLQV  147

Query  646   LRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPL  825
             LRIGDN LTG++  S GNL  L  LG++ C  +G IP ++G L +L+  ++Q N++ G L
Sbjct  148   LRIGDNFLTGEVVKSIGNLTELQVLGISYCQFNGSIPKEIGELKKLRFFDMQSNMIGGVL  207

Query  826   PPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVY  1005
             P EI ++  L  F+A+ N + G IP+ +GGL+ L ILNLANNT TG IP +L  +S+L Y
Sbjct  208   PREIGDLKELQMFAASNNEIEGDIPRSVGGLESLQILNLANNTFTGSIPKELRYLSNLKY  267

Query  1006  LNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTI  1185
             LNL GN+L   IP  +  L  L++LDLS N LAG +     S+  L+ LAL+ N L+G I
Sbjct  268   LNLQGNELSSEIPSEINDLIRLETLDLSRNNLAGPVNILTTSLKNLEVLALSENLLTGGI  327

Query  1186  PKSLC--SNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQ  1359
             P++ C  SN +NL+ L LS+  LSG+ P E+  C  LQQLDLS N + G +P E+  L  
Sbjct  328   PENFCMRSNTSNLRRLFLSDNKLSGDFPVEILNCTFLQQLDLSGNKIGGFLPPEIDRLQS  387

Query  1360  LTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFS  1539
             LTDL+LNNN+  G + P + NLT+L++L LF N + G +P EIG L  L+I++LY+N  S
Sbjct  388   LTDLLLNNNSFGGNLPPQIGNLTDLESLFLFGNMIEGGIPLEIGKLQRLKILYLYDNQMS  447

Query  1540  GEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQ  1719
              EIP E+ NC+SL  IDF+GN F+G IP T+G+LK+L  L LR+N+L+G IP+SLG C +
Sbjct  448   KEIPWELTNCTSLSEIDFFGNHFSGFIPPTIGKLKNLEILQLRQNELTGPIPSSLGYCRK  507

Query  1720  LDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFS  1899
             L  L LADN L G +P T  +L  L  + LYNNSL G LP  L NL NL+ +N SHN FS
Sbjct  508   LQRLVLADNKLEGPLPPTLSFLNELFLVTLYNNSLSGPLPQSLFNLKNLSIVNFSHNRFS  567

Query  1900  GSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIREL  2079
             GS+ P+  S S +  D+TNN+F + IP  + +S +L RLRL  N  TG +P  L  + EL
Sbjct  568   GSVHPLTGSDSLIVLDLTNNSFSENIPYGIFSSRNLTRLRLARNFLTGVVPSELSQLSEL  627

Query  2080  SLLDLSGNKLSGFIPP-QLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFS  2256
               LDLS N L+G +   +LS   KLTHL L+NN  SG IP  LGRL  LGEL LS N+F+
Sbjct  628   RFLDLSFNNLTGELEKIELSGLTKLTHLMLSNNRFSGRIPTSLGRLQELGELDLSFNEFN  687

Query  2257  GSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGK  2436
             GS+P EL NCS++L LSL++N L+G++PPEIGNL  LN                     K
Sbjct  688   GSVPSELGNCSRMLKLSLKSNRLSGSIPPEIGNLGFLN------------------NCKK  729

Query  2437  LYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDL  2616
             LYELRLS N  +G+IP E+G L DLQ +LD S+N L+GEIPPSIG L KLE L+LSHN L
Sbjct  730   LYELRLSENSLTGKIPPEIGALGDLQVILDLSFNRLSGEIPPSIGDLMKLERLNLSHNQL  789

Query  2617  TGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFV--GNSHLCGSPLGSCRD-K  2787
              G+IP  + E+SSL R+N+S N L+G++   ++ +P  SF   G   LCG+PL SC +  
Sbjct  790   AGKIPVSLGELSSLHRINISGNLLQGQIPTSFSGFPASSFSENGGGGLCGAPLESCSEYS  849

Query  2788  GSR----NKGSMVVVISALSATVAIILLLM  2865
             G R    ++  +  VI A+  T  +I L M
Sbjct  850   GGRKVWMSESEVAGVIVAIVFTSTLICLFM  879



>emb|CDY49822.1| BnaCnng18190D [Brassica napus]
Length=1010

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/875 (44%), Positives = 501/875 (57%), Gaps = 71/875 (8%)
 Frame = +1

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGN---RLAGELPGEFGSMGQLQFLALTSN  1167
             ++ LNL G  L GSI  S+ +  NL  LDLS N   RL G +P + G + Q+Q+L L  N
Sbjct  72    VIGLNLSGLNLTGSISPSIGRFDNLIDLDLSSNTACRLTGPIPSQLGRLVQMQYLYLRHN  131

Query  1168  NLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELY  1347
              L G IP  L  N TNL         L+G +P ELS+   L+ L+L+NN  +G IP+  +
Sbjct  132   YLEGPIPPEL-GNCTNLVTFSAEVNSLNGSLPAELSRLGNLESLNLANNCFSGEIPK-FW  189

Query  1348  ELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLF-HNNLHGEVPREIGMLGDLQIIFLY  1524
              + QL  LVL  N L G++  S+ +      L L     L GE+P EI     LQ + L 
Sbjct  190   NMNQLEYLVLEYNPLSGSLPKSLCSNNTNLKLLLLSETQLSGEIPTEISKCRSLQELNLS  249

Query  1525  ENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASL  1704
              N  +G +   I N ++LQ      N   GK+P  +G L  L  L L +N  SGEIP  +
Sbjct  250   NNTLTGTLSPSISNLTNLQEFGPSHNALEGKLPKEIGFLSKLERLLLHDNRFSGEIPVEI  309

Query  1705  GNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLS  1884
             GNC  L  +D   NH SG IP+  G L+ LT L L  N   G++P  L N   L  ++L+
Sbjct  310   GNCTSLQQIDTYGNHFSGEIPSWIGRLKDLTWLHLRENEFSGNIPATLGNCHQLRLLDLA  369

Query  1885  HNNFSGSIAPICTSHSFLS----FDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIP  2052
              N+ +GSI    +S  FL+      + NN+   ++PS L N  +L R+   +N   G I 
Sbjct  370   DNHLTGSIP---SSFGFLTALDQLHLYNNSLQGDLPSSLINLKNLTRINFSNNTLDGSIS  426

Query  2053  MTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgel  2232
                G    LS  DL+ N+  G IP  L     L  L L  N  +G IP  LG++  L  L
Sbjct  427   PLCGSSSYLSF-DLTDNRFQGDIPLDLGKSPSLERLRLGKNQFTGRIPWTLGKINALSLL  485

Query  2233  klSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIP  2412
              +SSN  +G++P EL  C  L ++ L +N ++G +PP +G L  L  L L  NQL GS+P
Sbjct  486   DISSNSLTGTIPVELGLCKNLTLIDLSDNFISGVIPPWLGKLPFLGELKLSSNQLTGSLP  545

Query  2413  STIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLES  2592
             S I  L KL  L L  N  +G IP+E+G L+ L +VL+   N ++G++P +IG LSKL  
Sbjct  546   SEIFNLTKLLVLSLDGNSLNGSIPQEIGNLEAL-NVLNLGKNQISGQLPSAIGKLSKLYE  604

Query  2593  LDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLG  2772
             L LS N LTG+IP ++ ++  L                       ++FVGN+ LCGSPL 
Sbjct  605   LRLSRNILTGDIPVEIGQLQDLQ----------------------NAFVGNADLCGSPLS  642

Query  2773  SCRDKGSRNKG---SMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsss  2943
              C+  GS+ +G     VV+ISALS+  AI L ++    F K                   
Sbjct  643   PCKRAGSKQQGLSAKTVVIISALSSVAAIALTVLVVVLFCK-------------------  683

Query  2944  ssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAI  3123
                    + PLF N A   DI+W+DIMEAT+ L DEF+IGSGG   VYKA+L NGET+A+
Sbjct  684   -------QTPLFRNGAANTDIKWEDIMEATHGLDDEFMIGSGGSGKVYKADLKNGETIAV  736

Query  3124  KRIPRKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDW  3303
             K+I  KDDL  +KSF  E+KTL  IRHRHLV+LMGYC++K EG N+LIYEYM NGSVWDW
Sbjct  737   KKILWKDDLMSNKSFNIEVKTLGTIRHRHLVKLMGYCTSKAEGLNLLIYEYMANGSVWDW  796

Query  3304  LHNQPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAH  3483
             LH      K K+ LDWE RLKIA+GLAQGVEYLH DC P I+HRDIK+SNVLLDSNMEAH
Sbjct  797   LH-----EKKKQVLDWETRLKIALGLAQGVEYLHFDCAPPIVHRDIKTSNVLLDSNMEAH  851

Query  3484  LGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             LGDFGLAK LT+  +  NTES++ FAGSYGY APE
Sbjct  852   LGDFGLAKILTEECNDTNTESHSLFAGSYGYTAPE  886


 Score =   543 bits (1399),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 325/572 (57%), Positives = 414/572 (72%), Gaps = 28/572 (5%)
 Frame = +1

Query  817   GPLPPEIANISSLTAFSAALNS---LNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGE  987
             G + P I    +L     + N+   L G IP +LG L  +  L L +N L G IP +LG 
Sbjct  84    GSISPSIGRFDNLIDLDLSSNTACRLTGPIPSQLGRLVQMQYLYLRHNYLEGPIPPELGN  143

Query  988   MSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSN  1167
              ++LV  +   N L GS+P  L++L NL+SL+L+ N  +GE+P +F +M QL++L L  N
Sbjct  144   CTNLVTFSAEVNSLNGSLPAELSRLGNLESLNLANNCFSGEIP-KFWNMNQLEYLVLEYN  202

Query  1168  NLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELY  1347
              LSG++PKSLCSN TNL+LL+LSET LSGEIP E+S+CR LQ                  
Sbjct  203   PLSGSLPKSLCSNNTNLKLLLLSETQLSGEIPTEISKCRSLQ------------------  244

Query  1348  ELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYE  1527
                   +L L+NNTL GT+SPS++NLTNLQ     HN L G++P+EIG L  L+ + L++
Sbjct  245   ------ELNLSNNTLTGTLSPSISNLTNLQEFGPSHNALEGKLPKEIGFLSKLERLLLHD  298

Query  1528  NHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLG  1707
             N FSGEIPVEIGNC+SLQ ID YGN F+G+IP  +GRLK L +LHLREN+ SG IPA+LG
Sbjct  299   NRFSGEIPVEIGNCTSLQQIDTYGNHFSGEIPSWIGRLKDLTWLHLRENEFSGNIPATLG  358

Query  1708  NCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSH  1887
             NCHQL  LDLADNHL+G+IP++FG+L AL +L LYNNSL+GDLP  L NL NLTRIN S+
Sbjct  359   NCHQLRLLDLADNHLTGSIPSSFGFLTALDQLHLYNNSLQGDLPSSLINLKNLTRINFSN  418

Query  1888  NNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGL  2067
             N   GSI+P+C S S+LSFD+T+N F  +IP  LG SPSL+RLRLG N+FTG+IP TLG 
Sbjct  419   NTLDGSISPLCGSSSYLSFDLTDNRFQGDIPLDLGKSPSLERLRLGKNQFTGRIPWTLGK  478

Query  2068  IRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSN  2247
             I  LSLLD+S N L+G IP +L LC+ LT +DL++N +SG IP WLG+LP LGELKLSSN
Sbjct  479   INALSLLDISSNSLTGTIPVELGLCKNLTLIDLSDNFISGVIPPWLGKLPFLGELKLSSN  538

Query  2248  QFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGG  2427
             Q +GSLP E+FN +KLLVLSL+ NSLNG++P EIGNL++LNVLNL  NQ+ G +PS IG 
Sbjct  539   QLTGSLPSEIFNLTKLLVLSLDGNSLNGSIPQEIGNLEALNVLNLGKNQISGQLPSAIGK  598

Query  2428  LGKLYELRLSRNRFSGEIPREVGQLKDLQSVL  2523
             L KLYELRLSRN  +G+IP E+GQL+DLQ+  
Sbjct  599   LSKLYELRLSRNILTGDIPVEIGQLQDLQNAF  630


 Score =   256 bits (653),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 204/555 (37%), Positives = 281/555 (51%), Gaps = 51/555 (9%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
              GPIPSQLG L  +Q L +  N L G IP   GN  NLVT       L+G +P +L RL 
Sbjct  110   TGPIPSQLGRLVQMQYLYLRHNYLEGPIPPELGNCTNLVTFSAEVNSLNGSLPAELSRLG  169

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNT-  954
              L++LNL  N   G + P+  N++ L       N L+GS+PK L        L L + T 
Sbjct  170   NLESLNLANNCFSGEI-PKFWNMNQLEYLVLEYNPLSGSLPKSLCSNNTNLKLLLLSETQ  228

Query  955   LTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSM  1134
             L+GEIP ++ +  SL  LNL  N L G++  S++ LTNLQ    S N L G+LP E G +
Sbjct  229   LSGEIPTEISKCRSLQELNLSNNTLTGTLSPSISNLTNLQEFGPSHNALEGKLPKEIGFL  288

Query  1135  GQLQFLALTSNNLSGTIPKSLCSNATNLQ------------------------LLMLSET  1242
              +L+ L L  N  SG IP  +  N T+LQ                         L L E 
Sbjct  289   SKLERLLLHDNRFSGEIPVEI-GNCTSLQQIDTYGNHFSGEIPSWIGRLKDLTWLHLREN  347

Query  1243  GLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVAN  1422
               SG IP  L  C  L+ LDL++N L GSIP     LT L  L L NN+L+G +  S+ N
Sbjct  348   EFSGNIPATLGNCHQLRLLDLADNHLTGSIPSSFGFLTALDQLHLYNNSLQGDLPSSLIN  407

Query  1423  LTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGN  1602
             L NL  ++  +N L G +    G    L    L +N F G+IP+++G   SL+ +    N
Sbjct  408   LKNLTRINFSNNTLDGSISPLCGSSSYLSFD-LTDNRFQGDIPLDLGKSPSLERLRLGKN  466

Query  1603  QFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGY  1782
             QFTG+IP TLG++  L  L +  N L+G IP  LG C  L  +DL+DN +SG IP   G 
Sbjct  467   QFTGRIPWTLGKINALSLLDISSNSLTGTIPVELGLCKNLTLIDLSDNFISGVIPPWLGK  526

Query  1783  LRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNA  1962
             L  L  L L +N L G LP ++ NL  L  ++L  N+ +GS                   
Sbjct  527   LPFLGELKLSSNQLTGSLPSEIFNLTKLLVLSLDGNSLNGS-------------------  567

Query  1963  FDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLC  2142
                 IP  +GN  +L+ L LG N+ +G++P  +G + +L  L LS N L+G IP ++   
Sbjct  568   ----IPQEIGNLEALNVLNLGKNQISGQLPSAIGKLSKLYELRLSRNILTGDIPVEIGQL  623

Query  2143  RKLTHLDLNNNLLSG  2187
             + L +  + N  L G
Sbjct  624   QDLQNAFVGNADLCG  638


 Score =   236 bits (601),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 204/650 (31%), Positives = 298/650 (46%), Gaps = 105/650 (16%)
 Frame = +1

Query  298   SSTLRVLLEVKRSFVLQ------LQGWSEKNPNYCSWQGVSCDGslkvvslnl--sdssl  453
             S+ L+ LL+VK+S V        L+ W+  + N+C+W GV+C G   +       + +  
Sbjct  26    SNDLQTLLQVKKSLVTNPKEEKVLRSWNSDDSNFCNWTGVTCGGREVIGLNLSGLNLTGS  85

Query  454   ggsispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLT  633
                       L  L     ++  L+GPIP  L  L  ++ L L  N L GPIP +LG  T
Sbjct  86    ISPSIGRFDNLIDLDLSSNTACRLTGPIPSQLGRLVQMQYLYLRHNYLEGPIPPELGNCT  145

Query  634   NLQALRIGDNGLTGQIPTSFGNLGNLVTLGLAS-CY------------------------  738
             NL       N L G +P     LGNL +L LA+ C+                        
Sbjct  146   NLVTFSAEVNSLNGSLPAELSRLGNLESLNLANNCFSGEIPKFWNMNQLEYLVLEYNPLS  205

Query  739   -----------------------LSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANIS  849
                                    LSG IP ++ +   LQ LNL  N L G L P I+N++
Sbjct  206   GSLPKSLCSNNTNLKLLLLSETQLSGEIPTEISKCRSLQELNLSNNTLTGTLSPSISNLT  265

Query  850   SLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQL  1029
             +L  F  + N+L G +PKE+G L  L  L L +N  +GEIP ++G  +SL  ++  GN  
Sbjct  266   NLQEFGPSHNALEGKLPKEIGFLSKLERLLLHDNRFSGEIPVEIGNCTSLQQIDTYGNHF  325

Query  1030  GGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNA  1209
              G IP  + +L +L  L L  N  +G +P   G+  QL+ L L  N+L+G+IP S     
Sbjct  326   SGEIPSWIGRLKDLTWLHLRENEFSGNIPATLGNCHQLRLLDLADNHLTGSIPSS-----  380

Query  1210  TNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNT  1389
                                       L QL L NN+L G +P  L  L  LT +  +NNT
Sbjct  381   --------------------FGFLTALDQLHLYNNSLQGDLPSSLINLKNLTRINFSNNT  420

Query  1390  LEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNC  1569
             L+G+ISP   + + L +  L  N   G++P ++G    L+ + L +N F+G IP  +G  
Sbjct  421   LDGSISPLCGSSSYL-SFDLTDNRFQGDIPLDLGKSPSLERLRLGKNQFTGRIPWTLGKI  479

Query  1570  SSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNH  1749
             ++L  +D   N  TG IP+ LG  K+L  + L +N +SG IP  LG    L  L L+ N 
Sbjct  480   NALSLLDISSNSLTGTIPVELGLCKNLTLIDLSDNFISGVIPPWLGKLPFLGELKLSSNQ  539

Query  1750  LSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSH  1929
             L+G++P+    L  L  L L  NSL G +P ++ NL  L  +NL  N  SG         
Sbjct  540   LTGSLPSEIFNLTKLLVLSLDGNSLNGSIPQEIGNLEALNVLNLGKNQISG---------  590

Query  1930  SFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIREL  2079
                           ++PS +G    L  LRL  N  TG IP+ +G +++L
Sbjct  591   --------------QLPSAIGKLSKLYELRLSRNILTGDIPVEIGQLQDL  626


 Score = 98.6 bits (244),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 118/216 (55%), Gaps = 4/216 (2%)
 Frame = +1

Query  2071  RELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNL---LSGPIPVWlgrlpllgelklS  2241
             RE+  L+LSG  L+G I P +     L  LDL++N    L+GPIP  LGRL  +  L L 
Sbjct  70    REVIGLNLSGLNLTGSISPSIGRFDNLIDLDLSSNTACRLTGPIPSQLGRLVQMQYLYLR  129

Query  2242  SNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTI  2421
              N   G +PPEL NC+ L+  S E NSLNG+LP E+  L +L  LNL +N   G IP   
Sbjct  130   HNYLEGPIPPELGNCTNLVTFSAEVNSLNGSLPAELSRLGNLESLNLANNCFSGEIPK-F  188

Query  2422  GGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDL  2601
               + +L  L L  N  SG +P+ +        +L  S   L+GEIP  I     L+ L+L
Sbjct  189   WNMNQLEYLVLEYNPLSGSLPKSLCSNNTNLKLLLLSETQLSGEIPTEISKCRSLQELNL  248

Query  2602  SHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKR  2709
             S+N LTG + P ++ +++L     S N LEG+L K 
Sbjct  249   SNNTLTGTLSPSISNLTNLQEFGPSHNALEGKLPKE  284



>ref|XP_011071901.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Sesamum indicum]
Length=976

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/868 (49%), Positives = 564/868 (65%), Gaps = 12/868 (1%)
 Frame = +1

Query  292   NTSSTLRVLLEVKRSFVL---QLQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdsslgg  459
             + SS    LL +K  FV     L  W ++  + C+W GV+C D    V+SLNLS S L G
Sbjct  26    DNSSDSYWLLRIKTEFVDPFGALNNWLQET-SMCTWYGVTCTDDKNHVLSLNLSGSGLNG  84

Query  460   sispslgllthllhldlssnhlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNL  639
              ISP    LT L  +DLS N+L+GPIPP +  L +L  L LFSN L G IP+++GLL  L
Sbjct  85    VISPEFSKLTFLERVDLSQNYLTGPIPPDIGKLQNLRELQLFSNSLTGVIPTEIGLLKKL  144

Query  640   QALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEG  819
             Q LRIGDN L G+I  + GNL  L  LGLA C  SG +P ++G L  L+ L+LQQN + G
Sbjct  145   QVLRIGDNLLMGRIVPAIGNLTELTVLGLAYCQFSGSVPEEIGNLKNLKFLDLQQNSIGG  204

Query  820   PLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSL  999
              +P EI     L  F+A+ N + G IP  +G L+ L ILNLANN+L+G IP +L  +S+L
Sbjct  205   VIPEEIGGCKKLQNFAASNNRIEGKIPGSVGDLESLEILNLANNSLSGSIPVELSHLSNL  264

Query  1000  VYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSG  1179
              YLNL GN+LGG IP  L  L  L++LDLS N L+G +      +  L+ L L+ N  +G
Sbjct  265   KYLNLQGNELGGEIPLELNNLAELETLDLSRNNLSGPINLFNTKLKNLEVLVLSENFFTG  324

Query  1180  TIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQ  1359
             +IP++LC   +NL+ L L++  LSG+ P ++  C  LQQLDLS N + GS+P +L +L  
Sbjct  325   SIPENLCIRNSNLRQLFLADNDLSGDFPADILNCTSLQQLDLSGNNIGGSLPADLGKLEN  384

Query  1360  LTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFS  1539
             LTDL+LNNN+  G I P + N++NL++L LF N + G +P EIG L  L  ++LY+N  S
Sbjct  385   LTDLLLNNNSFTGIIPPEIGNMSNLESLFLFGNMITGRIPAEIGKLQKLSTLYLYDNQMS  444

Query  1540  GEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQ  1719
             G IP E+ NCSSL  +DF+GN F+G IP T+G+LK+L  L LR+N+LSG IP+SLG C +
Sbjct  445   GTIPRELTNCSSLAEVDFFGNHFSGAIPPTIGKLKNLVLLQLRQNELSGPIPSSLGYCRK  504

Query  1720  LDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFS  1899
             L  L LADN LSG++P+TFG+L  L  + LYNNSL G LP+ L +L NL+ +N SHN  S
Sbjct  505   LQRLVLADNKLSGSVPSTFGFLSDLFLVTLYNNSLSGPLPESLFHLKNLSIVNFSHNRLS  564

Query  1900  GSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIREL  2079
             GSI P+  S+S    D+TNN+F   IPS L  S +L RLRL  N  TG IP     ++EL
Sbjct  565   GSIVPLTGSNSLTVLDLTNNSFSNNIPSELAMSRNLTRLRLAHNFLTGNIPSEFNQLKEL  624

Query  2080  SLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSG  2259
               LDLS N L+G +  +LS   KL HL L+NN   G IP WLG +  LGEL LSSN FSG
Sbjct  625   HFLDLSFNNLTGELETELSALTKLGHLMLSNNRFFGMIPTWLGSIQDLGELDLSSNTFSG  684

Query  2260  SLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKL  2439
             S+P EL NCS+LL LSL +N L+G +PPEIGNL  LNVLNL  N L GSIPSTI    KL
Sbjct  685   SIPSELGNCSRLLKLSLHSNRLSGPIPPEIGNLNFLNVLNLQKNNLSGSIPSTIQQCKKL  744

Query  2440  YELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLT  2619
             YELRLS N  +G IP E+G L +LQ VLD S+N L+GEIP SIG L KLE L+LS N L 
Sbjct  745   YELRLSENGLTGPIPPEIGTLSELQVVLDLSFNRLSGEIPSSIGNLVKLERLNLSFNQLE  804

Query  2620  GEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCGSPLGSCRDKG---  2790
             G++P  + ++SSL RLNLS N L+G+L   ++ + + SF+GN  LCG PL SC +     
Sbjct  805   GKVPASLGKLSSLHRLNLSSNHLQGQLPPTFSGFTLSSFLGNDKLCGPPLVSCSESSGHM  864

Query  2791  ----SRNKGSMVVVISALSATVAIILLL  2862
                 S ++ + ++V    ++T+  + LL
Sbjct  865   RKWLSESQVAGIIVAIVFTSTLICLFLL  892



>dbj|BAF79945.1| receptor-like kinase [Marchantia polymorpha]
Length=1253

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/1013 (40%), Positives = 552/1013 (54%), Gaps = 56/1013 (6%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP +LG L+ L+A  IG+N LTG+IP+S  N   L  LGLA   L             
Sbjct  133   GTIPPELGSLSRLKAFVIGENRLTGEIPSSLTNCTRLERLGLAGNML-------------  179

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
                        EG LP EI+ +  L   +   N  NGSIP E G L +L IL + NN L 
Sbjct  180   -----------EGRLPAEISRLKHLAFLNLQFNFFNGSIPSEYGLLTNLSILLMQNNQLV  228

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP   G ++SL  L L  N L GS+P  + K +NLQ L +  N L G +P E  ++ Q
Sbjct  229   GSIPASFGNLTSLTDLELDNNFLTGSLPPEIGKCSNLQILHVRNNSLTGSIPEELSNLAQ  288

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L  L L +NNLSG +P +L  N + L     S   LSG +  +      L+   LS N +
Sbjct  289   LTSLDLMANNLSGILPAAL-GNLSLLTFFDASSNQLSGPLSLQPGHFPSLEYFYLSANRM  347

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
             +G++PE L  L  L  +  + N   G + P +    NL  L L+ N L+G +   IG   
Sbjct  348   SGTLPEALGSLPALRHIYADTNKFHGGV-PDLGKCENLTDLILYGNMLNGSINPTIGQNK  406

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
             +L+  + YEN  +G IP EIG+C+ L+ +D   N  TG IP  LG L  + FL+  +N L
Sbjct  407   NLETFYAYENQLTGGIPPEIGHCTHLKNLDLDMNNLTGPIPPELGNLTLVVFLNFYKNFL  466

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
             +G IP  +G    ++ L L+DN L+G IP   G + +L  L+LY N LEG +P  L N  
Sbjct  467   TGPIPPEMGKMTMMENLTLSDNQLTGTIPPELGRIHSLKTLLLYQNRLEGSIPSTLSNCK  526

Query  1861  NLTRINLSHNNFSGSIAPI--CTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNR  2034
             NL+ +N S N  SG IA     +       D++NN+    IP   G    L R RL +NR
Sbjct  527   NLSIVNFSGNKLSGVIAGFDQLSPCRLEVMDLSNNSLTGPIPPLWGGCQGLRRFRLHNNR  586

Query  2035  FTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQL-SLCRKLTHLDLNNNLLSGPIPVWlgr  2211
              TG IP T      L LLD+S N L G IP  L +    L  LDL+ N L G IP  + +
Sbjct  587   LTGTIPATFANFTALELLDVSSNDLHGEIPVALLTGSPALGELDLSRNNLVGLIPSQIDQ  646

Query  2212  lpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDN  2391
             L  L  L LS N+ +G +PPE+ N  KL  L L NN+L G +P E+GNL +L  L L  N
Sbjct  647   LGKLQVLDLSWNRLTGRIPPEIGNIPKLSDLRLNNNALGGVIPTEVGNLSALTGLKLQSN  706

Query  2392  QLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIG  2571
             QL G IP+ +     L ELRL  NR SG IP  +G L  L  +LD   N+LTG IPP+  
Sbjct  707   QLEGVIPAALSSCVNLIELRLGNNRLSGAIPAGLGSLYSLSVMLDLGSNSLTGSIPPAFQ  766

Query  2572  TLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYA--HWPVDSFVGN  2745
              L KLE L+LS N L+G +P  +  + SL  LN+S N+L G L +        V  F+GN
Sbjct  767   HLDKLERLNLSSNFLSGRVPAVLGSLVSLTELNISNNQLVGPLPESQVIERMNVSCFLGN  826

Query  2746  SHLCGSPLGSCRDKGSRNKGSMVVVISALS-ATVAIILLLMGAAFFFKHNREAYR-RRRG  2919
             + LCG PL  C+     ++G   + IS +  A V  ++ + G A         YR R+R 
Sbjct  827   TGLCGPPLAQCQVVLQPSEGLSGLEISMIVLAVVGFVMFVAGIALL------CYRARQRD  880

Query  2920  KENYAsssssssQAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAEL  3099
                       +S    K  F N  ++R + +++IM+AT+NL +  +IG GG   VYKA +
Sbjct  881   PVMIIPQGKRASSFNLKVRFNN--RRRKMTFNEIMKATDNLHESNLIGKGGYGLVYKAVM  938

Query  3100  FNGETVAIKRIP-RKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEY  3276
              +GE +A+K++    DD  +DKSF RE++TL RIRHRHL+ L+G+CS    G ++L+YEY
Sbjct  939   PSGEILAVKKVVFHDDDSSIDKSFIREVETLGRIRHRHLLNLIGFCSYN--GVSLLVYEY  996

Query  3277  MENGSVWDWLHNQPAN---------NKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKII  3429
             M NGS+ D L+  P            K +++LDW  R  IA+ +A+G+ YLHHDC P II
Sbjct  997   MANGSLADILYLDPTMLPHGIAQELRKKQQALDWGTRYDIAVAVAEGLAYLHHDCSPPII  1056

Query  3430  HRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             HRDIKSSN+LLDS+M AH+GDFGLAK L         ES +  AGSYGYIAPE
Sbjct  1057  HRDIKSSNILLDSDMIAHVGDFGLAKILEAGRLG---ESMSIIAGSYGYIAPE  1106


 Score =   264 bits (675),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 225/664 (34%), Positives = 320/664 (48%), Gaps = 81/664 (12%)
 Frame = +1

Query  1018  GNQLG-----GSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGT  1182
             G QLG     G    ++AKL  L++++L  N L+G +P E GS+ +L+   +  N L+G 
Sbjct  99    GIQLGECGMTGVFSAAIAKLPYLETVELFSNNLSGTIPPELGSLSRLKAFVIGENRLTGE  158

Query  1183  IPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQL  1362
             IP SL +N T L+ L L+   L G +P E+S+ + L  L+L  N  NGSIP E   LT L
Sbjct  159   IPSSL-TNCTRLERLGLAGNMLEGRLPAEISRLKHLAFLNLQFNFFNGSIPSEYGLLTNL  217

Query  1363  TDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSG  1542
             + L++ NN L G+I  S  NLT+L  L L +N L                        +G
Sbjct  218   SILLMQNNQLVGSIPASFGNLTSLTDLELDNNFL------------------------TG  253

Query  1543  EIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQL  1722
              +P EIG CS+LQ +    N  TG IP  L  L  L  L L  N+LSG +PA+LGN   L
Sbjct  254   SLPPEIGKCSNLQILHVRNNSLTGSIPEELSNLAQLTSLDLMANNLSGILPAALGNLSLL  313

Query  1723  DTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSG  1902
                D + N LSG +    G+  +L    L  N + G LP+ L +L  L  I    N F G
Sbjct  314   TFFDASSNQLSGPLSLQPGHFPSLEYFYLSANRMSGTLPEALGSLPALRHIYADTNKFHG  373

Query  1903  SIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELS  2082
              +  +    +     +  N  +  I   +G + +L+      N+ TG IP  +G    L 
Sbjct  374   GVPDLGKCENLTDLILYGNMLNGSINPTIGQNKNLETFYAYENQLTGGIPPEIGHCTHLK  433

Query  2083  LLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGS  2262
              LDL  N L+G IPP+L     +  L+   N L+GPIP  +G++ ++  L LS NQ +G+
Sbjct  434   NLDLDMNNLTGPIPPELGNLTLVVFLNFYKNFLTGPIPPEMGKMTMMENLTLSDNQLTGT  493

Query  2263  LPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLN---------------------  2379
             +PPEL     L  L L  N L G++P  + N K+L+++N                     
Sbjct  494   IPPELGRIHSLKTLLLYQNRLEGSIPSTLSNCKNLSIVNFSGNKLSGVIAGFDQLSPCRL  553

Query  2380  ----LDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLT  2547
                 L +N L G IP   GG   L   RL  NR +G IP        L+ +LD S N+L 
Sbjct  554   EVMDLSNNSLTGPIPPLWGGCQGLRRFRLHNNRLTGTIPATFANFTALE-LLDVSSNDLH  612

Query  2548  GEIPPSIGTLS-KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWP  2724
             GEIP ++ T S  L  LDLS N+L G IP Q+ ++  L  L+LS N L G +     + P
Sbjct  613   GEIPVALLTGSPALGELDLSRNNLVGLIPSQIDQLGKLQVLDLSWNRLTGRIPPEIGNIP  672

Query  2725  ---------------VDSFVGN-SHLCGSPLGSCRDKGSRNKGSMVVVISALSATVAIIL  2856
                            + + VGN S L G  L S + +G        V+ +ALS+ V +I 
Sbjct  673   KLSDLRLNNNALGGVIPTEVGNLSALTGLKLQSNQLEG--------VIPAALSSCVNLIE  724

Query  2857  LLMG  2868
             L +G
Sbjct  725   LRLG  728


 Score =   112 bits (281),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 88/234 (38%), Positives = 116/234 (50%), Gaps = 29/234 (12%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
             VG IPSQ+  L  LQ L +  N LTG+IP   GN+  L  L L +  L G+I        
Sbjct  637   VGLIPSQIDQLGKLQVLDLSWNRLTGRIPPEIGNIPKLSDLRLNNNALGGVI--------  688

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
                             P E+ N+S+LT      N L G IP  L    +L  L L NN L
Sbjct  689   ----------------PTEVGNLSALTGLKLQSNQLEGVIPAALSSCVNLIELRLGNNRL  732

Query  958   TGEIPGQLGEMSSL-VYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSM  1134
             +G IP  LG + SL V L+L  N L GSIP +   L  L+ L+LS N L+G +P   GS+
Sbjct  733   SGAIPAGLGSLYSLSVMLDLGSNSLTGSIPPAFQHLDKLERLNLSSNFLSGRVPAVLGSL  792

Query  1135  GQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQ  1296
               L  L +++N L G +P+S      N+    L  TGL G   P L+QC+V+ Q
Sbjct  793   VSLTELNISNNQLVGPLPESQVIERMNVSCF-LGNTGLCG---PPLAQCQVVLQ  842



>ref|XP_009362981.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
Length=968

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/844 (47%), Positives = 527/844 (62%), Gaps = 4/844 (0%)
 Frame = +1

Query  532   PIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNL  711
             P+PP L  L SL+ LLL+SN L G IP+++GLL NLQ LRIGDN  +G IP S GNL  L
Sbjct  104   PLPPELGQLQSLKILLLYSNFLSGGIPAEIGLLRNLQVLRIGDNLFSGAIPPSIGNLTEL  163

Query  712   VTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNG  891
               LGLA C L+G IP ++G L +L +L+L+ N L G +P EI  +  +  F+A+ N L G
Sbjct  164   RVLGLAYCQLNGSIPVEIGDLKKLTSLDLRNNSLTGLMPEEIHGLQEIQNFAASNNMLEG  223

Query  892   SIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNL  1071
              IP  +G LK L ILNLANN+L+G IP  L ++++L YLNL+GN+L G IP  L +L  L
Sbjct  224   DIPSSIGSLKSLQILNLANNSLSGTIPSALSQLANLNYLNLVGNRLNGDIPSGLNQLAQL  283

Query  1072  QSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLS  1251
             + LDLS N L+G +      +  L+ L L+ N L+GTI  + C + +NLQ L+L+   L+
Sbjct  284   EILDLSRNNLSGSIGLLSTQLRNLESLVLSDNALTGTISSNFCLSNSNLQQLLLARNKLT  343

Query  1252  GEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTN  1431
             G+ P +L  C  LQQLDLS+NT  G +P  L +L  LTDLVLNNN+  GT+ P + N++ 
Sbjct  344   GKFPLDLLSCSSLQQLDLSDNTFEGELPAALDKLQNLTDLVLNNNSFTGTLPPEIGNMSY  403

Query  1432  LQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFT  1611
             L+ L LF N + G +P EIG L  L+ ++LY+N  SG IP E+ NC+ L  IDF+GN FT
Sbjct  404   LENLYLFGNMITGRIPAEIGKLKKLKTLYLYDNQLSGSIPRELTNCTELIEIDFFGNHFT  463

Query  1612  GKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRA  1791
             G IP T+G+LK L  LHLR+N LSG IP SLG C  L  L LADN L+G +P TF ++  
Sbjct  464   GSIPATIGKLKSLVLLHLRQNGLSGPIPPSLGYCRSLRLLALADNKLTGTLPPTFRFISQ  523

Query  1792  LTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQ  1971
             L+ + LYNNS EG LP  L  L NL  IN SHN F+GSI P+  S S    D+TNN+F  
Sbjct  524   LSTITLYNNSFEGPLPASLFLLKNLKIINFSHNRFNGSIYPLSGSSSLTKVDLTNNSFSG  583

Query  1972  EIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKL  2151
              IPS L  + +L RLRL  N   G IP   G + +L  LDLS N L+G +PPQLS  + +
Sbjct  584   SIPSRLAMARNLTRLRLAYNHLAGTIPSEFGQLTQLKFLDLSFNNLTGEVPPQLSSAKLI  643

Query  2152  THLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnG  2331
              HL L+NN   G IP WLG L  LGEL LS+N F G+LP E+ NCSKLL LSL+ NSL+ 
Sbjct  644   EHLLLSNNRFKGKIPAWLGSLQELGELDLSTNNFQGTLPAEIGNCSKLLKLSLQGNSLSN  703

Query  2332  TLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDL  2511
              +P E+GNL SLNVLNL  N   GSIPSTI    KLYELRLS N  +G IP E+G+L +L
Sbjct  704   MMPEEMGNLTSLNVLNLQRNSFSGSIPSTIRQCVKLYELRLSENNLTGSIPSELGELTEL  763

Query  2512  QSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELE  2691
             Q +LD S N L+G+IP S+G L KLE L+LS N L GE+P  + +++SL  LNLS N L+
Sbjct  764   QVILDLSENFLSGKIPSSLGNLMKLERLNLSSNQLQGEVPSSLGKLTSLHMLNLSNNFLQ  823

Query  2692  GELDKRYAHWPVDSFVGNSHLCGSPLGSCRD-KGSRNKGSMVVVISALSATVAIILLLMG  2868
             G++   ++ +P  SF  N  LCG PL SC + K  R KG      + ++  + +   ++ 
Sbjct  824   GQIPSIFSGFPPSSFSSNPKLCGPPLASCSESKRQRKKGLSDAAETGITVAIVLTSAVIC  883

Query  2869  AAFFFKHNREAYRRRRGKENYAsssssssQAQRKPL---FGNAAKKRDIRWDDIMEATNN  3039
              A  +   R     RR   +        ++ +R+     FGN  K+    W+ +  A  N
Sbjct  884   LAMIYVMLRMWCNWRRVSVSNMDGGGGGAECKREEELWDFGNEKKRGGECWNVVSLALVN  943

Query  3040  LSDE  3051
               DE
Sbjct  944   SKDE  947


 Score =   304 bits (778),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 223/618 (36%), Positives = 311/618 (50%), Gaps = 53/618 (9%)
 Frame = +1

Query  997   LVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLS  1176
             ++ LNL G+ L G IP+ L++L+++Q+LD S N LA  LP E G +  L+ L L SN LS
Sbjct  67    IIGLNLSGSGLAGPIPRELSQLSSIQTLDFSSNSLADPLPPELGQLQSLKILLLYSNFLS  126

Query  1177  GTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELT  1356
             G IP  +     NLQ+L + +   SG IPP +     L+ L L+   LNGSIP E+ +L 
Sbjct  127   GGIPAEI-GLLRNLQVLRIGDNLFSGAIPPSIGNLTELRVLGLAYCQLNGSIPVEIGDLK  185

Query  1357  QLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHF  1536
             +LT L L NN+L G +   +  L  +Q  +  +N L G++P  IG L  LQI+ L  N  
Sbjct  186   KLTSLDLRNNSLTGLMPEEIHGLQEIQNFAASNNMLEGDIPSSIGSLKSLQILNLANNSL  245

Query  1537  SGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEI--------  1692
             SG IP  +   ++L +++  GN+  G IP  L +L  L  L L  N+LSG I        
Sbjct  246   SGTIPSALSQLANLNYLNLVGNRLNGDIPSGLNQLAQLEILDLSRNNLSGSIGLLSTQLR  305

Query  1693  -----------------------------------------PASLGNCHQLDTLDLADNH  1749
                                                      P  L +C  L  LDL+DN 
Sbjct  306   NLESLVLSDNALTGTISSNFCLSNSNLQQLLLARNKLTGKFPLDLLSCSSLQQLDLSDNT  365

Query  1750  LSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSI-APICTS  1926
               G +PA    L+ LT L+L NNS  G LP ++ N+  L  + L  N  +G I A I   
Sbjct  366   FEGELPAALDKLQNLTDLVLNNNSFTGTLPPEIGNMSYLENLYLFGNMITGRIPAEIGKL  425

Query  1927  HSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNK  2106
                 +  + +N     IP  L N   L  +    N FTG IP T+G ++ L LL L  N 
Sbjct  426   KKLKTLYLYDNQLSGSIPRELTNCTELIEIDFFGNHFTGSIPATIGKLKSLVLLHLRQNG  485

Query  2107  LSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNC  2286
             LSG IPP L  CR L  L L +N L+G +P     +  L  + L +N F G LP  LF  
Sbjct  486   LSGPIPPSLGYCRSLRLLALADNKLTGTLPPTFRFISQLSTITLYNNSFEGPLPASLFLL  545

Query  2287  skllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNR  2466
               L +++  +N  NG++ P  G+  SL  ++L +N   GSIPS +     L  LRL+ N 
Sbjct  546   KNLKIINFSHNRFNGSIYPLSGS-SSLTKVDLTNNSFSGSIPSRLAMARNLTRLRLAYNH  604

Query  2467  FSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAE  2646
              +G IP E GQL  L+  LD S+NNLTGE+PP + +   +E L LS+N   G+IP  +  
Sbjct  605   LAGTIPSEFGQLTQLK-FLDLSFNNLTGEVPPQLSSAKLIEHLLLSNNRFKGKIPAWLGS  663

Query  2647  MSSLGRLNLSCNELEGEL  2700
             +  LG L+LS N  +G L
Sbjct  664   LQELGELDLSTNNFQGTL  681


 Score =   139 bits (349),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 141/454 (31%), Positives = 198/454 (44%), Gaps = 99/454 (22%)
 Frame = +1

Query  1645  HLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSL  1824
             H+  L+L  + L+G IP  L     + TLD + N L+  +P   G L++L  L+LY+N L
Sbjct  66    HIIGLNLSGSGLAGPIPRELSQLSSIQTLDFSSNSLADPLPPELGQLQSLKILLLYSNFL  125

Query  1825  EGDLPDDLRNLGNLTRINLSHNNFSGSIAP------------------------------  1914
              G +P ++  L NL  + +  N FSG+I P                              
Sbjct  126   SGGIPAEIGLLRNLQVLRIGDNLFSGAIPPSIGNLTELRVLGLAYCQLNGSIPVEIGDLK  185

Query  1915  -------------------ICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRF  2037
                                I       +F  +NN  + +IPS +G+  SL  L L +N  
Sbjct  186   KLTSLDLRNNSLTGLMPEEIHGLQEIQNFAASNNMLEGDIPSSIGSLKSLQILNLANNSL  245

Query  2038  TGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlp  2217
             +G IP  L  +  L+ L+L GN+L+G IP  L+   +L  LDL+ N LSG I +   +L 
Sbjct  246   SGTIPSALSQLANLNYLNLVGNRLNGDIPSGLNQLAQLEILDLSRNNLSGSIGLLSTQLR  305

Query  2218  llgelklSSNQFSGSL-------------------------PPELFNCskllvlslenns  2322
              L  L LS N  +G++                         P +L +CS L  L L +N+
Sbjct  306   NLESLVLSDNALTGTISSNFCLSNSNLQQLLLARNKLTGKFPLDLLSCSSLQQLDLSDNT  365

Query  2323  lnGTL------------------------PPEIGNLKSLNVLNLDDNQLCGSIPSTIGGL  2430
               G L                        PPEIGN+  L  L L  N + G IP+ IG L
Sbjct  366   FEGELPAALDKLQNLTDLVLNNNSFTGTLPPEIGNMSYLENLYLFGNMITGRIPAEIGKL  425

Query  2431  GKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHN  2610
              KL  L L  N+ SG IPRE+    +L  + DF  N+ TG IP +IG L  L  L L  N
Sbjct  426   KKLKTLYLYDNQLSGSIPRELTNCTELIEI-DFFGNHFTGSIPATIGKLKSLVLLHLRQN  484

Query  2611  DLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRY  2712
              L+G IPP +    SL  L L+ N+L G L   +
Sbjct  485   GLSGPIPPSLGYCRSLRLLALADNKLTGTLPPTF  518



>tpg|DAA37041.1| TPA: putative leucine-rich repeat receptor protein kinase family 
protein [Zea mays]
Length=1097

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/909 (41%), Positives = 523/909 (58%), Gaps = 22/909 (2%)
 Frame = +1

Query  880   SLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAK  1059
             +L+G++   +G L  L +L+L+ N   G IP ++G +S L  LNL  N   G+IP  L K
Sbjct  79    NLSGTVAPSIGSLSELTLLDLSFNGFYGTIPPEIGNLSKLEVLNLYNNSFVGTIPPELGK  138

Query  1060  LTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSE  1239
             L  L + +L  N+L G +P E G+M  LQ L   SNNL+G++P+SL     NL+ + L +
Sbjct  139   LDRLVTFNLCNNKLHGPIPDEVGNMTALQELVGYSNNLTGSLPRSL-GKLKNLKNIRLGQ  197

Query  1240  TGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVA  1419
               +SG IP E+  C  +    L+ N L G +P+E+  LT +TDL+L  N L G I P + 
Sbjct  198   NLISGNIPVEIGACLNITVFGLAQNKLEGPLPKEIGRLTLMTDLILWGNQLSGVIPPEIG  257

Query  1420  NLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYG  1599
             N T+L T++L+ NNL G +P  I  + +LQ ++LY N  +G IP +IGN S  + IDF  
Sbjct  258   NCTSLSTIALYDNNLVGPIPATIVKITNLQKLYLYRNSLNGTIPSDIGNLSLAKEIDFSE  317

Query  1600  NQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFG  1779
             N  TG IP  L  +  L  L+L +N L+G IP  L     L  LDL+ N L+G IP  F 
Sbjct  318   NFLTGGIPKELADIPGLNLLYLFQNQLTGPIPTELCGLKNLSKLDLSINSLNGTIPVGFQ  377

Query  1780  YLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP-ICTSHSFLSFDVTN  1956
             Y+R L +L L+NN L G++P        L  ++ S+N+ +G I   +C   + +  ++ +
Sbjct  378   YMRNLIQLQLFNNMLSGNIPPRFGIYSRLWVVDFSNNSITGQIPKDLCRQSNLILLNLGS  437

Query  1957  NAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLS  2136
             N     IP  + N  +L +LRL  N  TG  P  L  +  L+ ++L  NK SG IPPQ+ 
Sbjct  438   NMLTGNIPRGITNCKTLVQLRLSDNSLTGSFPTDLCNLVNLTTVELGRNKFSGPIPPQIG  497

Query  2137  LCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslen  2316
              C+ L  LDL NN  +  +P  +G L  L    +SSN+  G++P E+FNC+ L  L L  
Sbjct  498   SCKSLQRLDLTNNYFTSELPREIGNLSKLVVFNISSNRLGGNIPLEIFNCTVLQRLDLSQ  557

Query  2317  nslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVG  2496
             NS  G+LP E+G L  L +L+  DN+L G IP  +G L  L  L++  N+ SGEIP+E+G
Sbjct  558   NSFEGSLPNEVGRLPQLELLSFADNRLTGQIPPILGELSHLTALQIGGNQLSGEIPKELG  617

Query  2497  QLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLS  2676
              L  LQ  L+ SYNNL+G+IP  +G L+ LESL L++N L GEIP   A +SSL  LN+S
Sbjct  618   LLSSLQIALNLSYNNLSGDIPSELGNLALLESLFLNNNKLMGEIPTTFANLSSLLELNVS  677

Query  2677  CNELEGELD--KRYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKGSMVVVISALSATVAI  2850
              N L G L     + +  V  F+GN  LCG  LG C  + S +  S   V   L   +AI
Sbjct  678   YNYLSGALPPIPLFDNMSVTCFIGNKGLCGGQLGRCGSRPSSSSQSSKSVSPPLGKIIAI  737

Query  2851  ILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGN--AAKKRDIRWDDIM  3024
             +  ++G           +  R+  E  A         Q  P   N   + K    + +++
Sbjct  738   VAAVIGGISLILIAIIVHHIRKPMETVA----PLQDKQPFPACSNVHVSAKDAYTFQELL  793

Query  3025  EATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIP-RKDDLFLDKSFAREIKTLWRIR  3201
              ATNN  +  +IG G C TVY+A L  G+T+A+K++   ++    D SF  EI TL +IR
Sbjct  794   TATNNFDESCVIGRGACGTVYRAILKAGQTIAVKKLASNREGSNTDNSFRAEIMTLGKIR  853

Query  3202  HRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKKSLDWEARLKIAMGL  3381
             HR++V+L G+  +  +GSN+L+YEYM  GS+ + LH Q     S  SLDWE R  IA+G 
Sbjct  854   HRNIVKLYGFVYH--QGSNLLLYEYMSRGSLGELLHGQ-----SSSSLDWETRFLIALGA  906

Query  3382  AQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSLNTESNTWFA  3561
             A+G+ YLHHDC P+IIHRDIKS+N+LLD N EAH+GDFGLAK +   Y    ++S +  A
Sbjct  907   AEGLSYLHHDCKPRIIHRDIKSNNILLDENFEAHVGDFGLAKVIDMPY----SKSMSAIA  962

Query  3562  GSYGYIAPE  3588
             GSYGYIAPE
Sbjct  963   GSYGYIAPE  971


 Score =   295 bits (754),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 213/525 (41%), Positives = 279/525 (53%), Gaps = 25/525 (5%)
 Frame = +1

Query  1150  LALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGS  1329
             L L++ NLSGT+  S+ S  + L LL LS  G  G IPPE+     L+ L+L NN+  G+
Sbjct  73    LDLSNMNLSGTVAPSIGS-LSELTLLDLSFNGFYGTIPPEIGNLSKLEVLNLYNNSFVGT  131

Query  1330  IPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQ  1509
             IP EL +L +L    L NN L G I   V N+T LQ L  + NNL G +PR +G L +L+
Sbjct  132   IPPELGKLDRLVTFNLCNNKLHGPIPDEVGNMTALQELVGYSNNLTGSLPRSLGKLKNLK  191

Query  1510  IIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGE  1689
              I L +N  SG IPVEIG C ++       N+  G +P  +GRL  +  L L  N LSG 
Sbjct  192   NIRLGQNLISGNIPVEIGACLNITVFGLAQNKLEGPLPKEIGRLTLMTDLILWGNQLSGV  251

Query  1690  IPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLT  1869
             IP  +GNC  L T+ L DN+L G IPAT   +  L +L LY NSL G +P D+ NL    
Sbjct  252   IPPEIGNCTSLSTIALYDNNLVGPIPATIVKITNLQKLYLYRNSLNGTIPSDIGNLSLAK  311

Query  1870  RINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKI  2049
              I+ S N  +G                        IP  L + P L+ L L  N+ TG I
Sbjct  312   EIDFSENFLTGG-----------------------IPKELADIPGLNLLYLFQNQLTGPI  348

Query  2050  PMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllge  2229
             P  L  ++ LS LDLS N L+G IP      R L  L L NN+LSG IP   G    L  
Sbjct  349   PTELCGLKNLSKLDLSINSLNGTIPVGFQYMRNLIQLQLFNNMLSGNIPPRFGIYSRLWV  408

Query  2230  lklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSI  2409
             +  S+N  +G +P +L   S L++L+L +N L G +P  I N K+L  L L DN L GS 
Sbjct  409   VDFSNNSITGQIPKDLCRQSNLILLNLGSNMLTGNIPRGITNCKTLVQLRLSDNSLTGSF  468

Query  2410  PSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLE  2589
             P+ +  L  L  + L RN+FSG IP ++G  K LQ  LD + N  T E+P  IG LSKL 
Sbjct  469   PTDLCNLVNLTTVELGRNKFSGPIPPQIGSCKSLQR-LDLTNNYFTSELPREIGNLSKLV  527

Query  2590  SLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWP  2724
               ++S N L G IP ++   + L RL+LS N  EG L       P
Sbjct  528   VFNISSNRLGGNIPLEIFNCTVLQRLDLSQNSFEGSLPNEVGRLP  572


 Score =   276 bits (705),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 249/648 (38%), Positives = 352/648 (54%), Gaps = 9/648 (1%)
 Frame = +1

Query  346   QLQGWSEKNPNYCSWQGVSCDGsl--kvvslnlsdsslggsispslgllthllhldlssn  519
              L  W  ++   C W+GVSC  +    VVSL+LS+ +L G+++PS+G L+ L  LDLS N
Sbjct  43    HLDNWDARDLTPCIWKGVSCSSTPNPVVVSLDLSNMNLSGTVAPSIGSLSELTLLDLSFN  102

Query  520   hlsGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGN  699
                G IPP + NLS LE L L++N  VG IP +LG L  L    + +N L G IP   GN
Sbjct  103   GFYGTIPPEIGNLSKLEVLNLYNNSFVGTIPPELGKLDRLVTFNLCNNKLHGPIPDEVGN  162

Query  700   LGNLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALN  879
             +  L  L   S  L+G +P  LG+L  L+N+ L QNL+ G +P EI    ++T F  A N
Sbjct  163   MTALQELVGYSNNLTGSLPRSLGKLKNLKNIRLGQNLISGNIPVEIGACLNITVFGLAQN  222

Query  880   SLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAK  1059
              L G +PKE+G L  +  L L  N L+G IP ++G  +SL  + L  N L G IP ++ K
Sbjct  223   KLEGPLPKEIGRLTLMTDLILWGNQLSGVIPPEIGNCTSLSTIALYDNNLVGPIPATIVK  282

Query  1060  LTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSE  1239
             +TNLQ L L  N L G +P + G++   + +  + N L+G IPK L ++   L LL L +
Sbjct  283   ITNLQKLYLYRNSLNGTIPSDIGNLSLAKEIDFSENFLTGGIPKEL-ADIPGLNLLYLFQ  341

Query  1240  TGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVA  1419
               L+G IP EL   + L +LDLS N+LNG+IP     +  L  L L NN L G I P   
Sbjct  342   NQLTGPIPTELCGLKNLSKLDLSINSLNGTIPVGFQYMRNLIQLQLFNNMLSGNIPPRFG  401

Query  1420  NLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYG  1599
               + L  +   +N++ G++P+++    +L ++ L  N  +G IP  I NC +L  +    
Sbjct  402   IYSRLWVVDFSNNSITGQIPKDLCRQSNLILLNLGSNMLTGNIPRGITNCKTLVQLRLSD  461

Query  1600  NQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFG  1779
             N  TG  P  L  L +L  + L  N  SG IP  +G+C  L  LDL +N+ +  +P   G
Sbjct  462   NSLTGSFPTDLCNLVNLTTVELGRNKFSGPIPPQIGSCKSLQRLDLTNNYFTSELPREIG  521

Query  1780  YLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSI---APICTSHSFLSFDV  1950
              L  L    + +N L G++P ++ N   L R++LS N+F GS+            LSF  
Sbjct  522   NLSKLVVFNISSNRLGGNIPLEIFNCTVLQRLDLSQNSFEGSLPNEVGRLPQLELLSF--  579

Query  1951  TNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSL-LDLSGNKLSGFIPP  2127
              +N    +IP  LG    L  L++G N+ +G+IP  LGL+  L + L+LS N LSG IP 
Sbjct  580   ADNRLTGQIPPILGELSHLTALQIGGNQLSGEIPKELGLLSSLQIALNLSYNNLSGDIPS  639

Query  2128  QLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPP  2271
             +L     L  L LNNN L G IP     L  L EL +S N  SG+LPP
Sbjct  640   ELGNLALLESLFLNNNKLMGEIPTTFANLSSLLELNVSYNYLSGALPP  687


 Score =   120 bits (302),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 99/302 (33%), Positives = 148/302 (49%), Gaps = 1/302 (0%)
 Frame = +1

Query  1819  SLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNS  1998
             +L+  + D L +L N    +L+   + G       +   +S D++N      +   +G+ 
Sbjct  32    ALKSQMNDTLHHLDNWDARDLTPCIWKGVSCSSTPNPVVVSLDLSNMNLSGTVAPSIGSL  91

Query  1999  PSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNL  2178
               L  L L  N F G IP  +G + +L +L+L  N   G IPP+L    +L   +L NN 
Sbjct  92    SELTLLDLSFNGFYGTIPPEIGNLSKLEVLNLYNNSFVGTIPPELGKLDRLVTFNLCNNK  151

Query  2179  LSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNL  2358
             L GPIP  +G +  L EL   SN  +GSLP  L     L  + L  N ++G +P EIG  
Sbjct  152   LHGPIPDEVGNMTALQELVGYSNNLTGSLPRSLGKLKNLKNIRLGQNLISGNIPVEIGAC  211

Query  2359  KSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYN  2538
              ++ V  L  N+L G +P  IG L  + +L L  N+ SG IP E+G    L ++  +  N
Sbjct  212   LNITVFGLAQNKLEGPLPKEIGRLTLMTDLILWGNQLSGVIPPEIGNCTSLSTIALYD-N  270

Query  2539  NLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAH  2718
             NL G IP +I  ++ L+ L L  N L G IP  +  +S    ++ S N L G + K  A 
Sbjct  271   NLVGPIPATIVKITNLQKLYLYRNSLNGTIPSDIGNLSLAKEIDFSENFLTGGIPKELAD  330

Query  2719  WP  2724
              P
Sbjct  331   IP  332



>ref|XP_002278672.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Vitis vinifera]
Length=974

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/763 (49%), Positives = 490/763 (64%), Gaps = 8/763 (1%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP+++ LL  LQ LRIGDN L G+I  S GNL  L  LGLA C L+G IP ++G L  
Sbjct  132   GKIPTEICLLKKLQVLRIGDNMLAGEITPSIGNLKELRVLGLAYCQLNGSIPAEIGNLKN  191

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L+ L+LQ+N L   +P EI     L  F+A+ N L G IP  +G LK L ILNLANN+L+
Sbjct  192   LKFLDLQKNSLSSVIPEEIQGCVELQNFAASNNKLEGEIPASMGNLKSLQILNLANNSLS  251

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP +LG +S+L YLNLLGN+L G IP  L +L  LQ LDLS N L+G +      +  
Sbjct  252   GSIPIELGGLSNLKYLNLLGNRLSGMIPSELNQLDQLQKLDLSSNNLSGTINFLNTQLKS  311

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L+ LAL+ N L+ +IP + C+++++L+ + L++  LSG  P EL  C  +QQLDLS+N  
Sbjct  312   LEVLALSDNLLTDSIPGNFCTSSSSLRQIFLAQNKLSGTFPLELLNCSSIQQLDLSDNRF  371

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
              G +P EL +L  LTDL+LNNN+  G + P + N+++L+TL LF N + G +P E+G L 
Sbjct  372   EGVLPPELEKLENLTDLLLNNNSFSGKLPPEIGNMSSLETLYLFDNMITGNIPVELGKLQ  431

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
              L  I+LY+N  SG IP E+ NCSSL  IDF+GN F G IP T+G+L++L FL LR+NDL
Sbjct  432   KLSSIYLYDNQLSGSIPRELTNCSSLSEIDFFGNHFMGSIPATIGKLRNLVFLQLRQNDL  491

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
             SG IP SLG C +L TL LADN LSG++P TF +L  L    LYNNS EG LP+ L  L 
Sbjct  492   SGPIPPSLGYCKKLHTLTLADNKLSGSLPPTFRFLSELHLFSLYNNSFEGPLPESLFLLK  551

Query  1861  NLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFT  2040
              L  IN SHN FSGSI P+  S      D+TNN+F   IPS L  S +L RLRL  N  T
Sbjct  552   KLGIINFSHNRFSGSILPLLGSDFLTLLDLTNNSFSGPIPSRLAMSKNLTRLRLAHNLLT  611

Query  2041  GKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpl  2220
             G I    G ++EL  LDLS N  +G + P+LS C+KL H+ LNNN   G IP WLG L  
Sbjct  612   GNISSEFGQLKELKFLDLSFNNFTGEVAPELSNCKKLEHVLLNNNQFIGMIPSWLGGLQK  671

Query  2221  lgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLC  2400
             LGEL LS N F G++P  L NCS LL LSL +NSL+G +PPE+GNL SLNVL+L  N L 
Sbjct  672   LGELDLSFNFFHGTVPAALGNCSILLKLSLNDNSLSGEIPPEMGNLTSLNVLDLQRNNLS  731

Query  2401  GSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLS  2580
             G IPST     KLYELRLS N  +G IP E+G L +LQ +LD S N  +GEIP S+G L 
Sbjct  732   GQIPSTFQQCKKLYELRLSENMLTGSIPSELGTLTELQVILDLSRNLFSGEIPSSLGNLM  791

Query  2581  KLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAHWPVDSFVGNSHLCG  2760
             KLESL++S N L GE+P  + +++SL  L+LS N L G+L   ++ +P+ SF+ N  LCG
Sbjct  792   KLESLNISFNQLQGEVPSSLGKLTSLHLLDLSNNHLRGQLPSTFSEFPLSSFMLNDKLCG  851

Query  2761  SPLGSCRDKGSRNK--------GSMVVVISALSATVAIILLLM  2865
              PL SC +   + K          ++V I   S  + ++LL +
Sbjct  852   PPLESCSEYAGQEKRRLSNTAVAGIIVAIVFTSTLICLVLLYI  894


 Score =   237 bits (604),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 195/550 (35%), Positives = 285/550 (52%), Gaps = 52/550 (9%)
 Frame = +1

Query  1201  SNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLN  1380
             S+ T+LQ L LS    +G IP EL   + L++L L +N L+G IP E+  L +L  L + 
Sbjct  91    SHLTSLQTLDLSLNAFAGSIPHELGLLQNLRELLLYSNYLSGKIPTEICLLKKLQVLRIG  150

Query  1381  NNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFS-------  1539
             +N L G I+PS+ NL  L+ L L +  L+G +P EIG L +L+ + L +N  S       
Sbjct  151   DNMLAGEITPSIGNLKELRVLGLAYCQLNGSIPAEIGNLKNLKFLDLQKNSLSSVIPEEI  210

Query  1540  -----------------GEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLR  1668
                              GEIP  +GN  SLQ ++   N  +G IPI LG L +L +L+L 
Sbjct  211   QGCVELQNFAASNNKLEGEIPASMGNLKSLQILNLANNSLSGSIPIELGGLSNLKYLNLL  270

Query  1669  ENDLSGEIPASLGNCHQLDTLDLADNHLSG------------------------AIPATF  1776
              N LSG IP+ L    QL  LDL+ N+LSG                        +IP  F
Sbjct  271   GNRLSGMIPSELNQLDQLQKLDLSSNNLSGTINFLNTQLKSLEVLALSDNLLTDSIPGNF  330

Query  1777  -GYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP-ICTSHSFLSFDV  1950
                  +L ++ L  N L G  P +L N  ++ +++LS N F G + P +    +     +
Sbjct  331   CTSSSSLRQIFLAQNKLSGTFPLELLNCSSIQQLDLSDNRFEGVLPPELEKLENLTDLLL  390

Query  1951  TNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQ  2130
              NN+F  ++P  +GN  SL+ L L  N  TG IP+ LG +++LS + L  N+LSG IP +
Sbjct  391   NNNSFSGKLPPEIGNMSSLETLYLFDNMITGNIPVELGKLQKLSSIYLYDNQLSGSIPRE  450

Query  2131  LSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlsl  2310
             L+ C  L+ +D   N   G IP  +G+L  L  L+L  N  SG +PP L  C KL  L+L
Sbjct  451   LTNCSSLSEIDFFGNHFMGSIPATIGKLRNLVFLQLRQNDLSGPIPPSLGYCKKLHTLTL  510

Query  2311  ennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPRE  2490
              +N L+G+LPP    L  L++ +L +N   G +P ++  L KL  +  S NRFSG I   
Sbjct  511   ADNKLSGSLPPTFRFLSELHLFSLYNNSFEGPLPESLFLLKKLGIINFSHNRFSGSILPL  570

Query  2491  VGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLN  2670
             +G   D  ++LD + N+ +G IP  +     L  L L+HN LTG I  +  ++  L  L+
Sbjct  571   LG--SDFLTLLDLTNNSFSGPIPSRLAMSKNLTRLRLAHNLLTGNISSEFGQLKELKFLD  628

Query  2671  LSCNELEGEL  2700
             LS N   GE+
Sbjct  629   LSFNNFTGEV  638


 Score =   234 bits (597),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 181/481 (38%), Positives = 249/481 (52%), Gaps = 27/481 (6%)
 Frame = +1

Query  1264  PELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTL  1443
             PE S    LQ LDLS N   GSIP EL  L  L +L+L +N L G I   +  L  LQ L
Sbjct  88    PEFSHLTSLQTLDLSLNAFAGSIPHELGLLQNLRELLLYSNYLSGKIPTEICLLKKLQVL  147

Query  1444  SLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIP  1623
              +  N L GE+   IG L +L+++ L     +G IP EIGN  +L+F+D   N  +  IP
Sbjct  148   RIGDNMLAGEITPSIGNLKELRVLGLAYCQLNGSIPAEIGNLKNLKFLDLQKNSLSSVIP  207

Query  1624  ITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRL  1803
               +     L       N L GEIPAS+GN   L  L+LA+N LSG+IP   G L  L  L
Sbjct  208   EEIQGCVELQNFAASNNKLEGEIPASMGNLKSLQILNLANNSLSGSIPIELGGLSNLKYL  267

Query  1804  MLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTS-HSFLSFDVTNNAFDQEIP  1980
              L  N L G +P +L  L  L +++LS NN SG+I  + T   S     +++N     IP
Sbjct  268   NLLGNRLSGMIPSELNQLDQLQKLDLSSNNLSGTINFLNTQLKSLEVLALSDNLLTDSIP  327

Query  1981  -SFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTH  2157
              +F  +S SL ++ L  N+ +G  P+ L     +  LDLS N+  G +PP+L        
Sbjct  328   GNFCTSSSSLRQIFLAQNKLSGTFPLELLNCSSIQQLDLSDNRFEGVLPPELE-------  380

Query  2158  LDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTL  2337
                              +L  L +L L++N FSG LPPE+ N S L  L L +N + G +
Sbjct  381   -----------------KLENLTDLLLNNNSFSGKLPPEIGNMSSLETLYLFDNMITGNI  423

Query  2338  PPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQS  2517
             P E+G L+ L+ + L DNQL GSIP  +     L E+    N F G IP  +G+L++L  
Sbjct  424   PVELGKLQKLSSIYLYDNQLSGSIPRELTNCSSLSEIDFFGNHFMGSIPATIGKLRNL-V  482

Query  2518  VLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGE  2697
              L    N+L+G IPPS+G   KL +L L+ N L+G +PP    +S L   +L  N  EG 
Sbjct  483   FLQLRQNDLSGPIPPSLGYCKKLHTLTLADNKLSGSLPPTFRFLSELHLFSLYNNSFEGP  542

Query  2698  L  2700
             L
Sbjct  543   L  543


 Score =   213 bits (542),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 162/448 (36%), Positives = 224/448 (50%), Gaps = 29/448 (6%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
             +G IP+ +G L NL  L++  N L+G IP S G    L TL LA   LS           
Sbjct  468   MGSIPATIGKLRNLVFLQLRQNDLSGPIPPSLGYCKKLHTLTLADNKLS-----------  516

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
                          G LPP    +S L  FS   NS  G +P+ L  LK L I+N ++N  
Sbjct  517   -------------GSLPPTFRFLSELHLFSLYNNSFEGPLPESLFLLKKLGIINFSHNRF  563

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             +G I   LG    L  L+L  N   G IP  LA   NL  L L+ N L G +  EFG + 
Sbjct  564   SGSILPLLGS-DFLTLLDLTNNSFSGPIPSRLAMSKNLTRLRLAHNLLTGNISSEFGQLK  622

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
             +L+FL L+ NN +G +   L SN   L+ ++L+     G IP  L   + L +LDLS N 
Sbjct  623   ELKFLDLSFNNFTGEVAPEL-SNCKKLEHVLLNNNQFIGMIPSWLGGLQKLGELDLSFNF  681

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
              +G++P  L   + L  L LN+N+L G I P + NLT+L  L L  NNL G++P      
Sbjct  682   FHGTVPAALGNCSILLKLSLNDNSLSGEIPPEMGNLTSLNVLDLQRNNLSGQIPSTFQQC  741

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFI-DFYGNQFTGKIPITLGRLKHLFFLHLREN  1674
               L  + L EN  +G IP E+G  + LQ I D   N F+G+IP +LG L  L  L++  N
Sbjct  742   KKLYELRLSENMLTGSIPSELGTLTELQVILDLSRNLFSGEIPSSLGNLMKLESLNISFN  801

Query  1675  DLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRN  1854
              L GE+P+SLG    L  LDL++NHL G +P+TF     L+  ML N+ L G   +    
Sbjct  802   QLQGEVPSSLGKLTSLHLLDLSNNHLRGQLPSTFSEF-PLSSFML-NDKLCGPPLESCSE  859

Query  1855  LGNLTRINLSHNNFSGSIAPICTSHSFL  1938
                  +  LS+   +G I  I  + + +
Sbjct  860   YAGQEKRRLSNTAVAGIIVAIVFTSTLI  887


 Score =   144 bits (362),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 140/443 (32%), Positives = 193/443 (44%), Gaps = 105/443 (24%)
 Frame = +1

Query  1720  LDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFS  1899
             L TLDL+ N  +G+IP   G L+ L  L+LY+N L G +P ++  L  L  + +  N  +
Sbjct  96    LQTLDLSLNAFAGSIPHELGLLQNLRELLLYSNYLSGKIPTEICLLKKLQVLRIGDNMLA  155

Query  1900  GSIAP--------------ICTSHSFLSFDVTN---------------------------  1956
             G I P               C  +  +  ++ N                           
Sbjct  156   GEITPSIGNLKELRVLGLAYCQLNGSIPAEIGNLKNLKFLDLQKNSLSSVIPEEIQGCVE  215

Query  1957  --------NAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLS  2112
                     N  + EIP+ +GN  SL  L L +N  +G IP+ LG +  L  L+L GN+LS
Sbjct  216   LQNFAASNNKLEGEIPASMGNLKSLQILNLANNSLSGSIPIELGGLSNLKYLNLLGNRLS  275

Query  2113  GFIPPQLSLCRKLTHLDLNNNLLSGPIPV-------------------------Wlgrlp  2217
             G IP +L+   +L  LDL++N LSG I                           +     
Sbjct  276   GMIPSELNQLDQLQKLDLSSNNLSGTINFLNTQLKSLEVLALSDNLLTDSIPGNFCTSSS  335

Query  2218  llgelklSSNQFSGSLPPELFNCskllvlsle------------------------nnsl  2325
              L ++ L+ N+ SG+ P EL NCS +  L L                         NNS 
Sbjct  336   SLRQIFLAQNKLSGTFPLELLNCSSIQQLDLSDNRFEGVLPPELEKLENLTDLLLNNNSF  395

Query  2326  nGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLK  2505
             +G LPPEIGN+ SL  L L DN + G+IP  +G L KL  + L  N+ SG IPRE+    
Sbjct  396   SGKLPPEIGNMSSLETLYLFDNMITGNIPVELGKLQKLSSIYLYDNQLSGSIPRELTNCS  455

Query  2506  DLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNE  2685
              L S +DF  N+  G IP +IG L  L  L L  NDL+G IPP +     L  L L+ N+
Sbjct  456   SL-SEIDFFGNHFMGSIPATIGKLRNLVFLQLRQNDLSGPIPPSLGYCKKLHTLTLADNK  514

Query  2686  LEGELDKRYAHWPVDSFVGNSHL  2754
             L G L       P   F+   HL
Sbjct  515   LSGSLP------PTFRFLSELHL  531



>emb|CAD41180.1| OSJNBb0002J11.4 [Oryza sativa Japonica Group]
 emb|CAE05566.1| OSJNBb0116K07.19 [Oryza sativa Japonica Group]
 emb|CAH67267.1| OSIGBa0145C12.4 [Oryza sativa Indica Group]
Length=1104

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/912 (41%), Positives = 526/912 (58%), Gaps = 28/912 (3%)
 Frame = +1

Query  880   SLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAK  1059
             +L+G++   +GGL  L  L+L+ N  +G IP ++G  S L  LNL  NQ  G+IP  L K
Sbjct  86    NLSGTVDPSIGGLAELTNLDLSFNGFSGTIPAEIGNCSKLTGLNLNNNQFQGTIPAELGK  145

Query  1060  LTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSE  1239
             L  + + +L  N+L G +P E G+M  L+ L   SNNLSG+IP ++     NL+ + L +
Sbjct  146   LAMMITFNLCNNKLFGAIPDEIGNMASLEDLVGYSNNLSGSIPHTI-GRLKNLKTVRLGQ  204

Query  1240  TGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVA  1419
               +SG IP E+ +C  L    L+ N L G +P+E+ +LT +TDL+L  N L   I P + 
Sbjct  205   NAISGNIPVEIGECLNLVVFGLAQNKLGGPLPKEIGKLTNMTDLILWGNQLSSVIPPEIG  264

Query  1420  NLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYG  1599
             N  NL+T++L+ NNL G +P  IG + +LQ ++LY N  +G IP+EIGN S  + IDF  
Sbjct  265   NCINLRTIALYDNNLVGPIPATIGNIQNLQRLYLYRNLLNGTIPLEIGNLSLAEEIDFSE  324

Query  1600  NQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFG  1779
             N  TG +P   G++  L+ L+L +N L+G IP  L     L  LDL+ N LSG IPA F 
Sbjct  325   NVLTGGVPKEFGKIPRLYLLYLFQNQLTGPIPTELCVLRNLSKLDLSINTLSGPIPACFQ  384

Query  1780  YLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIA-PICTSHSFLSFDVTN  1956
             Y+  L +L L+NN L GD+P        L  ++ S+NN +G I   +C   + +  ++  
Sbjct  385   YMSRLIQLQLFNNMLSGDIPPRFGIYSRLWVVDFSNNNITGQIPRDLCRQSNLILLNLGA  444

Query  1957  NAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLS  2136
             N     IP  + +  SL +LRL  N  TG  P  L  +  L+ ++L  NK +G IPPQ+ 
Sbjct  445   NKLIGNIPHGITSCKSLVQLRLADNSLTGSFPTDLCNLVNLTTIELGRNKFNGPIPPQIG  504

Query  2137  LCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslen  2316
              C+ L  LDL NN  +  +P  +G L  L    +SSN+  GS+P E+FNC+ L  L L  
Sbjct  505   NCKSLQRLDLTNNYFTSELPQEIGNLSKLVVFNISSNRLGGSIPLEIFNCTMLQRLDLSQ  564

Query  2317  nslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVG  2496
             NS  G+LP E+G+L  L +L+  DN+L G IP  +G L  L  L++  N+FSG IP+E+G
Sbjct  565   NSFEGSLPNEVGSLPQLELLSFADNRLSGEIPPILGKLSHLTALQIGGNQFSGGIPKELG  624

Query  2497  QLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLS  2676
              L  LQ  ++ SYNNL+G IP  +G L+ LE+L L++N LTGEIP   A +SSL   N+S
Sbjct  625   LLSSLQIAMNLSYNNLSGNIPSELGNLALLENLFLNNNKLTGEIPDTFANLSSLLEFNVS  684

Query  2677  CNELEGELDK--RYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKGSMVVVISALSATVAI  2850
              N L G L     + +    SF+GN  LCG  LG C  +   +  S       L   +AI
Sbjct  685   YNNLTGALPTIPLFDNMASTSFLGNKGLCGGQLGKCGSESISSSQSSNSGSPPLGKVIAI  744

Query  2851  ILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFG-----NAAKKRDIRWD  3015
             +  ++G           Y  R+  E  A         Q K +F        + K    + 
Sbjct  745   VAAVIGGISLILIVIIVYHMRKPLETVA-------PLQDKQIFSAGSNMQVSTKDAYTFQ  797

Query  3016  DIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIP-RKDDLFLDKSFAREIKTLW  3192
             +++ ATNN  +  +IG G C TVY+A L  G+T+A+K++   ++    D SF  EI TL 
Sbjct  798   ELVSATNNFDESCVIGRGACGTVYRAILKAGQTIAVKKLASNREGSNTDNSFRAEILTLG  857

Query  3193  RIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKKSLDWEARLKIA  3372
             +IRHR++V+L G+  +  +GSN+L+YEYM  GS+ + LH Q     S  SLDWE R  IA
Sbjct  858   KIRHRNIVKLYGFIYH--QGSNLLLYEYMPRGSLGELLHGQ-----SSSSLDWETRFMIA  910

Query  3373  MGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSLNTESNT  3552
             +G A+G+ YLHHDC P+IIHRDIKS+N+LLD N EAH+GDFGLAK +   Y    ++S +
Sbjct  911   LGSAEGLSYLHHDCKPRIIHRDIKSNNILLDENFEAHVGDFGLAKVIDMPY----SKSMS  966

Query  3553  WFAGSYGYIAPE  3588
               AGSYGYIAPE
Sbjct  967   AIAGSYGYIAPE  978


 Score =   221 bits (564),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 157/415 (38%), Positives = 231/415 (56%), Gaps = 2/415 (0%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrlt  777
             VGPIP+ +G + NLQ L +  N L G IP   GNL     +  +   L+G +P + G++ 
Sbjct  280   VGPIPATIGNIQNLQRLYLYRNLLNGTIPLEIGNLSLAEEIDFSENVLTGGVPKEFGKIP  339

Query  778   qlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTL  957
             +L  L L QN L GP+P E+  + +L+    ++N+L+G IP     +  L  L L NN L
Sbjct  340   RLYLLYLFQNQLTGPIPTELCVLRNLSKLDLSINTLSGPIPACFQYMSRLIQLQLFNNML  399

Query  958   TGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMG  1137
             +G+IP + G  S L  ++   N + G IP+ L + +NL  L+L  N+L G +P    S  
Sbjct  400   SGDIPPRFGIYSRLWVVDFSNNNITGQIPRDLCRQSNLILLNLGANKLIGNIPHGITSCK  459

Query  1138  QLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNT  1317
              L  L L  N+L+G+ P  LC N  NL  + L     +G IPP++  C+ LQ+LDL+NN 
Sbjct  460   SLVQLRLADNSLTGSFPTDLC-NLVNLTTIELGRNKFNGPIPPQIGNCKSLQRLDLTNNY  518

Query  1318  LNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGML  1497
                 +P+E+  L++L    +++N L G+I   + N T LQ L L  N+  G +P E+G L
Sbjct  519   FTSELPQEIGNLSKLVVFNISSNRLGGSIPLEIFNCTMLQRLDLSQNSFEGSLPNEVGSL  578

Query  1498  GDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHL-FFLHLREN  1674
               L+++   +N  SGEIP  +G  S L  +   GNQF+G IP  LG L  L   ++L  N
Sbjct  579   PQLELLSFADNRLSGEIPPILGKLSHLTALQIGGNQFSGGIPKELGLLSSLQIAMNLSYN  638

Query  1675  DLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLP  1839
             +LSG IP+ LGN   L+ L L +N L+G IP TF  L +L    +  N+L G LP
Sbjct  639   NLSGNIPSELGNLALLENLFLNNNKLTGEIPDTFANLSSLLEFNVSYNNLTGALP  693


 Score =   211 bits (537),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 174/502 (35%), Positives = 231/502 (46%), Gaps = 74/502 (15%)
 Frame = +1

Query  1438  TLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGK  1617
             +L+L + NL G V   IG L +L  + L  N FSG IP EIGNCS L  ++   NQF G 
Sbjct  79    SLNLSNMNLSGTVDPSIGGLAELTNLDLSFNGFSGTIPAEIGNCSKLTGLNLNNNQFQGT  138

Query  1618  IPI------------------------------------------------TLGRLKHLF  1653
             IP                                                 T+GRLK+L 
Sbjct  139   IPAELGKLAMMITFNLCNNKLFGAIPDEIGNMASLEDLVGYSNNLSGSIPHTIGRLKNLK  198

Query  1654  FLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGD  1833
              + L +N +SG IP  +G C  L    LA N L G +P   G L  +T L+L+ N L   
Sbjct  199   TVRLGQNAISGNIPVEIGECLNLVVFGLAQNKLGGPLPKEIGKLTNMTDLILWGNQLSSV  258

Query  1834  LPDDLRNLGNLTRINLSHNNFSGSIAPICTS--------------HSFLSFDVTNNAFDQ  1971
             +P ++ N  NL  I L  NN  G I     +              +  +  ++ N +  +
Sbjct  259   IPPEIGNCINLRTIALYDNNLVGPIPATIGNIQNLQRLYLYRNLLNGTIPLEIGNLSLAE  318

Query  1972  EI-----------PSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGF  2118
             EI           P   G  P L  L L  N+ TG IP  L ++R LS LDLS N LSG 
Sbjct  319   EIDFSENVLTGGVPKEFGKIPRLYLLYLFQNQLTGPIPTELCVLRNLSKLDLSINTLSGP  378

Query  2119  IPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskll  2298
             IP       +L  L L NN+LSG IP   G    L  +  S+N  +G +P +L   S L+
Sbjct  379   IPACFQYMSRLIQLQLFNNMLSGDIPPRFGIYSRLWVVDFSNNNITGQIPRDLCRQSNLI  438

Query  2299  vlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGE  2478
             +L+L  N L G +P  I + KSL  L L DN L GS P+ +  L  L  + L RN+F+G 
Sbjct  439   LLNLGANKLIGNIPHGITSCKSLVQLRLADNSLTGSFPTDLCNLVNLTTIELGRNKFNGP  498

Query  2479  IPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSL  2658
             IP ++G  K LQ  LD + N  T E+P  IG LSKL   ++S N L G IP ++   + L
Sbjct  499   IPPQIGNCKSLQR-LDLTNNYFTSELPQEIGNLSKLVVFNISSNRLGGSIPLEIFNCTML  557

Query  2659  GRLNLSCNELEGELDKRYAHWP  2724
              RL+LS N  EG L       P
Sbjct  558   QRLDLSQNSFEGSLPNEVGSLP  579


 Score =   175 bits (444),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 135/385 (35%), Positives = 197/385 (51%), Gaps = 7/385 (2%)
 Frame = +1

Query  1564  NCSS-----LQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDT  1728
             NCSS     +  ++      +G +  ++G L  L  L L  N  SG IPA +GNC +L  
Sbjct  68    NCSSGSTPAVVSLNLSNMNLSGTVDPSIGGLAELTNLDLSFNGFSGTIPAEIGNCSKLTG  127

Query  1729  LDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSI  1908
             L+L +N   G IPA  G L  +    L NN L G +PD++ N+ +L  +    NN SGSI
Sbjct  128   LNLNNNQFQGTIPAELGKLAMMITFNLCNNKLFGAIPDEIGNMASLEDLVGYSNNLSGSI  187

Query  1909  A-PICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSL  2085
                I    +  +  +  NA    IP  +G   +L    L  N+  G +P  +G +  ++ 
Sbjct  188   PHTIGRLKNLKTVRLGQNAISGNIPVEIGECLNLVVFGLAQNKLGGPLPKEIGKLTNMTD  247

Query  2086  LDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSL  2265
             L L GN+LS  IPP++  C  L  + L +N L GPIP  +G +  L  L L  N  +G++
Sbjct  248   LILWGNQLSSVIPPEIGNCINLRTIALYDNNLVGPIPATIGNIQNLQRLYLYRNLLNGTI  307

Query  2266  PPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYE  2445
             P E+ N S    +    N L G +P E G +  L +L L  NQL G IP+ +  L  L +
Sbjct  308   PLEIGNLSLAEEIDFSENVLTGGVPKEFGKIPRLYLLYLFQNQLTGPIPTELCVLRNLSK  367

Query  2446  LRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGE  2625
             L LS N  SG IP     +  L  +  F+ N L+G+IPP  G  S+L  +D S+N++TG+
Sbjct  368   LDLSINTLSGPIPACFQYMSRLIQLQLFN-NMLSGDIPPRFGIYSRLWVVDFSNNNITGQ  426

Query  2626  IPPQVAEMSSLGRLNLSCNELEGEL  2700
             IP  +   S+L  LNL  N+L G +
Sbjct  427   IPRDLCRQSNLILLNLGANKLIGNI  451


 Score =   170 bits (430),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 133/369 (36%), Positives = 195/369 (53%), Gaps = 7/369 (2%)
 Frame = +1

Query  1690  IPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLT  1869
             +  S G+   + +L+L++ +LSG +  + G L  LT L L  N   G +P ++ N   LT
Sbjct  67    VNCSSGSTPAVVSLNLSNMNLSGTVDPSIGGLAELTNLDLSFNGFSGTIPAEIGNCSKLT  126

Query  1870  RINLSHNNFSGSI-APICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGK  2046
              +NL++N F G+I A +      ++F++ NN     IP  +GN  SL+ L   SN  +G 
Sbjct  127   GLNLNNNQFQGTIPAELGKLAMMITFNLCNNKLFGAIPDEIGNMASLEDLVGYSNNLSGS  186

Query  2047  IPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllg  2226
             IP T+G ++ L  + L  N +SG IP ++  C  L    L  N L GP+P  +G+L  + 
Sbjct  187   IPHTIGRLKNLKTVRLGQNAISGNIPVEIGECLNLVVFGLAQNKLGGPLPKEIGKLTNMT  246

Query  2227  elklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGS  2406
             +L L  NQ S  +PPE+ NC  L  ++L +N+L G +P  IGN+++L  L L  N L G+
Sbjct  247   DLILWGNQLSSVIPPEIGNCINLRTIALYDNNLVGPIPATIGNIQNLQRLYLYRNLLNGT  306

Query  2407  IPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKL  2586
             IP  IG L    E+  S N  +G +P+E G++  L  +  F  N LTG IP  +  L  L
Sbjct  307   IPLEIGNLSLAEEIDFSENVLTGGVPKEFGKIPRLYLLYLFQ-NQLTGPIPTELCVLRNL  365

Query  2587  ESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKRYAH----WPVDSFVGNSHL  2754
               LDLS N L+G IP     MS L +L L  N L G++  R+      W VD F  N+  
Sbjct  366   SKLDLSINTLSGPIPACFQYMSRLIQLQLFNNMLSGDIPPRFGIYSRLWVVD-FSNNNIT  424

Query  2755  CGSPLGSCR  2781
                P   CR
Sbjct  425   GQIPRDLCR  433


 Score =   132 bits (331),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 122/318 (38%), Positives = 160/318 (50%), Gaps = 26/318 (8%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             G IPP     S L  +   +N + G IP  L   +NL  L +G N L G IP    +  +
Sbjct  401   GDIPPRFGIYSRLWVVDFSNNNITGQIPRDLCRQSNLILLNLGANKLIGNIPHGITSCKS  460

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
             LV L LA   L+G  P  L  L  L  + L +N   GP+PP+I N               
Sbjct  461   LVQLRLADNSLTGSFPTDLCNLVNLTTIELGRNKFNGPIPPQIGNC--------------  506

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
                       K L  L+L NN  T E+P ++G +S LV  N+  N+LGGSIP  +   T 
Sbjct  507   ----------KSLQRLDLTNNYFTSELPQEIGNLSKLVVFNISSNRLGGSIPLEIFNCTM  556

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             LQ LDLS N   G LP E GS+ QL+ L+   N LSG IP  L    ++L  L +     
Sbjct  557   LQRLDLSQNSFEGSLPNEVGSLPQLELLSFADNRLSGEIPPIL-GKLSHLTALQIGGNQF  615

Query  1249  SGEIPPELSQCRVLQ-QLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANL  1425
             SG IP EL     LQ  ++LS N L+G+IP EL  L  L +L LNNN L G I  + ANL
Sbjct  616   SGGIPKELGLLSSLQIAMNLSYNNLSGNIPSELGNLALLENLFLNNNKLTGEIPDTFANL  675

Query  1426  TNLQTLSLFHNNLHGEVP  1479
             ++L   ++ +NNL G +P
Sbjct  676   SSLLEFNVSYNNLTGALP  693



>ref|XP_007210387.1| hypothetical protein PRUPE_ppa000993mg [Prunus persica]
 gb|EMJ11586.1| hypothetical protein PRUPE_ppa000993mg [Prunus persica]
Length=938

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/894 (47%), Positives = 543/894 (61%), Gaps = 22/894 (2%)
 Frame = +1

Query  349   LQGWSEKNPNYCSWQGVSC-DGslkvvslnlsdsslggsispslgllthllhldlssnhl  525
             L  WS +  + CSW G+SC D  + +  LNLS S L GSI   L  LT +  LDLSSN L
Sbjct  43    LDNWSPR-AHICSWNGLSCSDDQIHIFGLNLSGSGLSGSIPRELWQLTSIETLDLSSNSL  101

Query  526   sGPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLG  705
             +GP+PP L  L +LE+LLL+SN L G IP ++GLL NLQ LRIGDN L+G I  S GNL 
Sbjct  102   TGPLPPELQQLQNLETLLLYSNFLSGEIPPEVGLLKNLQVLRIGDNLLSGAITPSIGNLT  161

Query  706   NLVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSL  885
              L  LGLA C L+G IP  +G L  L +L+LQ N L G +P EI     L  F+A+ N L
Sbjct  162   ELRVLGLAYCQLNGSIPVDIGNLKHLISLDLQNNSLSGLIPEEIHGCEELQNFAASNNML  221

Query  886   NGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLT  1065
              G IP  +G LK L ILNLANN+L+G IP             +L N+L G IP  L +L 
Sbjct  222   EGDIPSSIGSLKLLQILNLANNSLSGSIPV------------VLRNRLNGDIPLELNQLV  269

Query  1066  NLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETG  1245
              L+ LDLS N L+G +      +  L+ L L+ N L+G+IP++ C   +NL+ L+L+   
Sbjct  270   QLEMLDLSQNNLSGSIHLLSTQLKNLEALVLSDNALTGSIPRNFCLRNSNLRQLLLARNK  329

Query  1246  LSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANL  1425
             L+G  P E+  C  LQQLDLS+N+  G +P  L +L  L DLVLNNN+  GT+ P + N+
Sbjct  330   LTGRFPLEVLSCYSLQQLDLSDNSFGGELPAALDKLENLIDLVLNNNSFTGTLPPEIGNM  389

Query  1426  TNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQ  1605
             + L+ L LF N + G +P EIG L  L+ I+LY+N  SG IP+E+ NCS L  IDF+GN 
Sbjct  390   SYLENLYLFGNMITGGIPVEIGKLQRLKTIYLYDNQMSGSIPIELTNCSDLTGIDFFGNH  449

Query  1606  FTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYL  1785
             FTG IP T+G LK+L  L LR+N LSG IP SLG C  L  L LADN L+G +P TF ++
Sbjct  450   FTGPIPATIGNLKNLVLLQLRQNGLSGPIPPSLGYCRSLQLLALADNKLTGTLPPTFRFI  509

Query  1786  RALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLSFDVTNNAF  1965
               L+ + LYNNS EG LP  L  L NL  IN SHN FSG+I P+  S+S  + D+TNN+F
Sbjct  510   SQLSTITLYNNSFEGPLPSSLFLLKNLKIINFSHNRFSGTIFPLSGSNSLTAVDLTNNSF  569

Query  1966  DQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCR  2145
                IPS L    +L RLRL  N  TG IP   G + +L+ LDLS N L+G +PPQLS C+
Sbjct  570   SGSIPSRLSMCRNLSRLRLAHNHLTGTIPSEFGQLTQLNFLDLSYNNLTGEVPPQLSSCK  629

Query  2146  KLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennsl  2325
             ++ HL L++N   G IP WLG L  LGEL  SSN F G++P EL  CS LL LSL  NSL
Sbjct  630   RVEHLLLSDNQFRGTIPPWLGSLQELGELDFSSNNFHGTVPAELGKCSNLLKLSLHGNSL  689

Query  2326  nGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLK  2505
             +  +P EIGNL SLNVLNL  N   GSI STI    KLYELRLS N  +G IP E+G+L 
Sbjct  690   SNMIPEEIGNLTSLNVLNLQRNNFSGSISSTIRQCKKLYELRLSENFLTGLIPFELGELT  749

Query  2506  DLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNE  2685
             +LQ +LD S N  +GEIP S+G L KLE L+LS N L GE+P  + +++SL  LNLS N 
Sbjct  750   ELQVILDLSKNLFSGEIPSSLGNLMKLERLNLSSNQLQGEVPVSLGKLTSLHMLNLSNNH  809

Query  2686  LEGELDKRYAHWPVDSFVGNSHLCGSPLGSC-RDKGSRNK----GSMVVVISALSATVAI  2850
             L+G++   ++ +P+ SF+ N  LCG PL  C   +G R K     ++  +  A+  T  +
Sbjct  810   LQGQIPSTFSGFPLSSFLRNDKLCGPPLAKCLESQGQRKKHLSDAAVTGITVAIVLTSTV  869

Query  2851  ILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGNAAKKRDIRW  3012
             I L+M    +         R+    N     +   + + K   GN  K+    W
Sbjct  870   ICLVM---LYIMLRMWCKWRKVSISNLDGGGAEYKREEEKWGLGNEKKRPGEYW  920



>ref|XP_010264019.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g63930 [Nelumbo nucifera]
Length=1107

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/921 (41%), Positives = 538/921 (58%), Gaps = 26/921 (3%)
 Frame = +1

Query  856   TAFSAALNSLN--GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQL  1029
               +S  L+S+N  G++   +GGL HL  L+L+ N L+G IP ++G  S L  L L  NQ 
Sbjct  78    VVWSLDLHSMNLSGNLSSSIGGLVHLTYLDLSYNKLSGSIPMEIGSCSKLELLYLNNNQF  137

Query  1030  GGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNA  1209
              G IP  L  +++L  L+L  N+++G LP E G++  L  L   +N LSG +P+SL  N 
Sbjct  138   EGEIPVELGNMSSLTELNLCNNKISGHLPEELGNLSSLVQLVAYTNKLSGPLPRSL-GNL  196

Query  1210  TNLQLLMLSETGLSGEIPPELSQ-CRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNN  1386
               L++    +  +SG IP E+ + C  L+ L +S + L+G IP+EL  L +L +L+L +N
Sbjct  197   KRLRIFRAGQNLISGSIPVEIIEGCESLEVLGISQSQLSGEIPKELGMLGKLKELLLYSN  256

Query  1387  TLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGN  1566
              L G I   + N TNL+TL+L+ NNL G +P EIG L  L  ++LY N  +G IP EIGN
Sbjct  257   ELSGVIPKELGNCTNLKTLALYQNNLVGGIPMEIGNLRFLDKLYLYRNALNGTIPKEIGN  316

Query  1567  CSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADN  1746
              S    IDF  N  TGKIPI L ++K L  LHL +N L+G IP  LG+   L  LDL+ N
Sbjct  317   LSMATEIDFSQNLLTGKIPIELSKIKSLRLLHLFQNQLTGIIPDELGSLRNLTKLDLSMN  376

Query  1747  HLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP-ICT  1923
             +L+G IP  F YL  L +L L++N L G++P  L     L  ++LS NN +G I   +C 
Sbjct  377   YLTGHIPVGFQYLTELLQLQLFHNLLSGNIPQRLGLYSRLWVVDLSENNLTGQIPHHLCR  436

Query  1924  SHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGN  2103
               + +S ++ +N     IP+ + N  SL +LRL  N  TG +P  L  +  LS ++L  N
Sbjct  437   HSNLISLNLGSNRLTGNIPTEVTNCKSLVQLRLVGNSLTGSLPSDLCKLVNLSAIELDHN  496

Query  2104  KLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFN  2283
             + SG IPP++  C+ L  L L+ N  +  +P  +G L  L    +SSN  +G +P E+ N
Sbjct  497   RFSGPIPPEIGNCKTLQRLHLSENYFTSELPKEIGNLSQLVIFNISSNMLTGQIPREVVN  556

Query  2284  CskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRN  2463
             C  L  L L  N    +LP EIGNL  L +L L +N+L GSIP+++G L +L EL++  N
Sbjct  557   CRMLQRLDLSRNRFTNSLPHEIGNLSQLELLKLSENKLSGSIPASLGNLSRLTELQMGGN  616

Query  2464  RFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVA  2643
               SG IP E+G+L  LQ  ++ SYNNL+G IPP +G L  LE L L++N LTGEIP    
Sbjct  617   ALSGVIPPELGRLSSLQIAMNLSYNNLSGNIPPELGNLILLECLLLNNNHLTGEIPDTFG  676

Query  2644  EMSSLGRLNLSCNELEGELDK--RYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKGSMVV  2817
              +SSL   NLS N L G L     + +  + SF+GN  LCG PL  C    S        
Sbjct  677   NLSSLLGFNLSYNNLTGPLPSIPLFQNMAISSFIGNKGLCGGPLQGCSGSPSSPSFLPNS  736

Query  2818  V-ISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGNA--  2988
                + LS  VAI+   +G           Y  RR  ++ A       +    PL  +   
Sbjct  737   QGATPLSKIVAIVAAAVGGVSLVLIVVIVYFIRRPVDDVA---PFQDKQLSFPLSDDMYF  793

Query  2989  AKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRI-PRKDDLFLDKS  3165
             + K    + D++EATNN +D F+IG G C TVY+A + +G+T+A+K++   ++   ++ S
Sbjct  794   SPKEGFTFQDLLEATNNFNDSFVIGRGACGTVYRAVMPSGQTIAVKKLESNREGNNIENS  853

Query  3166  FAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKKSL  3345
             F  EI TL ++RHR++V+L G+C +  +GSN+L+YEYM  GS+ + LH    N      L
Sbjct  854   FRTEILTLGKVRHRNIVKLYGFCYH--QGSNLLLYEYMGKGSLGELLHGSSCN------L  905

Query  3346  DWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNY  3525
             +W  RL IA+G AQG+ YLHHDC PKIIHRDIKS+N+LLD N EAH+GDFGLAK +    
Sbjct  906   EWRTRLAIALGAAQGLAYLHHDCKPKIIHRDIKSNNILLDDNFEAHVGDFGLAKII----  961

Query  3526  DSLNTESNTWFAGSYGYIAPE  3588
             D   ++S +  AGSYGYIAPE
Sbjct  962   DMPQSKSMSAIAGSYGYIAPE  982


 Score =   265 bits (676),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 196/503 (39%), Positives = 259/503 (51%), Gaps = 26/503 (5%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP +LG+L  L+ L +  N L+G IP   GN  NL TL L    L G IP ++G L  
Sbjct  236   GEIPKELGMLGKLKELLLYSNELSGVIPKELGNCTNLKTLALYQNNLVGGIPMEIGNLRF  295

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L  L L +N L G +P EI N+S  T    + N L G IP EL  +K L +L+L  N LT
Sbjct  296   LDKLYLYRNALNGTIPKEIGNLSMATEIDFSQNLLTGKIPIELSKIKSLRLLHLFQNQLT  355

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             G IP +LG + +L  L+L  N L G IP     LT L  L L  N L+G +P   G   +
Sbjct  356   GIIPDELGSLRNLTKLDLSMNYLTGHIPVGFQYLTELLQLQLFHNLLSGNIPQRLGLYSR  415

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L  + L+ NNL+G IP  LC + +NL  L L    L+G IP E++ C+ L QL L  N+L
Sbjct  416   LWVVDLSENNLTGQIPHHLCRH-SNLISLNLGSNRLTGNIPTEVTNCKSLVQLRLVGNSL  474

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
              GS+P +L +L  L+ + L++N   G I P + N   LQ L L  N    E+P+EIG L 
Sbjct  475   TGSLPSDLCKLVNLSAIELDHNRFSGPIPPEIGNCKTLQRLHLSENYFTSELPKEIGNLS  534

Query  1501  DLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDL  1680
              L I  +  N  +G+IP E+ NC  LQ +D   N+FT  +P  +G L  L  L L EN L
Sbjct  535   QLVIFNISSNMLTGQIPREVVNCRMLQRLDLSRNRFTNSLPHEIGNLSQLELLKLSENKL  594

Query  1681  SGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLG  1860
             SG IPASLGN  +L  L +  N LSG IP   G L +L   M                  
Sbjct  595   SGSIPASLGNLSRLTELQMGGNALSGVIPPELGRLSSLQIAM------------------  636

Query  1861  NLTRINLSHNNFSGSIAP-ICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRF  2037
                  NLS+NN SG+I P +          + NN    EIP   GN  SL    L  N  
Sbjct  637   -----NLSYNNLSGNIPPELGNLILLECLLLNNNHLTGEIPDTFGNLSSLLGFNLSYNNL  691

Query  2038  TGKIPMTLGLIRELSLLDLSGNK  2106
             TG +P ++ L + +++    GNK
Sbjct  692   TGPLP-SIPLFQNMAISSFIGNK  713


 Score =   152 bits (385),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 123/316 (39%), Positives = 171/316 (54%), Gaps = 3/316 (1%)
 Frame = +1

Query  1759  AIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFL  1938
              +  TF Y   +  L L++ +L G+L   +  L +LT ++LS+N  SGSI     S S L
Sbjct  68    GVNCTFDYNPVVWSLDLHSMNLSGNLSSSIGGLVHLTYLDLSYNKLSGSIPMEIGSCSKL  127

Query  1939  S-FDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSG  2115
                 + NN F+ EIP  LGN  SL  L L +N+ +G +P  LG +  L  L    NKLSG
Sbjct  128   ELLYLNNNQFEGEIPVELGNMSSLTELNLCNNKISGHLPEELGNLSSLVQLVAYTNKLSG  187

Query  2116  FIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgr-lpllgelklSSNQFSGSLPPELFNCsk  2292
              +P  L   ++L       NL+SG IPV +      L  L +S +Q SG +P EL    K
Sbjct  188   PLPRSLGNLKRLRIFRAGQNLISGSIPVEIIEGCESLEVLGISQSQLSGEIPKELGMLGK  247

Query  2293  llvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFS  2472
             L  L L +N L+G +P E+GN  +L  L L  N L G IP  IG L  L +L L RN  +
Sbjct  248   LKELLLYSNELSGVIPKELGNCTNLKTLALYQNNLVGGIPMEIGNLRFLDKLYLYRNALN  307

Query  2473  GEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMS  2652
             G IP+E+G L  + + +DFS N LTG+IP  +  +  L  L L  N LTG IP ++  + 
Sbjct  308   GTIPKEIGNLS-MATEIDFSQNLLTGKIPIELSKIKSLRLLHLFQNQLTGIIPDELGSLR  366

Query  2653  SLGRLNLSCNELEGEL  2700
             +L +L+LS N L G +
Sbjct  367   NLTKLDLSMNYLTGHI  382


 Score =   126 bits (317),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 99/238 (42%), Positives = 136/238 (57%), Gaps = 2/238 (1%)
 Frame = +1

Query  1999  PSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLNNNL  2178
             P +  L L S   +G +  ++G +  L+ LDLS NKLSG IP ++  C KL  L LNNN 
Sbjct  77    PVVWSLDLHSMNLSGNLSSSIGGLVHLTYLDLSYNKLSGSIPMEIGSCSKLELLYLNNNQ  136

Query  2179  LSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEIGNL  2358
               G IPV LG +  L EL L +N+ SG LP EL N S L+ L    N L+G LP  +GNL
Sbjct  137   FEGEIPVELGNMSSLTELNLCNNKISGHLPEELGNLSSLVQLVAYTNKLSGPLPRSLGNL  196

Query  2359  KSLNVLNLDDNQLCGSIP-STIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDFSY  2535
             K L +     N + GSIP   I G   L  L +S+++ SGEIP+E+G L  L+ +L +S 
Sbjct  197   KRLRIFRAGQNLISGSIPVEIIEGCESLEVLGISQSQLSGEIPKELGMLGKLKELLLYS-  255

Query  2536  NNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGELDKR  2709
             N L+G IP  +G  + L++L L  N+L G IP ++  +  L +L L  N L G + K 
Sbjct  256   NELSGVIPKELGNCTNLKTLALYQNNLVGGIPMEIGNLRFLDKLYLYRNALNGTIPKE  313



>ref|XP_006653582.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930-like [Oryza brachyantha]
Length=1102

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/912 (41%), Positives = 525/912 (58%), Gaps = 29/912 (3%)
 Frame = +1

Query  880   SLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAK  1059
             +L+G++   +G L  L  L+L+ N L+G IP ++G  S LV L L  N   G+IP  L K
Sbjct  85    NLSGTVDPGIGDLAELTYLDLSFNGLSGTIPAEIGNCSKLVGLYLNNNYFQGTIPPELGK  144

Query  1060  LTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSE  1239
             L  L + +L  N+L G +P E G+M  L+ L   SNNLSG+IP+S+     NL+ + L +
Sbjct  145   LAMLTTFNLCNNKLLGAIPDEIGNMASLEDLVGYSNNLSGSIPRSI-GRLKNLRTVRLGQ  203

Query  1240  TGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVA  1419
               +SG IP E+ +C  L    L+ N L G +P+E+ +L+ +TDL+L  N L G I P + 
Sbjct  204   NAISGNIPVEIGECLNLTVFGLAQNKLGGPLPKEIGKLSLMTDLILWGNLLSGVIPPEIG  263

Query  1420  NLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYG  1599
             N  NL+T++L+ NNL G +P  IG + +LQ ++LY N  +G IP EIGN S  + IDF  
Sbjct  264   NCINLRTIALYDNNLVGSIPSTIGKIQNLQRLYLYRNLLNGTIPSEIGNLSLAEEIDFSE  323

Query  1600  NQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFG  1779
             N  TG IP   G +  L+ L+L +N L+G IP  L     L  LDL+ N LSG IP  F 
Sbjct  324   NALTGGIPKEFGNIPRLYLLYLFQNQLTGPIPTELCVLKNLSKLDLSINTLSGPIPGCFQ  383

Query  1780  YLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIA-PICTSHSFLSFDVTN  1956
             Y+  L +L L+NN L GD+P        L  ++ S+NN +G I   +C   + +  ++ +
Sbjct  384   YMSKLIQLQLFNNMLSGDIPPRFGIYSRLWVVDFSNNNITGLIPRDLCRQSNLILLNLGS  443

Query  1957  NAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLS  2136
             N     IP  + +  SL +LRL  N  TG  P  L  +  L+ ++L  NK SG IPPQ+ 
Sbjct  444   NKLIGNIPHGITSCKSLVQLRLADNSLTGSFPTDLCNLVNLTTIELGRNKFSGPIPPQIG  503

Query  2137  LCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslen  2316
              C+ L  LDL NN  +  +P  +G L  L    +SSN+  GS+P E+FNC+ L  L L  
Sbjct  504   NCKALQRLDLTNNYFTSELPQEIGNLSKLVVFNISSNRLGGSIPLEIFNCTMLQRLDLSQ  563

Query  2317  nslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVG  2496
             NS  G+LP E+G L  L +L+  DN+L G IP  +G L  L  L++  NRFSG IP+E+G
Sbjct  564   NSFEGSLPNEVGRLPQLELLSFADNRLSGQIPPILGKLSHLTALQIGGNRFSGGIPKELG  623

Query  2497  QLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLS  2676
              L  LQ  ++ SYNNL+G IP  +G L+ LE+L L++N LTGEIP   A +SSL   N+S
Sbjct  624   LLSSLQIAMNLSYNNLSGNIPSELGNLALLENLFLNNNKLTGEIPDTFANLSSLLEFNVS  683

Query  2677  CNELEGELDK--RYAHWPVDSFVGNSHLCGSPLGSCRDKGSRNKGSMVVVISALSATVAI  2850
              N L G L     + +    SF+GN  LCG  LG C  +   +  S       L   +AI
Sbjct  684   YNNLTGALPTIPLFDNMAATSFLGNKGLCGGQLGKCGSESVSSSQSSHSGSPPLGKVIAI  743

Query  2851  ILLLMGAAFFFKHNREAYRRRRGKENYAsssssssQAQRKPLFGNA-----AKKRDIRWD  3015
             +  ++G           Y  R+  E  A         Q K +F  A     A K    + 
Sbjct  744   VAAIIGGISLILIGIIVYHMRKPLETVA-------PLQDKQMFSAASNMQVATKDAYTFQ  796

Query  3016  DIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIP-RKDDLFLDKSFAREIKTLW  3192
             +++ ATNN  +  +IG G C TVY+A L  G+T+A+K++   ++    D SF  EI TL 
Sbjct  797   ELVSATNNFDESCVIGRGACGTVYRAILKAGQTIAVKKLASNREGSNTDNSFRAEILTLG  856

Query  3193  RIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHNQPANNKSKKSLDWEARLKIA  3372
             +IRHR++V+L G+  +  +GSN+L+YEYM  GS+ + LH Q +      SLDWE R  IA
Sbjct  857   KIRHRNIVKLYGFIYH--QGSNLLLYEYMPRGSLGELLHGQSS------SLDWETRFMIA  908

Query  3373  MGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGDFGLAKALTDNYDSLNTESNT  3552
             +G A+G+ YLHHDC P+IIHRDIKS+N+LLD N EAH+GDFGLAK +   Y    ++S +
Sbjct  909   LGAAEGLSYLHHDCKPRIIHRDIKSNNILLDENFEAHVGDFGLAKVIDMPY----SKSMS  964

Query  3553  WFAGSYGYIAPE  3588
               AGSYGYIAPE
Sbjct  965   AIAGSYGYIAPE  976


 Score =   220 bits (560),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 166/438 (38%), Positives = 244/438 (56%), Gaps = 2/438 (0%)
 Frame = +1

Query  529   GPIPPAlsnlssleslllfsnrlVGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGN  708
             G IPP + N  +L ++ L+ N LVG IPS +G + NLQ L +  N L G IP+  GNL  
Sbjct  256   GVIPPEIGNCINLRTIALYDNNLVGSIPSTIGKIQNLQRLYLYRNLLNGTIPSEIGNLSL  315

Query  709   LVTLGLASCYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLN  888
                +  +   L+G IP + G + +L  L L QN L GP+P E+  + +L+    ++N+L+
Sbjct  316   AEEIDFSENALTGGIPKEFGNIPRLYLLYLFQNQLTGPIPTELCVLKNLSKLDLSINTLS  375

Query  889   GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTN  1068
             G IP     +  L  L L NN L+G+IP + G  S L  ++   N + G IP+ L + +N
Sbjct  376   GPIPGCFQYMSKLIQLQLFNNMLSGDIPPRFGIYSRLWVVDFSNNNITGLIPRDLCRQSN  435

Query  1069  LQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGL  1248
             L  L+L  N+L G +P    S   L  L L  N+L+G+ P  LC N  NL  + L     
Sbjct  436   LILLNLGSNKLIGNIPHGITSCKSLVQLRLADNSLTGSFPTDLC-NLVNLTTIELGRNKF  494

Query  1249  SGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLT  1428
             SG IPP++  C+ LQ+LDL+NN     +P+E+  L++L    +++N L G+I   + N T
Sbjct  495   SGPIPPQIGNCKALQRLDLTNNYFTSELPQEIGNLSKLVVFNISSNRLGGSIPLEIFNCT  554

Query  1429  NLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCSSLQFIDFYGNQF  1608
              LQ L L  N+  G +P E+G L  L+++   +N  SG+IP  +G  S L  +   GN+F
Sbjct  555   MLQRLDLSQNSFEGSLPNEVGRLPQLELLSFADNRLSGQIPPILGKLSHLTALQIGGNRF  614

Query  1609  TGKIPITLGRLKHL-FFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYL  1785
             +G IP  LG L  L   ++L  N+LSG IP+ LGN   L+ L L +N L+G IP TF  L
Sbjct  615   SGGIPKELGLLSSLQIAMNLSYNNLSGNIPSELGNLALLENLFLNNNKLTGEIPDTFANL  674

Query  1786  RALTRLMLYNNSLEGDLP  1839
              +L    +  N+L G LP
Sbjct  675   SSLLEFNVSYNNLTGALP  692


 Score =   215 bits (548),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 178/502 (35%), Positives = 231/502 (46%), Gaps = 74/502 (15%)
 Frame = +1

Query  1438  TLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNCS---------------  1572
             +L+L + NL G V   IG L +L  + L  N  SG IP EIGNCS               
Sbjct  78    SLNLSNMNLSGTVDPGIGDLAELTYLDLSFNGLSGTIPAEIGNCSKLVGLYLNNNYFQGT  137

Query  1573  ---------------------------------SLQFIDFYGNQFTGKIPITLGRLKHLF  1653
                                              SL+ +  Y N  +G IP ++GRLK+L 
Sbjct  138   IPPELGKLAMLTTFNLCNNKLLGAIPDEIGNMASLEDLVGYSNNLSGSIPRSIGRLKNLR  197

Query  1654  FLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLRALTRLMLYNNSLEGD  1833
              + L +N +SG IP  +G C  L    LA N L G +P   G L  +T L+L+ N L G 
Sbjct  198   TVRLGQNAISGNIPVEIGECLNLTVFGLAQNKLGGPLPKEIGKLSLMTDLILWGNLLSGV  257

Query  1834  LPDDLRNLGNLTRINLSHNNFSGSIAPICTSHSFLS------------------------  1941
             +P ++ N  NL  I L  NN  GSI         L                         
Sbjct  258   IPPEIGNCINLRTIALYDNNLVGSIPSTIGKIQNLQRLYLYRNLLNGTIPSEIGNLSLAE  317

Query  1942  -FDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGF  2118
               D + NA    IP   GN P L  L L  N+ TG IP  L +++ LS LDLS N LSG 
Sbjct  318   EIDFSENALTGGIPKEFGNIPRLYLLYLFQNQLTGPIPTELCVLKNLSKLDLSINTLSGP  377

Query  2119  IPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskll  2298
             IP       KL  L L NN+LSG IP   G    L  +  S+N  +G +P +L   S L+
Sbjct  378   IPGCFQYMSKLIQLQLFNNMLSGDIPPRFGIYSRLWVVDFSNNNITGLIPRDLCRQSNLI  437

Query  2299  vlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGE  2478
             +L+L +N L G +P  I + KSL  L L DN L GS P+ +  L  L  + L RN+FSG 
Sbjct  438   LLNLGSNKLIGNIPHGITSCKSLVQLRLADNSLTGSFPTDLCNLVNLTTIELGRNKFSGP  497

Query  2479  IPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSL  2658
             IP ++G  K LQ  LD + N  T E+P  IG LSKL   ++S N L G IP ++   + L
Sbjct  498   IPPQIGNCKALQR-LDLTNNYFTSELPQEIGNLSKLVVFNISSNRLGGSIPLEIFNCTML  556

Query  2659  GRLNLSCNELEGELDKRYAHWP  2724
              RL+LS N  EG L       P
Sbjct  557   QRLDLSQNSFEGSLPNEVGRLP  578


 Score =   119 bits (299),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 89/237 (38%), Positives = 134/237 (57%), Gaps = 1/237 (0%)
 Frame = +1

Query  1990  GNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDLSGNKLSGFIPPQLSLCRKLTHLDLN  2169
             G+ P++  L L +   +G +   +G + EL+ LDLS N LSG IP ++  C KL  L LN
Sbjct  71    GSKPAVVSLNLSNMNLSGTVDPGIGDLAELTYLDLSFNGLSGTIPAEIGNCSKLVGLYLN  130

Query  2170  NNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPELFNCskllvlslennslnGTLPPEI  2349
             NN   G IP  LG+L +L    L +N+  G++P E+ N + L  L   +N+L+G++P  I
Sbjct  131   NNYFQGTIPPELGKLAMLTTFNLCNNKLLGAIPDEIGNMASLEDLVGYSNNLSGSIPRSI  190

Query  2350  GNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRLSRNRFSGEIPREVGQLKDLQSVLDF  2529
             G LK+L  + L  N + G+IP  IG    L    L++N+  G +P+E+G+L  L + L  
Sbjct  191   GRLKNLRTVRLGQNAISGNIPVEIGECLNLTVFGLAQNKLGGPLPKEIGKLS-LMTDLIL  249

Query  2530  SYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPPQVAEMSSLGRLNLSCNELEGEL  2700
               N L+G IPP IG    L ++ L  N+L G IP  + ++ +L RL L  N L G +
Sbjct  250   WGNLLSGVIPPEIGNCINLRTIALYDNNLVGSIPSTIGKIQNLQRLYLYRNLLNGTI  306



>ref|XP_004514026.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170-like [Cicer arietinum]
Length=1112

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/932 (40%), Positives = 537/932 (58%), Gaps = 46/932 (5%)
 Frame = +1

Query  838   ANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLL  1017
              N+SS+   S  LN+        +GGL +L  LNLA N L G IP ++G   SL YL L 
Sbjct  85    VNLSSMD-LSGTLNA------SSIGGLINLTYLNLAYNGLNGNIPKEIGGCLSLEYLYLN  137

Query  1018  GNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSL  1197
              NQ  G IP  L KL+ L+SL++  N+L+G LP EFG++  L  L   SN L G +P S+
Sbjct  138   NNQFEGLIPVELGKLSVLRSLNICNNKLSGVLPDEFGNLTSLVELVAYSNFLVGPLPNSI  197

Query  1198  CSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVL  1377
               N  NL+        ++G +P E+S+C+ L +L L+ N + G IP E+  L  L +L+L
Sbjct  198   -GNLKNLETFRAGANNITGSLPKEISRCKSLVRLGLAQNQIEGEIPSEIGMLVSLKELIL  256

Query  1378  NNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVE  1557
               N L G +   + N T L+ L+L+ NN+ G +P+EIG L  L+ ++LY N  +G IP E
Sbjct  257   WENQLSGVVPKELGNCTRLEKLALYGNNIVGPLPQEIGNLKSLKWLYLYRNKLNGTIPRE  316

Query  1558  IGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDL  1737
             IGN SS   IDF  N   G IP    +++ L  L L EN LSG IP   GN   L  LDL
Sbjct  317   IGNLSSALHIDFSENSLVGDIPSEFNKIRGLSLLFLFENHLSGLIPNEFGNLKNLTKLDL  376

Query  1738  ADNHLSGAIPATFGYLRALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIAP-  1914
             + N+L+G IP  F YL  + +L L++NSL G +P  L     L  ++ S NN +G+I P 
Sbjct  377   SINNLTGPIPLGFQYLTHMYQLQLFDNSLSGIIPQGLGLYSPLWVVDFSDNNLTGTIPPH  436

Query  1915  ICTSHSFLSFDVTNNAFDQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSLLDL  2094
             +C +   +  ++ +N     IP+ + N  SL +L L  NR TG  P  L  +  L+ +DL
Sbjct  437   LCRNSHLMLLNLADNQLYGNIPTGILNCKSLAQLLLVGNRLTGGFPSELCKLENLTAIDL  496

Query  2095  SGNKLSGFIPPQLSLCRKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLPPE  2274
             + N+ SG +PP+++ C  L  L + +N  S  +P  +G L  L    +SSN F+G +PPE
Sbjct  497   NKNRFSGPLPPEIANCHNLQRLHVADNYFSLELPKEIGNLSQLVTFNVSSNLFTGRIPPE  556

Query  2275  LFNCskllvlslennslnGTLPPEIGNLKSLNVLNLDDNQLCGSIPSTIGGLGKLYELRL  2454
             +F C +L  L L  NS  G+LP E+G L+ L +L L DN+L G IP+ +G L  L  L +
Sbjct  557   IFWCQRLQRLDLSRNSFTGSLPNELGTLQHLEILKLSDNKLSGYIPAALGNLSHLNWLMM  616

Query  2455  SRNRFSGEIPREVGQLKDLQSVLDFSYNNLTGEIPPSIGTLSKLESLDLSHNDLTGEIPP  2634
               N F GEIP ++G L  LQ  +D SYNNL+G IP  +G L+ LE L L++N L GEIP 
Sbjct  617   GGNSFFGEIPPQLGSLSSLQIEMDLSYNNLSGRIPSQLGYLNMLEYLFLNNNHLDGEIPS  676

Query  2635  QVAEMSSLGRLNLSCNELEGEL--DKRYAHWPVDSFV-GNSHLCGSPLGSCRD-------  2784
                ++SSL   N S N L G +   K +    + SFV GN+ LCG+P+G C         
Sbjct  677   TFGQLSSLMGCNFSYNNLSGPIPSTKIFESMVLSSFVGGNAGLCGTPIGDCNSISASRSV  736

Query  2785  ---KGSRNKGSMVVVISALSATVAIILLLMGAAFFFKHNREAYRRRRGKENYAsssssss  2955
                KG  +  + +V+I A +     ++L++   +F K  REA       EN         
Sbjct  737   PPGKGIESPRAKIVMIIAATVGGVSLILILVLLYFMKQPREAIGSFADTEN---------  787

Query  2956  QAQRKPLFGNAAKKRDIRWDDIMEATNNLSDEFIIGSGGCATVYKAELFNGETVAIKRIP  3135
              +Q   ++     K    + D++EAT    + ++IGSG C TVYKA + +G+T+A+K++ 
Sbjct  788   PSQDSDIY--LPPKDGFTFQDLLEATKRFHESYVIGSGACGTVYKAVMKSGKTIAVKKLA  845

Query  3136  -RKDDLFLDKSFAREIKTLWRIRHRHLVRLMGYCSNKGEGSNVLIYEYMENGSVWDWLHN  3312
               ++   ++ SF  EI TL RIRHR++V+L G+C +  +GSN+L+YEYME GS+ + LH 
Sbjct  846   SNREGNNIENSFRAEISTLGRIRHRNIVKLYGFCYH--QGSNLLLYEYMERGSLGELLHG  903

Query  3313  QPANNKSKKSLDWEARLKIAMGLAQGVEYLHHDCVPKIIHRDIKSSNVLLDSNMEAHLGD  3492
               +N      L+W  R  IA+G A+G+ YLHHDC PKIIHRDIKS+N+LLD N EAH+GD
Sbjct  904   SASN------LEWPTRFMIALGAAEGLAYLHHDCKPKIIHRDIKSNNILLDENFEAHVGD  957

Query  3493  FGLAKALTDNYDSLNTESNTWFAGSYGYIAPE  3588
             FGLAK +    D   ++S +  AGSYGYIAPE
Sbjct  958   FGLAKVI----DMPQSKSMSAVAGSYGYIAPE  985


 Score =   289 bits (739),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 214/582 (37%), Positives = 301/582 (52%), Gaps = 27/582 (5%)
 Frame = +1

Query  601   GPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLASCYLSGLIPPqlgrltq  780
             G IP ++G   +L+ L + +N   G IP   G L  L +L + +  LSG++P + G LT 
Sbjct  119   GNIPKEIGGCLSLEYLYLNNNQFEGLIPVELGKLSVLRSLNICNNKLSGVLPDEFGNLTS  178

Query  781   lqnlnlqqnllEGPLPPEIANISSLTAFSAALNSLNGSIPKELGGLKHLHILNLANNTLT  960
             L  L    N L GPLP  I N+ +L  F A  N++ GS+PKE+   K L  L LA N + 
Sbjct  179   LVELVAYSNFLVGPLPNSIGNLKNLETFRAGANNITGSLPKEISRCKSLVRLGLAQNQIE  238

Query  961   GEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQ  1140
             GEIP ++G + SL  L L  NQL G +PK L   T L+ L L GN + G LP E G++  
Sbjct  239   GEIPSEIGMLVSLKELILWENQLSGVVPKELGNCTRLEKLALYGNNIVGPLPQEIGNLKS  298

Query  1141  LQFLALTSNNLSGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTL  1320
             L++L L  N L+GTIP+ + + ++ L  +  SE  L G+IP E ++ R L  L L  N L
Sbjct  299   LKWLYLYRNKLNGTIPREIGNLSSALH-IDFSENSLVGDIPSEFNKIRGLSLLFLFENHL  357

Query  1321  NGSIPEELYELTQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLG  1500
             +G IP E   L  LT L L+ N L G I      LT++  L LF N+L G +P+ +G+  
Sbjct  358   SGLIPNEFGNLKNLTKLDLSINNLTGPIPLGFQYLTHMYQLQLFDNSLSGIIPQGLGLYS  417

Query  1501  DLQII------------------------FLYENHFSGEIPVEIGNCSSLQFIDFYGNQF  1608
              L ++                         L +N   G IP  I NC SL  +   GN+ 
Sbjct  418   PLWVVDFSDNNLTGTIPPHLCRNSHLMLLNLADNQLYGNIPTGILNCKSLAQLLLVGNRL  477

Query  1609  TGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNHLSGAIPATFGYLR  1788
             TG  P  L +L++L  + L +N  SG +P  + NCH L  L +ADN+ S  +P   G L 
Sbjct  478   TGGFPSELCKLENLTAIDLNKNRFSGPLPPEIANCHNLQRLHVADNYFSLELPKEIGNLS  537

Query  1789  ALTRLMLYNNSLEGDLPDDLRNLGNLTRINLSHNNFSGSIA-PICTSHSFLSFDVTNNAF  1965
              L    + +N   G +P ++     L R++LS N+F+GS+   + T        +++N  
Sbjct  538   QLVTFNVSSNLFTGRIPPEIFWCQRLQRLDLSRNSFTGSLPNELGTLQHLEILKLSDNKL  597

Query  1966  DQEIPSFLGNSPSLDRLRLGSNRFTGKIPMTLGLIRELSL-LDLSGNKLSGFIPPQLSLC  2142
                IP+ LGN   L+ L +G N F G+IP  LG +  L + +DLS N LSG IP QL   
Sbjct  598   SGYIPAALGNLSHLNWLMMGGNSFFGEIPPQLGSLSSLQIEMDLSYNNLSGRIPSQLGYL  657

Query  2143  RKLTHLDLNNNLLSGPIPVWlgrlpllgelklSSNQFSGSLP  2268
               L +L LNNN L G IP   G+L  L     S N  SG +P
Sbjct  658   NMLEYLFLNNNHLDGEIPSTFGQLSSLMGCNFSYNNLSGPIP  699


 Score =   258 bits (660),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 192/510 (38%), Positives = 250/510 (49%), Gaps = 74/510 (15%)
 Frame = +1

Query  598   VGPIPSQLGLLTNLQALRIGDNGLTGQIPTSFGNLGNLVTLGLAS---------------  732
             VGP+P+ +G L NL+  R G N +TG +P       +LV LGLA                
Sbjct  190   VGPLPNSIGNLKNLETFRAGANNITGSLPKEISRCKSLVRLGLAQNQIEGEIPSEIGMLV  249

Query  733   ---------CYLSGLIPPqlgrltqlqnlnlqqnllEGPLPPEIANISSLTAFSAALNSL  885
                        LSG++P +LG  T+L+ L L  N + GPLP EI N+ SL       N L
Sbjct  250   SLKELILWENQLSGVVPKELGNCTRLEKLALYGNNIVGPLPQEIGNLKSLKWLYLYRNKL  309

Query  886   NGSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQLGGSIPKSLAKLT  1065
             NG+IP+E+G L     ++ + N+L G+IP +  ++  L  L L  N L G IP     L 
Sbjct  310   NGTIPREIGNLSSALHIDFSENSLVGDIPSEFNKIRGLSLLFLFENHLSGLIPNEFGNLK  369

Query  1066  NLQSLDLSGNRLAGELPGEF---GSMGQLQF---------------------LALTSNNL  1173
             NL  LDLS N L G +P  F     M QLQ                      +  + NNL
Sbjct  370   NLTKLDLSINNLTGPIPLGFQYLTHMYQLQLFDNSLSGIIPQGLGLYSPLWVVDFSDNNL  429

Query  1174  SGTIPKSLCSNATNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYEL  1353
             +GTIP  LC N ++L LL L++  L G IP  +  C+ L QL L  N L G  P EL +L
Sbjct  430   TGTIPPHLCRN-SHLMLLNLADNQLYGNIPTGILNCKSLAQLLLVGNRLTGGFPSELCKL  488

Query  1354  TQLTDLVLNNNTLEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENH  1533
               LT + LN N   G + P +AN  NLQ L +  N    E+P+EIG L  L    +  N 
Sbjct  489   ENLTAIDLNKNRFSGPLPPEIANCHNLQRLHVADNYFSLELPKEIGNLSQLVTFNVSSNL  548

Query  1534  FSGEIPVEIGNCSSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNC  1713
             F+G IP EI  C  LQ +D   N FTG +P  LG L+HL  L L +N LSG IPA+LGN 
Sbjct  549   FTGRIPPEIFWCQRLQRLDLSRNSFTGSLPNELGTLQHLEILKLSDNKLSGYIPAALGNL  608

Query  1714  HQLDTL-------------------------DLADNHLSGAIPATFGYLRALTRLMLYNN  1818
               L+ L                         DL+ N+LSG IP+  GYL  L  L L NN
Sbjct  609   SHLNWLMMGGNSFFGEIPPQLGSLSSLQIEMDLSYNNLSGRIPSQLGYLNMLEYLFLNNN  668

Query  1819  SLEGDLPDDLRNLGNLTRINLSHNNFSGSI  1908
              L+G++P     L +L   N S+NN SG I
Sbjct  669   HLDGEIPSTFGQLSSLMGCNFSYNNLSGPI  698



>ref|XP_006492135.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170-like isoform X1 [Citrus sinensis]
Length=1132

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/928 (40%), Positives = 541/928 (58%), Gaps = 42/928 (5%)
 Frame = +1

Query  856   TAFSAALNSLN--GSIPKELGGLKHLHILNLANNTLTGEIPGQLGEMSSLVYLNLLGNQL  1029
               +S  LN++N  GS+   +GGL HL  L+LA N LTG IP ++G  S L +L L  NQ 
Sbjct  105   VVWSLDLNAMNFTGSLSPSIGGLVHLTYLDLAYNELTGYIPREIGNCSRLEHLYLNNNQF  164

Query  1030  GGSIPKSLAKLTNLQSLDLSGNRLAGELPGEFGSMGQLQFLALTSNNLSGTIPKSLCSNA  1209
              G IP  L KL++L SL++  N ++G LP   G++  L+     +NNL+G +P+S+  N 
Sbjct  165   SGKIPAELGKLSSLVSLNICNNMISGALPEGLGNLSSLEDFVAYTNNLTGPLPQSI-GNL  223

Query  1210  TNLQLLMLSETGLSGEIPPELSQCRVLQQLDLSNNTLNGSIPEELYELTQLTDLVLNNNT  1389
              NL++    +  +SG IP E+S C+ LQ L L+ N + GS+P+E+  L  LT++VL +N 
Sbjct  224   RNLRVFRAGQNAISGSIPAEISGCQSLQILGLAQNDIGGSLPKEIGMLESLTEIVLWDNQ  283

Query  1390  LEGTISPSVANLTNLQTLSLFHNNLHGEVPREIGMLGDLQIIFLYENHFSGEIPVEIGNC  1569
             L G I   + N T LQTL+L+ NNL G++P+E+G L  L  ++LY N  +G IP EIGN 
Sbjct  284   LTGFIPLELGNCTKLQTLALYSNNLVGQIPKEVGNLKFLTKLYLYRNKLNGTIPREIGNL  343

Query  1570  SSLQFIDFYGNQFTGKIPITLGRLKHLFFLHLRENDLSGEIPASLGNCHQLDTLDLADNH  1749
             S +  ID   N   G+IP    ++  L  L L +N L+G IP  L +   L  LDL+ N+
Sbjct  344   SMVTEI