BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19357_g1_i1 len=1353 path=[1620:0-414 3262:415-649 2270:650-741
4389:742-1352]

Length=1353
                                                                      Score     E

ref|XP_006340819.1|  PREDICTED: adipocyte plasma membrane-associa...    507   6e-175   
ref|XP_004232552.1|  PREDICTED: protein YLS2                            496   2e-170   
ref|XP_009784074.1|  PREDICTED: protein YLS2-like                       494   8e-170   
ref|XP_004287742.1|  PREDICTED: adipocyte plasma membrane-associa...    493   7e-169   
ref|XP_009605180.1|  PREDICTED: protein YLS2-like                       492   9e-169   
emb|CDP01813.1|  unnamed protein product                                489   2e-167   
ref|XP_011087145.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    474   5e-162   
ref|XP_009337096.1|  PREDICTED: protein YLS2-like                       474   1e-161   
ref|XP_004287743.1|  PREDICTED: adipocyte plasma membrane-associa...    470   4e-160   
ref|XP_009344660.1|  PREDICTED: protein YLS2-like                       470   4e-160   
ref|XP_007203450.1|  hypothetical protein PRUPE_ppa022087mg             470   7e-160   
ref|XP_008393525.1|  PREDICTED: protein YLS2-like                       469   1e-159   
ref|XP_008241973.1|  PREDICTED: protein YLS2-like                       468   7e-159   
ref|XP_008241972.1|  PREDICTED: protein YLS2-like                       467   1e-158   
ref|XP_002268467.1|  PREDICTED: protein YLS2                            463   1e-157   Vitis vinifera
ref|XP_009344661.1|  PREDICTED: protein YLS2-like                       463   2e-157   
emb|CBI38400.3|  unnamed protein product                                464   2e-157   
ref|XP_009344663.1|  PREDICTED: protein YLS2-like                       460   4e-156   
ref|XP_010113253.1|  Adipocyte plasma membrane-associated protein       458   1e-155   
ref|XP_008241975.1|  PREDICTED: protein YLS2-like                       456   1e-154   
ref|XP_002268316.2|  PREDICTED: protein YLS2                            455   2e-154   Vitis vinifera
ref|XP_009337098.1|  PREDICTED: protein YLS2-like                       453   1e-153   
ref|XP_008337934.1|  PREDICTED: protein YLS2-like                       452   3e-153   
ref|XP_002273458.3|  PREDICTED: protein YLS2                            448   9e-152   Vitis vinifera
emb|CBI38406.3|  unnamed protein product                                449   6e-151   
ref|XP_002274023.1|  PREDICTED: protein YLS2                            446   8e-151   Vitis vinifera
emb|CAN69510.1|  hypothetical protein VITISV_018383                     443   1e-149   Vitis vinifera
ref|XP_010649306.1|  PREDICTED: protein YLS2-like                       443   1e-149   
ref|XP_002264366.2|  PREDICTED: protein YLS2-like                       442   2e-149   Vitis vinifera
emb|CBI38402.3|  unnamed protein product                                447   7e-149   
emb|CBI38397.3|  unnamed protein product                                455   2e-148   
emb|CDP01812.1|  unnamed protein product                                440   2e-148   
ref|XP_011022274.1|  PREDICTED: protein YLS2-like                       439   4e-148   
ref|XP_007046542.1|  Calcium-dependent phosphotriesterase superfa...    436   3e-147   
gb|KDP43740.1|  hypothetical protein JCGZ_22367                         436   4e-147   
gb|KDP43745.1|  hypothetical protein JCGZ_22372                         435   1e-146   
ref|XP_010033573.1|  PREDICTED: protein YLS2-like                       435   2e-146   
ref|XP_010048018.1|  PREDICTED: protein YLS2-like                       433   9e-146   
gb|KCW87750.1|  hypothetical protein EUGRSUZ_A00119                     434   1e-145   
ref|XP_002306422.2|  hypothetical protein POPTR_0005s10240g             432   2e-145   Populus trichocarpa [western balsam poplar]
ref|XP_010033571.1|  PREDICTED: protein YLS2-like                       425   2e-142   
ref|XP_010033572.1|  PREDICTED: protein YLS2-like                       424   3e-142   
gb|KHG02679.1|  Adipocyte plasma membrane-associated                    423   1e-141   
ref|XP_010033570.1|  PREDICTED: protein YLS2-like                       422   1e-141   
ref|XP_010426697.1|  PREDICTED: protein YLS2-like                       421   4e-141   
emb|CAN70331.1|  hypothetical protein VITISV_001430                     419   6e-141   Vitis vinifera
gb|KCW53260.1|  hypothetical protein EUGRSUZ_J02521                     421   6e-141   
ref|XP_007046543.1|  Calcium-dependent phosphotriesterase superfa...    420   1e-140   
emb|CAN68853.1|  hypothetical protein VITISV_037416                     419   3e-140   Vitis vinifera
gb|KHF98691.1|  Adipocyte plasma membrane-associated                    417   2e-139   
ref|XP_006291226.1|  hypothetical protein CARUB_v10017358mg             418   2e-139   
ref|XP_010550491.1|  PREDICTED: protein YLS2-like                       417   2e-139   
gb|EYU22994.1|  hypothetical protein MIMGU_mgv1a0246431mg               414   2e-139   
ref|XP_002521695.1|  Adipocyte plasma membrane-associated protein...    416   7e-139   Ricinus communis
ref|XP_010503835.1|  PREDICTED: protein YLS2-like                       415   7e-139   
gb|EYU39426.1|  hypothetical protein MIMGU_mgv1a026231mg                413   8e-139   
ref|XP_010503836.1|  PREDICTED: protein YLS2-like                       412   9e-138   
ref|XP_010426698.1|  PREDICTED: protein YLS2-like                       412   2e-137   
ref|NP_190712.1|  strictosidine synthase family protein                 411   4e-137   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34387.1|  hypothetical protein AALP_AA5G138500                    410   8e-137   
gb|KGN55618.1|  hypothetical protein Csa_3G002390                       410   1e-136   
ref|NP_001190053.1|  strictosidine synthase-like 5                      409   3e-136   
ref|NP_566951.1|  strictosidine synthase-like 5                         408   3e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876086.1|  yellow-leaf-specific gene 2                        408   6e-136   
ref|XP_006403914.1|  hypothetical protein EUTSA_v10010472mg             406   3e-135   
ref|XP_002876085.1|  strictosidine synthase family protein              405   5e-135   
ref|XP_006467059.1|  PREDICTED: protein YLS2-like                       406   6e-135   
ref|XP_004146168.1|  PREDICTED: adipocyte plasma membrane-associa...    405   1e-134   
ref|NP_190710.1|  strictosidine synthase-like 4                         404   1e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293238.1|  hypothetical protein CARUB_v10019569mg             404   2e-134   
ref|XP_006425309.1|  hypothetical protein CICLE_v10025811mg             404   4e-134   
ref|XP_008448496.1|  PREDICTED: protein YLS2-like                       403   6e-134   
ref|XP_009149019.1|  PREDICTED: protein YLS2-like                       401   3e-133   
emb|CDY33279.1|  BnaA01g19460D                                          400   7e-133   
gb|KCW53263.1|  hypothetical protein EUGRSUZ_J02524                     397   1e-132   
ref|XP_009115831.1|  PREDICTED: protein YLS2-like                       396   3e-131   
gb|EPS58715.1|  hypothetical protein M569_16097                         392   2e-130   
ref|XP_004509420.1|  PREDICTED: adipocyte plasma membrane-associa...    393   4e-130   
emb|CAB63007.1|  mucin-like protein                                     392   1e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682996.1|  PREDICTED: protein YLS2-like                       391   3e-129   
ref|XP_010266134.1|  PREDICTED: protein YLS2-like                       391   4e-129   
ref|NP_190713.1|  strictosidine synthase family protein                 390   5e-129   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73720.1|  BnaC08g22830D                                          389   9e-129   
gb|KCW53262.1|  hypothetical protein EUGRSUZ_J02522                     385   4e-128   
ref|XP_010683361.1|  PREDICTED: protein YLS2-like                       385   6e-127   
gb|AET03659.2|  strictosidine synthase family protein                   385   8e-127   
ref|XP_003629186.1|  Adipocyte plasma membrane-associated protein       384   9e-127   
emb|CDY33280.1|  BnaA01g19470D                                          384   1e-126   
emb|CDY16307.1|  BnaC01g23420D                                          384   2e-126   
gb|AFK48885.1|  unknown                                                 383   2e-126   
ref|XP_003629179.1|  Adipocyte plasma membrane-associated protein       382   1e-125   
ref|XP_009149030.1|  PREDICTED: protein YLS2-like                       381   2e-125   
ref|XP_002876087.1|  strictosidine synthase family protein              380   3e-125   
ref|XP_004509419.1|  PREDICTED: adipocyte plasma membrane-associa...    377   5e-124   
emb|CDX78005.1|  BnaA09g32000D                                          379   7e-124   
ref|XP_007156223.1|  hypothetical protein PHAVU_003G268700g             374   6e-123   
ref|XP_006292426.1|  hypothetical protein CARUB_v10018641mg             373   2e-122   
ref|XP_003547900.1|  PREDICTED: protein YLS2-like                       373   2e-122   
ref|XP_003519847.1|  PREDICTED: protein YLS2-like                       371   2e-121   
emb|CDY16306.1|  BnaC01g23410D                                          370   2e-121   
ref|XP_010503837.1|  PREDICTED: protein YLS2-like                       370   4e-121   
ref|XP_009385650.1|  PREDICTED: protein YLS2-like                       370   7e-121   
gb|KCW45369.1|  hypothetical protein EUGRSUZ_L00935                     366   1e-120   
ref|XP_003520040.2|  PREDICTED: protein YLS2-like isoform X1            368   4e-120   
ref|XP_010426700.1|  PREDICTED: protein YLS2-like                       365   2e-119   
ref|XP_004983784.1|  PREDICTED: adipocyte plasma membrane-associa...    363   9e-119   
ref|XP_004509421.1|  PREDICTED: adipocyte plasma membrane-associa...    360   5e-118   
ref|XP_010515551.1|  PREDICTED: protein YLS2-like                       362   7e-118   
gb|AAG13594.1|AC051633_10  mucin-like protein                           352   6e-114   Oryza sativa [red rice]
dbj|BAK05159.1|  predicted protein                                      351   9e-114   
ref|XP_002467566.1|  hypothetical protein SORBIDRAFT_01g030270          348   6e-113   Sorghum bicolor [broomcorn]
emb|CAN68626.1|  hypothetical protein VITISV_008834                     353   8e-112   Vitis vinifera
ref|XP_008802853.1|  PREDICTED: protein YLS2-like                       346   9e-112   
emb|CBI38401.3|  unnamed protein product                                341   3e-111   
ref|XP_010113254.1|  Adipocyte plasma membrane-associated protein       341   2e-109   
ref|XP_002521694.1|  Adipocyte plasma membrane-associated protein...    338   2e-109   Ricinus communis
ref|XP_003574275.1|  PREDICTED: protein YLS2-like                       337   2e-108   
ref|XP_010943944.1|  PREDICTED: LOW QUALITY PROTEIN: protein YLS2...    332   8e-106   
ref|XP_008337329.1|  PREDICTED: protein YLS2-like                       327   5e-105   
ref|XP_003574276.2|  PREDICTED: protein YLS2-like                       328   9e-105   
ref|XP_008354638.1|  PREDICTED: protein YLS2-like                       317   1e-102   
emb|CBI38407.3|  unnamed protein product                                313   1e-99    
emb|CAN70332.1|  hypothetical protein VITISV_001431                     306   4e-98    Vitis vinifera
ref|XP_009350729.1|  PREDICTED: protein YLS2-like                       306   2e-97    
gb|ABG66230.1|  Strictosidine synthase family protein, expressed        305   5e-97    Oryza sativa Japonica Group [Japonica rice]
emb|CBI38398.3|  unnamed protein product                                306   9e-97    
ref|XP_006828750.1|  hypothetical protein AMTR_s00001p00067420          305   5e-96    
gb|KHN09361.1|  Adipocyte plasma membrane-associated protein            290   3e-91    
ref|XP_002985221.1|  hypothetical protein SELMODRAFT_157072             284   8e-88    
gb|ABR18309.1|  unknown                                                 283   3e-87    Picea sitchensis
ref|XP_002970033.1|  hypothetical protein SELMODRAFT_171056             282   4e-87    
gb|KHN00425.1|  Adipocyte plasma membrane-associated protein            284   2e-86    
ref|XP_003629183.1|  Adipocyte plasma membrane-associated protein       266   4e-82    
gb|EMT15958.1|  Adipocyte plasma membrane-associated protein            266   8e-82    
gb|KHF98690.1|  Adipocyte plasma membrane-associated                    254   5e-78    
ref|XP_001766712.1|  predicted protein                                  258   1e-77    
ref|XP_002993328.1|  hypothetical protein SELMODRAFT_136874             257   2e-77    
ref|NP_001065198.1|  Os10g0543500                                       253   2e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002979226.1|  hypothetical protein SELMODRAFT_110343             248   5e-74    
gb|ABK25036.1|  unknown                                                 247   1e-73    Picea sitchensis
gb|ABK21480.1|  unknown                                                 246   2e-73    Picea sitchensis
gb|EAY79392.1|  hypothetical protein OsI_34518                          243   3e-73    Oryza sativa Indica Group [Indian rice]
ref|XP_002979137.1|  hypothetical protein SELMODRAFT_153129             241   2e-71    
gb|EMS45922.1|  Adipocyte plasma membrane-associated protein            237   3e-71    
ref|XP_002988510.1|  hypothetical protein SELMODRAFT_128345             235   9e-70    
ref|WP_003120501.1|  gluconolactonase                                   230   2e-67    
emb|CEI19183.1|  hypothetical protein PAMH19_4775                       230   2e-67    
ref|WP_023117492.1|  hypothetical protein                               230   4e-67    
ref|WP_031640700.1|  gluconolactonase                                   230   4e-67    
ref|WP_033993819.1|  gluconolactonase                                   230   4e-67    
ref|WP_034053102.1|  gluconolactonase                                   230   4e-67    
ref|WP_003116037.1|  gluconolactonase                                   229   5e-67    
ref|WP_034043384.1|  gluconolactonase                                   229   5e-67    
ref|WP_003082649.1|  MULTISPECIES: gluconolactonase                     229   5e-67    
ref|WP_003145301.1|  gluconolactonase                                   229   5e-67    
ref|WP_003109273.1|  gluconolactonase                                   229   6e-67    
ref|WP_023092021.1|  hypothetical protein                               229   6e-67    
ref|WP_016253680.1|  hypothetical protein                               229   6e-67    
ref|WP_022580880.1|  gluconolactonase                                   229   6e-67    
ref|XP_001753951.1|  predicted protein                                  228   6e-67    
ref|WP_034053170.1|  gluconolactonase                                   229   7e-67    
ref|WP_027897266.1|  gluconolactonase                                   229   7e-67    
ref|WP_012663252.1|  gluconolactonase                                   229   7e-67    
ref|WP_023126343.1|  hypothetical protein                               229   8e-67    
ref|WP_033984214.1|  gluconolactonase                                   229   8e-67    
ref|WP_033969040.1|  gluconolactonase                                   229   8e-67    
ref|WP_019725984.1|  gluconolactonase                                   229   8e-67    
ref|WP_017939602.1|  gluconolactonase                                   229   1e-66    
ref|WP_023105431.1|  hypothetical protein                               228   1e-66    
ref|WP_037053513.1|  gluconolactonase                                   228   2e-66    
ref|WP_004348796.1|  gluconolactonase                                   228   2e-66    
ref|WP_033990195.1|  gluconolactonase                                   228   2e-66    
ref|WP_033980895.1|  gluconolactonase                                   228   3e-66    
ref|WP_024916611.1|  gluconolactonase                                   227   3e-66    
ref|WP_034047829.1|  gluconolactonase                                   227   3e-66    
ref|WP_003112360.1|  gluconolactonase                                   227   3e-66    
emb|CBI38403.3|  unnamed protein product                                222   3e-66    
ref|WP_033984591.1|  gluconolactonase                                   227   4e-66    
ref|WP_034038032.1|  gluconolactonase                                   227   6e-66    
ref|WP_034049694.1|  gluconolactonase                                   226   8e-66    
ref|WP_012076580.1|  gluconolactonase                                   225   2e-65    
ref|WP_036988887.1|  gluconolactonase                                   225   2e-65    
ref|WP_021442626.1|  gluconolactonase                                   225   3e-65    
ref|WP_011394057.1|  gluconolactonase                                   224   7e-65    
ref|WP_007154291.1|  gluconolactonase                                   224   7e-65    
ref|WP_033998906.1|  gluconolactonase                                   224   8e-65    
ref|WP_017677447.1|  gluconolactonase                                   223   1e-64    
ref|WP_021490043.1|  gluconolactonase                                   223   1e-64    
emb|CBI38404.3|  unnamed protein product                                217   2e-64    
ref|XP_010042604.1|  PREDICTED: protein YLS2-like                       216   3e-64    
gb|AHI30776.1|  gluconolactonase                                        222   4e-64    
ref|WP_036203082.1|  gluconolactonase                                   222   6e-64    
ref|WP_015476341.1|  hypothetical protein                               221   6e-64    
ref|XP_001768837.1|  predicted protein                                  219   1e-63    
ref|WP_025167244.1|  gluconolactonase                                   220   1e-63    
gb|KFJ93264.1|  gluconolactonase                                        220   2e-63    
ref|WP_027830770.1|  gluconolactonase                                   220   2e-63    
gb|EZH79532.1|  gluconolactonase                                        219   5e-63    
ref|WP_003244587.1|  gluconolactonase                                   219   5e-63    
ref|WP_037002501.1|  gluconolactonase                                   219   6e-63    
ref|WP_014420374.1|  gluconolactonase                                   219   6e-63    
gb|KER99317.1|  gluconolactonase                                        219   7e-63    
ref|WP_013716188.1|  gluconolactonase                                   219   7e-63    
ref|WP_012018271.1|  gluconolactonase                                   218   8e-63    
ref|WP_003461681.1|  gluconolactonase                                   218   9e-63    
ref|WP_007616709.1|  adipocyte plasma membrane-associated protein       218   1e-62    
ref|WP_021699192.1|  hypothetical protein                               218   2e-62    
ref|WP_004578969.1|  strictosidine synthase family protein              218   2e-62    
ref|WP_020988177.1|  strictosidine synthase                             217   3e-62    
gb|ERS04722.1|  gluconolactonase                                        217   3e-62    
ref|WP_031211619.1|  gluconolactonase                                   217   4e-62    
gb|ADE76402.1|  unknown                                                 217   4e-62    
ref|WP_017518494.1|  gluconolactonase                                   216   9e-62    
ref|WP_009623600.1|  putative enzyme                                    216   9e-62    
ref|WP_039660610.1|  gluconolactonase                                   216   1e-61    
gb|ADE76543.1|  unknown                                                 216   1e-61    
ref|WP_021222721.1|  gluconolactonase                                   215   1e-61    
ref|WP_010568638.1|  gluconolactonase                                   216   3e-61    
ref|WP_003454827.1|  Strictosidine synthase precursor                   214   3e-61    
ref|WP_028628995.1|  gluconolactonase                                   214   5e-61    
emb|CDF85380.1|  hypothetical protein PKB_4051                          214   5e-61    
ref|WP_016491774.1|  hypothetical protein                               214   5e-61    
gb|ERS86402.1|  gluconolactonase                                        214   5e-61    
ref|WP_016548796.1|  strictosidine synthase                             214   5e-61    
ref|WP_011784053.1|  gluconolactonase                                   214   6e-61    
gb|ERP99132.1|  gluconolactonase                                        214   6e-61    
ref|WP_031209904.1|  MULTISPECIES: gluconolactonase                     214   6e-61    
ref|WP_036218657.1|  gluconolactonase                                   214   6e-61    
ref|WP_024766451.1|  gluconolactonase                                   213   1e-60    
ref|XP_008802475.1|  PREDICTED: adipocyte plasma membrane-associa...    213   2e-60    
ref|XP_010939896.1|  PREDICTED: adipocyte plasma membrane-associa...    213   2e-60    
gb|KES22899.1|  gluconolactonase                                        212   2e-60    
ref|XP_006452820.1|  hypothetical protein CICLE_v10008683mg             213   3e-60    
ref|WP_012139230.1|  strictosidine synthase                             212   3e-60    
ref|WP_010575787.1|  gluconolactonase                                   213   3e-60    
ref|XP_006474715.1|  PREDICTED: protein YLS2-like                       213   3e-60    
gb|ABR17054.1|  unknown                                                 212   3e-60    Picea sitchensis
ref|XP_001773641.1|  predicted protein                                  210   4e-60    
gb|ADE77910.1|  unknown                                                 212   4e-60    
gb|AAU83366.1|  conserved hypothetical protein                          209   3e-59    uncultured archaeon GZfos27E7
ref|WP_010485149.1|  gluconolactonase                                   209   3e-59    
gb|KDO73883.1|  hypothetical protein CISIN_1g0173172mg                  207   4e-59    
ref|XP_010090178.1|  Adipocyte plasma membrane-associated protein       209   7e-59    
ref|WP_029654418.1|  gluconolactonase                                   207   1e-58    
ref|WP_034062860.1|  gluconolactonase                                   204   2e-58    
gb|EMJ97366.1|  strictosidine synthase                                  207   3e-58    
ref|WP_036134224.1|  gluconolactonase                                   207   3e-58    
ref|WP_036090792.1|  gluconolactonase                                   207   4e-58    
ref|WP_014575868.1|  gluconolactonase                                   206   7e-58    
ref|WP_014100473.1|  gluconolactonase                                   205   9e-58    
ref|WP_034051379.1|  gluconolactonase                                   202   1e-57    
ref|XP_009382974.1|  PREDICTED: adipocyte plasma membrane-associa...    205   1e-57    
ref|WP_008173243.1|  gluconolactonase                                   204   2e-57    
ref|XP_010656110.1|  PREDICTED: protein YLS2-like                       204   4e-57    
gb|KDP33928.1|  hypothetical protein JCGZ_07499                         203   5e-57    
ref|WP_016545814.1|  strictosidine synthase                             203   5e-57    
emb|CDP03073.1|  unnamed protein product                                202   1e-56    
ref|WP_039700172.1|  gluconolactonase                                   199   1e-56    
ref|XP_011039971.1|  PREDICTED: protein YLS2-like                       202   2e-56    
ref|WP_008595237.1|  gluconolactonase                                   203   2e-56    
emb|CBI27792.3|  unnamed protein product                                204   3e-56    
ref|WP_029889953.1|  hypothetical protein                               201   4e-56    
ref|WP_018052374.1|  hypothetical protein                               199   1e-55    
gb|AHI29013.1|  gluconolactonase                                        199   2e-55    
ref|XP_008242256.1|  PREDICTED: protein YLS2-like                       199   2e-55    
ref|WP_008940560.1|  strictosidine synthase family protein              199   2e-55    
ref|XP_010261822.1|  PREDICTED: protein YLS2-like isoform X1            201   2e-55    
ref|XP_010261823.1|  PREDICTED: protein YLS2-like isoform X2            201   2e-55    
ref|XP_002277807.1|  PREDICTED: protein YLS2                            199   3e-55    Vitis vinifera
ref|WP_008252036.1|  strictosidine synthase family protein              198   5e-55    
gb|AFK43571.1|  unknown                                                 198   5e-55    
ref|XP_002516259.1|  Adipocyte plasma membrane-associated protein...    197   9e-55    Ricinus communis
ref|XP_009337197.1|  PREDICTED: protein YLS2-like isoform X1            197   9e-55    
ref|WP_036691801.1|  gluconolactonase                                   197   1e-54    
ref|XP_004239316.1|  PREDICTED: protein YLS2 isoform X2                 196   2e-54    
ref|XP_002277770.1|  PREDICTED: protein YLS2-like                       196   2e-54    Vitis vinifera
ref|WP_039832956.1|  gluconolactonase                                   197   3e-54    
ref|XP_006658807.1|  PREDICTED: adipocyte plasma membrane-associa...    196   3e-54    
emb|CBI27791.3|  unnamed protein product                                197   3e-54    
gb|EAZ04693.1|  hypothetical protein OsI_26851                          196   5e-54    
ref|WP_014108493.1|  strictosidine synthase family protein              196   5e-54    
ref|XP_009764710.1|  PREDICTED: protein YLS2-like isoform X1            195   5e-54    
ref|WP_025708202.1|  gluconolactonase                                   196   6e-54    
gb|EEE67583.1|  hypothetical protein OsJ_25115                          195   8e-54    
gb|KDO73884.1|  hypothetical protein CISIN_1g0173172mg                  191   8e-54    
ref|WP_025566378.1|  gluconolactonase                                   194   1e-53    
ref|NP_001060260.1|  Os07g0614000                                       195   1e-53    
ref|XP_006574654.1|  PREDICTED: protein YLS2-like isoform X2            189   2e-53    
ref|WP_027000426.1|  hypothetical protein                               193   4e-53    
ref|XP_010666852.1|  PREDICTED: protein YLS2-like                       193   4e-53    
gb|EMT23469.1|  Adipocyte plasma membrane-associated protein            195   6e-53    
ref|WP_039295071.1|  gluconolactonase                                   193   6e-53    
ref|XP_008388891.1|  PREDICTED: protein YLS2-like isoform X1            192   8e-53    
gb|AIQ33017.1|  gluconolactonase                                        192   2e-52    
gb|KCW53264.1|  hypothetical protein EUGRSUZ_J02525                     186   3e-52    
ref|XP_003559969.1|  PREDICTED: LOW QUALITY PROTEIN: adipocyte pl...    191   3e-52    
gb|EAZ04694.1|  hypothetical protein OsI_26852                          191   4e-52    
ref|WP_011588783.1|  gluconolactonase                                   191   4e-52    
ref|WP_019914714.1|  gluconolactonase                                   191   5e-52    
ref|XP_004288991.1|  PREDICTED: adipocyte plasma membrane-associa...    191   6e-52    
ref|WP_028316241.1|  strictosidine synthase                             190   7e-52    
ref|XP_010049404.1|  PREDICTED: adipocyte plasma membrane-associa...    190   7e-52    
ref|XP_003629190.1|  Adipocyte plasma membrane-associated protein       185   8e-52    
ref|XP_010321125.1|  PREDICTED: protein YLS2 isoform X1                 189   8e-52    
gb|AIQ44306.1|  gluconolactonase                                        189   1e-51    
dbj|BAP14404.1|  strictosidine synthase subfamily protein               189   1e-51    
ref|WP_026180222.1|  gluconolactonase                                   189   1e-51    
ref|XP_007012617.1|  Strictosidine synthase-like 4                      189   1e-51    
ref|XP_009337198.1|  PREDICTED: protein YLS2-like isoform X2            188   3e-51    
ref|WP_022994647.1|  MULTISPECIES: gluconolactonase                     188   3e-51    
ref|WP_035203951.1|  hypothetical protein                               187   4e-51    
ref|WP_035460323.1|  gluconolactonase                                   188   4e-51    
ref|WP_015949049.1|  strictosidine synthase                             188   4e-51    
gb|EYU25838.1|  hypothetical protein MIMGU_mgv1a021873mg                188   4e-51    
ref|XP_008388894.1|  PREDICTED: protein YLS2-like isoform X2            187   5e-51    
gb|AJD48578.1|  hypothetical protein S7S_10830                          187   5e-51    
ref|XP_008354463.1|  PREDICTED: protein YLS2-like                       187   9e-51    
ref|WP_029921702.1|  gluconolactonase                                   187   1e-50    
ref|WP_007105805.1|  strictosidine synthase family protein              186   2e-50    
ref|WP_014995027.1|  gluconolactonase                                   186   2e-50    
dbj|BAJ87181.1|  predicted protein                                      186   3e-50    
ref|WP_011061965.1|  gluconolactonase                                   186   3e-50    
ref|WP_028621358.1|  gluconolactonase                                   185   4e-50    
ref|WP_015636109.1|  strictosidine synthase family protein              185   4e-50    
dbj|BAO63179.1|  strictosidine synthase                                 185   6e-50    
ref|WP_019094006.1|  gluconolactonase                                   184   1e-49    
ref|WP_010180222.1|  hypothetical protein                               184   1e-49    
ref|XP_010049397.1|  PREDICTED: protein YLS2-like                       184   1e-49    
ref|XP_006452819.1|  hypothetical protein CICLE_v10008687mg             184   1e-49    
ref|XP_007202297.1|  hypothetical protein PRUPE_ppa007866mg             184   1e-49    
gb|KDO73891.1|  hypothetical protein CISIN_1g017371mg                   184   1e-49    
ref|XP_011093856.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    184   1e-49    
ref|WP_011525656.1|  strictosidine synthase                             184   1e-49    
ref|WP_010565732.1|  gluconolactonase                                   184   1e-49    
ref|XP_008459911.1|  PREDICTED: protein YLS2-like isoform X1            184   2e-49    
gb|AFK41737.1|  unknown                                                 183   2e-49    
ref|XP_010049393.1|  PREDICTED: protein YLS2-like                       183   2e-49    
ref|WP_033389600.1|  gluconolactonase                                   183   2e-49    
ref|XP_008459921.1|  PREDICTED: protein YLS2-like isoform X2            183   2e-49    
ref|XP_006474718.1|  PREDICTED: protein YLS2-like                       183   3e-49    
ref|XP_003595316.1|  Adipocyte plasma membrane-associated protein       183   3e-49    
ref|WP_034353906.1|  strictosidine synthase                             182   3e-49    
ref|WP_025126751.1|  gluconolactonase                                   182   3e-49    
gb|AFK37804.1|  unknown                                                 182   4e-49    
ref|WP_010347782.1|  gluconolactonase                                   183   4e-49    
ref|WP_015678566.1|  strictosidine synthase                             182   4e-49    
ref|WP_029640070.1|  hypothetical protein                               182   7e-49    
ref|XP_003533788.1|  PREDICTED: adipocyte plasma membrane-associa...    182   7e-49    
ref|XP_003595315.1|  Adipocyte plasma membrane-associated protein       181   7e-49    
ref|WP_035244752.1|  gluconolactonase                                   181   8e-49    
ref|WP_013783832.1|  strictosidine synthase                             182   8e-49    
ref|WP_007185801.1|  hypothetical protein                               182   8e-49    
ref|WP_022639427.1|  gluconolactonase                                   182   9e-49    
ref|WP_013308471.1|  gluconolactonase                                   182   9e-49    
ref|WP_006011537.1|  strictosidine synthase                             182   1e-48    
gb|EMT05328.1|  Adipocyte plasma membrane-associated protein            181   1e-48    
ref|XP_004958290.1|  PREDICTED: adipocyte plasma membrane-associa...    181   1e-48    
ref|WP_012167905.1|  strictosidine synthase family protein              181   1e-48    
gb|KGD62704.1|  hypothetical protein T9A_00024                          181   1e-48    
gb|AFK34069.1|  unknown                                                 181   1e-48    
ref|WP_015890956.1|  gluconolactonase                                   181   1e-48    
ref|WP_007987442.1|  gluconolactonase                                   181   1e-48    
ref|XP_003595312.1|  Adipocyte plasma membrane-associated protein       181   1e-48    
ref|XP_006355768.1|  PREDICTED: adipocyte plasma membrane-associa...    181   2e-48    
ref|XP_007138651.1|  hypothetical protein PHAVU_009G226600g             180   2e-48    
ref|WP_002978245.1|  strictosidine synthase                             180   3e-48    
ref|WP_007234615.1|  hypothetical protein                               180   3e-48    
ref|WP_026913349.1|  gluconolactonase                                   180   3e-48    
ref|WP_032863710.1|  gluconolactonase                                   179   5e-48    
ref|WP_023986709.1|  MULTISPECIES: gluconolactonase                     180   5e-48    
ref|WP_017139556.1|  gluconolactonase                                   179   5e-48    
ref|WP_015679698.1|  strictosidine synthase                             179   7e-48    
ref|XP_004141179.1|  PREDICTED: adipocyte plasma membrane-associa...    179   8e-48    
gb|KDO73890.1|  hypothetical protein CISIN_1g017371mg                   179   8e-48    
ref|WP_007151011.1|  gluconolactonase                                   179   1e-47    
gb|KGN60501.1|  hypothetical protein Csa_2G000100                       179   1e-47    
ref|WP_038849055.1|  gluconolactonase                                   179   1e-47    
ref|WP_012389576.1|  gluconolactonase                                   178   1e-47    
gb|KHN12288.1|  Adipocyte plasma membrane-associated protein            178   1e-47    
ref|WP_033903301.1|  gluconolactonase                                   178   1e-47    
ref|WP_016974852.1|  gluconolactonase                                   178   1e-47    
ref|WP_008928436.1|  gluconolactonase                                   178   2e-47    
ref|WP_014279457.1|  gluconolactonase                                   179   2e-47    
gb|AAR37964.1|  strictosidine synthase family protein                   177   2e-47    
ref|WP_034147187.1|  gluconolactonase                                   177   3e-47    
gb|AIQ12221.1|  gluconolactonase                                        178   3e-47    
ref|XP_009764711.1|  PREDICTED: protein YLS2-like isoform X2            175   3e-47    
ref|XP_004488078.1|  PREDICTED: adipocyte plasma membrane-associa...    177   4e-47    
ref|WP_028617012.1|  gluconolactonase                                   177   4e-47    
ref|WP_035491248.1|  strictosidine synthase                             177   5e-47    
ref|WP_025718117.1|  gluconolactonase                                   177   6e-47    
ref|WP_022840389.1|  MULTISPECIES: gluconolactonase                     176   6e-47    
gb|KDO73889.1|  hypothetical protein CISIN_1g017371mg                   176   8e-47    
ref|WP_007995942.1|  gluconolactonase                                   176   1e-46    
ref|WP_024076374.1|  gluconolactonase                                   176   1e-46    
ref|WP_017735486.1|  gluconolactonase                                   176   1e-46    
ref|WP_029514699.1|  MULTISPECIES: gluconolactonase                     176   2e-46    
ref|WP_008015938.1|  gluconolactonase                                   175   2e-46    
ref|WP_002636333.1|  Strictosidine synthase                             176   2e-46    
ref|WP_036737342.1|  gluconolactonase                                   175   2e-46    
ref|WP_025683220.1|  gluconolactonase                                   176   2e-46    
ref|WP_008084819.1|  gluconolactonase                                   175   3e-46    
ref|WP_025722899.1|  gluconolactonase                                   175   3e-46    
ref|WP_011686137.1|  gluconolactonase                                   174   3e-46    
ref|WP_004784328.1|  gluconolactonase                                   174   3e-46    
ref|WP_025112564.1|  gluconolactonase                                   174   3e-46    
ref|WP_027606157.1|  gluconolactonase                                   174   4e-46    
ref|WP_008031538.1|  MULTISPECIES: gluconolactonase                     174   6e-46    
ref|WP_032888177.1|  gluconolactonase                                   174   6e-46    
ref|WP_017339185.1|  gluconolactonase                                   174   6e-46    
ref|WP_010209284.1|  MULTISPECIES: gluconolactonase                     174   7e-46    
ref|WP_038441952.1|  gluconolactonase                                   174   8e-46    
ref|WP_007976516.1|  gluconolactonase                                   173   8e-46    
ref|WP_029293264.1|  gluconolactonase                                   173   9e-46    
ref|WP_006912821.1|  gluconolactonase                                   174   1e-45    
ref|WP_008050669.1|  gluconolactonase                                   173   1e-45    
ref|WP_023964589.1|  gluconolactonase                                   173   1e-45    
ref|WP_025695151.1|  gluconolactonase                                   174   1e-45    
ref|WP_011576164.1|  strictosidine synthase                             173   1e-45    
ref|NP_001142013.1|  Strictosidine synthase 1 precursor                 173   1e-45    
ref|XP_001756649.1|  predicted protein                                  168   2e-45    
ref|WP_015094875.1|  strictosidine synthase                             172   2e-45    
ref|WP_025700854.1|  gluconolactonase                                   173   2e-45    
ref|WP_038577974.1|  gluconolactonase                                   172   2e-45    
ref|WP_038633540.1|  gluconolactonase                                   172   2e-45    
ref|WP_039758658.1|  gluconolactonase                                   172   3e-45    
ref|WP_016705376.1|  gluconolactonase                                   172   3e-45    
ref|WP_016968955.1|  gluconolactonase                                   172   3e-45    
ref|WP_007932356.1|  gluconolactonase                                   172   3e-45    
ref|WP_019586165.1|  hypothetical protein                               172   3e-45    
ref|WP_002974640.1|  strictosidine synthase                             171   6e-45    
ref|WP_025854915.1|  gluconolactonase                                   171   7e-45    
ref|WP_016774472.1|  gluconolactonase                                   171   7e-45    
ref|WP_025804515.1|  gluconolactonase                                   171   7e-45    
ref|WP_034402124.1|  strictosidine synthase                             171   7e-45    
ref|WP_007959468.1|  gluconolactonase                                   171   7e-45    
ref|WP_008248277.1|  strictosidine synthase family protein              171   7e-45    
ref|WP_007233292.1|  hypothetical protein                               171   7e-45    
ref|WP_008154989.1|  gluconolactonase                                   171   8e-45    
ref|WP_024012722.1|  gluconolactonase                                   171   8e-45    
ref|WP_033865912.1|  gluconolactonase                                   171   8e-45    
ref|WP_033185837.1|  strictosidine synthase                             171   9e-45    
ref|WP_020296917.1|  strictosidine synthase family protein              171   1e-44    
ref|WP_020799158.1|  gluconolactonase                                   171   1e-44    
ref|WP_035229158.1|  gluconolactonase                                   170   1e-44    
ref|WP_009049697.1|  gluconolactonase                                   170   1e-44    
ref|WP_018754312.1|  gluconolactonase                                   171   1e-44    
ref|WP_027461186.1|  strictosidine synthase                             170   2e-44    
gb|ABK96449.1|  unknown                                                 167   2e-44    
ref|WP_006994375.1|  adipocyte plasma membrane-associated protein       170   2e-44    
ref|WP_022986647.1|  gluconolactonase                                   170   2e-44    
ref|WP_034730853.1|  strictosidine synthase                             169   2e-44    
ref|WP_009471081.1|  gluconolactonase                                   169   2e-44    
ref|WP_008302561.1|  hypothetical protein                               169   2e-44    
gb|KDO73892.1|  hypothetical protein CISIN_1g017371mg                   167   2e-44    
ref|WP_007968824.1|  gluconolactonase                                   169   4e-44    
ref|XP_006445750.1|  hypothetical protein CICLE_v10015735mg             169   4e-44    
ref|WP_033044391.1|  gluconolactonase                                   169   5e-44    
ref|WP_028081992.1|  hypothetical protein                               169   6e-44    
ref|XP_006445715.1|  hypothetical protein CICLE_v10015739mg             168   6e-44    
ref|WP_034107390.1|  gluconolactonase                                   168   7e-44    
ref|WP_008059227.1|  gluconolactonase                                   168   7e-44    
ref|XP_004488079.1|  PREDICTED: adipocyte plasma membrane-associa...    168   8e-44    
ref|WP_028682855.1|  gluconolactonase                                   168   9e-44    
ref|WP_033061631.1|  gluconolactonase                                   167   1e-43    
gb|EZP32354.1|  strictosidine synthase                                  167   1e-43    
ref|WP_034671261.1|  gluconolactonase                                   167   1e-43    
ref|WP_009044486.1|  gluconolactonase                                   167   2e-43    
ref|WP_030984804.1|  strictosidine synthase                             167   2e-43    
ref|WP_020031400.1|  hypothetical protein                               167   2e-43    
ref|XP_008344214.1|  PREDICTED: protein YLS2-like                       161   2e-43    
ref|WP_038045208.1|  ABC transporter permease                           172   2e-43    
ref|WP_013753020.1|  Strictosidine synthase, conserved region           166   3e-43    
ref|WP_011334514.1|  gluconolactonase                                   166   3e-43    
ref|WP_015884791.1|  gluconolactonase                                   166   4e-43    
ref|WP_039768851.1|  gluconolactonase                                   166   4e-43    
gb|AHZ67140.1|  strictosidine synthase                                  166   6e-43    
ref|WP_007946486.1|  gluconolactonase                                   166   6e-43    
ref|WP_007941773.1|  gluconolactonase                                   166   6e-43    
ref|WP_038588989.1|  gluconolactonase                                   166   7e-43    
ref|WP_003210263.1|  MULTISPECIES: gluconolactonase                     166   8e-43    
ref|WP_007988196.1|  strictosidine synthase family protein              165   9e-43    
emb|CCK77407.1|  Strictosidine synthase                                 165   1e-42    
ref|WP_038299699.1|  hypothetical protein                               165   1e-42    
ref|WP_010495413.1|  gluconolactonase                                   166   1e-42    
ref|WP_014976362.1|  hypothetical protein                               165   1e-42    
gb|EJW22061.1|  hypothetical protein IMCC14465_04550                    165   1e-42    
ref|WP_026353244.1|  hypothetical protein                               164   1e-42    
ref|XP_006485457.1|  PREDICTED: protein YLS2-like                       164   2e-42    
ref|WP_037323841.1|  ABC transporter permease                           169   2e-42    
ref|WP_027613687.1|  gluconolactonase                                   164   2e-42    
gb|KDO44208.1|  hypothetical protein CISIN_1g018474mg                   164   2e-42    
ref|WP_008006518.1|  gluconolactonase                                   164   2e-42    
ref|WP_014979153.1|  hypothetical protein                               164   2e-42    
ref|WP_007898204.1|  gluconolactonase                                   164   3e-42    
ref|WP_020418911.1|  ABC transporter permease                           168   4e-42    
ref|WP_014949274.1|  hypothetical protein                               163   4e-42    
ref|XP_006474719.1|  PREDICTED: protein YLS2-like                       164   4e-42    
ref|XP_010031590.1|  PREDICTED: adipocyte plasma membrane-associa...    164   4e-42    
ref|WP_039791598.1|  ABC transporter permease                           168   5e-42    



>ref|XP_006340819.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Solanum tuberosum]
Length=374

 Score =   507 bits (1306),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 237/363 (65%), Positives = 299/363 (82%), Gaps = 2/363 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
              +V++PVILG V YQLDSFDPA YP H L+   P VAPKRN ++L  SEKIGV +L  PE
Sbjct  13    ISVIIPVILGTVFYQLDSFDPASYPTHVLSTDPPIVAPKRNNQMLRRSEKIGVNQLLSPE  72

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+ YD K+GVIYTGC+DGWVK+V VNES AADS VEDWV TGGRPLGLA G HGEVIVAD
Sbjct  73    DVAYDQKSGVIYTGCVDGWVKKVKVNES-AADSTVEDWVFTGGRPLGLALGRHGEVIVAD  131

Query  432   AEIGLL-NVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A+ GLL NVTS G+++V+T EA+G+KFKL DAVDVAEDG++YF+DAS+KY +E +I++ L
Sbjct  132   ADKGLLLNVTSVGEIKVLTEEAEGLKFKLADAVDVAEDGIIYFSDASYKYNIEQYIYDIL  191

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EG+P+GRLLSYDP TKQTK L++DL+FANGVAV PDQ++VIFCET +R+CKKYYI+GEKK
Sbjct  192   EGRPNGRLLSYDPSTKQTKTLLSDLYFANGVAVSPDQNYVIFCETPLRKCKKYYIKGEKK  251

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
             GS+++F++NLPG PDNIRYDGEG +WI    E T++++L  RYP +RKI+ +M KY  +P
Sbjct  252   GSVDMFVDNLPGFPDNIRYDGEGHYWIAFASEKTYSWDLTLRYPFIRKIMAIMVKYVGQP  311

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAV  1148
               EKNGG+  VD++GNP+ HYY+ D T+VS+GIKIG+++YCG VK  +IL LNL QNPAV
Sbjct  312   KAEKNGGVLSVDLQGNPLEHYYDEDLTMVSSGIKIGDHLYCGSVKSPYILRLNLKQNPAV  371

Query  1149  ASG  1157
              + 
Sbjct  372   QTS  374



>ref|XP_004232552.1| PREDICTED: protein YLS2 [Solanum lycopersicum]
Length=371

 Score =   496 bits (1276),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 230/360 (64%), Positives = 295/360 (82%), Gaps = 2/360 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
              ++++PVILG V YQLDSFDP  YP H L+   P VAPKRN ++L  SE IGV +L  PE
Sbjct  13    ISLIIPVILGTVFYQLDSFDPVSYPTHVLSTDPPIVAPKRNNQVLRGSENIGVNQLLAPE  72

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+ YDP++GVIYT C+DGWVK+V VNES AADS VEDWV TGGRPLGLA G HGEVIVAD
Sbjct  73    DVAYDPESGVIYTACVDGWVKKVKVNES-AADSTVEDWVFTGGRPLGLALGHHGEVIVAD  131

Query  432   AEIGLL-NVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             +E GLL NVTS+G+++V+T EA+G+K KL DAVDVAEDG++YF+DAS+KY +E +I++FL
Sbjct  132   SEKGLLLNVTSEGEIKVLTEEAEGLKLKLADAVDVAEDGIIYFSDASYKYNIEQYIYDFL  191

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EG+PHGRLLSYDP TKQTK L+++L FANGVAV PDQ++VIFCET +R+CKKY+I+GEKK
Sbjct  192   EGRPHGRLLSYDPSTKQTKTLLSNLHFANGVAVSPDQNYVIFCETPLRKCKKYHIKGEKK  251

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
             GS+++F++NLPG PDNIRYDGEG +WI    E T++++L  +YP +RKI+ +M KY  +P
Sbjct  252   GSVDMFVDNLPGFPDNIRYDGEGHYWIAFASENTYSWDLTLKYPFIRKIMAIMVKYVGQP  311

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAV  1148
               EKNGG+  VD++GNP+ HYY+ D T+VS+GIKIG+++YCG VK  +IL LNL Q PAV
Sbjct  312   KTEKNGGVLSVDLQGNPLEHYYDEDLTMVSSGIKIGDHLYCGSVKSPYILRLNLKQYPAV  371



>ref|XP_009784074.1| PREDICTED: protein YLS2-like [Nicotiana sylvestris]
Length=385

 Score =   494 bits (1273),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 234/369 (63%), Positives = 297/369 (80%), Gaps = 6/369 (2%)
 Frame = +3

Query  66    WP----FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVG  233
             WP     +V +PVILGVV+YQL+SF+P  YP H L+   P V PKRN ++L  SEKIGV 
Sbjct  18    WPVTLFISVSIPVILGVVVYQLESFEPVSYPTHVLSSDPPMVVPKRNNQMLRGSEKIGVD  77

Query  234   RLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHG  413
             +L  PED+ YDP  GVIYTGC+DGWVKRVTVNES   DS VEDWV TGGRPLG+A G +G
Sbjct  78    QLLSPEDVAYDPNWGVIYTGCVDGWVKRVTVNES-VGDSRVEDWVFTGGRPLGVALGHYG  136

Query  414   EVIVADAEIGLL-NVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLED  590
             EVIVADA+ GLL NVTS+G+V+V+T EA+G+KFKL DAVD+AEDGM+YF+DAS+KY  +D
Sbjct  137   EVIVADADKGLLLNVTSEGEVKVLTEEAEGLKFKLADAVDIAEDGMIYFSDASYKYKFKD  196

Query  591   FIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYY  770
             +I++FLEG+P+GRLLSYDP TKQTK L+ DL+FANGVAV PDQ+FVIFCET +R CKKYY
Sbjct  197   YIYDFLEGRPYGRLLSYDPLTKQTKTLLRDLYFANGVAVSPDQNFVIFCETPLRICKKYY  256

Query  771   IRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVME  950
             ++GE+KGS++VF+ENLPG PDNIRYDG+  +WI      T++++L QRYP +RKI+ +M 
Sbjct  257   VKGERKGSVDVFVENLPGYPDNIRYDGDSHYWIAFATAKTYSWDLAQRYPFIRKIMAIMV  316

Query  951   KYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             KY  +P+ EKNGG+  VD++GNPV HYY++D T+VS+  KIG+++YCG VK  F+L LNL
Sbjct  317   KYVGQPHAEKNGGVVSVDLQGNPVEHYYDQDLTMVSSATKIGDHLYCGSVKSPFMLRLNL  376

Query  1131  TQNPAVASG  1157
              QNPAV + 
Sbjct  377   KQNPAVHTS  385



>ref|XP_004287742.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Fragaria vesca subsp. vesca]
Length=393

 Score =   493 bits (1268),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 234/380 (62%), Positives = 298/380 (78%), Gaps = 9/380 (2%)
 Frame = +3

Query  36    KILRTKMSGLWP-----FAVLVPVILGV-VIYQLDSFDPAPYPAHELTQGSPAVAPKRNG  197
             + +R   S  WP     F++LVPV + + V+YQLD FDPAP P HE++    A AP+RN 
Sbjct  15    QAVRRSTSSSWPLNFLLFSILVPVAVALLVLYQLDPFDPAPLPLHEISH-RIAAAPRRND  73

Query  198   RLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTG  377
             ++L  SE IGVG L+GPED+ YD K+GVIYTGC DGWVKRVT+NES  ADS VE+WVNTG
Sbjct  74    QMLKGSEFIGVGVLAGPEDVAYDSKSGVIYTGCADGWVKRVTLNES-VADSVVENWVNTG  132

Query  378   GRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYF  557
             GRPLGLAHG +G+++VAD E GLL  +  G+V+++T EA+GVKFKLTDAVDVA+DGM+YF
Sbjct  133   GRPLGLAHGHNGDLLVADTEKGLLRTSEAGEVELLTDEAEGVKFKLTDAVDVAKDGMIYF  192

Query  558   TDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFC  737
             TDAS+KY   DFIW+ LEG+PHGRLLSYDP TK+TKVLV DL+FANGVAV PDQ FVIFC
Sbjct  193   TDASYKYSFHDFIWDILEGRPHGRLLSYDPTTKETKVLVPDLYFANGVAVSPDQKFVIFC  252

Query  738   ETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRY  917
             ET+MRRCKKYY++GEKKG +E FI++LPG PDNIRYDGEG +WIG+  E T +++L  RY
Sbjct  253   ETVMRRCKKYYLQGEKKGHVENFIDSLPGTPDNIRYDGEGHYWIGLATEITVSWDLALRY  312

Query  918   PLLRKILGVMEKYGV-RPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCG  1094
             P +RK L +MEKY   +P+MEKN G+  V++EG P+ HY +   +L+S+GIKIGNY+YCG
Sbjct  313   PFIRKWLAIMEKYTAGKPHMEKNSGVMAVNLEGEPIDHYSDPGLSLISSGIKIGNYLYCG  372

Query  1095  FVKYGFILSLNLTQNPAVAS  1154
              + Y +I+  +L  +PA A+
Sbjct  373   SIVYPYIIRFDLEHHPAQAT  392



>ref|XP_009605180.1| PREDICTED: protein YLS2-like [Nicotiana tomentosiformis]
Length=386

 Score =   492 bits (1266),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 231/369 (63%), Positives = 296/369 (80%), Gaps = 6/369 (2%)
 Frame = +3

Query  66    WPF----AVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVG  233
             WP     +VL+PVILGVV+YQL+SFDPA YP H L+   P + PKRN ++L  +EKIGV 
Sbjct  19    WPIPLFISVLIPVILGVVLYQLESFDPASYPIHVLSSYPPMIVPKRNNQMLRSAEKIGVD  78

Query  234   RLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHG  413
             RL  PED+ YD  +GVIYTGC+DGWVKRVTVNES   DS VE+WV TGGRPLG+A G +G
Sbjct  79    RLLSPEDVAYDLNSGVIYTGCVDGWVKRVTVNES-VGDSRVENWVFTGGRPLGVALGHYG  137

Query  414   EVIVADAEIGLL-NVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLED  590
             EVIV DA+ GLL NVTS+G+++V+T EA+G+K KL DAVD+AE+GM+YF+DAS+KY  +D
Sbjct  138   EVIVVDADKGLLLNVTSEGEIKVLTEEAEGLKLKLADAVDIAENGMIYFSDASYKYNFKD  197

Query  591   FIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYY  770
             +I++FLEG+P+GRLLSYDP TKQTK L+ DL+FANGVAV PDQ+FVI CET +R+CKKYY
Sbjct  198   YIYDFLEGRPYGRLLSYDPLTKQTKTLLRDLYFANGVAVSPDQNFVIICETPLRKCKKYY  257

Query  771   IRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVME  950
             I GE+KGS++VF+ENLPG PDNIRYDG+G +WI      T++++L QRYP +RKI+ +M 
Sbjct  258   INGERKGSVDVFVENLPGYPDNIRYDGDGHYWIAFATAKTYSWDLAQRYPFIRKIMAIMV  317

Query  951   KYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             KY  +P+ EKNGG+  VD++GNPV HYY+RD T+VS+  KIG ++YCG VK  ++L LNL
Sbjct  318   KYIGQPHAEKNGGVISVDLQGNPVEHYYDRDLTMVSSATKIGEHLYCGSVKSPYMLRLNL  377

Query  1131  TQNPAVASG  1157
              QNPAV + 
Sbjct  378   KQNPAVHTS  386



>emb|CDP01813.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   489 bits (1259),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 239/376 (64%), Positives = 297/376 (79%), Gaps = 5/376 (1%)
 Frame = +3

Query  45    RTKMSGLWPFAVLVPVILGVV---IYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDS  215
             RTK S  WPFA LV V+  VV   IYQLDSFDPAPYPAHELT+  P   PK N  +L  +
Sbjct  20    RTKKS-RWPFACLVSVLPVVVGVLIYQLDSFDPAPYPAHELTRKKPLTVPKSNPHVLKGA  78

Query  216   EKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGL  395
             E IGVG+L GPEDI YDPK+GVIYTGC DGW+KRVTVN+S AADS V DW+NTGGRPLG+
Sbjct  79    ENIGVGKLLGPEDIAYDPKSGVIYTGCEDGWIKRVTVNDS-AADSVVADWINTGGRPLGV  137

Query  396   AHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWK  575
               G HGEVIVADA+ GLLN T+DG +Q++T EA+GVKF+LTD VDVAEDG++YFTDAS+K
Sbjct  138   VCGHHGEVIVADADKGLLNATADGGIQLLTDEAEGVKFRLTDGVDVAEDGIVYFTDASYK  197

Query  576   YGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRR  755
             Y   +F W++ EG+P GRLLSYDP TK+TKVLV DL+FANGVAV PDQ FVIFCE+ M R
Sbjct  198   YSFWEFAWDYFEGRPFGRLLSYDPSTKETKVLVRDLYFANGVAVSPDQKFVIFCESPMAR  257

Query  756   CKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKI  935
             CKKYYI GE+KGS+++F+ENLPGMPDNIRYDG+G +WI +  E T+A++L QRYP +RKI
Sbjct  258   CKKYYINGERKGSVDIFVENLPGMPDNIRYDGQGHYWIALPTEITYAWDLAQRYPFIRKI  317

Query  936   LGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFI  1115
             + ++E+Y  RP++EKNGG   VD++G P AHY ERD +L++   KIG+++Y G +   +I
Sbjct  318   MAILERYVGRPHVEKNGGGLAVDLDGKPAAHYCERDLSLITGVNKIGDHIYLGSIDKPYI  377

Query  1116  LSLNLTQNPAVASG*Y  1163
             + LN+ Q PAV+   Y
Sbjct  378   IRLNIKQYPAVSDTEY  393



>ref|XP_011087145.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 5-like [Sesamum 
indicum]
Length=371

 Score =   474 bits (1220),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 219/363 (60%), Positives = 283/363 (78%), Gaps = 3/363 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAV-APKRNGRLLHDSEKIGVGRLSGP  248
             F  L+PV++ V +YQLD FDPAPYP HELTQ  P    P RN  +L  SEKIG G+L  P
Sbjct  11    FISLLPVLVAVFLYQLDRFDPAPYPEHELTQKEPPFFVPNRNSHMLRGSEKIGYGQLPAP  70

Query  249   EDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVA  428
             EDI YD KTG +YTGC DGWV R+ +N +SAAD  VE+WVNTGGRPLGL  GLHGEVIVA
Sbjct  71    EDIAYDAKTGALYTGCEDGWVNRLVLN-ASAADPVVENWVNTGGRPLGLVRGLHGEVIVA  129

Query  429   DAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             DA+ GLLN++SDG ++++T EA+GVKFKLTD VD+  DG LYFTDAS+KY  +++  + L
Sbjct  130   DADKGLLNISSDGVIELLTDEAEGVKFKLTDGVDIGPDGKLYFTDASYKYSFKEYFLDLL  189

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EG+PHGR L+YDP TK+T+VLV DL+FANGVAV  DQSFVIFCET MRRC+KYYI G +K
Sbjct  190   EGRPHGRFLAYDPSTKKTQVLVKDLYFANGVAVSADQSFVIFCETAMRRCRKYYIEGPRK  249

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
             G+I+ FIE+LPG+PDNIRYDG+  +WI +G E  + ++L+Q+YP +RK++ ++E+Y  RP
Sbjct  250   GTIDTFIEDLPGLPDNIRYDGDNQYWIALGTE-ANLWKLLQKYPFVRKVIVIVERYIGRP  308

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAV  1148
             N EKNGG+  VD++G P AHYY++D  LVS+GIKIG ++YCG + + +I  LN++Q PA 
Sbjct  309   NTEKNGGLIAVDLDGKPTAHYYDQDMFLVSSGIKIGEHLYCGSIVFPYITRLNVSQYPAT  368

Query  1149  ASG  1157
              + 
Sbjct  369   PAA  371



>ref|XP_009337096.1| PREDICTED: protein YLS2-like [Pyrus x bretschneideri]
Length=392

 Score =   474 bits (1220),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 212/359 (59%), Positives = 285/359 (79%), Gaps = 0/359 (0%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
             +++P+    ++YQLDSFDPAP P  ELT+     AP +N  +L  +E++G G L GPED+
Sbjct  32    LIIPIFAATLVYQLDSFDPAPLPFQELTRHLIKTAPAQNPHMLRGAERVGFGVLPGPEDV  91

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              YD ++G+IYTGC DGWVKRV  NES + + A+E+WVNTGGRPLGLA G H EV+VADA+
Sbjct  92    AYDKRSGIIYTGCADGWVKRVKRNESESPEFAIENWVNTGGRPLGLAFGHHDEVLVADAD  151

Query  438   IGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGK  617
              GLLNVTS+G+V+++T + +GVKF LTDAVDVA DGM+YFTDAS+KY L+D +W+ LEG+
Sbjct  152   KGLLNVTSEGEVKLLTDKVEGVKFSLTDAVDVAVDGMIYFTDASYKYSLKDHVWDILEGR  211

Query  618   PHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSI  797
             PHGRL+SYD  TKQT V+V DL+FANGV V PDQS VI+CET MRRC KYYI+G+KKGS+
Sbjct  212   PHGRLMSYDSATKQTTVMVRDLYFANGVVVSPDQSHVIYCETPMRRCTKYYIQGQKKGSV  271

Query  798   EVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNME  977
             + FI++LPG PDNIRYDGEG +WI + +  + A++L  RYP +RK++ +MEKY +RP++E
Sbjct  272   DTFIDHLPGYPDNIRYDGEGRYWIALSLAPSLAWDLAVRYPSIRKVMAIMEKYKLRPSVE  331

Query  978   KNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVAS  1154
             KNGG+  VD+EGN + HYY+   ++VS+GIKIGNY+YCG + + ++L LN+ +NP VA+
Sbjct  332   KNGGVLAVDLEGNLIEHYYDPRLSMVSSGIKIGNYIYCGSILHPYMLRLNIQENPPVAA  390



>ref|XP_004287743.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Fragaria vesca subsp. vesca]
Length=390

 Score =   470 bits (1210),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 220/372 (59%), Positives = 290/372 (78%), Gaps = 8/372 (2%)
 Frame = +3

Query  48    TKMSGLWP-----FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHD  212
             TK S  WP     F VLVPV   +++YQLDSFDPAPYP HEL+    + AP+RN ++L  
Sbjct  17    TKTSSSWPLNILFFTVLVPVAAAILLYQLDSFDPAPYPLHELSHLVTS-APRRNAQMLKG  75

Query  213   SEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLG  392
             SE +GVG L GPED+ YD K+GVIYTGC DGW+KRV +NES AADS VE+WVNTGGRP G
Sbjct  76    SEFLGVGALEGPEDVAYDSKSGVIYTGCADGWIKRVKLNES-AADSVVENWVNTGGRPFG  134

Query  393   LAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASW  572
             LAH   G+++VAD E GLL +  +G V+++T E++GVKFKLTD VDVA+DGM+YFTDAS+
Sbjct  135   LAHEHGGKLLVADGEKGLLRIDENGAVELLTDESEGVKFKLTDCVDVAKDGMIYFTDASY  194

Query  573   KYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMR  752
             K+  E+  W++LEG+PHGRLLSY+P TK+TKVLV+DL+FANGVA+ PDQ+++IFCET+M 
Sbjct  195   KHRAENTYWDYLEGRPHGRLLSYNPFTKETKVLVHDLYFANGVAISPDQNYLIFCETLMV  254

Query  753   RCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRK  932
             RC+KYY++GEKKGSIE FI+NLPG PDNIRYDGEG +WI + +  +   +L  RYP +RK
Sbjct  255   RCRKYYLQGEKKGSIENFIDNLPGSPDNIRYDGEGHYWIALAMGTSSITKLTFRYPFVRK  314

Query  933   ILGVMEKYGV-RPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYG  1109
             +L +MEKY +  P  EKN G+  V+++G P AHY +   +L+++GIKIGNY+YCG V Y 
Sbjct  315   VLAIMEKYKLSSPYKEKNSGVIAVNLDGEPTAHYSDPALSLITSGIKIGNYLYCGSVLYP  374

Query  1110  FILSLNLTQNPA  1145
             +I+ L++ ++PA
Sbjct  375   YIIRLDIEEHPA  386



>ref|XP_009344660.1| PREDICTED: protein YLS2-like [Pyrus x bretschneideri]
Length=389

 Score =   470 bits (1209),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 211/359 (59%), Positives = 285/359 (79%), Gaps = 0/359 (0%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
             +++P+    +IYQLDSFDPAP P  ELT+     AP +N R+L  +E++G G L GPED+
Sbjct  29    LIIPIFAATLIYQLDSFDPAPMPFRELTRHLIKKAPAQNPRMLRGAERVGYGVLLGPEDV  88

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              YD ++G+IYTGC DGW+KR+  NES   +  VE+WVNTGGRPLGLA G H EV+VADA+
Sbjct  89    AYDKRSGIIYTGCADGWMKRIKRNESENPEFVVENWVNTGGRPLGLAFGHHDEVLVADAD  148

Query  438   IGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGK  617
              GLLNVTS+G+V+V+  +A+GVKF LT+ VDVA DGM+YFTDAS+KY ++D +W+ LEG+
Sbjct  149   KGLLNVTSEGEVKVLADKAEGVKFLLTETVDVAVDGMIYFTDASYKYNMKDHVWDILEGR  208

Query  618   PHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSI  797
             PHGRL+SYD  TKQT VL+ DL+FANGV V PDQS VI+CET MRRC+K+YI+GEKKGS+
Sbjct  209   PHGRLMSYDSATKQTTVLLRDLYFANGVVVSPDQSHVIYCETPMRRCRKFYIQGEKKGSV  268

Query  798   EVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNME  977
             + FI++LPG+PDNIRYDGEG +WI + +  + A++L  RYP +RK++ +MEKY +RP++E
Sbjct  269   DAFIDHLPGLPDNIRYDGEGHYWIAMSMGLSLAWDLAVRYPFIRKVMAIMEKYKLRPSVE  328

Query  978   KNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVAS  1154
             KNGG+  VDMEGN +AHYY+   +++S+GIKIGNY+YCG   Y ++L LN+ +NP +A+
Sbjct  329   KNGGVLAVDMEGNLIAHYYDPGLSIISSGIKIGNYIYCGSPIYPYMLRLNIQENPPIAA  387



>ref|XP_007203450.1| hypothetical protein PRUPE_ppa022087mg [Prunus persica]
 gb|EMJ04649.1| hypothetical protein PRUPE_ppa022087mg [Prunus persica]
Length=400

 Score =   470 bits (1209),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 226/391 (58%), Positives = 293/391 (75%), Gaps = 12/391 (3%)
 Frame = +3

Query  3     PSGVKKKKNQDKILRTK----MSGLWP-----FAVLVPVILGVVIYQLDSFDPAPYPAHE  155
             PS  +   +   I  TK     S  WP     F++LVP+ + ++IYQLDS DPAP P HE
Sbjct  8     PSQTQPSHHTHPIPTTKPSSSSSSSWPSAFLIFSILVPLAIALLIYQLDSLDPAPLPLHE  67

Query  156   LTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNES  335
             LT+   AV P RN  +L  SE +G G L  PED+ YD K+G+IYTGC DGWVKRVT+NE 
Sbjct  68    LTKRVAAV-PTRNAHMLKGSEFVGAGALVAPEDVAYDSKSGLIYTGCADGWVKRVTLNEY  126

Query  336   SAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKL  515
              AADS VE+WV TGGRPLGLAHG   EV VAD E GLL ++ DG V+++T EA+GVKFKL
Sbjct  127   -AADSVVENWVFTGGRPLGLAHGHKNEVFVADTEKGLLKISEDGTVELLTDEAEGVKFKL  185

Query  516   TDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFAN  695
             TD VDVA++GMLYFTDAS KY L+DFI + L G+PHGRL+SY+P TK+TKVLV++L+FAN
Sbjct  186   TDCVDVAQNGMLYFTDASHKYSLKDFISDILGGRPHGRLMSYNPTTKETKVLVHNLYFAN  245

Query  696   GVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGI  875
             GVAV PDQ+FV+FCET+MRRC+KYY++G KKGS+E FI++LPGMPDNIRYDGEG +WI +
Sbjct  246   GVAVSPDQNFVVFCETVMRRCRKYYLQGSKKGSVENFIDHLPGMPDNIRYDGEGQYWIAL  305

Query  876   GIEYTHAFELIQRYPLLRKILGVMEKYGV-RPNMEKNGGIFVVDMEGNPVAHYYERDFTL  1052
               E T  ++L  RYP +RK+L ++++Y   RP+MEKN G+  V++ G P AHY + +  L
Sbjct  306   ATEVTPYWDLALRYPFIRKVLAIVKRYAAGRPHMEKNAGVLAVNLNGEPTAHYSDPELFL  365

Query  1053  VSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
             +S+GIKIGNY+YCG +   +I+ L++ Q+PA
Sbjct  366   ISSGIKIGNYLYCGSIVNPYIIRLDVHQHPA  396



>ref|XP_008393525.1| PREDICTED: protein YLS2-like [Malus domestica]
Length=391

 Score =   469 bits (1207),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 218/367 (59%), Positives = 288/367 (78%), Gaps = 3/367 (1%)
 Frame = +3

Query  57    SGLWPFAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGR  236
             S L  F+VL PV + ++IYQLD+ +PAP P HELTQ   A APKRN  +L  SE +G G 
Sbjct  26    STLLIFSVLAPVAIALLIYQLDTLNPAPLPLHELTQPV-AAAPKRNAHMLKGSEFVGAGA  84

Query  237   LSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGE  416
             L  PED+ YDPK+G IYTGC DGWVKRVT+NES AADS VE+WV TGGRPLGLAHG   E
Sbjct  85    LMAPEDVAYDPKSGFIYTGCADGWVKRVTLNES-AADSVVENWVFTGGRPLGLAHGADKE  143

Query  417   VIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFI  596
             V VAD E GLL ++ +G ++++T EA+GVKFKLTD VDVAEDGM+YFTDAS+KY L +F+
Sbjct  144   VYVADTEKGLLKISEEGTIELLTDEAEGVKFKLTDFVDVAEDGMIYFTDASYKYSLHEFM  203

Query  597   WEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIR  776
             W+ LEG+P+GR LSY+P TK+TKVLV +L+FANG+ V PDQ++VIFCET+MRRC+KYY++
Sbjct  204   WDILEGRPYGRFLSYNPTTKETKVLVRNLYFANGLVVSPDQNYVIFCETVMRRCRKYYLQ  263

Query  777   GEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKY  956
             G KKGS+E FI+ LPGMPDNIRYDGEG +WI +  +    ++L  RYP +RK+L ++++Y
Sbjct  264   GTKKGSVENFIDQLPGMPDNIRYDGEGRYWIALATDVKPYWDLALRYPFIRKVLAIVKRY  323

Query  957   -GVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLT  1133
              G RP +EKN G+F V+++G P+AHY + +  L+++GIKIG ++YCG V Y +I+ L+L 
Sbjct  324   AGGRPYLEKNAGVFAVNLDGEPIAHYSDPELFLITSGIKIGKFLYCGSVVYPYIIRLDLD  383

Query  1134  QNPAVAS  1154
             ++PA A+
Sbjct  384   RHPAHAT  390



>ref|XP_008241973.1| PREDICTED: protein YLS2-like [Prunus mume]
Length=402

 Score =   468 bits (1203),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 218/359 (61%), Positives = 282/359 (79%), Gaps = 3/359 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F+VL P+ + ++IYQLDS DPAP P HELTQ   A AP RN  +L  SE +G G L  PE
Sbjct  42    FSVLGPLAIALLIYQLDSLDPAPLPLHELTQ-RVAAAPTRNAHMLKGSEFVGAGALVAPE  100

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+ YD K+G+IYTGC DGWVKRVT+NES A DS VE+WV TGGRPLGLAHG   EV VAD
Sbjct  101   DVAYDSKSGLIYTGCADGWVKRVTLNES-ATDSVVENWVFTGGRPLGLAHGHKNEVFVAD  159

Query  432   AEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
              E GLL ++ DG V+++T EA+GVKFKLTD VDVA++GMLYFTDAS KY L+DF+ + L 
Sbjct  160   TEKGLLKISEDGTVELLTDEAEGVKFKLTDCVDVAQNGMLYFTDASHKYSLKDFVSDILG  219

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
             G+PHGRL+SY+P TK+TKVLV++L+FANGVAV PDQ+FV+FCET+MRRC+KY+++G KKG
Sbjct  220   GRPHGRLMSYNPTTKETKVLVHNLYFANGVAVSPDQNFVVFCETVMRRCRKYHLQGSKKG  279

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGV-RP  968
             S+E FI++LPGMPDNIRYDGEG +WI +  E T   +L  RYP +RK+L ++++Y   RP
Sbjct  280   SVENFIDHLPGMPDNIRYDGEGQYWIALATEVTPYLDLALRYPFIRKVLAIVKQYAAGRP  339

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
             +MEKN G+F V++ G P AHY + +  L+S+GIKIGNY+YCG +   +I+ L++ Q+PA
Sbjct  340   HMEKNAGVFGVNLNGEPTAHYSDPELFLISSGIKIGNYLYCGSIVNPYIIRLDVHQHPA  398



>ref|XP_008241972.1| PREDICTED: protein YLS2-like [Prunus mume]
Length=401

 Score =   467 bits (1201),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 218/359 (61%), Positives = 282/359 (79%), Gaps = 3/359 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F+VL P+ + ++IYQLDS DPAP P HELTQ   A AP RN  +L  SE +G G L  PE
Sbjct  41    FSVLGPLAIALLIYQLDSLDPAPLPLHELTQ-RVAAAPTRNAHMLKGSEFVGAGALVAPE  99

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+ YD K+G+IYTGC DGWVKRV +NES AADS VE+WV TGGRPLGLAHGL  EV VAD
Sbjct  100   DVAYDSKSGLIYTGCADGWVKRVRLNES-AADSVVENWVFTGGRPLGLAHGLKNEVFVAD  158

Query  432   AEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
              E GLL ++ +G V+++T EA+GVKFKLTD VDVA++GMLYFTDAS KY L+DFI + L 
Sbjct  159   TEKGLLKISENGTVELLTDEAEGVKFKLTDCVDVAQNGMLYFTDASHKYSLKDFISDILG  218

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
             G+PHGRL+SY+P TK+TKVLV++L+FANGVAV PDQ+F +FCET+MRRC+KYYI+G KKG
Sbjct  219   GRPHGRLMSYNPTTKETKVLVHNLYFANGVAVSPDQNFAVFCETVMRRCRKYYIQGSKKG  278

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGV-RP  968
             S+E FI++LPGMPDNIRYDGEG +WI +  E T  ++L  RYP++RK+L ++++Y   RP
Sbjct  279   SVENFIDHLPGMPDNIRYDGEGQYWIALATEVTPYWDLALRYPIIRKVLAIVKQYAAGRP  338

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
             +MEKN G+  V++ G P AHY +    L+S+GIKIGNY+YCG +   +I+ L++ ++PA
Sbjct  339   HMEKNAGVLAVNLNGEPTAHYSDPKLFLISSGIKIGNYLYCGSIVNPYIIRLDVHKHPA  397



>ref|XP_002268467.1| PREDICTED: protein YLS2 [Vitis vinifera]
Length=383

 Score =   463 bits (1192),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 214/370 (58%), Positives = 282/370 (76%), Gaps = 6/370 (2%)
 Frame = +3

Query  48    TKMSGLWPFAVLV----PVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDS  215
             T+ S  W  A+L+    PV   + +YQLDSFDPA  P H  +Q  P   P+ N RLLH+S
Sbjct  12    TRKSSSWSLALLISILTPVAAAIFLYQLDSFDPASLPTHVFSQ-EPMSVPRINSRLLHES  70

Query  216   EKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGL  395
             E IG+G+L GPEDI YD  + +IYTGC DGW+K+VT+N+S A +S V DW  TGGRPLG+
Sbjct  71    EMIGLGKLLGPEDIAYDTNSHLIYTGCADGWIKKVTLNDS-AVNSVVHDWAFTGGRPLGV  129

Query  396   AHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWK  575
               G  GEV+VADA+ GLL ++ DG V+++T EA+G+ FKLTDAVDVA DGM+YFTDAS+K
Sbjct  130   VLGRAGEVLVADADKGLLEISEDGVVKLLTDEAEGIGFKLTDAVDVAVDGMIYFTDASYK  189

Query  576   YGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRR  755
             Y L+DFIW+ LEG+PHGRLLS+DP T++TKVLV DL+FANGV V PDQ+F+IFCET M+R
Sbjct  190   YSLKDFIWDILEGRPHGRLLSFDPSTQETKVLVRDLYFANGVVVSPDQTFLIFCETFMKR  249

Query  756   CKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKI  935
             C KYYI+GE+KGS++ FI+NLPGMPDNI YDGEG +WIG+   Y   ++L  +YP +RKI
Sbjct  250   CSKYYIQGERKGSVDKFIDNLPGMPDNILYDGEGHYWIGLATGYNDLWDLALKYPSIRKI  309

Query  936   LGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFI  1115
             + +ME++  RP  EKNGG+  +D+EG P+AHYY+   +L+S+GIKI  Y+YCGFV   ++
Sbjct  310   MAIMERFIGRPEFEKNGGVLAIDLEGKPIAHYYDPKLSLMSSGIKIDKYLYCGFVVKPYM  369

Query  1116  LSLNLTQNPA  1145
             + L+L Q+ A
Sbjct  370   IRLDLDQHAA  379



>ref|XP_009344661.1| PREDICTED: protein YLS2-like [Pyrus x bretschneideri]
Length=390

 Score =   463 bits (1192),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 217/362 (60%), Positives = 287/362 (79%), Gaps = 3/362 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F VL PV + ++IY+LD+ DPA  P HELTQ   A APKRN  +L  SE +GVG L  PE
Sbjct  30    FLVLAPVAIALLIYRLDTLDPASLPLHELTQPV-AAAPKRNAHMLKGSEFVGVGALVAPE  88

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+ YDPKTG+IYTGC DGWVKRVT+NES AADS VE+WV TGGRPLG+AHG   EV VAD
Sbjct  89    DVAYDPKTGLIYTGCADGWVKRVTLNES-AADSVVENWVFTGGRPLGIAHGADKEVYVAD  147

Query  432   AEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
              + GLL ++ +G ++++  EA+GVKFKLTD VDVAEDGM+YFTDAS+KY L++F+ + LE
Sbjct  148   IDKGLLKISEEGIIELLADEAEGVKFKLTDFVDVAEDGMIYFTDASYKYSLDEFMLDILE  207

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
             G+P+GR LSY+P TK+TKVLV +L+FANGVAV PDQ++VIFCET+MRRC+KYY+ G KKG
Sbjct  208   GRPYGRFLSYNPMTKETKVLVRNLYFANGVAVSPDQNYVIFCETVMRRCRKYYLEGTKKG  267

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKY-GVRP  968
              +E FI++LPGMPDNIRYDGEG +WI +  +    ++L  RYP +RK+L ++++Y G RP
Sbjct  268   GVENFIDHLPGMPDNIRYDGEGHYWIALATDVKPYWDLALRYPFIRKVLAIVKRYAGGRP  327

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAV  1148
             ++EKN G+FVV+++G P+AHY + +  L+++GIKIG Y+YCG V Y +I+ L+L Q+PA 
Sbjct  328   HLEKNAGVFVVNLDGEPIAHYSDPELILITSGIKIGKYLYCGSVVYPYIIRLDLDQHPAH  387

Query  1149  AS  1154
             A+
Sbjct  388   AT  389



>emb|CBI38400.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   464 bits (1195),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 214/370 (58%), Positives = 282/370 (76%), Gaps = 6/370 (2%)
 Frame = +3

Query  48    TKMSGLWPFAVLV----PVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDS  215
             T+ S  W  A+L+    PV   + +YQLDSFDPA  P H  +Q  P   P+ N RLLH+S
Sbjct  46    TRKSSSWSLALLISILTPVAAAIFLYQLDSFDPASLPTHVFSQ-EPMSVPRINSRLLHES  104

Query  216   EKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGL  395
             E IG+G+L GPEDI YD  + +IYTGC DGW+K+VT+N+S A +S V DW  TGGRPLG+
Sbjct  105   EMIGLGKLLGPEDIAYDTNSHLIYTGCADGWIKKVTLNDS-AVNSVVHDWAFTGGRPLGV  163

Query  396   AHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWK  575
               G  GEV+VADA+ GLL ++ DG V+++T EA+G+ FKLTDAVDVA DGM+YFTDAS+K
Sbjct  164   VLGRAGEVLVADADKGLLEISEDGVVKLLTDEAEGIGFKLTDAVDVAVDGMIYFTDASYK  223

Query  576   YGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRR  755
             Y L+DFIW+ LEG+PHGRLLS+DP T++TKVLV DL+FANGV V PDQ+F+IFCET M+R
Sbjct  224   YSLKDFIWDILEGRPHGRLLSFDPSTQETKVLVRDLYFANGVVVSPDQTFLIFCETFMKR  283

Query  756   CKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKI  935
             C KYYI+GE+KGS++ FI+NLPGMPDNI YDGEG +WIG+   Y   ++L  +YP +RKI
Sbjct  284   CSKYYIQGERKGSVDKFIDNLPGMPDNILYDGEGHYWIGLATGYNDLWDLALKYPSIRKI  343

Query  936   LGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFI  1115
             + +ME++  RP  EKNGG+  +D+EG P+AHYY+   +L+S+GIKI  Y+YCGFV   ++
Sbjct  344   MAIMERFIGRPEFEKNGGVLAIDLEGKPIAHYYDPKLSLMSSGIKIDKYLYCGFVVKPYM  403

Query  1116  LSLNLTQNPA  1145
             + L+L Q+ A
Sbjct  404   IRLDLDQHAA  413



>ref|XP_009344663.1| PREDICTED: protein YLS2-like [Pyrus x bretschneideri]
Length=391

 Score =   460 bits (1183),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 216/367 (59%), Positives = 290/367 (79%), Gaps = 3/367 (1%)
 Frame = +3

Query  57    SGLWPFAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGR  236
             S L  F+VL PV + ++I+QLD+ +PAP P HEL+Q   A APKRN  +L  SE +G G 
Sbjct  26    STLLIFSVLAPVAIALLIHQLDTLNPAPLPLHELSQPV-AAAPKRNAHILKGSEFVGAGA  84

Query  237   LSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGE  416
             L  PED+ YDPK+G+IYTGC DGWVKRVT+N+S AA+S VE+WV TGGRPLGLAHG   E
Sbjct  85    LVAPEDVAYDPKSGLIYTGCADGWVKRVTLNDS-AAESVVENWVFTGGRPLGLAHGDDKE  143

Query  417   VIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFI  596
             V VAD E GLL ++ +G ++++T EA+GVKFKLTD VDVAEDGM+YFTDAS+KY L++FI
Sbjct  144   VYVADTEKGLLKISEEGIIELLTDEAEGVKFKLTDCVDVAEDGMIYFTDASYKYSLDEFI  203

Query  597   WEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIR  776
              + LEG+P+GR LSY+P TK+TKVLV +L+FANGVAV PDQ++VIFCET+MRRC+KYY++
Sbjct  204   LDILEGRPYGRFLSYNPLTKETKVLVRNLYFANGVAVSPDQNYVIFCETVMRRCRKYYLQ  263

Query  777   GEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKY  956
             G KKGS+E FI+ LPG PDNIRYDGEG +WI +  +    ++L  RYP +RK+L ++++Y
Sbjct  264   GSKKGSVENFIDQLPGTPDNIRYDGEGHYWIALATDVKPYWDLALRYPFIRKVLAIVKRY  323

Query  957   -GVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLT  1133
              G  P++EKN G+FVV+++G P+AHY + +  L+++GIKIG Y+YCG V Y +I+ L+L 
Sbjct  324   AGGWPHLEKNAGVFVVNLDGEPIAHYSDPELFLITSGIKIGKYLYCGSVFYPYIIRLDLD  383

Query  1134  QNPAVAS  1154
             ++PA A+
Sbjct  384   RHPAHAT  390



>ref|XP_010113253.1| Adipocyte plasma membrane-associated protein [Morus notabilis]
 gb|EXC35260.1| Adipocyte plasma membrane-associated protein [Morus notabilis]
Length=376

 Score =   458 bits (1178),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 220/379 (58%), Positives = 287/379 (76%), Gaps = 17/379 (4%)
 Frame = +3

Query  33    DKILRTKMSGLWPFAVLV------PVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRN  194
             DK   TK S  WPF+  +       V+L +++YQL+ F+P P P HEL  G+ A AP  N
Sbjct  3     DKKTETKTS--WPFSTFLLFSAIFSVVLALLVYQLEPFEPVPLPVHELI-GAVARAPASN  59

Query  195   GRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNT  374
              RLL  SE +GVG L   ED+ YD ++GVIYTGC+DGWVKRV +N     DS V+ W+NT
Sbjct  60    DRLLRGSELVGVGALVAAEDVAYDAQSGVIYTGCVDGWVKRVRLN-----DSGVDSWINT  114

Query  375   GGRPLGLA--HGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGM  548
             GGRPLGLA  H  H +++VADAE GLL+++ DG ++V++ EA+G+KFKLTD VD+A+DG 
Sbjct  115   GGRPLGLAVDHANH-KLLVADAEKGLLSISEDGVIEVLSDEAEGLKFKLTDGVDIAKDGT  173

Query  549   LYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFV  728
             +YFTDAS KY L+DFIW+ LEGKPHGRLLSYDP TKQTKVLV  L+FANGVAV PDQS V
Sbjct  174   IYFTDASHKYHLKDFIWDILEGKPHGRLLSYDPSTKQTKVLVRGLYFANGVAVSPDQSSV  233

Query  729   IFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELI  908
             IFCET+MRRC+KY+++GE+KGS++ FIE LPGMPDNIRYDGEGL+WI +  E T ++ L 
Sbjct  234   IFCETVMRRCRKYHLKGERKGSVDPFIERLPGMPDNIRYDGEGLYWIALSTEATWSWNLA  293

Query  909   QRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMY  1088
             Q++P +RK + ++ ++  RP+MEKNGG+F VD+EG PV HYY+   +L+S+G KIGN++Y
Sbjct  294   QKFPFIRKAIAIIVRHIGRPHMEKNGGVFAVDLEGKPVFHYYDPALSLISSGAKIGNHLY  353

Query  1089  CGFVKYGFILSLNLTQNPA  1145
             CG + Y +I+ LNL   PA
Sbjct  354   CGSIAYPYIIRLNLQDYPA  372



>ref|XP_008241975.1| PREDICTED: protein YLS2-like [Prunus mume]
Length=395

 Score =   456 bits (1174),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 218/378 (58%), Positives = 284/378 (75%), Gaps = 9/378 (2%)
 Frame = +3

Query  45    RTKMSGLWPFAVL-------VPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRL  203
             +T+ S  WP A         +P+I   +IYQLDSFDPAP P HELT+     AP  N R+
Sbjct  16    QTQPSNSWPSATTSLFLILILPIITATLIYQLDSFDPAPLPYHELTRRLTRRAPAHNPRM  75

Query  204   LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGR  383
             L  SE++G G L  PED+ Y   +G+IYTGC DGW+KRV +N+S   +  VE WVNTGGR
Sbjct  76    LRGSERVGFGLLRAPEDVAYHSGSGLIYTGCEDGWLKRVKLNDSENPEFVVESWVNTGGR  135

Query  384   PLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTD  563
             PLGLA GLH EV+VADA+ GLLNVTS+G+V+++T EA+GVKF +TD VDVA DG +YFTD
Sbjct  136   PLGLAFGLHNEVVVADADEGLLNVTSEGEVKLLTDEAEGVKFGITDGVDVAVDGTIYFTD  195

Query  564   ASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCE-  740
             AS+KY L+ F+W+FLEG+P+GR +SYD  TKQT VLV DL+FANGV V PDQS VIFCE 
Sbjct  196   ASYKYNLKHFVWDFLEGRPYGRFMSYDSATKQTTVLVRDLYFANGVVVSPDQSHVIFCEP  255

Query  741   -TIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRY  917
                MRRC+KYY++GEKKGS+E FI+ LPG+PDNIRYDGEG +WI + +  T A++L  RY
Sbjct  256   PCTMRRCRKYYVQGEKKGSVEAFIDQLPGLPDNIRYDGEGHYWIALSMAPTLAWDLAVRY  315

Query  918   PLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGF  1097
             P +RK++G+MEKY  RPN+EKNGG+  VD++GN ++HYY+   +LVS+ IKIGN ++CG 
Sbjct  316   PFIRKVMGIMEKYTGRPNVEKNGGVLAVDLDGNLISHYYDPGLSLVSSVIKIGNQIFCGS  375

Query  1098  VKYGFILSLNLTQNPAVA  1151
             + + ++L LN+ Q P +A
Sbjct  376   IFHPYMLRLNIQQYPTMA  393



>ref|XP_002268316.2| PREDICTED: protein YLS2 [Vitis vinifera]
Length=383

 Score =   455 bits (1171),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 209/370 (56%), Positives = 280/370 (76%), Gaps = 6/370 (2%)
 Frame = +3

Query  48    TKMSGLWPFAVLV----PVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDS  215
             T+ S  W  A+LV    PV   + +YQ DSFDPA  P H  +Q  P   P+ N RLLH+S
Sbjct  12    TRKSSSWSLALLVSILTPVAAAIFLYQFDSFDPASLPTHVFSQ-EPMSVPRINSRLLHES  70

Query  216   EKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGL  395
             E IG+G+L GPEDI YD  + +IYTGC DGW+K+VT+N+S A +S V DW  TGGRPLG+
Sbjct  71    EMIGLGKLLGPEDIAYDTNSHLIYTGCADGWIKKVTLNDS-AVNSVVHDWAFTGGRPLGV  129

Query  396   AHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWK  575
               G  GEV+VADA+ GLL ++ DG V+++T EA+G++FKLTDAVDVA DGM+YFTDAS+K
Sbjct  130   VLGRAGEVLVADADKGLLEISEDGVVKLLTNEAEGIRFKLTDAVDVAVDGMIYFTDASYK  189

Query  576   YGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRR  755
             Y  +DFIW+ LE +PHGRLLS+DP T++TKVLV DL+FANGV V PDQ+F+IFCE+ M+R
Sbjct  190   YSFKDFIWDMLELRPHGRLLSFDPSTQETKVLVRDLYFANGVVVSPDQTFLIFCESFMKR  249

Query  756   CKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKI  935
             C KYY++GE+KGS++ FI+NLPGMPDNI YDGEG +WIG+   Y   ++L  +YP +RK+
Sbjct  250   CSKYYLQGERKGSMDKFIDNLPGMPDNILYDGEGHYWIGLATGYNDLWDLAFKYPSIRKV  309

Query  936   LGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFI  1115
             + +MEK+   P +EKNGG+  +D+EG P+AHYY+   +LVS+GIKI  Y+YCGF+   ++
Sbjct  310   MAIMEKFIGMPEIEKNGGVLAIDLEGKPIAHYYDPKLSLVSSGIKIDKYLYCGFIVKPYM  369

Query  1116  LSLNLTQNPA  1145
             + L+L Q+ A
Sbjct  370   IRLDLDQHAA  379



>ref|XP_009337098.1| PREDICTED: protein YLS2-like [Pyrus x bretschneideri]
Length=390

 Score =   453 bits (1166),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 213/369 (58%), Positives = 282/369 (76%), Gaps = 8/369 (2%)
 Frame = +3

Query  66    WP-----FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGV  230
             WP     F+VL PV + ++IYQLD+  PAP P HEL Q   A APKRN  +L  SE +G 
Sbjct  23    WPSTFLIFSVLAPVTIALLIYQLDTLHPAPLPLHELNQRV-ASAPKRNSHMLKGSEFVGA  81

Query  231   GRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLH  410
             G L  PED+ +DPK+G+IYTGC DGWVKRVTV ES AADS VE+WV TGGRPLGLAHG  
Sbjct  82    GALVAPEDVAHDPKSGLIYTGCADGWVKRVTVKES-AADSVVENWVFTGGRPLGLAHGAD  140

Query  411   GEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLED  590
              EV VAD E GLL +  DG V+++T EA+G+KFK+ + VDVA+DGMLYFTDAS+K+ L +
Sbjct  141   NEVYVADTEKGLLKIREDGTVELLTDEAEGIKFKIPNCVDVAQDGMLYFTDASYKHSLHE  200

Query  591   FIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYY  770
                + L G+P+GRLLSY+P TK+TKVLV +L+F NGVAV PDQ+FV+FCET+MRRC+KYY
Sbjct  201   VQSDLLGGRPYGRLLSYNPTTKETKVLVRNLYFVNGVAVSPDQNFVVFCETVMRRCRKYY  260

Query  771   IRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVME  950
             ++G KKGS+E FI+ LPG+PDNIRYDGEG +WI +  + T  ++L+ RYP +RK+L +++
Sbjct  261   LQGSKKGSVENFIDRLPGLPDNIRYDGEGHYWIALITDVTPYWDLVLRYPFIRKVLAIVK  320

Query  951   KY-GVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLN  1127
             +Y G RP + KN G+F V+++G P AHYY+ +  L+S+GIKIG Y+YCG + Y +I+ L+
Sbjct  321   RYAGDRPRLHKNAGVFAVNLDGEPTAHYYDPELFLISSGIKIGKYLYCGSIVYPYIIRLD  380

Query  1128  LTQNPAVAS  1154
             L ++PA A+
Sbjct  381   LDRHPAHAT  389



>ref|XP_008337934.1| PREDICTED: protein YLS2-like [Malus domestica]
Length=391

 Score =   452 bits (1164),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 214/375 (57%), Positives = 284/375 (76%), Gaps = 8/375 (2%)
 Frame = +3

Query  48    TKMSGLWP-----FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHD  212
             T+ +  WP      +VL P+ + ++IYQLD+  PAP P HELTQ   A APKRN  +L  
Sbjct  18    TRKTPSWPSTFLILSVLAPITIXLLIYQLDTLHPAPLPLHELTQRV-AAAPKRNAHMLKG  76

Query  213   SEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLG  392
             SE +G G L  PED+ +DPK+G+IYTGC DGWVKRVTV ES AADS VE+WV TGGRPLG
Sbjct  77    SEFVGAGDLVAPEDVAHDPKSGLIYTGCADGWVKRVTVKES-AADSVVENWVFTGGRPLG  135

Query  393   LAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASW  572
             LAHG   EV VAD E GLL +  DG V+++T EA+G+KFK+ ++VDVA+DGMLYFTDAS+
Sbjct  136   LAHGADNEVYVADTEKGLLKIREDGTVELLTDEAEGIKFKIPNSVDVAQDGMLYFTDASY  195

Query  573   KYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMR  752
             KY L +   + L G+P+GRLLSY+  TK+TKVLV +L+F NGVAV PDQ+FV+FCET+MR
Sbjct  196   KYSLHEVQSDLLGGRPYGRLLSYNTTTKETKVLVRNLYFVNGVAVSPDQNFVVFCETVMR  255

Query  753   RCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRK  932
             RC+KYY++G KKGS+E FI++LPG+PDNIRYDGEG +WI +    T  ++L+ RYP +RK
Sbjct  256   RCRKYYLQGSKKGSVENFIDHLPGLPDNIRYDGEGHYWIALITNVTPYWDLVHRYPFIRK  315

Query  933   ILGVMEKY-GVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYG  1109
             +L ++++Y G RP + KN G+F V+++G P A YY+ D  L+S+GIKIG Y+YCG V Y 
Sbjct  316   VLAIVKRYAGGRPRLHKNAGVFAVNLDGEPTADYYDPDLFLISSGIKIGKYLYCGSVVYP  375

Query  1110  FILSLNLTQNPAVAS  1154
             +I+ L+L ++PA A+
Sbjct  376   YIIRLDLDRHPAHAT  390



>ref|XP_002273458.3| PREDICTED: protein YLS2 [Vitis vinifera]
Length=379

 Score =   448 bits (1153),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 210/372 (56%), Positives = 282/372 (76%), Gaps = 10/372 (3%)
 Frame = +3

Query  51    KMSGLWPFA----VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSE  218
             + S  WP      +L PV   +++YQLD +DPAP P HE +Q  P V PK N R+L  SE
Sbjct  13    RRSSSWPLGLLTLILAPVAAAMLLYQLDPYDPAPVPIHEFSQ-QPMVVPKLNPRMLQGSE  71

Query  219   KIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLA  398
              IGVG+L  PEDI Y P + +IYTGC DGWVKR+T+N     DS V++W  TGGRPLG+A
Sbjct  72    MIGVGKLLSPEDIAYHPDSHLIYTGCDDGWVKRITLN-----DSMVQNWAFTGGRPLGVA  126

Query  399   HGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKY  578
              G HG+++VADAE GLL VT+DG V+ +T EA+G+KFKLTD VDVA DGM+YFTDAS+KY
Sbjct  127   LGRHGQLVVADAEKGLLEVTADGMVKTLTDEAEGLKFKLTDGVDVAVDGMIYFTDASYKY  186

Query  579   GLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRC  758
             GL++ I + LEG+PHGRL+S+DP TK+TKVLV DLFFANGV V PDQ+ VI CE++MRRC
Sbjct  187   GLKEHIRDILEGRPHGRLMSFDPSTKETKVLVRDLFFANGVVVSPDQNSVIVCESVMRRC  246

Query  759   KKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKIL  938
              KY+I+GE+KGS++ FI+NLPG PDNI YDGEG +WI + +  + A++L  +YP +RK++
Sbjct  247   LKYHIQGERKGSVDKFIDNLPGPPDNILYDGEGHYWIALPMGNSLAWDLALKYPWIRKVV  306

Query  939   GVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFIL  1118
              +ME+Y VRP++EKNGG+  VD+EG P A+YY+   + V++G+KIGNY+YCG +   +++
Sbjct  307   AIMERYKVRPHIEKNGGVLAVDLEGKPTAYYYDPSLSEVTSGVKIGNYLYCGSITKPYMI  366

Query  1119  SLNLTQNPAVAS  1154
              L+L Q+ A A+
Sbjct  367   RLDLHQHAARAT  378



>emb|CBI38406.3| unnamed protein product [Vitis vinifera]
Length=457

 Score =   449 bits (1155),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 210/372 (56%), Positives = 282/372 (76%), Gaps = 10/372 (3%)
 Frame = +3

Query  51    KMSGLWPFA----VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSE  218
             + S  WP      +L PV   +++YQLD +DPAP P HE +Q  P V PK N R+L  SE
Sbjct  91    RRSSSWPLGLLTLILAPVAAAMLLYQLDPYDPAPVPIHEFSQ-QPMVVPKLNPRMLQGSE  149

Query  219   KIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLA  398
              IGVG+L  PEDI Y P + +IYTGC DGWVKR+T+N     DS V++W  TGGRPLG+A
Sbjct  150   MIGVGKLLSPEDIAYHPDSHLIYTGCDDGWVKRITLN-----DSMVQNWAFTGGRPLGVA  204

Query  399   HGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKY  578
              G HG+++VADAE GLL VT+DG V+ +T EA+G+KFKLTD VDVA DGM+YFTDAS+KY
Sbjct  205   LGRHGQLVVADAEKGLLEVTADGMVKTLTDEAEGLKFKLTDGVDVAVDGMIYFTDASYKY  264

Query  579   GLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRC  758
             GL++ I + LEG+PHGRL+S+DP TK+TKVLV DLFFANGV V PDQ+ VI CE++MRRC
Sbjct  265   GLKEHIRDILEGRPHGRLMSFDPSTKETKVLVRDLFFANGVVVSPDQNSVIVCESVMRRC  324

Query  759   KKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKIL  938
              KY+I+GE+KGS++ FI+NLPG PDNI YDGEG +WI + +  + A++L  +YP +RK++
Sbjct  325   LKYHIQGERKGSVDKFIDNLPGPPDNILYDGEGHYWIALPMGNSLAWDLALKYPWIRKVV  384

Query  939   GVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFIL  1118
              +ME+Y VRP++EKNGG+  VD+EG P A+YY+   + V++G+KIGNY+YCG +   +++
Sbjct  385   AIMERYKVRPHIEKNGGVLAVDLEGKPTAYYYDPSLSEVTSGVKIGNYLYCGSITKPYMI  444

Query  1119  SLNLTQNPAVAS  1154
              L+L Q+ A A+
Sbjct  445   RLDLHQHAARAT  456



>ref|XP_002274023.1| PREDICTED: protein YLS2 [Vitis vinifera]
Length=379

 Score =   446 bits (1147),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 209/373 (56%), Positives = 281/373 (75%), Gaps = 10/373 (3%)
 Frame = +3

Query  48    TKMSGLWPFA----VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDS  215
              + S  WP      +L PV   +++YQLD +DPAP P HE +Q  P V PK N R+L  S
Sbjct  12    ARRSSSWPLGLLTLILAPVAAAMLLYQLDPYDPAPVPIHEFSQ-QPMVVPKLNPRMLQGS  70

Query  216   EKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGL  395
             E IGVG+L  PEDI Y P + +IYTGC DGWVKR+T+N     DS V++W  TGGRPLG+
Sbjct  71    EMIGVGKLLSPEDIAYHPDSHLIYTGCDDGWVKRITLN-----DSMVQNWAFTGGRPLGV  125

Query  396   AHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWK  575
             A G HG+++VADAE GLL VT+DG V+ +T EA+G+KFKLTD VDVA DGM+YFTDAS+K
Sbjct  126   ALGRHGQLVVADAEKGLLEVTADGMVKTLTDEAEGLKFKLTDGVDVAVDGMIYFTDASYK  185

Query  576   YGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRR  755
             YGL++ I + LEG+PHGRL+S+DP TK+TKVLV DLFFANGV V PDQ+ VI CE++MRR
Sbjct  186   YGLKEHIQDILEGRPHGRLMSFDPSTKETKVLVRDLFFANGVVVSPDQNSVIVCESVMRR  245

Query  756   CKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKI  935
             C KY+I+GE+KGS++ FI+NLPG PDNI YDGE  +WI + +  + A++L  +YP +RK+
Sbjct  246   CLKYHIQGERKGSVDKFIDNLPGPPDNILYDGEEHYWIALPMGNSLAWDLALKYPWIRKV  305

Query  936   LGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFI  1115
             + +ME+Y VRP++EKNGG+  VD+EG P A+YY+   + V++G+KIGNY+YCG +   ++
Sbjct  306   VAIMERYKVRPHIEKNGGVLAVDLEGKPTAYYYDPSLSEVTSGVKIGNYLYCGSITKPYM  365

Query  1116  LSLNLTQNPAVAS  1154
             + L+L Q+ A A+
Sbjct  366   IRLDLHQHAARAT  378



>emb|CAN69510.1| hypothetical protein VITISV_018383 [Vitis vinifera]
Length=383

 Score =   443 bits (1140),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 208/358 (58%), Positives = 272/358 (76%), Gaps = 2/358 (1%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
             +L PV   + +YQLDSFDPA  P HE +Q  P   PK N R+L  SE IG G L GPEDI
Sbjct  26    ILTPVAAAIFLYQLDSFDPASLPTHEFSQ-EPMPVPKLNPRMLQGSEMIGQGNLLGPEDI  84

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              YD  + +IYTGC DGWVKRVT+NES AA+S V +W  TGGRPLG+A G  GEV+VADAE
Sbjct  85    AYDANSHLIYTGCADGWVKRVTLNES-AANSVVHNWAFTGGRPLGVALGRAGEVLVADAE  143

Query  438   IGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGK  617
              GLL ++ DG ++++T EA+G+KFK T+AVDVA DGM+YFTDAS+KYGL +FIWE LEG+
Sbjct  144   KGLLEISGDGVMKLLTDEAEGLKFKQTNAVDVAVDGMIYFTDASYKYGLIEFIWEILEGR  203

Query  618   PHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSI  797
             PHGRLLS+DP T++T VL+ DL+ ANGV V PDQ+ V+FCET+M+RC KYYI+GE+KGS+
Sbjct  204   PHGRLLSFDPSTQETIVLLRDLYLANGVVVSPDQTSVVFCETLMKRCIKYYIQGERKGSM  263

Query  798   EVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNME  977
             E FI+NL GMPDNI YDGEG +WI +       ++L  +YP +RK++ ++E+Y  RP++E
Sbjct  264   EKFIDNLSGMPDNILYDGEGHYWIALATGTKGLWDLALKYPSIRKVMAILERYIGRPHIE  323

Query  978   KNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVA  1151
             KNGGI  VD+EG P+AHYY+ + ++VS+GIK+G Y+YCG     +I+ L+L Q+ A  
Sbjct  324   KNGGILAVDLEGKPIAHYYDHELSMVSSGIKVGKYLYCGSFVKPYIIRLDLDQHAACT  381



>ref|XP_010649306.1| PREDICTED: protein YLS2-like [Vitis vinifera]
Length=379

 Score =   443 bits (1139),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 209/372 (56%), Positives = 282/372 (76%), Gaps = 10/372 (3%)
 Frame = +3

Query  51    KMSGLWPFA----VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSE  218
             + S  WP      +L PV   +++YQLD +DPAP P HE +Q  P V PK N R+L  SE
Sbjct  13    RRSSSWPLGLLTLILAPVAAAMLLYQLDPYDPAPVPIHEFSQ-QPMVVPKLNPRMLQGSE  71

Query  219   KIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLA  398
              IGVG+L  PEDI Y P + +IYTGC DGWVKR+T+N     DS V++W  TGGRPLG+A
Sbjct  72    MIGVGKLLSPEDIAYHPDSHLIYTGCDDGWVKRITLN-----DSMVQNWAFTGGRPLGVA  126

Query  399   HGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKY  578
              G HG+++VADAE GLL VT+DG V+ +T EA+G+KFKLT+ VDVA DGM+YFTDAS+KY
Sbjct  127   LGRHGQLVVADAEKGLLEVTADGMVKTLTDEAEGLKFKLTNGVDVAVDGMIYFTDASYKY  186

Query  579   GLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRC  758
             GL++ I + LEG+PHGRL+S+DP T++TKVLV DLFFANGV V PDQ+ VI CE++MRRC
Sbjct  187   GLKEHIRDILEGRPHGRLMSFDPSTEETKVLVRDLFFANGVVVSPDQNSVIVCESVMRRC  246

Query  759   KKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKIL  938
              KY+I+GE+KGS++ FI+NLPG PDNI YDGEG +WI + +  + A++L  +YP +RK++
Sbjct  247   LKYHIQGERKGSMDKFIDNLPGPPDNILYDGEGHYWIALPMGNSLAWDLALKYPWIRKVV  306

Query  939   GVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFIL  1118
              +ME+Y VRP++EKNGG+  VD+EG P A+Y++   + VS+G+KIGNY+YCG V   +++
Sbjct  307   AIMERYKVRPHIEKNGGVLAVDLEGKPTAYYHDPGLSEVSSGVKIGNYLYCGSVAKPYMI  366

Query  1119  SLNLTQNPAVAS  1154
              L+L Q+ A A+
Sbjct  367   RLDLHQHVARAT  378



>ref|XP_002264366.2| PREDICTED: protein YLS2-like [Vitis vinifera]
Length=383

 Score =   442 bits (1138),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 208/356 (58%), Positives = 272/356 (76%), Gaps = 2/356 (1%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
             +L PV   + +YQLDSFDPA  P HE +Q  P   PK N R+L  SE IG G L GPEDI
Sbjct  26    ILTPVAAAIFLYQLDSFDPASLPTHEFSQ-EPMPVPKLNPRMLQGSEMIGQGNLLGPEDI  84

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              YD  + +IYTGC DGWVKRVT+NES AA+S V +W  TGGRPLG+A G  GEV+VADAE
Sbjct  85    AYDANSHLIYTGCADGWVKRVTLNES-AANSVVHNWAFTGGRPLGVALGRAGEVLVADAE  143

Query  438   IGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGK  617
              GLL ++ DG ++++T EA+G+KFK T+AVDVA DGM+YFTDAS+KYGL +FIWE LEG+
Sbjct  144   KGLLEISGDGVMKLLTDEAEGLKFKQTNAVDVAVDGMIYFTDASYKYGLIEFIWEILEGR  203

Query  618   PHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSI  797
             PHGRLLS+DP T++T VL+ DL+ ANGV V PDQ+ V+FCET+M+RC KYYI+GE+KGS+
Sbjct  204   PHGRLLSFDPSTQETIVLLRDLYLANGVVVSPDQTSVVFCETLMKRCIKYYIQGERKGSM  263

Query  798   EVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNME  977
             E FI+NL GMPDNI YDGEG +WI +       ++L  +YP +RK++ ++E+Y  RP++E
Sbjct  264   EKFIDNLSGMPDNILYDGEGHYWIALATGTKGLWDLALKYPSIRKVMAILERYIGRPHIE  323

Query  978   KNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
             KNGGI  VD+EG P+AHYY+ + ++VS+GIK+G Y+YCG     +I+ L+L Q+ A
Sbjct  324   KNGGILAVDLEGKPIAHYYDPELSMVSSGIKVGKYLYCGSFVKPYIIRLDLDQHAA  379



>emb|CBI38402.3| unnamed protein product [Vitis vinifera]
Length=539

 Score =   447 bits (1150),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 212/388 (55%), Positives = 285/388 (73%), Gaps = 12/388 (3%)
 Frame = +3

Query  3     PSGVKKKKNQDKILRTKMSGLWPFA----VLVPVILGVVIYQLDSFDPAPYPAHELTQGS  170
             P       +Q  + R   S  WP      +L PV   +++YQLD +DPAP P HE +Q  
Sbjct  159   PPMADSTPSQSSMARRSSS--WPLGLLTLILAPVAAAMLLYQLDPYDPAPVPIHEFSQ-Q  215

Query  171   PAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADS  350
             P V PK N R+L  SE IGVG+L  PEDI Y P + +IYTGC DGWVKR+T+N     DS
Sbjct  216   PMVVPKLNPRMLQGSEMIGVGKLLSPEDIAYHPDSHLIYTGCDDGWVKRITLN-----DS  270

Query  351   AVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVD  530
              V++W  TGGRPLG+A G HG+++VADAE GLL VT+DG V+ +T EA+G+KFKLTD VD
Sbjct  271   MVQNWAFTGGRPLGVALGRHGQLVVADAEKGLLEVTADGMVKTLTDEAEGLKFKLTDGVD  330

Query  531   VAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVF  710
             VA DGM+YFTDAS+KYGL++ I + LEG+PHGRL+S+DP TK+TKVLV DLFFANGV V 
Sbjct  331   VAVDGMIYFTDASYKYGLKEHIQDILEGRPHGRLMSFDPSTKETKVLVRDLFFANGVVVS  390

Query  711   PDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYT  890
             PDQ+ VI CE++MRRC KY+I+GE+KGS++ FI+NLPG PDNI YDGE  +WI + +  +
Sbjct  391   PDQNSVIVCESVMRRCLKYHIQGERKGSVDKFIDNLPGPPDNILYDGEEHYWIALPMGNS  450

Query  891   HAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIK  1070
              A++L  +YP +RK++ +ME+Y VRP++EKNGG+  VD+EG P A+YY+   + V++G+K
Sbjct  451   LAWDLALKYPWIRKVVAIMERYKVRPHIEKNGGVLAVDLEGKPTAYYYDPSLSEVTSGVK  510

Query  1071  IGNYMYCGFVKYGFILSLNLTQNPAVAS  1154
             IGNY+YCG +   +++ L+L Q+ A A+
Sbjct  511   IGNYLYCGSITKPYMIRLDLHQHAARAT  538


 Score =   111 bits (277),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 73/115 (63%), Gaps = 7/115 (6%)
 Frame = +3

Query  3    PSGVKKKKNQDKILRTKMSGLWPFA----VLVPVILGVVIYQLDSFDPAPYPAHELTQGS  170
            P       +Q  + R + SG  P      +L PV   +++YQLD +DPAP P HE +Q  
Sbjct  30   PPMADPTPSQSSMDRRRSSG--PLGLLTLILAPVATVMLLYQLDPYDPAPVPIHEFSQ-Q  86

Query  171  PAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNES  335
            P V PK N R+L  SE IGVG+L GPEDI Y P + +IYTGC+DGWVKRVT+N+S
Sbjct  87   PMVVPKLNSRMLQGSEMIGVGKLLGPEDIAYHPDSHLIYTGCVDGWVKRVTLNDS  141



>emb|CBI38397.3| unnamed protein product [Vitis vinifera]
Length=820

 Score =   455 bits (1171),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 209/370 (56%), Positives = 280/370 (76%), Gaps = 6/370 (2%)
 Frame = +3

Query  48    TKMSGLWPFAVLV----PVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDS  215
             T+ S  W  A+LV    PV   + +YQ DSFDPA  P H  +Q  P   P+ N RLLH+S
Sbjct  449   TRKSSSWSLALLVSILTPVAAAIFLYQFDSFDPASLPTHVFSQ-EPMSVPRINSRLLHES  507

Query  216   EKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGL  395
             E IG+G+L GPEDI YD  + +IYTGC DGW+K+VT+N+S A +S V DW  TGGRPLG+
Sbjct  508   EMIGLGKLLGPEDIAYDTNSHLIYTGCADGWIKKVTLNDS-AVNSVVHDWAFTGGRPLGV  566

Query  396   AHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWK  575
               G  GEV+VADA+ GLL ++ DG V+++T EA+G++FKLTDAVDVA DGM+YFTDAS+K
Sbjct  567   VLGRAGEVLVADADKGLLEISEDGVVKLLTNEAEGIRFKLTDAVDVAVDGMIYFTDASYK  626

Query  576   YGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRR  755
             Y  +DFIW+ LE +PHGRLLS+DP T++TKVLV DL+FANGV V PDQ+F+IFCE+ M+R
Sbjct  627   YSFKDFIWDMLELRPHGRLLSFDPSTQETKVLVRDLYFANGVVVSPDQTFLIFCESFMKR  686

Query  756   CKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKI  935
             C KYY++GE+KGS++ FI+NLPGMPDNI YDGEG +WIG+   Y   ++L  +YP +RK+
Sbjct  687   CSKYYLQGERKGSMDKFIDNLPGMPDNILYDGEGHYWIGLATGYNDLWDLAFKYPSIRKV  746

Query  936   LGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFI  1115
             + +MEK+   P +EKNGG+  +D+EG P+AHYY+   +LVS+GIKI  Y+YCGF+   ++
Sbjct  747   MAIMEKFIGMPEIEKNGGVLAIDLEGKPIAHYYDPKLSLVSSGIKIDKYLYCGFIVKPYM  806

Query  1116  LSLNLTQNPA  1145
             + L+L Q+ A
Sbjct  807   IRLDLDQHAA  816


 Score =   442 bits (1138),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 208/356 (58%), Positives = 272/356 (76%), Gaps = 2/356 (1%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
             +L PV   + +YQLDSFDPA  P HE +Q  P   PK N R+L  SE IG G L GPEDI
Sbjct  26    ILTPVAAAIFLYQLDSFDPASLPTHEFSQ-EPMPVPKLNPRMLQGSEMIGQGNLLGPEDI  84

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              YD  + +IYTGC DGWVKRVT+NES AA+S V +W  TGGRPLG+A G  GEV+VADAE
Sbjct  85    AYDANSHLIYTGCADGWVKRVTLNES-AANSVVHNWAFTGGRPLGVALGRAGEVLVADAE  143

Query  438   IGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGK  617
              GLL ++ DG ++++T EA+G+KFK T+AVDVA DGM+YFTDAS+KYGL +FIWE LEG+
Sbjct  144   KGLLEISGDGVMKLLTDEAEGLKFKQTNAVDVAVDGMIYFTDASYKYGLIEFIWEILEGR  203

Query  618   PHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSI  797
             PHGRLLS+DP T++T VL+ DL+ ANGV V PDQ+ V+FCET+M+RC KYYI+GE+KGS+
Sbjct  204   PHGRLLSFDPSTQETIVLLRDLYLANGVVVSPDQTSVVFCETLMKRCIKYYIQGERKGSM  263

Query  798   EVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNME  977
             E FI+NL GMPDNI YDGEG +WI +       ++L  +YP +RK++ ++E+Y  RP++E
Sbjct  264   EKFIDNLSGMPDNILYDGEGHYWIALATGTKGLWDLALKYPSIRKVMAILERYIGRPHIE  323

Query  978   KNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
             KNGGI  VD+EG P+AHYY+ + ++VS+GIK+G Y+YCG     +I+ L+L Q+ A
Sbjct  324   KNGGILAVDLEGKPIAHYYDPELSMVSSGIKVGKYLYCGSFVKPYIIRLDLDQHAA  379



>emb|CDP01812.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   440 bits (1131),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 202/346 (58%), Positives = 262/346 (76%), Gaps = 17/346 (5%)
 Frame = +3

Query  120   DSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCM  299
             D F+PAPYPAHELTQ  P   PKRN ++L  +EKIGVG L GPEDI YDPK+G +YTGC 
Sbjct  48    DPFNPAPYPAHELTQKKPLAVPKRNAQVLKGAEKIGVGELLGPEDIAYDPKSGKLYTGCA  107

Query  300   DGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQV  479
             DGW+KR              +W+NTGGRPLGL  GLHGE+I+ADA+ GLLN T +G++Q+
Sbjct  108   DGWIKR--------------NWLNTGGRPLGLVLGLHGELIIADADKGLLNATENGEIQL  153

Query  480   MTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQ  659
             +T EADG KFKLTD VD++EDG++YFTDAS KY + +   +  EG+P+GR LSY+P TK 
Sbjct  154   LTDEADGTKFKLTDGVDISEDGIIYFTDASSKYSISEVARDSFEGRPYGRFLSYNPSTKV  213

Query  660   TKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNI  839
             T+VLV DL+FANGVAV PDQ FVIFCET MRRCK+YY++GE+KGS++ F+++LPGMPDNI
Sbjct  214   TQVLVRDLYFANGVAVSPDQDFVIFCETRMRRCKRYYLKGERKGSVDTFVDSLPGMPDNI  273

Query  840   RYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPN---MEKNGGIFVVDME  1010
             RYDGEG +WI + +E T+A EL+QR+  +RKI+ +  KY  RP+   ++KNGG F VD+E
Sbjct  274   RYDGEGQYWIALTMEVTYALELVQRHAFIRKIMAIAGKYLDRPSPRLLQKNGGAFAVDLE  333

Query  1011  GNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAV  1148
             G P A YY+ D  LV+  +KI NY+Y GF+   +++ LN+ QNPAV
Sbjct  334   GKPTARYYDHDLALVTGVVKIENYIYFGFIIKPYLIRLNMEQNPAV  379



>ref|XP_011022274.1| PREDICTED: protein YLS2-like [Populus euphratica]
Length=386

 Score =   439 bits (1130),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 208/374 (56%), Positives = 278/374 (74%), Gaps = 7/374 (2%)
 Frame = +3

Query  48    TKMSGLWPF-----AVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHD  212
             T  +  WPF      VL PV++  +++QLDSF+PA  P HELTQ  P  A K+N  +L  
Sbjct  14    TSRNTSWPFFTVLVTVLSPVLVATLVFQLDSFEPAHLPIHELTQ-PPLKALKKNDHMLQG  72

Query  213   SEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLG  392
             SE +G  +L GPEDI YD  +GVIYT C DGWVKRVT+N+S  AD+ VE WVNTGGRPLG
Sbjct  73    SELVGFKQLIGPEDIAYDSNSGVIYTSCADGWVKRVTINDS-VADAIVESWVNTGGRPLG  131

Query  393   LAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASW  572
             LA G   EVIVADA  GLL ++ +GKV+++  EA+GVK KLTDAVD+AEDG +YFTDAS+
Sbjct  132   LALGHDNEVIVADAYKGLLKISGEGKVELLADEAEGVKLKLTDAVDIAEDGTIYFTDASY  191

Query  573   KYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMR  752
             KY L +F W+ LEGKP+GR +SYDP TK+TKVL +DL+FANGVAV PDQ +V+FCET MR
Sbjct  192   KYNLLEFFWDLLEGKPYGRAISYDPVTKETKVLAHDLYFANGVAVSPDQQYVVFCETFMR  251

Query  753   RCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRK  932
             RC+KY+I+G+KKGS+E FI+NLPG+PDNI +DG G ++I +    T A +L  ++P LRK
Sbjct  252   RCRKYHIQGKKKGSLETFIDNLPGLPDNIHHDGHGHYYIALSSGITVALDLALKHPFLRK  311

Query  933   ILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGF  1112
             + G+  KY    +  KN G+F+VD+EG P  HYY+    L+S+GI+IGN+++CG + Y +
Sbjct  312   LTGIYTKYMGEIHASKNSGVFIVDLEGKPTEHYYDPGLALISSGIRIGNHIHCGSLLYPY  371

Query  1113  ILSLNLTQNPAVAS  1154
             I+ L+++++PA A+
Sbjct  372   IVRLDVSKHPARAT  385



>ref|XP_007046542.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
 gb|EOX90699.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
Length=353

 Score =   436 bits (1121),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 203/358 (57%), Positives = 274/358 (77%), Gaps = 6/358 (2%)
 Frame = +3

Query  81    LVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIV  260
             +VPV+  V+ YQLDSFDPAP P HEL Q +P  A  RN  +L  +E +G G+L GPEDI 
Sbjct  1     MVPVLAAVLAYQLDSFDPAPIPIHELAQ-APIAASLRNDGMLQGAEFVGAGKLQGPEDIA  59

Query  261   YDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEI  440
             YD K+ +IYTGC+DGW+KRV +N     DS VE  VNT GRPLG+A G + E+IVADA  
Sbjct  60    YDSKSRLIYTGCLDGWIKRVRLN-----DSTVETLVNTYGRPLGVALGHNDEIIVADAFK  114

Query  441   GLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKP  620
             GLLN++ DG+V+++T EADG+KFK+TD VD+A++GM+YFTDAS+KY   D + + LEGKP
Sbjct  115   GLLNISRDGEVELLTDEADGLKFKITDGVDIADNGMIYFTDASYKYDSNDHLLDMLEGKP  174

Query  621   HGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIE  800
             HGR +S+DP T++T+VLV++L+FANGVAV P Q  VIFCET MRRC+KYYI+G ++G +E
Sbjct  175   HGRFMSFDPVTRKTRVLVSNLYFANGVAVSPRQDSVIFCETTMRRCRKYYIQGNQQGQLE  234

Query  801   VFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEK  980
              F++ LPG PDNIRYDG+G +WIG+ +E +   +L  RYP +RK++ +MEKY    +M K
Sbjct  235   KFVDQLPGFPDNIRYDGDGHYWIGLPLETSATLDLAFRYPFIRKVMAIMEKYIGPLSMGK  294

Query  981   NGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVAS  1154
             N G+FVVD+EG PVAHY++   ++V++G+KI N +YCG V Y +I+SLNL Q+PA A+
Sbjct  295   NAGVFVVDLEGKPVAHYHDHKLSMVTSGMKIENRLYCGSVIYPYIVSLNLDQHPARAT  352



>gb|KDP43740.1| hypothetical protein JCGZ_22367 [Jatropha curcas]
Length=376

 Score =   436 bits (1122),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 210/373 (56%), Positives = 284/373 (76%), Gaps = 11/373 (3%)
 Frame = +3

Query  57    SGLWPF-----AVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEK  221
             S  WPF     ++L PV+L + I+QLDSFDPAP P HELT   P  A  +NGRLL  SE 
Sbjct  7     SHSWPFYFIIFSILAPVLLAIFIFQLDSFDPAPMPIHELTDPPPE-ASMKNGRLLQGSEF  65

Query  222   IGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAH  401
             +GVG+L  PEDI YD ++GVIYT C DGW+KRVTVN+S  +DS VE+WVNTGGRPLGL  
Sbjct  66    LGVGQLKAPEDIAYDSESGVIYTTCADGWIKRVTVNDS-VSDSVVENWVNTGGRPLGLVL  124

Query  402   GLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYG  581
             G   +VIVADA  GLL ++ DG+++++T EA+G+KFKLTD VD+AEDG++YFTDAS+KY 
Sbjct  125   GKDKDVIVADAYKGLLKISRDGEIELLTDEAEGLKFKLTDGVDIAEDGIIYFTDASYKYN  184

Query  582   LEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCK  761
             L D +W+ LEGKP+GR+LSY+P T+ T VLV+DL+FANG+A+ PDQ  +IFCE+  RRC+
Sbjct  185   LHDHLWDILEGKPYGRVLSYNPATRITNVLVSDLYFANGLAISPDQDSLIFCESSRRRCR  244

Query  762   KYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILG  941
             KYYI+G KKGS+E F + LPGMPDNI YDG G FWI   +E T  ++ + +YP +RK+ G
Sbjct  245   KYYIKGNKKGSLEKFTD-LPGMPDNIHYDGHGHFWIASAMEITTFWKAVFKYPFIRKLAG  303

Query  942   VMEKYGVRP--NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFI  1115
             ++ K+ +R   +  KNGG+F+VD+EG  +++YY+ +  L+STG+KIGN++YCG + Y +I
Sbjct  304   IVSKH-IRNIGDTGKNGGVFMVDLEGKLISYYYDPELKLISTGVKIGNHLYCGSIIYPYI  362

Query  1116  LSLNLTQNPAVAS  1154
             + LNL + PA+A+
Sbjct  363   IRLNLAKYPALAN  375



>gb|KDP43745.1| hypothetical protein JCGZ_22372 [Jatropha curcas]
Length=376

 Score =   435 bits (1119),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 209/372 (56%), Positives = 280/372 (75%), Gaps = 9/372 (2%)
 Frame = +3

Query  57    SGLWPF-----AVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEK  221
             S  WPF     ++L PV+L + I+QLDSFDPAP P HELT   P  A  + GRLL  SE 
Sbjct  7     SHSWPFYFIIFSILAPVLLAIFIFQLDSFDPAPMPIHELTDPPPE-ASMKIGRLLQGSEF  65

Query  222   IGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAH  401
             +GVG+L  PEDI YD ++GVIYT C DGW+KRV VN+S  +DS VE+WVNTGGRPLGL  
Sbjct  66    LGVGQLKAPEDIAYDSESGVIYTTCADGWIKRVAVNDS-VSDSVVENWVNTGGRPLGLVL  124

Query  402   GLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYG  581
             G   +VIVADA  GLL ++ DG+++++T EA+G+KFKLTD VD+AEDG++YFTDAS+KY 
Sbjct  125   GKDNDVIVADAYKGLLKISRDGEIELLTDEAEGLKFKLTDGVDIAEDGIIYFTDASYKYN  184

Query  582   LEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCK  761
               D +W+ LEGKPHGR+LSY+P T+ TKVLV+DL+FANG+A+ PDQ  +IFCET MRRC+
Sbjct  185   FHDHLWDVLEGKPHGRVLSYNPATRITKVLVSDLYFANGLAISPDQDSLIFCETSMRRCR  244

Query  762   KYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILG  941
             KYYI+G KKGS+E F + LPGMPDNI YDG G FWI + +E    ++ + +YP +RK+ G
Sbjct  245   KYYIKGNKKGSLEKFTD-LPGMPDNIHYDGHGHFWIALPMEIATFWKAVFKYPFVRKLAG  303

Query  942   VMEKY-GVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFIL  1118
             ++ K+ G   +  KNGG+FVVD+EG  ++HYY+ +  L+S+ +KIGN++YCG + Y +I+
Sbjct  304   IVLKHKGNIGDTGKNGGVFVVDLEGKLISHYYDPELKLISSSVKIGNHLYCGSITYPYII  363

Query  1119  SLNLTQNPAVAS  1154
              LNL + P +A+
Sbjct  364   RLNLAKYPGLAN  375



>ref|XP_010033573.1| PREDICTED: protein YLS2-like [Eucalyptus grandis]
 gb|KCW53265.1| hypothetical protein EUGRSUZ_J02526 [Eucalyptus grandis]
Length=382

 Score =   435 bits (1119),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 206/353 (58%), Positives = 262/353 (74%), Gaps = 3/353 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
              +VL P++   V+Y+ + FDPAP P HEL       AP +NGR+L  +E +G GR+ GPE
Sbjct  32    LSVLAPIVAVTVLYRHEPFDPAPLPIHELP--GTVAAPMQNGRVLRGAEMVGAGRVVGPE  89

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+ +DP +GVIY GC DGWVKRV V ES A D+AVEDWVNTGGRPLGLA G  GE+IV D
Sbjct  90    DVEHDPASGVIYVGCADGWVKRVKVGES-AGDTAVEDWVNTGGRPLGLALGRDGELIVCD  148

Query  432   AEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
                GLLNV+  G V+++T EA+GVKFKLTD V VA DG +YFTDAS+KY   +FIW+ LE
Sbjct  149   PYKGLLNVSKHGMVELLTDEAEGVKFKLTDGVAVASDGTIYFTDASYKYTFGEFIWDILE  208

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
             G+PHGRLLSYDP TK+T+VL  DL+F NG+A+ P+QSFVIFCETIMRRCK+YYI GE+KG
Sbjct  209   GRPHGRLLSYDPATKETQVLARDLYFPNGIALSPNQSFVIFCETIMRRCKRYYINGERKG  268

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPN  971
              I+ FI  LPG PDNIRYDGEG +WI +    + +++L  ++P +RK   ++E+   RP 
Sbjct  269   HIDTFIGGLPGYPDNIRYDGEGHYWIALSSGISVSWDLAIKHPFIRKAAAILERLNRRPA  328

Query  972   MEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             MEK+ G+F VD EG PVAHYY+   +L+S+G KIG+Y+YCG + Y  IL L L
Sbjct  329   MEKDSGVFQVDSEGKPVAHYYDPQLSLISSGSKIGDYLYCGSLHYPHILRLKL  381



>ref|XP_010048018.1| PREDICTED: protein YLS2-like [Eucalyptus grandis]
Length=382

 Score =   433 bits (1114),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 203/353 (58%), Positives = 264/353 (75%), Gaps = 3/353 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
              +VL P++   V+Y+ + FDPAP P HEL       AP +NGR+L  +E +G GR+ GPE
Sbjct  32    LSVLAPIVAVTVLYRHEPFDPAPLPIHELP--GTVAAPMQNGRVLRGAEMVGAGRVVGPE  89

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+ +DP +GVIY GC DGWVKRV V ES A D+AVEDWVNTGGRPLGLA G  GE+IV D
Sbjct  90    DVEHDPASGVIYVGCADGWVKRVKVGES-AGDAAVEDWVNTGGRPLGLALGRDGELIVCD  148

Query  432   AEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
                GLLNV+  G ++++T EA+GVKFKLTD V VA DGM+YFTDAS+KY   +FIW+ LE
Sbjct  149   PYKGLLNVSKHGTIELLTDEAEGVKFKLTDGVVVASDGMIYFTDASYKYTYGEFIWDILE  208

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
             G+PHGRLLSY+P TK+T+VL  DL+F+NG+ + P+QSFVIFCET+MRRCK+YYI GE+KG
Sbjct  209   GRPHGRLLSYNPTTKETQVLARDLYFSNGITLSPNQSFVIFCETVMRRCKRYYINGERKG  268

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPN  971
              I+ FI  LPG PDNIRYDGEG +WI + +  + +++L  ++P +RK   ++E+   RP 
Sbjct  269   HIDTFIGGLPGYPDNIRYDGEGHYWIALSMGISVSWDLAIKHPFIRKAAAILERLNRRPA  328

Query  972   MEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             MEK+ G+F VD EG PVAHYY+   +L+S+G KIG+Y+YCG + Y  IL L L
Sbjct  329   MEKDSGVFQVDSEGKPVAHYYDPQLSLISSGNKIGDYLYCGSLHYPHILRLKL  381



>gb|KCW87750.1| hypothetical protein EUGRSUZ_A00119 [Eucalyptus grandis]
Length=416

 Score =   434 bits (1117),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 203/353 (58%), Positives = 264/353 (75%), Gaps = 3/353 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
              +VL P++   V+Y+ + FDPAP P HEL       AP +NGR+L  +E +G GR+ GPE
Sbjct  66    LSVLAPIVAVTVLYRHEPFDPAPLPIHELP--GTVAAPMQNGRVLRGAEMVGAGRVVGPE  123

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+ +DP +GVIY GC DGWVKRV V ES A D+AVEDWVNTGGRPLGLA G  GE+IV D
Sbjct  124   DVEHDPASGVIYVGCADGWVKRVKVGES-AGDAAVEDWVNTGGRPLGLALGRDGELIVCD  182

Query  432   AEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
                GLLNV+  G ++++T EA+GVKFKLTD V VA DGM+YFTDAS+KY   +FIW+ LE
Sbjct  183   PYKGLLNVSKHGTIELLTDEAEGVKFKLTDGVVVASDGMIYFTDASYKYTYGEFIWDILE  242

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
             G+PHGRLLSY+P TK+T+VL  DL+F+NG+ + P+QSFVIFCET+MRRCK+YYI GE+KG
Sbjct  243   GRPHGRLLSYNPTTKETQVLARDLYFSNGITLSPNQSFVIFCETVMRRCKRYYINGERKG  302

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPN  971
              I+ FI  LPG PDNIRYDGEG +WI + +  + +++L  ++P +RK   ++E+   RP 
Sbjct  303   HIDTFIGGLPGYPDNIRYDGEGHYWIALSMGISVSWDLAIKHPFIRKAAAILERLNRRPA  362

Query  972   MEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             MEK+ G+F VD EG PVAHYY+   +L+S+G KIG+Y+YCG + Y  IL L L
Sbjct  363   MEKDSGVFQVDSEGKPVAHYYDPQLSLISSGNKIGDYLYCGSLHYPHILRLKL  415



>ref|XP_002306422.2| hypothetical protein POPTR_0005s10240g [Populus trichocarpa]
 gb|EEE93418.2| hypothetical protein POPTR_0005s10240g [Populus trichocarpa]
Length=381

 Score =   432 bits (1112),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 208/368 (57%), Positives = 272/368 (74%), Gaps = 15/368 (4%)
 Frame = +3

Query  66    WP-----FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGV  230
             WP       +L PV++  +++QLDSF+PAP P HELTQ  P  A K+N  +L  SE +G 
Sbjct  23    WPIFTVLLTILSPVLVATLVFQLDSFEPAPLPIHELTQ-PPLKALKKNDHMLQGSELVGF  81

Query  231   GRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLH  410
              +L GPEDI YD  +GVIYT C DGWVKRVT+N+S  AD+ VE WVNTGGRPLGLA G  
Sbjct  82    KQLIGPEDIAYDSSSGVIYTSCADGWVKRVTINDS-VADTIVESWVNTGGRPLGLALGHD  140

Query  411   GEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLED  590
              EVIVADA          GKV+++  EA+GVK KLTDAVD+AEDG +YFTDAS+KY L +
Sbjct  141   NEVIVADA--------FKGKVELLADEAEGVKLKLTDAVDIAEDGTIYFTDASYKYNLLE  192

Query  591   FIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYY  770
             F W+FLEGKP+GR +SYDP TK+TKVL +DL+FANGVAV PDQ +V+FCET MRRC+KYY
Sbjct  193   FFWDFLEGKPYGRAISYDPVTKETKVLAHDLYFANGVAVSPDQQYVVFCETFMRRCRKYY  252

Query  771   IRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVME  950
             I+G+KKGS+E FI+NLPG+PDNI +DG G ++I +    T A +L  ++P LRK++G+  
Sbjct  253   IQGKKKGSLETFIDNLPGLPDNIHHDGHGHYYIALSSGITVALDLALKHPFLRKLMGIYT  312

Query  951   KYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             KY    N+ KN G+F+VD+EG P  HYY+    L+S+GI+IGN++YCG V   +I+ L++
Sbjct  313   KYIGEINVVKNSGVFIVDLEGKPTEHYYDPGLALISSGIRIGNHIYCGSVVSPYIVRLDV  372

Query  1131  TQNPAVAS  1154
             T++PA A+
Sbjct  373   TKHPARAT  380



>ref|XP_010033571.1| PREDICTED: protein YLS2-like [Eucalyptus grandis]
Length=378

 Score =   425 bits (1092),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 202/353 (57%), Positives = 262/353 (74%), Gaps = 3/353 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
              +VL P++   V+Y+ + FDPA  P HEL +     AP +NGR+L  +E +G GR+ GPE
Sbjct  28    LSVLAPILAVTVLYRHEPFDPASPPIHELPE--TVAAPIQNGRILGSAEMVGAGRVVGPE  85

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+ +DP +GVIY GC DGWVKR+ V   SA  +AVEDWVN GGRPLGLA G  GE+IV D
Sbjct  86    DVEHDPASGVIYVGCADGWVKRIKVG-GSAGYAAVEDWVNIGGRPLGLALGRDGELIVCD  144

Query  432   AEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
             A  GLLNV+  G V+++T EA GVKFKLTDAV VA DG +YFTDAS+KY + +FIW+ LE
Sbjct  145   AYKGLLNVSKHGTVELLTDEAKGVKFKLTDAVAVATDGTIYFTDASYKYTVGEFIWDILE  204

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
             G+P+GR LSYDP TK+TKVL  DL+F NGVA+ P+QSFVIFCET+MRRCK+YYI GE+KG
Sbjct  205   GRPYGRFLSYDPATKETKVLARDLYFPNGVALSPNQSFVIFCETVMRRCKRYYINGEQKG  264

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPN  971
              I+ FI+ LPG PDNIRYDG+G +WI +    + +++L  +YP +RK   ++E+   RP 
Sbjct  265   HIDTFIDGLPGYPDNIRYDGQGHYWIALASGTSVSWDLAFKYPFIRKAAVILERLNRRPA  324

Query  972   MEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             MEKNGG+F V+ EG PVAHYY+   +L+++G KIG+Y+YCG + Y  IL L L
Sbjct  325   MEKNGGVFQVNSEGKPVAHYYDPQLSLITSGNKIGDYLYCGSLHYPHILRLKL  377



>ref|XP_010033572.1| PREDICTED: protein YLS2-like [Eucalyptus grandis]
Length=379

 Score =   424 bits (1090),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 203/355 (57%), Positives = 260/355 (73%), Gaps = 5/355 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
              +VL P++   V+Y+ + FDPA  P H+L       AP +NGR+L  +E +G G++ GPE
Sbjct  27    LSVLAPILAVTVLYRHEPFDPASLPIHKLP--GTVAAPMQNGRVLGSAEMVGAGQVVGPE  84

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+ +DP +G+IY GC DGWVKRV V ES A D+ VEDWVNTGGRPLGLA G  GE+IV D
Sbjct  85    DVEHDPASGIIYVGCADGWVKRVKVGES-AGDAVVEDWVNTGGRPLGLALGRDGELIVCD  143

Query  432   AEIGLLNVT--SDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEF  605
             A  GLLN++    G V+++T EA+GVKFKLTDAV VA DG +YFTDAS+KY   +FIW+ 
Sbjct  144   AYKGLLNMSMSKHGTVELLTDEAEGVKFKLTDAVAVATDGTIYFTDASYKYTFGEFIWDI  203

Query  606   LEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEK  785
             LEG+PHGRLLSYDP TK+T+VL  DL+F NG+A+ P+QSFVIFCET+MRRCK+YYI GE+
Sbjct  204   LEGRPHGRLLSYDPATKETQVLAQDLYFPNGIALSPNQSFVIFCETVMRRCKRYYINGER  263

Query  786   KGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVR  965
             KG I+ FI  LPG  DNIRYDGEG +WI +    +   +L  +YP +RK   ++E+   R
Sbjct  264   KGHIDTFIGGLPGYSDNIRYDGEGHYWIALASGTSVTGDLAFKYPFIRKAAAILERLNRR  323

Query  966   PNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             P MEKNGG+F VD EG PVAHYY+   +L+S+G KIG+Y+YCG + Y  IL L L
Sbjct  324   PAMEKNGGVFQVDSEGKPVAHYYDPQLSLISSGNKIGDYLYCGSLHYPHILRLKL  378



>gb|KHG02679.1| Adipocyte plasma membrane-associated [Gossypium arboreum]
Length=387

 Score =   423 bits (1087),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 201/365 (55%), Positives = 267/365 (73%), Gaps = 8/365 (2%)
 Frame = +3

Query  63    LWPFAVLV----PVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGV  230
             L PF +L+    PV+  +++YQLD FDPAP P H+L Q + +V+  RN R+L  +E +G 
Sbjct  21    LCPFPLLLSSLFPVLAAMLVYQLDPFDPAPLPIHKLGQAAMSVS-LRNDRMLQGAEFVGA  79

Query  231   GRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLH  410
             G L GPEDI YD K+ +IYTGC DGW+KRV ++    A+SAVE WVNT GRPLG+A G +
Sbjct  80    GELLGPEDIAYDSKSHLIYTGCQDGWIKRVRLHH---ANSAVEKWVNTHGRPLGVALGHN  136

Query  411   GEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLED  590
             GE IVAD   GLLN++ DG+V+V+T EADG+KFKL D VD+A++GM+YFTDAS+KY +ED
Sbjct  137   GEAIVADGYKGLLNISRDGEVEVLTEEADGLKFKLADGVDIADNGMIYFTDASYKYSMED  196

Query  591   FIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYY  770
              +W+ LEGKPHGRL+S+DP T++T+VLV  L+FANGVAV P Q  +I CET MRRC+KYY
Sbjct  197   SVWDVLEGKPHGRLMSFDPVTRKTRVLVTHLYFANGVAVSPRQDSLILCETTMRRCRKYY  256

Query  771   IRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVME  950
             I G K+G +E F++NLPG+PDNI+YDGEG +WI +    +   +L  RY  +RK +G+ME
Sbjct  257   IEGNKQGELEKFVDNLPGLPDNIKYDGEGHYWIALATGNSVVLDLALRYAFIRKAMGLME  316

Query  951   KYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             KY    +   N G+ VVD+EG PVAHY++     V++ IKIGN +YCG   Y  I SL+L
Sbjct  317   KYIGGLSKGNNAGVLVVDLEGKPVAHYHDHKLCSVTSAIKIGNRLYCGSFVYPHITSLDL  376

Query  1131  TQNPA  1145
              Q+PA
Sbjct  377   NQHPA  381



>ref|XP_010033570.1| PREDICTED: protein YLS2-like [Eucalyptus grandis]
 gb|KCW53261.1| hypothetical protein EUGRSUZ_J02521 [Eucalyptus grandis]
Length=379

 Score =   422 bits (1086),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/354 (56%), Positives = 262/354 (74%), Gaps = 4/354 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
              +VL PV+   ++Y+L+ FDPAP P H L+      AP+ N R+L  +E +G GR+ GPE
Sbjct  28    LSVLAPVLAITILYRLEPFDPAPLPPHGLS--GTVAAPRENSRMLRGTEMVGAGRVVGPE  85

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+VYDP++GVIY GC DGWVK+V V+  S  D AVEDWVNTGGRPLGL  G  GE+IV D
Sbjct  86    DVVYDPESGVIYVGCADGWVKQVEVS-GSGKDFAVEDWVNTGGRPLGLTLGRDGELIVCD  144

Query  432   AEIGLLNVTS-DGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             +  GLL V+  DG V+++T EA+G+KF LTD  DVA DG +YFTDAS+KY L++ IW+ L
Sbjct  145   SYKGLLKVSKRDGTVELLTDEAEGLKFNLTDGADVARDGTIYFTDASYKYTLKEAIWDVL  204

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EG+PHGR LSYDP TK+T+VL  DL+F NGVA+ PDQSFVIFCET+MR CK+YYI GE+K
Sbjct  205   EGQPHGRFLSYDPTTKETRVLARDLYFPNGVALSPDQSFVIFCETVMRWCKRYYITGERK  264

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
             G I+ FI+ LPG PDNIRYDGEG +WI +    +   +L+ +YP +RK   ++E++  RP
Sbjct  265   GHIDTFIDRLPGYPDNIRYDGEGHYWIALYSGSSMFNKLLLKYPFIRKGAAILERFDRRP  324

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
              M+KN G+F VD+EG PVAHYY+   + +S+G KIG+Y+YCG + Y +IL L L
Sbjct  325   VMDKNSGVFQVDLEGKPVAHYYDPQLSFISSGNKIGDYLYCGSLYYPYILRLKL  378



>ref|XP_010426697.1| PREDICTED: protein YLS2-like [Camelina sativa]
Length=370

 Score =   421 bits (1082),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 197/359 (55%), Positives = 271/359 (75%), Gaps = 5/359 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F++ VP ++ +V+YQLDSFDP P+PA  L   + ++ P  N R L  +E IGVG L+ PE
Sbjct  12    FSIFVPFLISIVLYQLDSFDPVPFPADSLISSASSIPPLINDRFLTGAEFIGVGFLNSPE  71

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y   + +IYTGC+DGWVKRV++++S   +S VEDWVNTGGRPLG+A GLHGEVIVAD
Sbjct  72    DIAYHKDSNLIYTGCVDGWVKRVSIHDS-VNESVVEDWVNTGGRPLGIAFGLHGEVIVAD  130

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DGK  +++T EA+GV FKLTDAV VA++G+LYFTDA++KY +  FI++FL
Sbjct  131   ANKGLLNISDDGKKTELLTDEAEGVGFKLTDAVVVADNGVLYFTDATYKYNIHQFIFDFL  190

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRL+S+DP T+ T+VLV DL+FANGV++ PDQ+ ++FCETIMRRC KYYI  E+ 
Sbjct  191   EGKPHGRLMSFDPTTRVTRVLVKDLYFANGVSLSPDQTHLVFCETIMRRCSKYYINEER-  249

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +EVFI+ LPG PDNIRYDG+G +WI +  E T  ++L  +YP LRK++ +  KYGV  
Sbjct  250   --VEVFIQGLPGYPDNIRYDGDGHYWIALISEVTTPWKLAMKYPFLRKLIYIAAKYGVEL  307

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                KN G+  VD+ G P+A Y++  F+ +++G+KIGN++YCG + + +I  L+L + PA
Sbjct  308   LFIKNAGVMQVDLNGKPIALYHDHPFSHITSGVKIGNHLYCGNLLHSYITRLDLLKYPA  366



>emb|CAN70331.1| hypothetical protein VITISV_001430 [Vitis vinifera]
Length=327

 Score =   419 bits (1077),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 192/321 (60%), Positives = 252/321 (79%), Gaps = 1/321 (0%)
 Frame = +3

Query  183   PKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVED  362
             P+ N RLL +SE IG+G+L GPEDI YD  + +IYTGC DGW+K+VT+N+S A +S V D
Sbjct  4     PRINSRLLXESEMIGLGKLLGPEDIAYDTNSHLIYTGCADGWIKKVTLNDS-AVNSVVHD  62

Query  363   WVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAED  542
             W  TGGRPLG+  G  GEV+VADA+ GLL ++ DG V+++T EA+G+ FKLTDAVDVA D
Sbjct  63    WAFTGGRPLGVVLGRAGEVLVADADKGLLEISEDGVVKLLTDEAEGIGFKLTDAVDVAVD  122

Query  543   GMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQS  722
             GM+YFTDAS+KY L+DFIW+ LEG+PHGRLLS+DP T++TKVLV DL+FANGV V PDQ+
Sbjct  123   GMIYFTDASYKYSLKDFIWDILEGRPHGRLLSFDPSTQETKVLVRDLYFANGVVVSPDQT  182

Query  723   FVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFE  902
             F+IFCET M+RC KYYI+GE+KGS++ FI+NLPGMPDNI YDGEG +WIG+   Y   ++
Sbjct  183   FLIFCETFMKRCSKYYIQGERKGSVDKFIDNLPGMPDNILYDGEGHYWIGLATGYNDLWD  242

Query  903   LIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNY  1082
             L  +YP +RKI+ +ME +  RP  EKNGG+  +D+EG P+AHYY+   +L+S+GIKI  Y
Sbjct  243   LALKYPSIRKIMAIMEXFIGRPEFEKNGGVLAIDLEGKPIAHYYDPKLSLMSSGIKIDKY  302

Query  1083  MYCGFVKYGFILSLNLTQNPA  1145
              YCGF    +++ L+L Q+ A
Sbjct  303   XYCGFXVKPYMIRLDLDQHAA  323



>gb|KCW53260.1| hypothetical protein EUGRSUZ_J02521 [Eucalyptus grandis]
Length=380

 Score =   421 bits (1082),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 200/355 (56%), Positives = 264/355 (74%), Gaps = 5/355 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
              +VL PV+   ++Y+L+ FDPAP P H L+      AP+ N R+L  +E +G GR+ GPE
Sbjct  28    LSVLAPVLAITILYRLEPFDPAPLPPHGLS--GTVAAPRENSRMLRGTEMVGAGRVVGPE  85

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+VYDP++GVIY GC DGWVK+V V+  S  D AVEDWVNTGGRPLGL  G  GE+IV D
Sbjct  86    DVVYDPESGVIYVGCADGWVKQVEVS-GSGKDFAVEDWVNTGGRPLGLTLGRDGELIVCD  144

Query  432   A-EIGLLNVTS-DGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEF  605
             + ++GLL V+  DG V+++T EA+G+KF LTD  DVA DG +YFTDAS+KY L++ IW+ 
Sbjct  145   SYKVGLLKVSKRDGTVELLTDEAEGLKFNLTDGADVARDGTIYFTDASYKYTLKEAIWDV  204

Query  606   LEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEK  785
             LEG+PHGR LSYDP TK+T+VL  DL+F NGVA+ PDQSFVIFCET+MR CK+YYI GE+
Sbjct  205   LEGQPHGRFLSYDPTTKETRVLARDLYFPNGVALSPDQSFVIFCETVMRWCKRYYITGER  264

Query  786   KGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVR  965
             KG I+ FI+ LPG PDNIRYDGEG +WI +    +   +L+ +YP +RK   ++E++  R
Sbjct  265   KGHIDTFIDRLPGYPDNIRYDGEGHYWIALYSGSSMFNKLLLKYPFIRKGAAILERFDRR  324

Query  966   PNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             P M+KN G+F VD+EG PVAHYY+   + +S+G KIG+Y+YCG + Y +IL L L
Sbjct  325   PVMDKNSGVFQVDLEGKPVAHYYDPQLSFISSGNKIGDYLYCGSLYYPYILRLKL  379



>ref|XP_007046543.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
 gb|EOX90700.1| Calcium-dependent phosphotriesterase superfamily protein, putative 
[Theobroma cacao]
Length=386

 Score =   420 bits (1080),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 204/366 (56%), Positives = 270/366 (74%), Gaps = 6/366 (2%)
 Frame = +3

Query  66    WPFAV----LVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVG  233
             WP A+    ++ V+  +V+Y LDSFD A  P HEL+   P  A  RNGRLL  +E +GVG
Sbjct  21    WPLALFLTAMLAVVAAIVVYHLDSFDVATMPLHELSP-PPEPALLRNGRLLQGAELLGVG  79

Query  234   RLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHG  413
             +  GPEDI YD ++ +IYTG  DGW+KRV +NES A+D+ VE+WV TGGRPLG+A G + 
Sbjct  80    KFQGPEDIAYDSRSEIIYTGSGDGWIKRVWLNES-ASDTVVENWVRTGGRPLGIALGRNN  138

Query  414   EVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDF  593
             EVIVADA  GLLN++ DG ++++  EA+ +KFK+TD VDVAEDGM+YFTDAS KY L +F
Sbjct  139   EVIVADAYKGLLNISKDGAMELLADEAEELKFKITDGVDVAEDGMIYFTDASHKYSLHEF  198

Query  594   IWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYI  773
               + LEG+P+GRLLS+DP +++TKVL+ DL+F NG+AV  DQ  V+FCET MRRC+KYYI
Sbjct  199   ARDILEGRPYGRLLSFDPASRRTKVLLRDLYFPNGIAVSSDQDSVVFCETSMRRCRKYYI  258

Query  774   RGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEK  953
             +G+KKG +E FI+NLPGMPDN+RYDGEG +WI +  E T  ++L  RYPL+RK   +ME+
Sbjct  259   QGKKKGRVEKFIDNLPGMPDNVRYDGEGHYWIALVTENTILWDLAFRYPLVRKAALIMER  318

Query  954   YGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLT  1133
                R +  KNGG   VD+EG PVAHY + +  +VSTGIKI N++YCG     +I+ L+L 
Sbjct  319   LVGRVSTGKNGGALAVDLEGKPVAHYQDVELNMVSTGIKIKNHLYCGSFVRPYIIRLDLD  378

Query  1134  QNPAVA  1151
             Q+PA A
Sbjct  379   QHPAQA  384



>emb|CAN68853.1| hypothetical protein VITISV_037416 [Vitis vinifera]
Length=383

 Score =   419 bits (1078),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 199/356 (56%), Positives = 265/356 (74%), Gaps = 2/356 (1%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
             +L PV   + +YQLDSFDPA  P HE +Q  P   PK N  +L  SE IG G L GPEDI
Sbjct  26    ILTPVAAAIFLYQLDSFDPASLPTHEFSQ-EPMPVPKLNPCMLQGSEMIGQGNLLGPEDI  84

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              YD  + +IYTGC DGWVKRVT+NES AA+S V +W  TGGRPLG+A G  G+V+VADAE
Sbjct  85    AYDANSHLIYTGCADGWVKRVTLNES-AANSVVHNWAFTGGRPLGVALGRAGKVLVADAE  143

Query  438   IGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGK  617
              GLL ++ DG ++++T EA+G+KFK T+AVDVA DGM+YFTDAS+KYGL +FIWE LEG+
Sbjct  144   KGLLEISGDGVMKLLTDEAEGLKFKQTNAVDVAVDGMIYFTDASYKYGLIEFIWEILEGR  203

Query  618   PHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSI  797
             PH RLLS+DP T++T VL+ DL+ ANGV V PDQ+ V+ CET+M+RC KYYI+G++KGS 
Sbjct  204   PHDRLLSFDPSTEETIVLLRDLYLANGVVVSPDQTSVVLCETLMKRCTKYYIQGKRKGSX  263

Query  798   EVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNME  977
             E FI+NL GMPDNI YD +G +WI +       ++L  +YP +RK++ ++E+Y  RP+ E
Sbjct  264   EKFIDNLFGMPDNILYDEKGHYWIALATGTKGLWDLALKYPSIRKVVAILERYIGRPHXE  323

Query  978   KNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
             KNGGI  VD+EG  VAHY++ + ++VS+G+K+G Y+YCG     +I+ L+L Q+ A
Sbjct  324   KNGGILAVDLEGKLVAHYHDPELSMVSSGVKVGKYLYCGSFVKSYIIXLDLDQHAA  379



>gb|KHF98691.1| Adipocyte plasma membrane-associated [Gossypium arboreum]
Length=393

 Score =   417 bits (1073),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 268/363 (74%), Gaps = 11/363 (3%)
 Frame = +3

Query  63    LW-PFAVLV----PVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIG  227
             LW PF  ++    PV+  +++YQLDSFDPAP P HEL Q +P V    N R+L  +E +G
Sbjct  25    LWRPFITVLFTMFPVVAAMLVYQLDSFDPAPLPIHELGQ-APVVVSLPNDRMLQGAELLG  83

Query  228   VGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGL  407
             VG L GPEDI YDP   V+YTGC DGW+KRV       +DS VE++VNT GRPLGLA G 
Sbjct  84    VGELQGPEDIAYDPTANVVYTGCHDGWIKRVRF-----SDSVVENFVNTHGRPLGLALGH  138

Query  408   HGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLE  587
             + E+IVADA  GLLN++ DG+V+++T EADG KFKLTD VD+A++GM+YFTDAS+KY L 
Sbjct  139   NKEIIVADAYKGLLNISKDGEVELLTDEADGHKFKLTDGVDIADNGMIYFTDASYKYNLN  198

Query  588   DFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKY  767
             + IW+ LEGKPHGR +S+DP T++T VLV+ L+FANGVAV P+Q   IFCET+MRRC+KY
Sbjct  199   EDIWDILEGKPHGRFMSFDPVTRKTDVLVSHLYFANGVAVSPNQDHAIFCETVMRRCRKY  258

Query  768   YIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVM  947
             YI+G K+G +E FI++LPG PDNI+YDG+G +WI +    +   ++  RYP +RK++ + 
Sbjct  259   YIKGSKQGGLETFIDDLPGFPDNIKYDGDGHYWIALPSANSVPLDIAFRYPFIRKVMAIA  318

Query  948   EKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLN  1127
              KY  R   EK+ G+ VVD+EG PVAHY++   +++++G+KIGN +YCG V++  IL L+
Sbjct  319   MKYIGRLPTEKDAGVLVVDLEGKPVAHYHDHRLSMITSGMKIGNRVYCGSVRHPHILKLD  378

Query  1128  LTQ  1136
             L +
Sbjct  379   LAK  381



>ref|XP_006291226.1| hypothetical protein CARUB_v10017358mg [Capsella rubella]
 gb|EOA24124.1| hypothetical protein CARUB_v10017358mg [Capsella rubella]
Length=409

 Score =   418 bits (1075),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/360 (55%), Positives = 274/360 (76%), Gaps = 6/360 (2%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELT-QGSPAVAPKRNGRLLHDSEKIGVGRLSGP  248
             F+++VP+++ +V+Y+LDSFDP  +PA  L    + +  P  N R L  +E IGVG L+ P
Sbjct  50    FSIVVPLLISIVLYRLDSFDPVHFPADSLIPSAATSTPPLINDRFLTGAEFIGVGLLNNP  109

Query  249   EDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVA  428
             EDI Y  ++ +IYTGC+DGWVKRV+V +S A DS VEDWVNTGGRPLG+A GLHGEVIVA
Sbjct  110   EDIAYHKESNLIYTGCVDGWVKRVSVQDS-ANDSVVEDWVNTGGRPLGIAFGLHGEVIVA  168

Query  429   DAEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEF  605
             DA  GLLN++ DGK  +++T EA+GVKFKLTDAV VA++G+LYFTDAS+KY +  FI++F
Sbjct  169   DAIKGLLNISDDGKKTELLTDEAEGVKFKLTDAVVVADNGVLYFTDASYKYNIHQFIFDF  228

Query  606   LEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEK  785
             LEGKPHGRL+S+DP T+ T+VLV DL+FANGV++ PDQ+ ++FCE++MRRC KYYIR ++
Sbjct  229   LEGKPHGRLISFDPTTRVTRVLVRDLYFANGVSLSPDQTHLVFCESVMRRCSKYYIREDR  288

Query  786   KGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVR  965
                +EVFI+ LPG PDNIRYDG+G +WI +  E T  ++L  +YPLLRK++ +  KYGV 
Sbjct  289   ---VEVFIQGLPGYPDNIRYDGDGHYWIALISEVTRPWKLAMKYPLLRKLIAMAAKYGVE  345

Query  966   PNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                 KN  +  VD++GNP+A Y +  F+ ++TG+KIGN++Y G +   +I+ L+L + PA
Sbjct  346   LLSIKNASVLQVDLDGNPIASYQDHPFSHITTGVKIGNHLYFGNLLQSYIIRLDLLKYPA  405



>ref|XP_010550491.1| PREDICTED: protein YLS2-like [Tarenaya hassleriana]
Length=374

 Score =   417 bits (1071),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 191/350 (55%), Positives = 262/350 (75%), Gaps = 7/350 (2%)
 Frame = +3

Query  102   VVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGV  281
               +Y+L +FDPAP P   L    P  AP  N RLL  +E +G GRL GPE+I Y P++G+
Sbjct  28    TALYRLHTFDPAPLPLTALA-APPLKAPLLNARLLSGAEVVGSGRLDGPEEIAYHPESGL  86

Query  282   IYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTS  461
             IYTGC+DGWVKRV +N     DS V+DWVNTGGRPLG+A G  GEVIVADA+ GLLN++ 
Sbjct  87    IYTGCVDGWVKRVRLN-----DSVVDDWVNTGGRPLGIAFGPQGEVIVADADKGLLNISK  141

Query  462   DG-KVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLS  638
             DG + +++T EA+GV+FKLTD VDV EDG++YFTDAS++Y L++F+ + LEGKP+GRLLS
Sbjct  142   DGSRTELVTEEAEGVRFKLTDGVDVGEDGVIYFTDASYRYSLKEFMMDILEGKPNGRLLS  201

Query  639   YDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENL  818
             +DP TK T VL+ DL+FANG+++ PDQ+ +IFCET +RRC KY+IRGEK+G +E+F+E L
Sbjct  202   HDPSTKTTTVLLRDLYFANGISLSPDQTHLIFCETPLRRCSKYHIRGEKRGEVEIFVEGL  261

Query  819   PGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFV  998
             PG+PDNIR+D EG +WI +   YT  ++++ R+P LRK++ +  KYG+     K  G+F 
Sbjct  262   PGLPDNIRHDREGHYWIALATAYTAQWKVLFRHPTLRKVVAIATKYGMELQGAKGAGVFQ  321

Query  999   VDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAV  1148
             VD+EG P+AHYY+   + +++G+KIGN ++CG + Y  I  LNL Q PA+
Sbjct  322   VDLEGKPIAHYYDPSLSFITSGLKIGNNLFCGSISYPHITRLNLLQFPAL  371



>gb|EYU22994.1| hypothetical protein MIMGU_mgv1a0246431mg, partial [Erythranthe 
guttata]
Length=317

 Score =   414 bits (1065),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 248/306 (81%), Gaps = 4/306 (1%)
 Frame = +3

Query  84   VPVILGVVIYQLDSFDPAPYPAHELTQ-GSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIV  260
            +PV+  V++YQ+D FDPAPYP HELT+ G P   PKRN ++L  SEKIG G L  PEDI 
Sbjct  11   LPVVAAVLLYQIDPFDPAPYPDHELTRNGEPLFIPKRNSQMLLGSEKIGFGELPAPEDIA  70

Query  261  YDPKTGVIYTGCMDGWVKRVTVNESSAA--DSAVEDWVNTGGRPLGLAHGLHGEVIVADA  434
            YDPKTGVIYTGC+DGW++RV++  S+AA  D  VE+WVNTGGRPLG+ HG+HGEVIVADA
Sbjct  71   YDPKTGVIYTGCVDGWLRRVSLKGSAAAAADFVVEEWVNTGGRPLGIVHGIHGEVIVADA  130

Query  435  EIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEG  614
            + GLLN++ DG ++++T EADG+KFKLTDAVD+  DG LYFTDAS+K+  ++   +FLEG
Sbjct  131  DKGLLNISRDGVIELLTDEADGLKFKLTDAVDIGPDGTLYFTDASYKHNFKNHFEDFLEG  190

Query  615  KPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGS  794
            +P+GR LSYDP TKQT+VLV DL+FANGVA+  DQSFVIFCET M RCKKYYI+G  KGS
Sbjct  191  RPNGRFLSYDPSTKQTQVLVKDLYFANGVALSADQSFVIFCETAMMRCKKYYIQGPSKGS  250

Query  795  IEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNM  974
            +++F+ENLPG+PDNIRYDGEG +WI +  + T  ++L QRYP +RK++ ++++Y  RP+ 
Sbjct  251  VDIFVENLPGLPDNIRYDGEGQYWIALTTD-TSVWKLAQRYPFIRKVIAMVDRYIGRPST  309

Query  975  EKNGGI  992
            EKNGG+
Sbjct  310  EKNGGV  315



>ref|XP_002521695.1| Adipocyte plasma membrane-associated protein, putative [Ricinus 
communis]
 gb|EEF40682.1| Adipocyte plasma membrane-associated protein, putative [Ricinus 
communis]
Length=380

 Score =   416 bits (1068),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 206/379 (54%), Positives = 268/379 (71%), Gaps = 11/379 (3%)
 Frame = +3

Query  21    KKNQDKILRTKMSGLWP------FAVLVPVILGVVIY-QLDSFDPAPYPAHELTQGSPAV  179
               N D I R   S  WP       ++LVP++   VI+ QLD FDPAP P HELT+  PA 
Sbjct  5     NNNADTISRRSCSS-WPSFFIFSLSLLVPLVAASVIFFQLDPFDPAPMPIHELTR-PPAN  62

Query  180   APKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVE  359
                +N  +L  SE +G G L GPEDI +D K+G+IYT C  GW+KRVTVN+S   DS VE
Sbjct  63    VLTKNAHILKGSEFLGKGELLGPEDIAFDSKSGLIYTSCAGGWIKRVTVNDS-VTDSVVE  121

Query  360   DWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAE  539
             +WVNTGGRPLGLA G   EV+VADA  GLL +  DG ++++T EA+G+KFKLTD VD+AE
Sbjct  122   NWVNTGGRPLGLALGHGNEVLVADAFEGLLKINGDGGIELLTNEAEGIKFKLTDGVDIAE  181

Query  540   DGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQ  719
             DG +YFTDAS+KY L DF+W+ LEGKP+GRL+S+DP TK+TKVLV DL FANGVAV P+Q
Sbjct  182   DGTIYFTDASYKYDLHDFMWDILEGKPYGRLMSFDPATKETKVLVRDLHFANGVAVSPNQ  241

Query  720   SFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAF  899
              FV+FCET MRRC+KYYI+G KKG IE FI +LPG PDNI  DG G FWI +    +   
Sbjct  242   EFVVFCETPMRRCRKYYIQGNKKGQIENFI-SLPGAPDNIHSDGHGHFWIALSSGNSAFV  300

Query  900   ELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGN  1079
             +L+ RYP +RK + +  ++        N G++VVD+EGNP+AHYY+ +  + S+G++IG+
Sbjct  301   DLVYRYPFIRKFMAISIRFKGPVYSGNNAGLYVVDLEGNPIAHYYDHNLRMTSSGVRIGD  360

Query  1080  YMYCGFVKYGFILSLNLTQ  1136
             ++YCG ++  +IL LN T 
Sbjct  361   HIYCGSIEAPYILRLNPTS  379



>ref|XP_010503835.1| PREDICTED: protein YLS2-like [Camelina sativa]
Length=370

 Score =   415 bits (1067),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 269/359 (75%), Gaps = 5/359 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F++ VP+++ +V+YQLDSFDP  +PA  L   + ++ P  N R L  +E IGVG L+ PE
Sbjct  12    FSIFVPLLISIVLYQLDSFDPVHFPADSLISSATSIPPLINDRFLTGAEFIGVGLLNSPE  71

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y   + +IYTGC+DGWVKRV++++S   DS VEDWVNTGGRPLG+A GLHGEVIVAD
Sbjct  72    DIAYHKDSNLIYTGCVDGWVKRVSIHDS-VNDSVVEDWVNTGGRPLGIAFGLHGEVIVAD  130

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DGK  +++T EA+GV FKLTDAV VA++G+LYFTDA++KY +  FI++FL
Sbjct  131   ANKGLLNISDDGKKTELLTDEAEGVGFKLTDAVVVADNGVLYFTDATYKYNIHQFIFDFL  190

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRL+S+DP T+ T+VLV DL+FANGV++ PDQ+ ++FCETI RRC KYYI  E+ 
Sbjct  191   EGKPHGRLMSFDPTTRVTRVLVKDLYFANGVSLSPDQTHLVFCETITRRCSKYYINEER-  249

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +EVFI+ LPG PDNIRYDG+G +WI +  + T  ++L  +YP LRK++ +  KYGV  
Sbjct  250   --VEVFIQGLPGYPDNIRYDGDGHYWIALISQVTTPWKLSMKYPFLRKLIYIAAKYGVEL  307

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                KN  +  VD+ GNP+A Y +  F+ +++G+KIGN++YCG + + +I  L+L + PA
Sbjct  308   LSIKNASVMQVDLNGNPIALYNDHPFSHITSGVKIGNHLYCGNLLHSYITRLDLLKYPA  366



>gb|EYU39426.1| hypothetical protein MIMGU_mgv1a026231mg, partial [Erythranthe 
guttata]
Length=317

 Score =   413 bits (1061),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 251/316 (79%), Gaps = 4/316 (1%)
 Frame = +3

Query  54   MSGLWPFAVLVPVILGVVIYQLDSFDPAPYPAHELTQ-GSPAVAPKRNGRLLHDSEKIGV  230
            M+ +     ++PV+  V++YQ+D FDPAPYP HELT+ G P   PKRN  +L  SEKIG 
Sbjct  1    MANIAILISILPVVAAVLLYQIDPFDPAPYPDHELTRNGEPLFIPKRNSHMLLGSEKIGY  60

Query  231  GRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNES--SAADSAVEDWVNTGGRPLGLAHG  404
            G L  PEDI YDPKTGVIYTGC+DGW++RV++  S  +AAD  VE+WVNTGGRPLG+ HG
Sbjct  61   GELPAPEDIAYDPKTGVIYTGCVDGWLRRVSIKGSAATAADFVVEEWVNTGGRPLGIVHG  120

Query  405  LHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGL  584
            +HGEVIVADA+ GLLN++ DG ++++T EADG+KFKLTDAVD+  DG LYFTDAS+K+  
Sbjct  121  IHGEVIVADADKGLLNISRDGVIELLTDEADGLKFKLTDAVDIGPDGTLYFTDASYKHNF  180

Query  585  EDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKK  764
            ++   +FLEG+P+GR LSYDP +KQT+VLV DL+FANGVA+  DQSFVIFCET M RCKK
Sbjct  181  KNHFEDFLEGRPNGRFLSYDPSSKQTQVLVKDLYFANGVALSADQSFVIFCETAMMRCKK  240

Query  765  YYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGV  944
            YYI+G  +GS+++F+ENLPG+PDNIRYDGEG +WI +  + T  ++L QRYP +RK++ +
Sbjct  241  YYIQGPSRGSVDIFVENLPGLPDNIRYDGEGQYWIALTTD-TSVWKLAQRYPFIRKVIAM  299

Query  945  MEKYGVRPNMEKNGGI  992
            +++Y  RP+ EKNGG+
Sbjct  300  VDRYIGRPSTEKNGGV  315



>ref|XP_010503836.1| PREDICTED: protein YLS2-like [Camelina sativa]
Length=372

 Score =   412 bits (1060),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 268/359 (75%), Gaps = 5/359 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F V +P+++ + +Y+LD+FDPA +PA  L   + ++ P  N R L  +E IGVG L+ PE
Sbjct  13    FTVTLPLLVSIALYRLDTFDPAHHPADSLVYSTASIPPLINDRFLTGAEFIGVGLLNSPE  72

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y   +G+IYTGC+DGWVKRV V+ES   DS VEDWVNTGGRPLGLA G+HGEVIVAD
Sbjct  73    DIAYHEDSGLIYTGCVDGWVKRVKVSES-VNDSVVEDWVNTGGRPLGLAFGIHGEVIVAD  131

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DGK  +++T EADGV+FKLTDAV V+++G+LYFTD S+KY +  FI++ L
Sbjct  132   AYKGLLNISGDGKKTELLTEEADGVRFKLTDAVAVSDNGVLYFTDGSYKYSVHQFIFDIL  191

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRL+S+DP T+ T+VL++DL+FANGV++ PDQ+ ++FCET +RRC KYYI G   
Sbjct  192   EGKPHGRLMSFDPTTRLTRVLLSDLYFANGVSMSPDQTHLVFCETPIRRCSKYYING---  248

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
             G +EVFI+ LPG PDNIRYD +G +WI +    T  ++L  +YP LRKI  ++ KYG  P
Sbjct  249   GRVEVFIQGLPGYPDNIRYDYDGHYWIAMPSGVTTLWKLAMKYPFLRKITAIVAKYGYEP  308

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                +N G+  VD+ GNP+A+Y+++  + ++TG+KIGNY+YCG + +  I  L+L + PA
Sbjct  309   MFMENAGVMKVDLVGNPIAYYHDQTLSHITTGVKIGNYLYCGSLLHPHITRLDLLKYPA  367



>ref|XP_010426698.1| PREDICTED: protein YLS2-like [Camelina sativa]
Length=372

 Score =   412 bits (1058),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 270/359 (75%), Gaps = 5/359 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F V +P+++ + +Y+LD+FDPA +PA  L   + ++ P  N +LL  +E IGVG L+ PE
Sbjct  13    FTVTLPLLVSIALYRLDTFDPAHHPADSLVYSNASIPPLINDKLLTGAEFIGVGLLNSPE  72

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y   +G+IYTGC+DGWVKRV V ES   DS VEDWVNTGGRPLG+A G+HGEVIVAD
Sbjct  73    DIAYHVDSGLIYTGCVDGWVKRVKVAES-VNDSVVEDWVNTGGRPLGIAFGIHGEVIVAD  131

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DGK  +++T EADGV+FKLTDAV VA++G+LYFTD S+KY +  FI++ L
Sbjct  132   AYKGLLNISGDGKKTELLTDEADGVRFKLTDAVVVADNGVLYFTDGSYKYNVHQFIFDIL  191

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKP+GRLLS+DP T+ T+VL++ L+FANGV++ PDQ+ ++FCET +R+C KYYI G   
Sbjct  192   EGKPYGRLLSFDPTTRLTRVLLSGLYFANGVSMSPDQTHLVFCETPIRKCSKYYING---  248

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
             G +EVFI+ LPG PDNIRYDG+G +WI +    T  ++L  +YP LRKI  ++ KYG  P
Sbjct  249   GRVEVFIQGLPGYPDNIRYDGDGHYWIAMPSGVTTLWKLAMKYPFLRKITAIVAKYGYEP  308

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                +N G+  VD+EGNP+A+Y+++  + ++TG+KIGNY+YCG + +  I+ L+L + PA
Sbjct  309   MFMENAGVMKVDLEGNPIAYYHDQTLSHITTGVKIGNYLYCGSLSHSRIIRLDLLKYPA  367



>ref|NP_190712.1| strictosidine synthase family protein [Arabidopsis thaliana]
 sp|Q9SD05.1|SSL6_ARATH RecName: Full=Protein STRICTOSIDINE SYNTHASE-LIKE 6; Short=AtSSL6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK25984.1|AF360274_1 putative mucin protein [Arabidopsis thaliana]
 emb|CAB63008.1| mucin-like protein [Arabidopsis thaliana]
 gb|AAN13136.1| putative mucin protein [Arabidopsis thaliana]
 gb|AEE78793.1| strictosidine synthase family protein [Arabidopsis thaliana]
Length=371

 Score =   411 bits (1056),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 196/359 (55%), Positives = 265/359 (74%), Gaps = 5/359 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F ++VP+++ + +YQLD+FDPA +PA  L   + ++ P  N R L  +E IGVG L+ PE
Sbjct  12    FCIIVPLLISITLYQLDTFDPAHHPADSLISSTASIPPLINERFLTGAEFIGVGLLNSPE  71

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y   +G IYTGC+DGWVKRV V ES   DS VED VNTGGRPLG+A G+HGEVIVAD
Sbjct  72    DIAYHEDSGFIYTGCVDGWVKRVKVAES-VNDSLVEDLVNTGGRPLGIAFGIHGEVIVAD  130

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DGK  +++T EADGV+FKL DAV VA++G+LYFTD S+KY L  F ++ L
Sbjct  131   AYKGLLNISGDGKKTELLTEEADGVRFKLPDAVTVADNGVLYFTDGSYKYNLHQFSFDIL  190

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRL+S+DP TK T+VL+ DL+FANGV++ PDQ+ ++FCET +RRC KYYI G   
Sbjct  191   EGKPHGRLMSFDPTTKVTRVLLRDLYFANGVSLSPDQTHLVFCETPIRRCSKYYING---  247

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
             G +E+FI+ LPG PDNIRYDG+G +WI +    T  ++L  +YP LRKI  +  KYG  P
Sbjct  248   GRVELFIQGLPGYPDNIRYDGDGHYWIAMPSGVTTLWKLSMKYPFLRKITAMAAKYGYEP  307

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                +N G+  VD++GNP+A+Y+++  + ++TG+KIGNY+YCG + +  IL L+L + PA
Sbjct  308   MFMENAGVLQVDLDGNPIAYYHDQALSHITTGVKIGNYLYCGSLWHSHILRLDLLKYPA  366



>gb|KFK34387.1| hypothetical protein AALP_AA5G138500 [Arabis alpina]
Length=370

 Score =   410 bits (1053),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 194/359 (54%), Positives = 270/359 (75%), Gaps = 5/359 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F+ ++P+++ +V+Y+LD+FDPA  P+      + +  P  N R L  +E IGVG L  PE
Sbjct  12    FSTIIPLLISIVLYRLDTFDPAQIPSEAYDPPTTSNPPLYNDRFLTGAEFIGVGHLDKPE  71

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI+Y P +G+IYTGC+DGWVKRV+++ES A +S VEDWVNTGGRPLG+A GL GEVIVAD
Sbjct  72    DIIYHPDSGLIYTGCVDGWVKRVSLHES-ANESVVEDWVNTGGRPLGIAFGLDGEVIVAD  130

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A+ GLL+++SDGK +++++ EA+GVKFK+TDAV VA++G++YFTDAS KY L DF ++ L
Sbjct  131   ADKGLLSISSDGKNIELLSDEAEGVKFKITDAVAVADNGVMYFTDASSKYNLLDFSFDVL  190

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRLLSYDP T+ T+VL+ DL+FANGV++ PDQ+ +IFCET+MRRC KY IR E+ 
Sbjct  191   EGKPHGRLLSYDPATRTTRVLLKDLYFANGVSMSPDQTHLIFCETLMRRCNKYNIREER-  249

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +E FI+ L G PDNIRYD +G +WI +    T  ++L  ++P LRKI  +  KYG+ P
Sbjct  250   --VEPFIQGLSGYPDNIRYDEDGHYWIAMPSAVTKLWKLSMKHPFLRKITAIAAKYGIEP  307

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                +N G+  VD+EGNP+A Y+E+  + +STG+KIG Y+YCG + +  I+ L+L + PA
Sbjct  308   MFMENSGVLQVDLEGNPIALYHEQSLSHLSTGLKIGKYLYCGSLLHSHIMRLDLLKYPA  366



>gb|KGN55618.1| hypothetical protein Csa_3G002390 [Cucumis sativus]
Length=388

 Score =   410 bits (1054),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 203/365 (56%), Positives = 263/365 (72%), Gaps = 12/365 (3%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             FA+L      VV+Y+LD FDPA  PA EL+ G PA     NGR+L  +++IGVG L+  E
Sbjct  24    FALLAAA---VVVYKLDPFDPAALPAEELS-GEPASVAACNGRVLQAADRIGVGELAAAE  79

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D  YD + G++YTG  DGW+KRV +N     DS VE W  TGGRPLG+A G  G+V +AD
Sbjct  80    DFAYDSELGLVYTGDGDGWLKRVRLN-----DSTVEKWAFTGGRPLGVALGADGDVFIAD  134

Query  432   AEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
             A+ GLL  + +G V+V+T E DGVKF+LTD VDV EDG +YFTDAS KY    FI++F E
Sbjct  135   ADKGLLKASKEGVVEVLTEEDDGVKFRLTDGVDVGEDGTVYFTDASSKYAFHSFIFDFFE  194

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
             G+P+GR LSY+P TK+TK+LV DL F NGV V P Q FVIFCET +RRC+KYYI G++KG
Sbjct  195   GRPYGRFLSYNPTTKETKLLVGDLHFGNGVVVAPTQDFVIFCETPLRRCRKYYISGDRKG  254

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHA---FELIQRYPLLRKILGVMEKYGV  962
             S+E F+ENLPG PDNIRYDG+G +WIG+  E T +   + +  +YP+LRKI+ +MEKYG 
Sbjct  255   SVEKFVENLPGTPDNIRYDGDGHYWIGLSTEMTGSSSYWHIALKYPVLRKIMAIMEKYGQ  314

Query  963   RPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNP  1142
             RPN+EKNGG+  V++EG  VA YY+  +TLV+ GIKIGN++Y G +    IL L+L + P
Sbjct  315   RPNLEKNGGVVAVNLEGEQVAWYYDYKWTLVTAGIKIGNHLYSGSLALPGILRLDLDKFP  374

Query  1143  AVASG  1157
             A A+G
Sbjct  375   ATAAG  379



>ref|NP_001190053.1| strictosidine synthase-like 5 [Arabidopsis thaliana]
 gb|AEE78792.1| strictosidine synthase-like 5 [Arabidopsis thaliana]
Length=369

 Score =   409 bits (1050),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 194/359 (54%), Positives = 267/359 (74%), Gaps = 7/359 (2%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F  +VP+++ + +YQLD+FDPAP P+      + ++ P  + + L  +E IGVG L  PE
Sbjct  12    FFTIVPLLVSIALYQLDTFDPAPVPSEAYASSTTSIPPLISDKYLTGAEFIGVGLLDKPE  71

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y   + +IYTGC+DGWVKRV+V++S A DS VEDWVNTGGRPLG+A G+HGEVIVAD
Sbjct  72    DIAYHQDSNLIYTGCIDGWVKRVSVHDS-ANDSVVEDWVNTGGRPLGIAFGVHGEVIVAD  130

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DGK  +++T +A+GVKFKLTD V VA++G+LYFTDAS+KY L    ++ L
Sbjct  131   AYKGLLNISGDGKKTELLTDQAEGVKFKLTDVVAVADNGVLYFTDASYKYTLHQVKFDIL  190

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRL+S+DP T+ T+VL+ DL+FANGV++ PDQ+ +IFCET MRRC KYYI  E+ 
Sbjct  191   EGKPHGRLMSFDPTTRVTRVLLKDLYFANGVSMSPDQTHLIFCETPMRRCSKYYINEER-  249

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +EVFI+ LPG PDNIRYDG+G +WI +G   +  + L  +YP LRKI  +  KYGV  
Sbjct  250   --VEVFIQGLPGYPDNIRYDGDGHYWIAMGA--STLWRLSMKYPFLRKITAIAAKYGVEL  305

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                KN G+  VD++GNP+A+Y+++  + ++TGIKIGNY+YCG + + +I+ L+L + PA
Sbjct  306   MFMKNAGVLQVDLDGNPIAYYHDQRLSHITTGIKIGNYLYCGNILHSYIIRLDLLKYPA  364



>ref|NP_566951.1| strictosidine synthase-like 5 [Arabidopsis thaliana]
 sp|Q9CAZ7.1|SSL5_ARATH RecName: Full=Protein STRICTOSIDINE SYNTHASE-LIKE 5; Short=AtSSL5; 
AltName: Full=Protein YELLOW-LEAF-SPECIFIC GENE 2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL58944.1|AF462858_1 AT3g51430/F26O13_70 [Arabidopsis thaliana]
 dbj|BAB32882.1| strictosidine synthase-like protein [Arabidopsis thaliana]
 gb|AAL57676.1| AT3g51430/F26O13_70 [Arabidopsis thaliana]
 gb|AAM64876.1| mucin-like protein [Arabidopsis thaliana]
 gb|AAR23723.1| At3g51430 [Arabidopsis thaliana]
 gb|AEE78791.1| strictosidine synthase-like 5 [Arabidopsis thaliana]
Length=371

 Score =   408 bits (1049),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 193/359 (54%), Positives = 266/359 (74%), Gaps = 5/359 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F  +VP+++ + +YQLD+FDPAP P+      + ++ P  + + L  +E IGVG L  PE
Sbjct  12    FFTIVPLLVSIALYQLDTFDPAPVPSEAYASSTTSIPPLISDKYLTGAEFIGVGLLDKPE  71

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y   + +IYTGC+DGWVKRV+V++S A DS VEDWVNTGGRPLG+A G+HGEVIVAD
Sbjct  72    DIAYHQDSNLIYTGCIDGWVKRVSVHDS-ANDSVVEDWVNTGGRPLGIAFGVHGEVIVAD  130

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DGK  +++T +A+GVKFKLTD V VA++G+LYFTDAS+KY L    ++ L
Sbjct  131   AYKGLLNISGDGKKTELLTDQAEGVKFKLTDVVAVADNGVLYFTDASYKYTLHQVKFDIL  190

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRL+S+DP T+ T+VL+ DL+FANGV++ PDQ+ +IFCET MRRC KYYI  E+ 
Sbjct  191   EGKPHGRLMSFDPTTRVTRVLLKDLYFANGVSMSPDQTHLIFCETPMRRCSKYYINEER-  249

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +EVFI+ LPG PDNIRYDG+G +WI +    +  + L  +YP LRKI  +  KYGV  
Sbjct  250   --VEVFIQGLPGYPDNIRYDGDGHYWIAMVSGASTLWRLSMKYPFLRKITAIAAKYGVEL  307

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                KN G+  VD++GNP+A+Y+++  + ++TGIKIGNY+YCG + + +I+ L+L + PA
Sbjct  308   MFMKNAGVLQVDLDGNPIAYYHDQRLSHITTGIKIGNYLYCGNILHSYIIRLDLLKYPA  366



>ref|XP_002876086.1| yellow-leaf-specific gene 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52345.1| yellow-leaf-specific gene 2 [Arabidopsis lyrata subsp. lyrata]
Length=372

 Score =   408 bits (1048),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 194/357 (54%), Positives = 264/357 (74%), Gaps = 5/357 (1%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
              +VP ++ + +Y+LD+FDPAP P+      + ++ P  N + L  +E IGVG L  PEDI
Sbjct  14    TIVPFLVSIALYKLDTFDPAPVPSDAYASSTTSIPPLVNEKSLTGAEFIGVGLLDKPEDI  73

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              Y   + +IYTGC+DGWVKRVTV++S A DS VEDWVNTGGRPLG+A G+HGEVIVADA 
Sbjct  74    AYHQDSNLIYTGCIDGWVKRVTVHDS-ANDSVVEDWVNTGGRPLGIAFGIHGEVIVADAY  132

Query  438   IGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEG  614
              GLLN++ DGK  +++T EA+GV+FKLTD V V+++G+LYFTDAS+KY L     + LEG
Sbjct  133   KGLLNISGDGKKTELLTDEAEGVRFKLTDVVAVSDNGVLYFTDASYKYTLHQVKLDILEG  192

Query  615   KPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGS  794
             KPHGRL+S+DP TK T+VL+ DL+FANGV++ PDQ+ +IFCET MRRC KYYI  E+   
Sbjct  193   KPHGRLMSFDPTTKVTRVLLRDLYFANGVSMSPDQTHLIFCETPMRRCSKYYISEER---  249

Query  795   IEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNM  974
             +EVFI+ LPG PDNIRYDG+G +WI +    T+ + L  +YP LRK+ G+  KYGV    
Sbjct  250   VEVFIQGLPGYPDNIRYDGDGHYWIAMVSGATNLWRLSMKYPFLRKLTGMAAKYGVELMF  309

Query  975   EKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
              KN G+  VD++GNP+A+YY++  + ++TG+KIGNY+YCG + +  I+ L+L + PA
Sbjct  310   MKNAGVLQVDLDGNPIAYYYDQRLSHITTGVKIGNYLYCGNILHSHIIRLDLLKYPA  366



>ref|XP_006403914.1| hypothetical protein EUTSA_v10010472mg [Eutrema salsugineum]
 gb|ESQ45367.1| hypothetical protein EUTSA_v10010472mg [Eutrema salsugineum]
Length=368

 Score =   406 bits (1043),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 193/358 (54%), Positives = 263/358 (73%), Gaps = 5/358 (1%)
 Frame = +3

Query  75    AVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPED  254
             + ++P +  + +Y+LD+FDPAP PA  L   + ++ P  N  LL  +E IG G L+ PED
Sbjct  14    STIIPFLASIALYRLDTFDPAPLPAEALAYSTNSIPPLLNDGLLTGAEFIGAGLLNNPED  73

Query  255   IVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADA  434
             I Y   +G+IYTGC+DGWVKRV V +S A DS VEDWVNTGGRPLG+A GLHGEVIVADA
Sbjct  74    IAYHRDSGLIYTGCVDGWVKRVKVLDS-ANDSVVEDWVNTGGRPLGIAFGLHGEVIVADA  132

Query  435   EIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
               GLLN+++DGK  +++T EA+GV+FKLTDAV V ++G+LYFTDAS+KY      ++FLE
Sbjct  133   YKGLLNISNDGKKTELLTDEAEGVRFKLTDAVAVGDNGVLYFTDASYKYNFRQAAFDFLE  192

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
             GKPHGRL+S+DP T+ T+VL+ DL+FANGV++ PDQS ++FCET +RRC KYYI G   G
Sbjct  193   GKPHGRLMSFDPTTRTTRVLLRDLYFANGVSMSPDQSHLVFCETTVRRCSKYYING---G  249

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPN  971
              +EVFI++LPG PDNIRYDG+G +WI I    T  ++L  +YP LRK+  +  KYG  P 
Sbjct  250   RVEVFIQDLPGYPDNIRYDGDGHYWIAIPSGVTTLWKLSMKYPFLRKLTVMAAKYGFEPM  309

Query  972   MEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
               +N G+  VD++G P+A Y++R  + ++TG+KIG Y+YCG + +  I+ L+L + PA
Sbjct  310   FAENAGVLQVDLDGKPIALYHDRKISHITTGVKIGRYLYCGSLLHSHIIRLDLLKYPA  367



>ref|XP_002876085.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52344.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   405 bits (1041),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 192/349 (55%), Positives = 264/349 (76%), Gaps = 6/349 (2%)
 Frame = +3

Query  105   VIYQL-DSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGV  281
              +YQL DSFDPAP P   L     ++ P  N + L  +E IGVG L+ PEDI Y  ++G+
Sbjct  23    TLYQLIDSFDPAPLPPDSLFSSPTSIPPLLNDKFLTGAEFIGVGLLNNPEDIAYHKESGL  82

Query  282   IYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTS  461
             IYTGC+DGWVKRV+V++S A DS VEDWVNTGGRPLG+A G+HGEVIVADA+ GLLN++ 
Sbjct  83    IYTGCVDGWVKRVSVHDS-ANDSVVEDWVNTGGRPLGIAFGIHGEVIVADADKGLLNISG  141

Query  462   DGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLS  638
             DGK  +++T EA+GV+ KLTDAV VA++G+LYFTDAS+KY +  FI++FLEGKPHGRL+S
Sbjct  142   DGKKTELLTDEAEGVRLKLTDAVTVADNGVLYFTDASYKYDIHQFIFDFLEGKPHGRLIS  201

Query  639   YDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENL  818
             +DP T+ T+VL+ DL+FANG+++ PDQ+ ++FCETI RRC KYYI  E+   +EV I+ L
Sbjct  202   FDPTTRVTRVLLRDLYFANGISISPDQTHLVFCETIKRRCSKYYISEER---VEVLIQGL  258

Query  819   PGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFV  998
             PG PDNIRYDG+G +WI +  E T  ++L  +YP LRK++ +  KYGV     KN G+  
Sbjct  259   PGFPDNIRYDGDGHYWIALISEVTTPWKLSMKYPFLRKLISMAAKYGVELLFMKNAGVLQ  318

Query  999   VDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
             VD++GNP+A Y++  F+ +++G+KIGN++YCG + + +I  L+L + PA
Sbjct  319   VDLDGNPIALYHDHPFSHITSGVKIGNHLYCGSLLHSYITRLDLLKYPA  367



>ref|XP_006467059.1| PREDICTED: protein YLS2-like [Citrus sinensis]
 gb|KDO71440.1| hypothetical protein CISIN_1g016199mg [Citrus sinensis]
Length=393

 Score =   406 bits (1043),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 200/393 (51%), Positives = 281/393 (72%), Gaps = 13/393 (3%)
 Frame = +3

Query  3     PSGVKKKKNQDKILRTKMSGLWPFAVLV---PVILGVVIYQLDSFDPAPYPAHELTQGSP  173
             P+ + +  + D    +  S LW   V +   PV L +++Y+LDSFDPAP P HE T   P
Sbjct  2     PNSMPESVSADTSSSSSSSRLWLVTVFLTGGPVFLAMLVYKLDSFDPAPIPVHEFTH-PP  60

Query  174   AVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSA  353
               A  RN R+L  SEK+G G L GPED++YD  + +IYTGC DGW+KRVT+N+S  ADS 
Sbjct  61    LTAALRNERMLQGSEKVGYGVLKGPEDLLYDAHSKLIYTGCEDGWIKRVTLNDS-PADSL  119

Query  354   VEDWVNTGGRPLGLAHGLHG------EVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKL  515
             V +W+NTGGRPLG+A            +IVADA  GLL ++ +  V ++T EA+G KFKL
Sbjct  120   VHNWINTGGRPLGIAFANSDPDADRITMIVADAYKGLLKISGNSTV-LLTDEAEGQKFKL  178

Query  516   TDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFAN  695
             TD VDVA+DGM+YFTDAS KY L ++I +  EGKP+GRLLS+DP TK+TKVLV+DL+FAN
Sbjct  179   TDGVDVADDGMIYFTDASNKYYLREYILDIFEGKPNGRLLSFDPVTKETKVLVSDLYFAN  238

Query  696   GVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGI  875
             GV + PDQ+ +++CET MRRC+K+YI+G+  G +E FIE LPG+PDNIRYDGEG + I +
Sbjct  239   GVVLSPDQTHLVYCETSMRRCRKFYIKGKNAGRVEKFIETLPGLPDNIRYDGEGHYLIAL  298

Query  876   GIEYTHAFELIQRYPLLRKILGVMEKY-GVRPNMEKNGGIFVVDMEGNPVAHYYERDFTL  1052
               E++  ++L  RYP +RK+ G++ +Y G+ P  + + G+F+VD++G P+AHYY+ + +L
Sbjct  299   ATEFSTYWDLAYRYPFIRKVSGMVVRYLGMPPMGKSSSGVFIVDLDGKPIAHYYDPEMSL  358

Query  1053  VSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVA  1151
             +S+ IKIG+++YCG V +  IL L++ Q+PA A
Sbjct  359   ISSAIKIGDHLYCGSVHHRGILHLDVNQHPARA  391



>ref|XP_004146168.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cucumis sativus]
Length=392

 Score =   405 bits (1041),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 204/369 (55%), Positives = 263/369 (71%), Gaps = 16/369 (4%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             FA+L      VV+Y+LD FDPA  PA EL+ G PA     NGR+L  +++IGVG L+  E
Sbjct  24    FALLAAA---VVVYKLDPFDPAALPAEELS-GEPASVAACNGRVLQAADRIGVGELAAAE  79

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D  YD + G++YTG  DGW+KRV +N     DS VE W  TGGRPLG+A G  G+V +AD
Sbjct  80    DFAYDSELGLVYTGDGDGWLKRVRLN-----DSTVEKWAFTGGRPLGVALGADGDVFIAD  134

Query  432   AEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
             A+ GLL  + +G V+V+T E DGVKF+LTD VDV EDG +YFTDAS KY    FI++F E
Sbjct  135   ADKGLLKASKEGVVEVLTEEDDGVKFRLTDGVDVGEDGTVYFTDASSKYAFHSFIFDFFE  194

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
             G+P+GR LSY+P TK+TK+LV DL F NGV V P Q FVIFCET +RRC+KYYI G++KG
Sbjct  195   GRPYGRFLSYNPTTKETKLLVGDLHFGNGVVVAPTQDFVIFCETPLRRCRKYYISGDRKG  254

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIG----IGIEYTHA---FELIQRYPLLRKILGVME  950
             S+E F+ENLPG PDNIRYDG+G +WIG    I  E T +   + +  +YP+LRKI+ +ME
Sbjct  255   SVEKFVENLPGTPDNIRYDGDGHYWIGLSTVINFEMTGSSSYWHIALKYPVLRKIMAIME  314

Query  951   KYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             KYG RPN+EKNGG+  V++EG  VA YY+  +TLV+ GIKIGN++Y G +    IL L+L
Sbjct  315   KYGQRPNLEKNGGVVAVNLEGEQVAWYYDYKWTLVTAGIKIGNHLYSGSLALPGILRLDL  374

Query  1131  TQNPAVASG  1157
              + PA A+G
Sbjct  375   DKFPATAAG  383



>ref|NP_190710.1| strictosidine synthase-like 4 [Arabidopsis thaliana]
 sp|Q9SD07.1|SSL4_ARATH RecName: Full=Protein STRICTOSIDINE SYNTHASE-LIKE 4; Short=AtSSL4; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB63006.1| mucin-like protein [Arabidopsis thaliana]
 gb|AAM65345.1| mucin-like protein [Arabidopsis thaliana]
 gb|ABD85165.1| At3g51420 [Arabidopsis thaliana]
 gb|AEE78790.1| strictosidine synthase-like 4 protein [Arabidopsis thaliana]
Length=370

 Score =   404 bits (1038),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/359 (53%), Positives = 265/359 (74%), Gaps = 5/359 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F++  P ++ + +YQLDSF+PA  PA  L     ++ P  N R L  +E IGVG L+ PE
Sbjct  12    FSIFFPCLISITLYQLDSFEPASLPADSLITSPTSIPPLLNDRFLTGAEFIGVGLLNNPE  71

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y   + +IYTGC+DGWVKRV+V++S A DS VEDWVNTGGRPLG+A GLHGEVIVAD
Sbjct  72    DIAYHKDSNLIYTGCVDGWVKRVSVHDS-ANDSIVEDWVNTGGRPLGIAFGLHGEVIVAD  130

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLL+++  GK  +++T EADGV+FKLTDAV VA++G+LYFTDAS KY    FI++FL
Sbjct  131   ANKGLLSISDGGKKTELLTDEADGVRFKLTDAVTVADNGVLYFTDASSKYDFYQFIFDFL  190

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGR++S+DP T+ T+VL+ DL+FANG+++ PDQ+  +FCETIMRRC KYYI  E+ 
Sbjct  191   EGKPHGRVMSFDPTTRATRVLLKDLYFANGISMSPDQTHFVFCETIMRRCSKYYISEER-  249

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +EVFI+ LPG PDNIRYDG+G +WI +  E T +++L  +Y  LRK++ +  KYGV  
Sbjct  250   --VEVFIQGLPGYPDNIRYDGDGHYWIALISEVTTSWKLSMKYLFLRKLIYMAAKYGVEL  307

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                KN  +  VD++GNP+A Y++  F+ +++G+KIGN++Y G + + +I  L+L + PA
Sbjct  308   LSIKNAAVLQVDLDGNPIAMYHDHPFSHITSGVKIGNHLYFGSLLHSYITRLDLLKYPA  366



>ref|XP_006293238.1| hypothetical protein CARUB_v10019569mg [Capsella rubella]
 gb|EOA26136.1| hypothetical protein CARUB_v10019569mg [Capsella rubella]
Length=372

 Score =   404 bits (1038),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/355 (54%), Positives = 262/355 (74%), Gaps = 5/355 (1%)
 Frame = +3

Query  84    VPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVY  263
             +P+++ + +Y+LD+FDPA + A  L   + ++ P  N + L  +E I VG LS PEDI Y
Sbjct  17    LPILVSIALYRLDTFDPAHHTADSLVYSNASIPPLINDKFLSGAEFIVVGLLSSPEDIAY  76

Query  264   DPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIG  443
                +G+IYTGC+DGWVKRV V ES   +S VEDWVNTGGRPLG+A G+HGEVIVADA  G
Sbjct  77    HKDSGLIYTGCVDGWVKRVKVTES-VNESVVEDWVNTGGRPLGIAFGIHGEVIVADANKG  135

Query  444   LLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKP  620
             LLN++ DGK  +++T EA+GV+FKLTDAV V+++G+LYFTDAS+KY L  F ++ LEGKP
Sbjct  136   LLNISGDGKKTELLTDEAEGVRFKLTDAVAVSDNGVLYFTDASYKYSLHQFSFDILEGKP  195

Query  621   HGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIE  800
             HGRL+S+DP T+ T+VL+ DL+FANGV++ PDQ+ +IFCET MRRC KYYI G   G +E
Sbjct  196   HGRLMSFDPTTRVTRVLLRDLYFANGVSMSPDQTHLIFCETPMRRCSKYYING---GRVE  252

Query  801   VFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEK  980
             VFI  LPG PDNIRYDG+G +WI +    T  ++L  +YP LRKI  +  KYG  P   +
Sbjct  253   VFIHGLPGYPDNIRYDGDGHYWIAMPSGVTTLWKLSMKYPFLRKITAIAAKYGYEPMFME  312

Query  981   NGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
             + G+  VD++GNP+A+Y+++  + ++TG+KIGNY+YCG +    I+ L+L + PA
Sbjct  313   DAGVLQVDLDGNPIAYYHDQKLSHITTGVKIGNYLYCGSLLQSHIIRLDLLKYPA  367



>ref|XP_006425309.1| hypothetical protein CICLE_v10025811mg [Citrus clementina]
 gb|ESR38549.1| hypothetical protein CICLE_v10025811mg [Citrus clementina]
Length=390

 Score =   404 bits (1037),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 197/373 (53%), Positives = 273/373 (73%), Gaps = 13/373 (3%)
 Frame = +3

Query  63    LWPFAVLV---PVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVG  233
             LW   V +   PV L +++Y+LDSFDPAP P HE T   P  A  RN R+L  SEK+G G
Sbjct  19    LWLVTVFLTGGPVFLAMLVYKLDSFDPAPIPVHEFTH-PPLTAALRNERMLQGSEKVGYG  77

Query  234   RLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHG  413
              L GPED++YD  + +IYTGC DGW+KRVT+N+S  ADS V +W+NTGGRPLG+A     
Sbjct  78    VLKGPEDLLYDAHSKLIYTGCEDGWIKRVTLNDS-PADSLVHNWINTGGRPLGIAFANSD  136

Query  414   ------EVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWK  575
                    +IVADA  GLL ++ +  V ++T EA+G KFKLTD VDVA+DGM+YFTDAS K
Sbjct  137   PDADRITMIVADAYKGLLKISGNSTV-LLTDEAEGQKFKLTDGVDVADDGMIYFTDASNK  195

Query  576   YGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRR  755
             Y L ++I +  EGKP+GRLLS+DP TK+TKVLV+DL+FANGV + PDQ+ +++CET MRR
Sbjct  196   YYLREYILDIFEGKPNGRLLSFDPVTKETKVLVSDLYFANGVVLSPDQTHLVYCETSMRR  255

Query  756   CKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKI  935
             C+K+YI+G+  G +E FIE LPG+PDNIRYDGEG + I +  E++  ++L  RYP +RK+
Sbjct  256   CRKFYIKGKNAGRVEKFIETLPGLPDNIRYDGEGHYLIALATEFSTYWDLAYRYPFIRKV  315

Query  936   LGVMEKY-GVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGF  1112
              G++ +Y G+ P  + + G+F+VD++G P+AHYY+ + +L+S+ IKIG+++YCG V +  
Sbjct  316   SGMVVRYLGMPPMGKSSSGVFIVDLDGKPIAHYYDPEMSLISSAIKIGDHLYCGSVHHRG  375

Query  1113  ILSLNLTQNPAVA  1151
             IL L++ Q+PA A
Sbjct  376   ILHLDVNQHPARA  388



>ref|XP_008448496.1| PREDICTED: protein YLS2-like [Cucumis melo]
Length=388

 Score =   403 bits (1036),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 198/352 (56%), Positives = 257/352 (73%), Gaps = 9/352 (3%)
 Frame = +3

Query  111   YQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
             Y+LD FDPA  PA EL+ G PA     NGR+L  +E+IGVG L+  ED+ Y  + G++YT
Sbjct  34    YKLDPFDPAALPAEELS-GEPAAVAACNGRVLQGAERIGVGELAAAEDLSYHSELGLVYT  92

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGK  470
             G  DGW+KRV +N     DS VE W  TGGRPLG+A G  G+V +ADA+ GLL  + +G 
Sbjct  93    GDGDGWLKRVRLN-----DSTVEKWAFTGGRPLGVALGPDGDVFIADADKGLLKASKEGV  147

Query  471   VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPH  650
             V+ +T EADGVKF+LTD VDVAEDG +YFTDAS KY    FI++  EG+P+GRLLSY+P 
Sbjct  148   VEALTEEADGVKFRLTDGVDVAEDGTVYFTDASSKYRFHSFIFDIFEGRPYGRLLSYNPV  207

Query  651   TKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMP  830
             TK TK+LV DL+F NGVAV P Q FVIFCET +RRC+KYYI G++KGS+E F+ENLPG P
Sbjct  208   TKITKLLVGDLYFGNGVAVAPTQDFVIFCETPLRRCRKYYISGDRKGSVERFVENLPGTP  267

Query  831   DNIRYDGEGLFWIGIGIEYT---HAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVV  1001
             DNIRYDG G +WIG+  E T    ++ +  +YP+LRKI+ +MEKYG RPN+EKNGG+  V
Sbjct  268   DNIRYDGHGHYWIGLSTEMTGSSSSWHIALKYPMLRKIMAIMEKYGRRPNLEKNGGVVAV  327

Query  1002  DMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVASG  1157
             +++G  VA YY+  ++LV+ GIKIGN++Y G +    IL L+L + PA A+G
Sbjct  328   NLQGEQVAWYYDYKWSLVTAGIKIGNHLYSGSLALPGILRLDLDKFPATATG  379



>ref|XP_009149019.1| PREDICTED: protein YLS2-like [Brassica rapa]
Length=371

 Score =   401 bits (1030),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 193/362 (53%), Positives = 265/362 (73%), Gaps = 5/362 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F+ ++P I  + +Y+LD+FDP+  PA  L   + ++ P  N +LL  +E IGVG L+ PE
Sbjct  13    FSTIIPFIASITLYRLDTFDPSHLPADALVYSTTSIPPLVNDQLLTGAEFIGVGLLNKPE  72

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI YD  +G+IYTGC+DGWVKRV   ES   DS VEDWVNTGGRPLGLA GLHGEVIVAD
Sbjct  73    DIAYDRDSGLIYTGCLDGWVKRVKALES-CNDSVVEDWVNTGGRPLGLAFGLHGEVIVAD  131

Query  432   AEIGLLNVTSDG-KVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DG K +++T EA+GV+FKLTDAV V ++G+LYFTDAS+KY      ++FL
Sbjct  132   AYKGLLNISDDGRKTELLTDEAEGVRFKLTDAVAVGDNGVLYFTDASYKYDYSQASFDFL  191

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRL+S++P T+ T+VL+ DL+FANG+++ PDQ+ +IFCET +RRC KYYI  E+ 
Sbjct  192   EGKPHGRLMSFNPTTRTTRVLLKDLYFANGISMSPDQTHLIFCETPVRRCSKYYINEER-  250

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +EVFI++LPG PDNIRYDG+G +WI I    T  ++L  RYPLLRK+  ++ K+G   
Sbjct  251   --VEVFIQSLPGYPDNIRYDGDGHYWIAIPKGVTTLWKLSMRYPLLRKVTAMVAKWGFNL  308

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAV  1148
                ++ G+  VD++GNP+A Y++   + ++TG+KIG Y+YCG + +  IL L+L + PA 
Sbjct  309   MFAEDAGVLQVDLDGNPIAFYHDHKISHLTTGVKIGKYLYCGSLLHSRILRLDLLKYPAQ  368

Query  1149  AS  1154
              S
Sbjct  369   KS  370



>emb|CDY33279.1| BnaA01g19460D [Brassica napus]
Length=371

 Score =   400 bits (1027),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 193/362 (53%), Positives = 264/362 (73%), Gaps = 5/362 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F+ ++P I  + +Y+LD+FDP+  PA  L   + ++ P  N +LL  +E IGVG L+ PE
Sbjct  13    FSTIIPFIASITLYRLDTFDPSHLPADALVYSTTSIPPLVNDQLLTGAEFIGVGLLNKPE  72

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI YD  +G+IYTGC+DGWVKRV   ES   DS VEDWVNTGGRPLGLA GLHGEVIVAD
Sbjct  73    DIAYDRDSGLIYTGCIDGWVKRVKALES-CHDSVVEDWVNTGGRPLGLAFGLHGEVIVAD  131

Query  432   AEIGLLNVTSDG-KVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DG K +++T EA+GV+FKLTDAV V ++G+LYFTDAS+KY      ++FL
Sbjct  132   AYKGLLNISDDGRKTELLTDEAEGVRFKLTDAVAVGDNGVLYFTDASYKYDYSQASFDFL  191

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRL+S++P T+ T+VL+ DL+FANG+++ PDQ+ +IFCET +RRC KYYI  E+ 
Sbjct  192   EGKPHGRLMSFNPTTRTTRVLLKDLYFANGISMSPDQTHLIFCETPVRRCSKYYINEER-  250

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +EVFI+ LPG PDNIRYDG+G +WI I    T  ++L  RYPLLRK+  ++ K+G   
Sbjct  251   --VEVFIQGLPGYPDNIRYDGDGHYWIAIPKGVTTLWKLSMRYPLLRKVTAMVAKWGFNL  308

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAV  1148
                ++ G+  VD++GNP+A Y++   + ++TG+KIG Y+YCG + +  IL L+L + PA 
Sbjct  309   MFAEDAGVLQVDLDGNPIAFYHDHKISHLTTGVKIGKYLYCGSLLHSRILRLDLLKYPAQ  368

Query  1149  AS  1154
              S
Sbjct  369   KS  370



>gb|KCW53263.1| hypothetical protein EUGRSUZ_J02524 [Eucalyptus grandis]
Length=317

 Score =   397 bits (1021),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/316 (60%), Positives = 239/316 (76%), Gaps = 3/316 (1%)
 Frame = +3

Query  189   RNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWV  368
             +NGR+L  +E +G G++ GPED+ +DP +G+IY GC DGWVKRV V ES A D+ VEDWV
Sbjct  2     QNGRVLGSAEMVGAGQVVGPEDVEHDPASGIIYVGCADGWVKRVKVGES-AGDAVVEDWV  60

Query  369   NTGGRPLGLAHGLHGEVIVADAEIGLLNVT--SDGKVQVMTAEADGVKFKLTDAVDVAED  542
             NTGGRPLGLA G  GE+IV DA  GLLN++    G V+++T EA+GVKFKLTDAV VA D
Sbjct  61    NTGGRPLGLALGRDGELIVCDAYKGLLNMSMSKHGTVELLTDEAEGVKFKLTDAVAVATD  120

Query  543   GMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQS  722
             G +YFTDAS+KY   +FIW+ LEG+PHGRLLSYDP TK+T+VL  DL+F NG+A+ P+QS
Sbjct  121   GTIYFTDASYKYTFGEFIWDILEGRPHGRLLSYDPATKETQVLAQDLYFPNGIALSPNQS  180

Query  723   FVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFE  902
             FVIFCET+MRRCK+YYI GE+KG I+ FI  LPG  DNIRYDGEG +WI +    +   +
Sbjct  181   FVIFCETVMRRCKRYYINGERKGHIDTFIGGLPGYSDNIRYDGEGHYWIALASGTSVTGD  240

Query  903   LIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNY  1082
             L  +YP +RK   ++E+   RP MEKNGG+F VD EG PVAHYY+   +L+S+G KIG+Y
Sbjct  241   LAFKYPFIRKAAAILERLNRRPAMEKNGGVFQVDSEGKPVAHYYDPQLSLISSGNKIGDY  300

Query  1083  MYCGFVKYGFILSLNL  1130
             +YCG + Y  IL L L
Sbjct  301   LYCGSLHYPHILRLKL  316



>ref|XP_009115831.1| PREDICTED: protein YLS2-like [Brassica rapa]
Length=372

 Score =   396 bits (1017),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/360 (53%), Positives = 261/360 (73%), Gaps = 6/360 (2%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F+ ++P +  + +Y+LD+FDPA  P + L   + ++ P  N +LL  +E IGVG L+ PE
Sbjct  13    FSTVIPFLASIALYRLDTFDPALLPPNALDYSTTSLPPLSNDKLLTGAELIGVGLLNSPE  72

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y  ++ +IYTGC+DGWVKRV V ES   DS VEDWVNTGGRPLG+A GLHGEVIVAD
Sbjct  73    DIAYHRESNLIYTGCVDGWVKRVKVTES-VNDSVVEDWVNTGGRPLGVAFGLHGEVIVAD  131

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DGK  +++T EADGVKFKL DAV VA++G+LYFTDAS+KY +  F ++ L
Sbjct  132   AYKGLLNISGDGKKTELLTDEADGVKFKLADAVAVADNGVLYFTDASYKYNMRQFAFDIL  191

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRL+S+DP T+ T+VL+ DL+FANGV++ PDQ+ +IFCET MRRC KYYI  E+ 
Sbjct  192   EGKPHGRLMSFDPTTRTTRVLLKDLYFANGVSMSPDQTHLIFCETPMRRCSKYYINEER-  250

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +EVF + LPG PDNIR+DGEG +WI +    T  ++L  RYP LRK+  +   YG+ P
Sbjct  251   --VEVFTQGLPGYPDNIRFDGEGHYWIAMPSGVTVLWKLAFRYPFLRKLTAIAANYGLDP  308

Query  969   NM-EKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
              +   N G+  VD++G P+A Y++   + ++TG+KIG Y+YCG + +  I+ L+L + PA
Sbjct  309   LIFMANAGVLGVDLDGKPIALYHDHKLSHMTTGVKIGRYLYCGSLLHSHIVRLDLLKCPA  368



>gb|EPS58715.1| hypothetical protein M569_16097, partial [Genlisea aurea]
Length=328

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 195/356 (55%), Positives = 248/356 (70%), Gaps = 30/356 (8%)
 Frame = +3

Query  87    PVILGVVIYQLDSFDPAPYPAHELTQ-GSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVY  263
             PV+  V+IY++D   P  YP HEL +   P   PK N R+L  +EKIG G+L  PEDI  
Sbjct  1     PVLAAVLIYRIDELHPVSYPEHELIRYDEPLFIPKHNSRMLRGAEKIGYGQLPAPEDIAL  60

Query  264   DPKTGVIYTGCMDGWVKRVTVNES-SAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEI  440
             DP+TGVIYTGC DGW+ RVT+ ++ SAA + VE W+NTGGRPLG+AHGL+GEV+V DA  
Sbjct  61    DPQTGVIYTGCEDGWINRVTLKQNDSAAGAVVEKWINTGGRPLGIAHGLNGEVLVCDAIK  120

Query  441   GLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKP  620
             GLLN++ DG + ++T EA+G+KFKLT+AVDVA DG +YFTDAS  + L++ I + LEGKP
Sbjct  121   GLLNISKDGVIDLLTDEAEGIKFKLTNAVDVAPDGTVYFTDASHSHSLQNHILDLLEGKP  180

Query  621   HGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIE  800
             +GR LSY+P TKQTKVLV DLFFANGVAV PD +FVIFCET+MRRCK+YYI G +KGS +
Sbjct  181   NGRFLSYNPSTKQTKVLVKDLFFANGVAVSPDHTFVIFCETVMRRCKRYYIDGPRKGSTD  240

Query  801   VFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEK  980
              F+ENLPG+PDN+RYDGEG +WI +G E    + ++QRYP LRK+ G+  KY     +E+
Sbjct  241   TFVENLPGLPDNVRYDGEGRYWIALGTE-AGPWVVMQRYPALRKVAGIARKYAKWIKVER  299

Query  981   NGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAV  1148
             NGG          VAH                  +YCG V   +I+ LNLT  PA 
Sbjct  300   NGGA---------VAH------------------LYCGCVHLPYIVRLNLTAYPAT  328



>ref|XP_004509420.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
isoform X1 [Cicer arietinum]
Length=371

 Score =   393 bits (1009),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 268/370 (72%), Gaps = 4/370 (1%)
 Frame = +3

Query  45    RTKMSGLWPFAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKI  224
             RT++  L+   VL  VI   V+Y+LD F+P   P +E+ + + A AP RN  +   SE +
Sbjct  5     RTRLLTLFLTIVLPVVIAAAVLYRLDPFEPVHLPVNEINRATLA-APLRNNHMRLGSETL  63

Query  225   GVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHG  404
               G+++GPED++YD   GV+YTGC DGW+KRVT+NES   DS VE+WVNTGGRPLGLA  
Sbjct  64    AKGKVAGPEDLLYDATLGVVYTGCEDGWIKRVTLNES-VDDSVVENWVNTGGRPLGLAFY  122

Query  405   LHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGL  584
              +G++IVADA++GLL +T + +++V+  E +G+KFKLTD VDVA DG +YFTDAS+KY +
Sbjct  123   GNGDLIVADADLGLLRITREKEIEVLVNEIEGLKFKLTDGVDVANDGTIYFTDASYKYSV  182

Query  585   EDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKK  764
             +D I + LEG P+GR LSY+P TK+T +L+  L+F NGVAV PDQ FV+FCET++  CKK
Sbjct  183   KDSILDILEGNPNGRFLSYNPTTKKTTLLLTHLYFPNGVAVSPDQQFVVFCETVLMNCKK  242

Query  765   YYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGV  944
             YYI+G+K+GSIE F + LPGMPDNI YDG GLFWIGI    T   +L+ RYP++RK L +
Sbjct  243   YYIKGQKRGSIEKFCD-LPGMPDNIHYDGHGLFWIGIATGITPEMDLMLRYPIIRKTLAI  301

Query  945   MEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSL  1124
             + K     N+ K GG+  VD+EG P+ HYY+   +L + GIKIGN++YCG + Y +++ L
Sbjct  302   VTKKVPSLNLSKKGGVITVDLEGKPITHYYDPKLSL-TIGIKIGNHIYCGSILYPYLIRL  360

Query  1125  NLTQNPAVAS  1154
             N+ Q PA+ +
Sbjct  361   NIEQYPALPT  370



>emb|CAB63007.1| mucin-like protein [Arabidopsis thaliana]
Length=367

 Score =   392 bits (1006),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/359 (53%), Positives = 263/359 (73%), Gaps = 9/359 (3%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F  +VP+++ + +YQLD+FDPAP P+      + ++ P  + + L  +E IGVG L  PE
Sbjct  12    FFTIVPLLVSIALYQLDTFDPAPVPSEAYASSTTSIPPLISDKYLTGAEFIGVGLLDKPE  71

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y   + +IYTGC+DGWVKRV+V++S A DS VEDWVNTGGRPLG+A G+HGEVIVAD
Sbjct  72    DIAYHQDSNLIYTGCIDGWVKRVSVHDS-ANDSVVEDWVNTGGRPLGIAFGVHGEVIVAD  130

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DGK  +++T +A+GVKFKLTD V VA++G+LYFTDAS+KY L    ++ L
Sbjct  131   AYKGLLNISGDGKKTELLTDQAEGVKFKLTDVVAVADNGVLYFTDASYKYTLHQVKFDIL  190

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRL+S+DP T+ T+VL+ DL+FANGV++ PDQ+ +IFCET +    KYYI  E+ 
Sbjct  191   EGKPHGRLMSFDPTTRVTRVLLKDLYFANGVSMSPDQTHLIFCETPI----KYYINEER-  245

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +EVFI+ LPG PDNIRYDG+G +WI +    +  + L  +YP LRKI  +  KYGV  
Sbjct  246   --VEVFIQGLPGYPDNIRYDGDGHYWIAMVSGASTLWRLSMKYPFLRKITAIAAKYGVEL  303

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                KN G+  VD++GNP+A+Y+++  + ++TGIKIGNY+YCG + + +I+ L+L + PA
Sbjct  304   MFMKNAGVLQVDLDGNPIAYYHDQRLSHITTGIKIGNYLYCGNILHSYIIRLDLLKYPA  362



>ref|XP_010682996.1| PREDICTED: protein YLS2-like [Beta vulgaris subsp. vulgaris]
Length=387

 Score =   391 bits (1005),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/356 (50%), Positives = 266/356 (75%), Gaps = 6/356 (2%)
 Frame = +3

Query  81    LVPVILGVVI--YQLDSFDPAPYPAHELT--QGSPAVAPKRNGRLLHDSEKIGVGRLSGP  248
             L+P++L VV+  +Q+++FDPAP+P HE T  + +P  AP+ N R+L  SE IG  +L GP
Sbjct  31    LLPILLAVVVLLFQVNTFDPAPFPVHEFTNQRAAPITAPETNSRILWKSEFIGSRQLLGP  90

Query  249   EDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHG-EVIV  425
             EDI Y+PK+G+IYTGC+DGW+KRV + +S  ++S VEDWVNTGGRPLG+A    G E++V
Sbjct  91    EDIAYEPKSGIIYTGCVDGWIKRVKLGDS-VSESVVEDWVNTGGRPLGIAIATSGDELVV  149

Query  426   ADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEF  605
             ADA  GLL +T + ++Q++T EA+G KFK TD VD+A+DG +YFTDAS+KYG +D++ + 
Sbjct  150   ADALKGLLKITKNKEIQLLTDEAEGQKFKFTDGVDIAKDGTIYFTDASYKYGFQDYLLDI  209

Query  606   LEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEK  785
             LE +P+GRLLS+DP+TK+TKVL++DL+F NGV + PDQ+ +IFCET M+RC+ Y+IRG +
Sbjct  210   LEARPYGRLLSFDPNTKETKVLLHDLYFPNGVVISPDQNSLIFCETPMKRCRTYWIRGNR  269

Query  786   KGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVR  965
             KG+++ FI+NLPG PDNI  DG+  +WI I    +   E   ++ L+RK + ++++Y   
Sbjct  270   KGAVDSFIDNLPGYPDNIHSDGKTKYWIAISSSLSPYLEQANKFRLVRKAMSMVDRYIGL  329

Query  966   PNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLT  1133
              ++++NGGI  VD+EGN   H Y+R  +L+S+GI+I +++Y G + Y  I+  NL+
Sbjct  330   HHIQRNGGILGVDLEGNATLHVYDRAMSLISSGIQIQDHLYIGSLHYAHIIRFNLS  385



>ref|XP_010266134.1| PREDICTED: protein YLS2-like [Nelumbo nucifera]
Length=384

 Score =   391 bits (1004),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 183/348 (53%), Positives = 259/348 (74%), Gaps = 2/348 (1%)
 Frame = +3

Query  111   YQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
             Y++D FDPAP P H L++ +  V PK N R+L  +E++G G L GPED+ YD ++G+IYT
Sbjct  38    YRVDEFDPAPLPDHGLSRVTVEV-PKHNNRVLDAAERVGDGLLHGPEDLAYDAESGIIYT  96

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGK  470
             GC DGW+K+VTV +S A  + VE+WV  GGRPLGLA G   ++IVA++  GLL V  +G 
Sbjct  97    GCSDGWIKQVTVKDS-AEQTRVENWVYVGGRPLGLAFGPDKQLIVAESYKGLLKVNREGL  155

Query  471   VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPH  650
             V+++T EADGVKF+LTD VDVA DGM+YFTDAS+KY L+  + + LEG+P+GRL+S+DP 
Sbjct  156   VELLTDEADGVKFRLTDGVDVANDGMIYFTDASYKYDLDHHMLDILEGRPYGRLMSFDPS  215

Query  651   TKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMP  830
             T QT++LV  L+FANGVA+ PDQSF++FCET  RRC KY+I+GE+KGS++ FI+NLPG P
Sbjct  216   TNQTQILVRHLYFANGVALSPDQSFLVFCETPRRRCSKYHIKGERKGSVDNFIDNLPGFP  275

Query  831   DNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDME  1010
             DNIRYDG+G FWI +    T +++++ RYP +RK + ++ KY   PN++++GG+  V++E
Sbjct  276   DNIRYDGDGHFWIALPSAKTLSWDVVLRYPYVRKTMAILSKYMHLPNIQRDGGVLAVNLE  335

Query  1011  GNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVAS  1154
             G  VA Y +   ++VS G+KIG Y+Y G ++      +NLT++ A AS
Sbjct  336   GKAVALYSDPSLSMVSGGLKIGKYLYYGNLENAHFTRINLTRHAASAS  383



>ref|NP_190713.1| strictosidine synthase family protein [Arabidopsis thaliana]
 sp|Q9SD04.1|SSL7_ARATH RecName: Full=Protein STRICTOSIDINE SYNTHASE-LIKE 7; Short=AtSSL7; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB63009.1| mucin-like protein [Arabidopsis thaliana]
 gb|AAL77683.1| AT3g51450/F26O13_90 [Arabidopsis thaliana]
 gb|AAM65404.1| mucin-like protein [Arabidopsis thaliana]
 gb|AAN28865.1| At3g51450/F26O13_90 [Arabidopsis thaliana]
 dbj|BAD43008.1| mucin -like protein [Arabidopsis thaliana]
 dbj|BAD43327.1| mucin -like protein [Arabidopsis thaliana]
 gb|AEE78794.1| strictosidine synthase family protein [Arabidopsis thaliana]
Length=371

 Score =   390 bits (1002),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 187/359 (52%), Positives = 257/359 (72%), Gaps = 5/359 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
              +++VP+++ + +Y+LD+FDPA  P+   T  + ++ P  N   L  +E IGVG L+ PE
Sbjct  12    LSIIVPLLISIALYKLDTFDPAIVPSDAFTSSATSLPPLINDEFLTGAEFIGVGLLNIPE  71

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y  ++ +IYTGC+DGWVKRV V +S   DS VEDWVNTGGRPLG+A G+HGEVIVAD
Sbjct  72    DIAYHKESNLIYTGCVDGWVKRVKVADS-VNDSVVEDWVNTGGRPLGIAFGIHGEVIVAD  130

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
                GLLN++ DGK  +++T EADGVKFKLTDAV VA++G+LYFTDAS+KY L     + L
Sbjct  131   VHKGLLNISGDGKKTELLTDEADGVKFKLTDAVTVADNGVLYFTDASYKYTLNQLSLDML  190

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKP GRLLS+DP T+ TKVL+ DL+FANG+ + PDQ+ +IFCET M+RC KYYI  E+ 
Sbjct  191   EGKPFGRLLSFDPTTRVTKVLLKDLYFANGITISPDQTHLIFCETPMKRCSKYYISEER-  249

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +EVF ++LPG PDNIRYDG+G +WI +    T  + +  +YP LRK+  ++ KYGV  
Sbjct  250   --VEVFTQSLPGYPDNIRYDGDGHYWIALPSGVTTLWNISLKYPFLRKLTAMVAKYGVDL  307

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                +N G+  VD++GNP+A+Y++   + ++T  KIG Y+YCG +    IL L+L + PA
Sbjct  308   MFMENAGVLQVDLDGNPIAYYHDPKLSHIATCDKIGKYLYCGSLSQSHILRLDLLKYPA  366



>emb|CDX73720.1| BnaC08g22830D [Brassica napus]
Length=372

 Score =   389 bits (1000),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 190/360 (53%), Positives = 256/360 (71%), Gaps = 6/360 (2%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F+ ++P +  + +Y+LD+FDPA  P   L   + ++    N +LL  +E IGVG L+ PE
Sbjct  13    FSTIIPFLASIALYRLDTFDPALLPPKALDYSTISLPSLVNDKLLTGAELIGVGLLNSPE  72

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y  ++  IYTGC+DGWVKRV V ES   DS VEDWVNT GRPLG+A GLHGEVIVAD
Sbjct  73    DIAYHRESNFIYTGCVDGWVKRVKVTES-LTDSVVEDWVNTDGRPLGVAFGLHGEVIVAD  131

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DGK  +++T  ADGVKFKL DAV VA++G+LYFTDAS+KY +  F ++ L
Sbjct  132   AYKGLLNISGDGKKTELLTDAADGVKFKLADAVAVADNGVLYFTDASYKYNMRQFAFDIL  191

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EG+PHGRL+S+DP T+ T+VL+ DL+FANGV++ PDQ+ +IFCET MRRC KYYI  E+ 
Sbjct  192   EGRPHGRLMSFDPTTRTTRVLLKDLYFANGVSMSPDQTHLIFCETPMRRCSKYYINEER-  250

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +EVFI+ LPG PDNIRYDGEG +WI +    T  ++L  RYP LRK+  +   YG+ P
Sbjct  251   --VEVFIQGLPGYPDNIRYDGEGHYWIAMPSGVTVLWKLAFRYPFLRKLTAIAANYGLDP  308

Query  969   NM-EKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
              +   N G+  VD+EG P+A Y++   + ++TG+KIG Y+YCG + +  I  L+L + PA
Sbjct  309   MIFMANAGVLGVDLEGKPIALYHDHKLSHMTTGVKIGRYLYCGSLLHSHIARLDLLKYPA  368



>gb|KCW53262.1| hypothetical protein EUGRSUZ_J02522 [Eucalyptus grandis]
Length=304

 Score =   385 bits (990),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 182/303 (60%), Positives = 232/303 (77%), Gaps = 1/303 (0%)
 Frame = +3

Query  222   IGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAH  401
             +G GR+ GPED+ +DP +GVIY GC DGWVKR+ V   SA  +AVEDWVN GGRPLGLA 
Sbjct  2     VGAGRVVGPEDVEHDPASGVIYVGCADGWVKRIKVG-GSAGYAAVEDWVNIGGRPLGLAL  60

Query  402   GLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYG  581
             G  GE+IV DA  GLLNV+  G V+++T EA GVKFKLTDAV VA DG +YFTDAS+KY 
Sbjct  61    GRDGELIVCDAYKGLLNVSKHGTVELLTDEAKGVKFKLTDAVAVATDGTIYFTDASYKYT  120

Query  582   LEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCK  761
             + +FIW+ LEG+P+GR LSYDP TK+TKVL  DL+F NGVA+ P+QSFVIFCET+MRRCK
Sbjct  121   VGEFIWDILEGRPYGRFLSYDPATKETKVLARDLYFPNGVALSPNQSFVIFCETVMRRCK  180

Query  762   KYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILG  941
             +YYI GE+KG I+ FI+ LPG PDNIRYDG+G +WI +    + +++L  +YP +RK   
Sbjct  181   RYYINGEQKGHIDTFIDGLPGYPDNIRYDGQGHYWIALASGTSVSWDLAFKYPFIRKAAV  240

Query  942   VMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILS  1121
             ++E+   RP MEKNGG+F V+ EG PVAHYY+   +L+++G KIG+Y+YCG + Y  IL 
Sbjct  241   ILERLNRRPAMEKNGGVFQVNSEGKPVAHYYDPQLSLITSGNKIGDYLYCGSLHYPHILR  300

Query  1122  LNL  1130
             L L
Sbjct  301   LKL  303



>ref|XP_010683361.1| PREDICTED: protein YLS2-like [Beta vulgaris subsp. vulgaris]
Length=367

 Score =   385 bits (988),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 188/361 (52%), Positives = 253/361 (70%), Gaps = 6/361 (2%)
 Frame = +3

Query  63    LWPFAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLS  242
             ++ +    P +L V++YQLD  + A  P HELT+    VA + N +LL  +E IGVG+L 
Sbjct  12    IFSYCPSTPRLLAVLLYQLDPLELAQLPLHELTEPQ-KVARRVNSKLLEGAEFIGVGKLV  70

Query  243   GPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVI  422
             G ED  YDPK+ +IYT C DGW+KRV VN     +S VEDWV  GGRPLGLA GL+ E+I
Sbjct  71    GAEDFAYDPKSQLIYTSCADGWIKRVMVN-----NSVVEDWVYVGGRPLGLALGLNNELI  125

Query  423   VADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWE  602
             VAD   GLLNV++ GKV+V+T E +G K K  D +DVA+DGM+YF++AS+KY L DFI++
Sbjct  126   VADPFKGLLNVSAKGKVEVLTDEIEGRKLKFADGIDVAKDGMIYFSEASYKYSLLDFIFD  185

Query  603   FLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGE  782
               EGKPHG L+S+DP T++TK+LV DL+F NGV +  DQ  +IFCET+MRRCK+Y   GE
Sbjct  186   IFEGKPHGSLMSFDPITRETKILVRDLYFPNGVQMSADQKSIIFCETLMRRCKRYIREGE  245

Query  783   KKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGV  962
              +GS E F++NLP +PDNIRYD EG +WIG        +++  +YP +RK L ++ +Y  
Sbjct  246   MQGSSESFVDNLPSIPDNIRYDEEGYYWIGTSTSLKPYWDIALKYPSIRKGLAIITRYVG  305

Query  963   RPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNP  1142
             RP+MEKNGG+F VD+EG  VAHYY+   +LV+   KIGNY+Y G + Y  I+ L+L  + 
Sbjct  306   RPHMEKNGGVFGVDLEGRLVAHYYDPKLSLVTGANKIGNYLYVGSLHYPHIIRLDLALHD  365

Query  1143  A  1145
             A
Sbjct  366   A  366



>gb|AET03659.2| strictosidine synthase family protein [Medicago truncatula]
Length=375

 Score =   385 bits (988),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 192/380 (51%), Positives = 262/380 (69%), Gaps = 10/380 (3%)
 Frame = +3

Query  21    KKNQDKILRTKMSGLWPF-AVLVPVILG-VVIYQLDSFDPAPYPAHELTQGSPAVAPKRN  194
             K N +   +T+ S   PF A+++PVI+   V+Y+LD  +P  +P  ++ + +  V P  N
Sbjct  3     KSNTNTRTQTRASLFTPFIAIILPVIIASAVLYRLDPLEPVHFPLDKINRSAITV-PLLN  61

Query  195   GRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNT  374
               +   SEK   G++ GPED+VYD   GV+YTGC DGW+KR+TVNES      VEDWVNT
Sbjct  62    KNMRLGSEKAAEGQVLGPEDLVYDAALGVVYTGCEDGWIKRITVNES-----VVEDWVNT  116

Query  375   GGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLY  554
             GGRPLGLA   +G++IVADA  GLL VT + +++V+  E DG+KFK+ D VDVA DG +Y
Sbjct  117   GGRPLGLAFDGNGDLIVADAYKGLLRVTREKEIEVLVTEIDGLKFKVIDGVDVAHDGTIY  176

Query  555   FTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIF  734
             FT+AS KY  +D + + LEG P+GR  SY+P TK+T +LV DL+ ANGVAV PDQ+FV+F
Sbjct  177   FTEASSKYSYKDSVLDILEGNPNGRFFSYNPATKKTTLLVRDLYIANGVAVSPDQNFVVF  236

Query  735   CETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQR  914
             CET M  CKKYYI G KKGS E F + LPGMPDNI YDG+G +WIGI   ++   +LI +
Sbjct  237   CETSMMNCKKYYIGGTKKGSTEKFCD-LPGMPDNIHYDGQGQYWIGIATAFSPELDLIFK  295

Query  915   YPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCG  1094
             YP +RK+L ++ K  +  N  KNGG+ +VD+EG P  HYY+   +L + GIKIGN++YCG
Sbjct  296   YPFIRKVLAIIIKKVLSLNFSKNGGVIIVDLEGKPTTHYYDPKLSL-TGGIKIGNHLYCG  354

Query  1095  FVKYGFILSLNLTQNPAVAS  1154
              + Y FI  L++ + PA+ +
Sbjct  355   SILYPFITRLDIEKYPALPT  374



>ref|XP_003629186.1| Adipocyte plasma membrane-associated protein [Medicago truncatula]
 gb|AET03662.1| adipocyte plasma membrane-associated-like protein [Medicago truncatula]
Length=375

 Score =   384 bits (987),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 190/380 (50%), Positives = 262/380 (69%), Gaps = 10/380 (3%)
 Frame = +3

Query  21    KKNQDKILRTKMSGLWPF-AVLVPVILG-VVIYQLDSFDPAPYPAHELTQGSPAVAPKRN  194
             + N D   +T+ S   PF A+++PVI+   V Y+LD F+P  +P  + T+ S   AP RN
Sbjct  3     ESNTDTRTQTRTSLFTPFIAIILPVIIASAVFYRLDPFEPVVFPLEKQTR-STITAPLRN  61

Query  195   GRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNT  374
               +   SE +  G L GPED+VYD   G++YTGC DGW+KR++VN      S VEDW+NT
Sbjct  62    NNMRLGSENVADGELFGPEDLVYDADKGLMYTGCEDGWIKRISVN-----GSVVEDWINT  116

Query  375   GGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLY  554
             GGRPLGLA   +G++I+ADA+ GLL VT + +++V+  E DG+KFKLTD VDVA DG +Y
Sbjct  117   GGRPLGLAFDGNGQLIIADADKGLLRVTREKEIEVLVTEIDGLKFKLTDGVDVAHDGTIY  176

Query  555   FTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIF  734
             FTDAS KY ++D + + LEGKP+GR LSY+P TK+T +LV+DL+F NGVAV PDQ+FV+F
Sbjct  177   FTDASSKYSIKDSVLDILEGKPNGRFLSYNPATKKTTLLVSDLYFPNGVAVSPDQNFVVF  236

Query  735   CETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQR  914
             CET M  CKKYYI G KKGS E F + LPGMPDNI YDG+G +WIGI   ++   +++ +
Sbjct  237   CETSMMNCKKYYIHGSKKGSTEKFCD-LPGMPDNIHYDGQGQYWIGIATAFSPELDIMLK  295

Query  915   YPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCG  1094
             YP +RK L ++ K     N+ KNGG+  VD+EG P  HY +   +L   GIKIG ++Y G
Sbjct  296   YPFIRKALAIIIKKVSSLNLTKNGGLISVDLEGKPTTHYNDPKLSLTG-GIKIGKHLYGG  354

Query  1095  FVKYGFILSLNLTQNPAVAS  1154
              + Y F++ L++ + PA+ +
Sbjct  355   SILYPFVIRLDIEKYPALPT  374



>emb|CDY33280.1| BnaA01g19470D [Brassica napus]
Length=370

 Score =   384 bits (986),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 186/357 (52%), Positives = 256/357 (72%), Gaps = 5/357 (1%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
              +V ++  +V+Y+ D+FDPAP P+  L   + ++ P  N + L  +E IG G L+ PEDI
Sbjct  14    AIVALLASIVLYRFDTFDPAPLPSDALVYSTDSIPPLINNQFLIGAEFIGAGLLNSPEDI  73

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              Y   +G+IYTGC+DGWVKRV   ES A DS VEDWVNTG RPLGLA GLHGEVIVADA 
Sbjct  74    AYHRDSGLIYTGCVDGWVKRVQAFES-ANDSVVEDWVNTGSRPLGLAFGLHGEVIVADAY  132

Query  438   IGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEG  614
              GLLN++ DGK  +++T EA+GVKFKLTDAV V ++G+LYFTDAS+KY L  F ++  EG
Sbjct  133   KGLLNISDDGKKTELLTDEAEGVKFKLTDAVAVRDNGVLYFTDASYKYNLHHFAFDIWEG  192

Query  615   KPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGS  794
             KPHGRL+S+DP T+ T+VL+ D +F+NGV++ PDQ+ ++FCET +RRC KYYI  E+   
Sbjct  193   KPHGRLMSFDPITRTTRVLLRDRYFSNGVSMSPDQTHLVFCETPLRRCSKYYINEER---  249

Query  795   IEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNM  974
             +EVFIE+LPG PDNIRYDG+G +WI +    T  ++L  RYP +RK+  +  KYG    +
Sbjct  250   VEVFIESLPGYPDNIRYDGDGHYWIAMPSGVTTLWKLSFRYPFIRKLQALAAKYGFNTMI  309

Query  975   EKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
              +N G+  VD++G P+A Y++   + V++G+KIG Y+YCG +    I+ L+L + PA
Sbjct  310   MENAGVLQVDLDGKPIALYHDPKHSHVTSGVKIGKYLYCGSLLDSHIVRLDLLKYPA  366



>emb|CDY16307.1| BnaC01g23420D [Brassica napus]
Length=370

 Score =   384 bits (985),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 256/357 (72%), Gaps = 5/357 (1%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
              ++ ++  +V+Y+ D+FDPAP P+  L   + ++ P  N + L  +E IG G L+ PEDI
Sbjct  14    AIIALLASIVLYRFDTFDPAPLPSDALVYSTDSIPPLINNQFLTGAEFIGAGLLNSPEDI  73

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              Y   +G+IYTGC+DGWVKRV   ES A DS VEDWVNTGGRPLGLA GLHGEVIVADA 
Sbjct  74    AYHRDSGLIYTGCVDGWVKRVKAFES-ANDSVVEDWVNTGGRPLGLAFGLHGEVIVADAY  132

Query  438   IGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEG  614
              GLLN++ DGK  +++T EA+GVKFKLTDAV V ++G+LYFTDAS+KY L  F ++  EG
Sbjct  133   KGLLNISDDGKKTELLTDEAEGVKFKLTDAVAVRDNGILYFTDASYKYNLHHFAFDIWEG  192

Query  615   KPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGS  794
             KPHGRL+S+DP T+ T+VL+ D +F+NGV++ PDQ+ ++FCET +RRC KYYI  E+   
Sbjct  193   KPHGRLMSFDPITRTTRVLLRDRYFSNGVSMSPDQTHLVFCETPLRRCSKYYINEER---  249

Query  795   IEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNM  974
             +EVFI++LPG PDNIRYDG+G +WI +    T  ++L  RYP +RK+  +  KYG    +
Sbjct  250   VEVFIQSLPGYPDNIRYDGDGHYWIAMPSGVTTLWKLSFRYPFIRKLQALAAKYGFNTMI  309

Query  975   EKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
              +N G   VD++G P+A Y++   + V++G+KIG Y+YCG +    I+ L+L + PA
Sbjct  310   MENAGALQVDLDGKPIALYHDPKHSHVTSGVKIGKYLYCGSLLGSHIVRLDLLKYPA  366



>gb|AFK48885.1| unknown [Medicago truncatula]
Length=375

 Score =   383 bits (984),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 190/380 (50%), Positives = 262/380 (69%), Gaps = 10/380 (3%)
 Frame = +3

Query  21    KKNQDKILRTKMSGLWPF-AVLVPVILG-VVIYQLDSFDPAPYPAHELTQGSPAVAPKRN  194
             + N D   +T+ S   PF A+++PVI+   V Y+LD F+P  +P  + T+ S   AP RN
Sbjct  3     ESNTDTRTQTRTSLFTPFIAIILPVIIASAVFYRLDPFEPVVFPLEKQTR-STITAPLRN  61

Query  195   GRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNT  374
               +   SE +  G L GPED+VYD   G++YTGC DGW+KR++VN      S VEDW+NT
Sbjct  62    NNMRLGSENVADGELFGPEDLVYDADKGLMYTGCEDGWIKRISVN-----GSVVEDWINT  116

Query  375   GGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLY  554
             GGRPLGLA   +G++I+ADA+ GLL VT + +++V+  E DG+KFKLTD VDVA DG +Y
Sbjct  117   GGRPLGLAFDGNGQLIIADADKGLLRVTREKEIEVLVTEIDGLKFKLTDGVDVAHDGTIY  176

Query  555   FTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIF  734
             FTDAS KY ++D + + LEGKP+GR LSY+P TK+T +LV+DL+F NGVAV PDQ+FV+F
Sbjct  177   FTDASSKYSIKDSVLDILEGKPNGRFLSYNPATKKTTLLVSDLYFPNGVAVSPDQNFVVF  236

Query  735   CETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQR  914
             CET M  CKKYYI G KKGS E F + LPGMPDNI+YDG+G +WIGI   +    +++ +
Sbjct  237   CETSMMNCKKYYIHGSKKGSTEKFCD-LPGMPDNIQYDGQGQYWIGIATAFFPELDIMLK  295

Query  915   YPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCG  1094
             YP +RK L ++ K     N+ KNGG+  VD+EG P  HY +   +L   GIKIG ++Y G
Sbjct  296   YPFIRKALAIIIKKVSSLNLTKNGGLISVDLEGKPTTHYNDPKLSLTG-GIKIGKHLYGG  354

Query  1095  FVKYGFILSLNLTQNPAVAS  1154
              + Y F++ L++ + PA+ +
Sbjct  355   SILYPFVIRLDIEKYPALPT  374



>ref|XP_003629179.1| Adipocyte plasma membrane-associated protein [Medicago truncatula]
 gb|AET03655.1| adipocyte plasma membrane-associated-like protein [Medicago truncatula]
Length=375

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 187/380 (49%), Positives = 262/380 (69%), Gaps = 10/380 (3%)
 Frame = +3

Query  21    KKNQDKILRTKMSGLWPF-AVLVPVILGVVIY-QLDSFDPAPYPAHELTQGSPAVAPKRN  194
             K N +   + + S   PF A+++PVI+   ++ +LD F+P  +P  + T+ S   AP RN
Sbjct  3     KSNTNTRTQPRTSLFTPFIAIILPVIIASAVFNRLDPFEPVVFPLEKQTR-STITAPLRN  61

Query  195   GRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNT  374
               +   SE +  G L GPED+VYD   G++YTGC DGW+KR++VN      S VEDW+NT
Sbjct  62    NNMRLGSENVADGELFGPEDLVYDADKGLMYTGCEDGWIKRISVN-----GSVVEDWINT  116

Query  375   GGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLY  554
             GGRPLGLA   +G++I+ADA+ GLL VT + +++V+  E DG++FKLTD VDVA DG +Y
Sbjct  117   GGRPLGLAFDGNGQLIIADADKGLLRVTREKEIEVLVTEIDGLQFKLTDGVDVAHDGTIY  176

Query  555   FTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIF  734
             FTDAS KY  +D++ +  EG P+GR LSY+P TK+T +LV+DL+F NGVAV PDQ FV+F
Sbjct  177   FTDASSKYSYKDYLLDVFEGNPNGRFLSYNPATKKTTLLVSDLYFPNGVAVSPDQKFVVF  236

Query  735   CETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQR  914
             CET++  CKKYYI G KKGS E F + LPGMPDNIRYDG G + IGI   ++   +++ +
Sbjct  237   CETVLMNCKKYYIHGPKKGSTEKFCD-LPGMPDNIRYDGHGQYLIGIATAFSLDLDIMLK  295

Query  915   YPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCG  1094
             YP +RK L ++ K     N+ KNGG+  VD+EG   AHYY+   +L S GIKIGN++YCG
Sbjct  296   YPFIRKALAIITKKVPSLNLYKNGGVITVDLEGKSTAHYYDPKLSL-SGGIKIGNHLYCG  354

Query  1095  FVKYGFILSLNLTQNPAVAS  1154
              + Y F++ L++ + PA+ +
Sbjct  355   SILYPFVIRLDIEKYPALPT  374



>ref|XP_009149030.1| PREDICTED: protein YLS2-like [Brassica rapa]
Length=372

 Score =   381 bits (978),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/360 (53%), Positives = 255/360 (71%), Gaps = 9/360 (3%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
              +V ++  +V+Y+ D+FDPAP P+  L   + ++ P  N + L  +E IG G L+ PEDI
Sbjct  14    AIVALLASIVLYRFDTFDPAPLPSDALVYSTDSIPPLINNQFLTGAEFIGAGLLNSPEDI  73

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              Y   +G+IYTGC+DGWVKRV   ES A DS VEDWVNTGGRPLGLA GLHGEVIVADA 
Sbjct  74    AYHRDSGLIYTGCVDGWVKRVKAFES-ANDSVVEDWVNTGGRPLGLAFGLHGEVIVADAY  132

Query  438   IGLLNVTSDGKVQ----VMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEF  605
               LLN++ DGK      V+T EA+GVKFKLTDAV V ++G+LYFTDAS+KY L  F ++ 
Sbjct  133   KRLLNISDDGKKTELGWVVTDEAEGVKFKLTDAVAVRDNGVLYFTDASYKYNLHHFAFDI  192

Query  606   LEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEK  785
              EGKPHGRL+S+DP T+ T+VL+ D +F+NGV++ PDQ+ ++FCET +RRC KYYI  E+
Sbjct  193   WEGKPHGRLMSFDPITRTTRVLLRDRYFSNGVSMSPDQTHLVFCETPLRRCSKYYINEER  252

Query  786   KGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVR  965
                +EVFIE+LPG PDNIRYDG+G +WI +    T  ++L  RYP +RK+  +  KYG  
Sbjct  253   ---VEVFIESLPGYPDNIRYDGDGHYWIAMPSGVTTLWKLSFRYPFIRKLQALAAKYGFN  309

Query  966   PNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
               ME N G+  VD++G P+A Y++   + V++G+KIG Y+YCG +    IL L+L + PA
Sbjct  310   TIME-NAGVLQVDLDGKPIALYHDPKHSHVTSGVKIGKYLYCGSLLDSHILRLDLLKYPA  368



>ref|XP_002876087.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52346.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   380 bits (975),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 189/360 (53%), Positives = 253/360 (70%), Gaps = 30/360 (8%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F V+VP+++ +  Y+LD+F                         L  +E IGVG L+ PE
Sbjct  12    FFVIVPLLISITFYRLDTF-------------------------LAGAEFIGVGLLNNPE  46

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y   +G IYTGC+DGWVKRV V ES   DS VEDWVNTGGRPLG+A GLHGEVIVAD
Sbjct  47    DIAYHEDSGFIYTGCVDGWVKRVKVAES-VNDSVVEDWVNTGGRPLGIAFGLHGEVIVAD  105

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DGK  +++T EADGV+FKLTDAV V ++G+LYFTDAS+KY L  F ++ L
Sbjct  106   AYKGLLNISGDGKKTELLTEEADGVRFKLTDAVTVGDNGVLYFTDASYKYSLHQFSFDIL  165

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRL+S+D  TK T+VL+ DL+FANGV++ PDQ+ ++FCET +RRC KYYI G   
Sbjct  166   EGKPHGRLMSFDLTTKVTRVLLKDLYFANGVSMSPDQTHLVFCETPIRRCSKYYING---  222

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
             G +E+FI+ LPG PDNIRYDG+G +WI +    T  ++L  +YP LRKI  +  KYG  P
Sbjct  223   GRVELFIQGLPGYPDNIRYDGDGHYWIAMPSGVTTLWKLSMKYPFLRKITAMAAKYGYEP  282

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAV  1148
                +N G+  VD++GNP+A+Y+++  + ++TG+KIGNY+YCG + +  I+ L+L + PAV
Sbjct  283   MFMENAGVLQVDLDGNPMAYYHDQALSHITTGVKIGNYLYCGSLLHSHIIRLDLMKYPAV  342



>ref|XP_004509419.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cicer arietinum]
Length=372

 Score =   377 bits (969),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 182/351 (52%), Positives = 247/351 (70%), Gaps = 6/351 (2%)
 Frame = +3

Query  108   IYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIY  287
             +Y+ + F P  +P+ +LT  + A AP  N R+L   E +  G + GPED+ YD +  +IY
Sbjct  21    LYRPEPFQPVQFPSGDLTHRT-ANAPAVNPRMLIGWEVVAEGEVDGPEDLAYDKRRRLIY  79

Query  288   TGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDG  467
             TGC DGW+KRVTVN+S   DS VE+WVNTGGRPLGLA   +GE+IVADA +GL+ VT + 
Sbjct  80    TGCEDGWIKRVTVNDS-VGDSVVENWVNTGGRPLGLALEKNGELIVADATLGLVRVTQEK  138

Query  468   ----KVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLL  635
                 KV+++  E DG+KF LTD VDV +DG +YFTDAS+KY L+DF ++ +EG+PHGR +
Sbjct  139   GKQTKVEILADEHDGLKFNLTDGVDVGKDGTIYFTDASYKYNLKDFYYDIVEGEPHGRFM  198

Query  636   SYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIEN  815
             SY+P TK   +L  +L+FANGVAV PDQ FV++CET+ RRC+KYY++G KKG I  F  +
Sbjct  199   SYNPATKNVTLLARNLYFANGVAVAPDQKFVVYCETVKRRCRKYYLQGSKKGRIGEFCPD  258

Query  816   LPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIF  995
             LPGMPDNI Y G+G ++IG+    T    L+ +YP LRK      KY  RP +EKNGG+ 
Sbjct  259   LPGMPDNIHYVGKGQYFIGMSTSVTPERGLLLKYPFLRKSAAKFAKYFRRPKVEKNGGVL  318

Query  996   VVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAV  1148
             VV++EG    HYYE   +L+S+GIK+ +Y+YCG + Y FIL +N+ Q PA+
Sbjct  319   VVNLEGKQTEHYYEPQLSLISSGIKVEDYIYCGSLSYPFILRVNVKQYPAL  369



>emb|CDX78005.1| BnaA09g32000D [Brassica napus]
Length=414

 Score =   379 bits (972),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 184/341 (54%), Positives = 247/341 (72%), Gaps = 6/341 (2%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F+ ++P +  + +Y+LDSFDPA  P + L   + ++ P  N +LL  +E IGVG L+ PE
Sbjct  13    FSTVIPFLASIALYRLDSFDPALLPPNALDYSTTSLPPLSNDKLLTGAELIGVGLLNSPE  72

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y  ++  IYTGC+DGWVKRV V ES   DS VEDWVNTGGRPLG+A GLHGEVIVAD
Sbjct  73    DIAYHRESNFIYTGCVDGWVKRVKVTES-VNDSVVEDWVNTGGRPLGVAFGLHGEVIVAD  131

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DGK  +++T EADGVKFKL DAV VA++G+LYFTDAS+KY +  F ++ L
Sbjct  132   AYKGLLNISGDGKKTELLTDEADGVKFKLADAVAVADNGVLYFTDASYKYNMRQFAFDIL  191

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRL+S+DP T+ T+VL+  L+FANGV++ PDQ+ ++FCET MRRC KYYI  E+ 
Sbjct  192   EGKPHGRLMSFDPTTRTTRVLLKGLYFANGVSMSPDQTHLVFCETPMRRCSKYYINEER-  250

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +EVF + LPG PDNIRYDGEG +WI +    T  ++L  RYP LRK+  +   YG+ P
Sbjct  251   --VEVFTQGLPGYPDNIRYDGEGHYWIAMPSGVTVLWKLAFRYPFLRKLTAIAANYGLDP  308

Query  969   NM-EKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMY  1088
              +   N G+  VD++G P+A Y++   + ++TG+KIG Y+Y
Sbjct  309   LIFMANAGVLGVDLDGKPIALYHDHKLSHMTTGVKIGRYLY  349



>ref|XP_007156223.1| hypothetical protein PHAVU_003G268700g [Phaseolus vulgaris]
 gb|ESW28217.1| hypothetical protein PHAVU_003G268700g [Phaseolus vulgaris]
Length=369

 Score =   374 bits (961),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 184/361 (51%), Positives = 247/361 (68%), Gaps = 6/361 (2%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
              A+++PV +  +++QL+ F P   P   +   S  V P RN      SE + VG + GPE
Sbjct  14    LAIVLPVTVAAILFQLEPFQPVALP---IRLDSVVVVPARNDHARVGSEAVAVGHVEGPE  70

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+ YD  + V+YTGC DGW+KRVTVN+S A DS VE+W+NTGGRPLGL     GE+IVAD
Sbjct  71    DLAYDAASRVVYTGCEDGWIKRVTVNDS-AVDSVVENWINTGGRPLGLTLLQSGELIVAD  129

Query  432   AEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
             A  GLL V+S+ +V+++  E +G+KFKLTD VDVAEDG +YFTDAS KY L D + + LE
Sbjct  130   AGKGLLRVSSEKEVELLVDEFEGLKFKLTDGVDVAEDGTIYFTDASHKYTLNDAVIDILE  189

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
             GKP+GR  SY+P TK+T +L  DL+FANGVAV PDQ FVIFCE+++ RC KYY++G KKG
Sbjct  190   GKPNGRFFSYNPATKKTTLLAQDLYFANGVAVSPDQQFVIFCESVLLRCNKYYVQGPKKG  249

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPN  971
             +IE F + +PGMPDNI YDG+G + I +   +T   +L  RYP +RKI  ++ KY     
Sbjct  250   TIEKFCD-VPGMPDNIHYDGQGQYLIAMFTAFTSELDLAFRYPFIRKIAAIITKYVWNVP  308

Query  972   MEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVA  1151
             + KNGG  VVD+EG P AHYY+    L S  IKIGN++Y G + Y F+   ++ + PA+ 
Sbjct  309   LSKNGGFVVVDLEGKPTAHYYDPKLALTS-AIKIGNHIYAGSIFYPFVTRFDIGKYPALP  367

Query  1152  S  1154
             +
Sbjct  368   T  368



>ref|XP_006292426.1| hypothetical protein CARUB_v10018641mg [Capsella rubella]
 gb|EOA25324.1| hypothetical protein CARUB_v10018641mg [Capsella rubella]
Length=371

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/358 (49%), Positives = 253/358 (71%), Gaps = 5/358 (1%)
 Frame = +3

Query  75    AVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPED  254
             + +VP ++ + +YQLD+FDPAP P+   T  + ++    N +    +E IG+G L  PED
Sbjct  13    STIVPFLISIALYQLDTFDPAPAPSDAFTSSTSSIPSLLNEKFRTGAEFIGLGVLHKPED  72

Query  255   IVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADA  434
             I Y   +G+IYTGC+DGWVKRV V  S   DS +E+WVNTGGRPLG+  G+HGEVIVADA
Sbjct  73    IAYHKDSGLIYTGCVDGWVKRVKVAHS-VNDSVIENWVNTGGRPLGIDFGIHGEVIVADA  131

Query  435   EIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
               GLLN++ DGK  +++T EA+G++F LTDAV VA+DG+LYFTDAS KY L +   E LE
Sbjct  132   YKGLLNISGDGKKTELLTVEAEGLRFNLTDAVVVADDGVLYFTDASSKYNLHELNLEMLE  191

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
              +P+GRLLS+DP T+ T+VL+ DL+FANGV + PDQ+ +IFCET +++C KY I+ E+  
Sbjct  192   RRPYGRLLSFDPTTRVTRVLLKDLYFANGVTISPDQTHIIFCETPLKKCSKYNIKEER--  249

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPN  971
              +EVF+++LPG PDNIRYDGEG +WI +    T  + +  +YP +RK+  ++ KYGV   
Sbjct  250   -VEVFVQDLPGYPDNIRYDGEGHYWIALPSGVTTLWNISLKYPFMRKLAAMVAKYGVDLM  308

Query  972   MEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                + G+  VD++GNP+A+Y+++  + +ST  KIG Y+YCG +    IL L++ + PA
Sbjct  309   FMVDAGVMQVDLDGNPIAYYHDQTLSHISTCDKIGKYLYCGSLLQSHILRLDILKYPA  366



>ref|XP_003547900.1| PREDICTED: protein YLS2-like [Glycine max]
Length=378

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/361 (50%), Positives = 252/361 (70%), Gaps = 5/361 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F +++PV +  ++Y+L+ F P   P  +L + + AV P RNG +   SE++G G L GPE
Sbjct  22    FVIVLPVAVAALLYRLEPFKPVLLPV-QLGRSTVAV-PARNGHMQDGSERVGEGHLEGPE  79

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+ YD    V+YTGC DGW+KRVTVN+S   DSAVEDWVNTGGRPLGL    +GE+IVAD
Sbjct  80    DLAYDAAARVVYTGCEDGWIKRVTVNDS-VVDSAVEDWVNTGGRPLGLVLKPNGELIVAD  138

Query  432   AEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
             AE GLL V+S+ +++++  E +G+KFKLTD VD+A+DG +YFTDAS KY ++D +++ LE
Sbjct  139   AEKGLLRVSSEKEIELLVDEFEGLKFKLTDGVDIADDGTIYFTDASHKYPVKDAVFDVLE  198

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
             GKP+GR  SY+P TK+T +L  DL+FANGVAV  DQ FV+FCE+++ RC KY++ G K G
Sbjct  199   GKPNGRFFSYNPATKKTTLLAQDLYFANGVAVSADQQFVVFCESVLMRCNKYFVLGPKTG  258

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPN  971
             +IE F  +LPGMPDNI YDG+G + I +    +   EL  RYP +RK   +  KY    +
Sbjct  259   TIEKFC-DLPGMPDNIHYDGQGHYLIAMFTALSPELELAYRYPFIRKAFAMFTKYVGSLS  317

Query  972   MEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVA  1151
             + KNGG+ VVD+EG P AHYY+    L S  IKIGN++Y G + Y F+   ++ + PA+ 
Sbjct  318   ISKNGGVLVVDLEGKPTAHYYDPKLALTS-AIKIGNHIYAGSIFYPFVTRFDVEKYPALP  376

Query  1152  S  1154
             +
Sbjct  377   T  377



>ref|XP_003519847.1| PREDICTED: protein YLS2-like [Glycine max]
Length=367

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/371 (51%), Positives = 257/371 (69%), Gaps = 9/371 (2%)
 Frame = +3

Query  54    MSGLW---PFAVLV-PVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEK  221
             MS LW   PF V++ PV +  + ++L+ FDP   P  +L + + AV P  NG +   SE 
Sbjct  1     MSRLWFSTPFFVIILPVAVAALFFRLEPFDPGFLPV-QLGRSTVAV-PASNGHVRVGSEA  58

Query  222   IGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAH  401
             +G G L GPED+ YD    V+YTGC DGW+KRVTVN+S   DSAVEDWVNTGGRPLGL  
Sbjct  59    MGEGHLEGPEDLAYDAAARVVYTGCEDGWIKRVTVNDS-VLDSAVEDWVNTGGRPLGLTL  117

Query  402   GLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYG  581
               +GE+IVADAE GLL V+S+ +++++  E +G+KFKLTD VDVA+DG +YFTDAS KY 
Sbjct  118   KPNGELIVADAEKGLLRVSSEREIELLVDEYEGLKFKLTDGVDVADDGTIYFTDASHKYP  177

Query  582   LEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCK  761
             ++D + + LEGKP+GR  SY+P TK+T +L  DL+FANGVAV  DQ FV+FCE+++  C+
Sbjct  178   VKDAVLDILEGKPNGRFFSYNPATKKTTLLAKDLYFANGVAVSADQQFVVFCESVLMICE  237

Query  762   KYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILG  941
             KYY++G KKG+IE F  +LPGMPDNI YDG+G + I +    T   EL  RYP +RK   
Sbjct  238   KYYVQGPKKGTIEKFC-DLPGMPDNIHYDGQGHYLIAMVTALTPELELAYRYPFIRKTFA  296

Query  942   VMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILS  1121
             ++ KY     + KNGG+ VVD+EG P AHYY+   +L S  IKIGN++Y G + Y F+  
Sbjct  297   IVTKYVGSLPISKNGGVLVVDLEGKPTAHYYDPKLSLTS-AIKIGNHIYGGSIFYPFVTR  355

Query  1122  LNLTQNPAVAS  1154
              ++ + PA+ +
Sbjct  356   FDIEKYPALPT  366



>emb|CDY16306.1| BnaC01g23410D [Brassica napus]
Length=357

 Score =   370 bits (949),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/362 (51%), Positives = 253/362 (70%), Gaps = 19/362 (5%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F+ ++P I  + +Y++D+FDP+  PA  L   + ++ P  N +LL  +E IGVG L+ PE
Sbjct  13    FSTIIPFIASIALYRVDTFDPSHLPADALVYSTTSIPPLVNDQLLTGAEFIGVGLLNKPE  72

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI YD  +G+IYTGC+DGWVKRV V ES A DS VE+WVNTGGRPLGLA GLHGEVIVAD
Sbjct  73    DIAYDRDSGLIYTGCVDGWVKRVKVMES-ANDSVVENWVNTGGRPLGLAFGLHGEVIVAD  131

Query  432   AEIGLLNVTSDG-KVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  G+ N++ DG K +++T EA+GV+FKLTDAV V ++G+LYFTDAS+KY      ++ L
Sbjct  132   AYKGMFNISDDGRKTELLTDEAEGVRFKLTDAVAVGDNGVLYFTDASYKYDYSQSSFDVL  191

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             EGKPHGRL+S++P T+ T+VL+ DL+FANGV++              RRC KYYI  E+ 
Sbjct  192   EGKPHGRLMSFNPTTRTTRVLLKDLYFANGVSI--------------RRCSKYYISEER-  236

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +EVFI++LPG PDNIRYDG+G +WI +    T  ++L  RYPLLRK+  ++ K+G   
Sbjct  237   --VEVFIQSLPGYPDNIRYDGDGHYWIAMPTGVTTLWKLSMRYPLLRKVTAMVAKWGFNL  294

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAV  1148
                ++ G+  VD +GNP+A Y++   T ++TG+KIG Y+YCG + +  IL L+L + PA 
Sbjct  295   MFAEDAGVLQVDFDGNPIAFYHDHKITHLTTGVKIGKYLYCGSLLHSRILRLDLLKYPAQ  354

Query  1149  AS  1154
              S
Sbjct  355   KS  356



>ref|XP_010503837.1| PREDICTED: protein YLS2-like [Camelina sativa]
Length=371

 Score =   370 bits (949),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 178/357 (50%), Positives = 250/357 (70%), Gaps = 5/357 (1%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
             ++VP+ + + +Y+LD+FDPAP  +   T  + ++ P  N +    +E IGV  L  PEDI
Sbjct  14    IIVPLFISIALYKLDTFDPAPVTSDAFTSSTTSLPPLLNEKFRTGAEFIGVDVLHKPEDI  73

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              Y   +G+IYTGC+DGWVKRV V +S   DS +E+WVNTG RPLGLA GLHGEVIVADA 
Sbjct  74    AYHKDSGLIYTGCVDGWVKRVKVADS-VNDSVIENWVNTGSRPLGLAFGLHGEVIVADAY  132

Query  438   IGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEG  614
              GLLN++ DGK  +++T EA+G++F LTDAV VA++G+LYFTDAS KY L     E  E 
Sbjct  133   KGLLNISGDGKKTELLTDEAEGLRFNLTDAVVVADNGVLYFTDASSKYNLHQLNLEMFEM  192

Query  615   KPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGS  794
             +P+GRLLSYDP T+ T+VL+ DL+FANG+ + PDQ+ +IFCET +++C KYYI  E+   
Sbjct  193   RPYGRLLSYDPTTRVTRVLLRDLYFANGITISPDQTHIIFCETPLKKCSKYYIDEER---  249

Query  795   IEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNM  974
             +EVFIE+LPG  DNIRYDGEG +WI I    T  + +  +YP LRK+  +M KYGV    
Sbjct  250   VEVFIEDLPGYVDNIRYDGEGHYWIAIPTGVTTLWNISLKYPFLRKLAAMMAKYGVDVMF  309

Query  975   EKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
               + G+  VD++GNP+A+Y++   + ++T  KIG Y+YCG + +  +L +++ + PA
Sbjct  310   MVDAGVMQVDLDGNPIAYYHDPTLSHIATCDKIGKYLYCGSLMHSHMLRVDIQKYPA  366



>ref|XP_009385650.1| PREDICTED: protein YLS2-like [Musa acuminata subsp. malaccensis]
Length=382

 Score =   370 bits (949),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 172/369 (47%), Positives = 257/369 (70%), Gaps = 9/369 (2%)
 Frame = +3

Query  45    RTKMSGLWP-----FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLH  209
             RT     WP       +LVP+++ +V+   + FDPAP PA      S AVA +R+ R+L 
Sbjct  15    RTLRRPSWPIIGALLLILVPIVISIVVNDPNGFDPAPLPADYSFSASLAVA-ERHDRILA  73

Query  210   DSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPL  389
              S+++G GRL GPED+ YD   G +YTGC DGW++RV++ +       VEDW   GGRPL
Sbjct  74    SSKRVGEGRLPGPEDLAYDKARGFLYTGCSDGWIRRVSLKDEKME---VEDWAYVGGRPL  130

Query  390   GLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDAS  569
             G+A G  G+++VA++  GL+ V  D  V ++T EADG+ F+LTD VDVA DG++YFTDAS
Sbjct  131   GVALGPGGDLVVAESNNGLMIVKPDQSVAMLTDEADGLMFRLTDGVDVASDGLIYFTDAS  190

Query  570   WKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIM  749
             +K+ L+  I + LEG+PHGRL+S+D  T QT VL+ DL+FANGV++ PDQ F+IFCET +
Sbjct  191   YKFNLDTHILDILEGRPHGRLMSFDSSTNQTSVLLRDLYFANGVSLSPDQRFLIFCETTL  250

Query  750   RRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLR  929
             RRC++Y+IRGEK+G+++ FI+NLPG PDN+RYDGEG +WI +    T  ++++ +YP LR
Sbjct  251   RRCRRYHIRGEKRGTVDEFIQNLPGFPDNVRYDGEGHYWIALAAGKTPEWDVVLKYPFLR  310

Query  930   KILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYG  1109
             K++  +EK+   P+ +++ GI  VD++G PVA + +   TL ++G+KIG +++ G +   
Sbjct  311   KLMVTIEKFVKIPHSQRDSGILKVDLDGQPVALFSDPGLTLATSGLKIGKHLWYGSLVKD  370

Query  1110  FILSLNLTQ  1136
             ++  ++LTQ
Sbjct  371   YLSRIDLTQ  379



>gb|KCW45369.1| hypothetical protein EUGRSUZ_L00935 [Eucalyptus grandis]
Length=299

 Score =   366 bits (939),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/303 (58%), Positives = 227/303 (75%), Gaps = 6/303 (2%)
 Frame = +3

Query  222   IGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAH  401
             +G GR+ GPED+VYDP++GVIY GC DGWVK+V V+  S  DSAVEDWVNTGGRPLGLA 
Sbjct  2     VGAGRVVGPEDVVYDPESGVIYVGCADGWVKQVEVS-GSGRDSAVEDWVNTGGRPLGLAL  60

Query  402   GLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYG  581
             G  GE+IV D+         DG V+++T EA+G+KF LTD  DVA DG +YFTDAS+KY 
Sbjct  61    GRDGELIVCDS---YKVSKRDGTVELLTDEAEGLKFNLTDGADVARDGTIYFTDASYKYT  117

Query  582   LEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCK  761
             L++ IW+ LEG+PHGR LSYDP TK+T+VL  DL+F NGVA+ PDQSFVIFCET  R CK
Sbjct  118   LKEAIWDVLEGQPHGRFLSYDPTTKETQVLARDLYFPNGVALSPDQSFVIFCET--RWCK  175

Query  762   KYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILG  941
             +YYI GE+KG I+ FI+ LPG PDNIRYDGEG +WI +    +   +L+ +YP +RK   
Sbjct  176   RYYITGERKGHIDTFIDRLPGYPDNIRYDGEGHYWIALYSGSSMFNKLLLKYPFIRKGAA  235

Query  942   VMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILS  1121
             ++E++  RP M+KN G+F VD+EG PVAHYY+   + +S+G KIG+Y+YCG + Y +IL 
Sbjct  236   ILERFDRRPVMDKNSGVFQVDLEGKPVAHYYDPQLSFISSGNKIGDYLYCGSLYYPYILR  295

Query  1122  LNL  1130
             L L
Sbjct  296   LKL  298



>ref|XP_003520040.2| PREDICTED: protein YLS2-like isoform X1 [Glycine max]
Length=396

 Score =   368 bits (945),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 185/380 (49%), Positives = 255/380 (67%), Gaps = 25/380 (7%)
 Frame = +3

Query  6     SGVKKKKNQDKILRTKMSGLWPFAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAP  185
             S  K++  Q   L + +     FA+   V L  V+Y L S  PA    HE ++       
Sbjct  21    SPTKRRTKQRSCLLSSL-----FAIAFMVALVSVLYWLGSLGPA----HEWSRPI-----  66

Query  186   KRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDW  365
                      SE + VG +SGPED+ YD +  VIYTGC DGW+KRVTV +S  AD+ V++W
Sbjct  67    --------GSEVVAVGEVSGPEDLAYDKRRRVIYTGCEDGWIKRVTVTDS-VADTVVKNW  117

Query  366   VNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDG  545
             VNTGGRPLGLA    GE++VADA  GLL VT   KV+V+  E +G+KF LTD VDVAEDG
Sbjct  118   VNTGGRPLGLALEKSGELMVADAFKGLLRVTRKKKVEVLADEVEGLKFNLTDGVDVAEDG  177

Query  546   MLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSF  725
              +YFTDA++K+ L+D+  + +EGKPHGR ++Y+P TK+  VL  +L+F NGV V  DQ F
Sbjct  178   TIYFTDATYKHSLDDYYNDIIEGKPHGRFMNYNPETKKVTVLARNLYFPNGVVVSHDQHF  237

Query  726   VIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFEL  905
             VI+CETIM+RC+KYYI G KKG I  F  +LPGMPDNI Y G+G ++I +    T  ++L
Sbjct  238   VIYCETIMKRCRKYYIEGPKKGRIGEFCRDLPGMPDNIHYVGQGQYYIAMATSLTPEWDL  297

Query  906   IQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYM  1085
             + RYP ++K+  ++ KY ++P  ++NGG+ VVD+EG P AHYY+ + +L+S+GIKIGNY+
Sbjct  298   LLRYPFIQKVAAMVTKYVLQP--KENGGVLVVDLEGKPTAHYYDSELSLISSGIKIGNYI  355

Query  1086  YCGFVKYGFILSLNLTQNPA  1145
             YCG + Y F++  ++ Q PA
Sbjct  356   YCGSLMYPFLVRFDMKQYPA  375



>ref|XP_010426700.1| PREDICTED: protein YLS2-like [Camelina sativa]
Length=371

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/357 (50%), Positives = 250/357 (70%), Gaps = 5/357 (1%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
             ++VP+ L + +Y+LD+FDPAP  +   T  + ++ P  N +    +E IGV  L  PEDI
Sbjct  14    IIVPLFLSIALYKLDTFDPAPVTSDAFTSSTTSLPPLLNEKFRTGAEFIGVNVLHKPEDI  73

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              Y   +G+IYTGC+DGWVKRV V +S   DS +E+WVNTG RPLGLA GL+GEVIVADA 
Sbjct  74    AYHKDSGLIYTGCVDGWVKRVKVADS-VNDSVIENWVNTGSRPLGLAFGLNGEVIVADAY  132

Query  438   IGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEG  614
              GLLN++ DGK  +++T EA+G++F LTDAV VA++G+LYFTDAS KY L     E  E 
Sbjct  133   KGLLNISGDGKKTELLTDEAEGLRFNLTDAVVVADNGVLYFTDASSKYNLHQLNLEMFEM  192

Query  615   KPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGS  794
             +P+GRLLSYDP T+ T+VL+ DL+FANG+ + PDQ+ VI+CET +++C KYYI  E+   
Sbjct  193   RPYGRLLSYDPTTRVTRVLLRDLYFANGITISPDQTHVIYCETPLKKCSKYYIEEER---  249

Query  795   IEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNM  974
             +EVFIE+LPG  DNIRYDGEG +WI I    T  + +  +YP LRK+  ++ KYGV    
Sbjct  250   VEVFIEDLPGYVDNIRYDGEGHYWIAIPSVVTTLWNISLKYPFLRKLAAMVAKYGVDLMF  309

Query  975   EKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
               + G+  VD++GNP+A+Y++   + ++T  KIG Y+YCG + +  +L +++ + PA
Sbjct  310   MVDAGVMQVDLDGNPIAYYHDPKLSHIATCDKIGKYLYCGSLMHSHMLRVDIQKYPA  366



>ref|XP_004983784.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Setaria italica]
Length=367

 Score =   363 bits (933),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 175/356 (49%), Positives = 244/356 (69%), Gaps = 6/356 (2%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
             VL PV L V +Y    F PAP P  E + G    AP+   R L  SE++G GRL GPED+
Sbjct  14    VLAPVALAVALYSPRDFSPAPLPP-EYSYGPDVSAPRHEARALEQSERVGEGRLPGPEDL  72

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              YD   G +YTGC DGWV+RV+V         VEDWV TGGRPLG+     G +IVADA+
Sbjct  73    AYDAAGGWLYTGCADGWVRRVSVPGGD-----VEDWVRTGGRPLGVVLAADGGLIVADAD  127

Query  438   IGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGK  617
             IGLL V+ + KV+++T  A+G++F LTD VDVA DG +YFTDAS+KY L + + + LE +
Sbjct  128   IGLLKVSPERKVELLTDAAEGLEFALTDGVDVAADGTIYFTDASYKYNLANHMTDVLEAR  187

Query  618   PHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSI  797
             PHGRLLS+DP T +T VLV DL+FANGVA+ PDQS +I+CET++RRC +Y+I G+KKGS+
Sbjct  188   PHGRLLSFDPATGRTAVLVRDLYFANGVAISPDQSSLIYCETVVRRCSRYHIAGDKKGSV  247

Query  798   EVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNME  977
             E FI+NLPG PDNIRYDGEG +WI +    T  ++L+ +YP +RK+L ++EK+   P+  
Sbjct  248   EKFIDNLPGFPDNIRYDGEGRYWIALSAGRTLQWDLLMKYPFVRKLLYLVEKFVAVPHGL  307

Query  978   KNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
             KN G   V ++G PV+ Y +    L ++ +K+G ++Y G +   ++  +++T++ A
Sbjct  308   KNSGTMSVTLDGEPVSTYTDPGLALATSWLKVGKHLYYGSLTKTYLSRIDVTKSSA  363



>ref|XP_004509421.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
isoform X2 [Cicer arietinum]
Length=316

 Score =   360 bits (923),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 174/314 (55%), Positives = 237/314 (75%), Gaps = 3/314 (1%)
 Frame = +3

Query  213   SEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLG  392
             SE +  G+++GPED++YD   GV+YTGC DGW+KRVT+NES   DS VE+WVNTGGRPLG
Sbjct  5     SETLAKGKVAGPEDLLYDATLGVVYTGCEDGWIKRVTLNES-VDDSVVENWVNTGGRPLG  63

Query  393   LAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASW  572
             LA   +G++IVADA++GLL +T + +++V+  E +G+KFKLTD VDVA DG +YFTDAS+
Sbjct  64    LAFYGNGDLIVADADLGLLRITREKEIEVLVNEIEGLKFKLTDGVDVANDGTIYFTDASY  123

Query  573   KYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMR  752
             KY ++D I + LEG P+GR LSY+P TK+T +L+  L+F NGVAV PDQ FV+FCET++ 
Sbjct  124   KYSVKDSILDILEGNPNGRFLSYNPTTKKTTLLLTHLYFPNGVAVSPDQQFVVFCETVLM  183

Query  753   RCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRK  932
              CKKYYI+G+K+GSIE F + LPGMPDNI YDG GLFWIGI    T   +L+ RYP++RK
Sbjct  184   NCKKYYIKGQKRGSIEKFCD-LPGMPDNIHYDGHGLFWIGIATGITPEMDLMLRYPIIRK  242

Query  933   ILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGF  1112
              L ++ K     N+ K GG+  VD+EG P+ HYY+   +L + GIKIGN++YCG + Y +
Sbjct  243   TLAIVTKKVPSLNLSKKGGVITVDLEGKPITHYYDPKLSL-TIGIKIGNHIYCGSILYPY  301

Query  1113  ILSLNLTQNPAVAS  1154
             ++ LN+ Q PA+ +
Sbjct  302   LIRLNIEQYPALPT  315



>ref|XP_010515551.1| PREDICTED: protein YLS2-like [Camelina sativa]
Length=373

 Score =   362 bits (928),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 174/359 (48%), Positives = 247/359 (69%), Gaps = 3/359 (1%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             F+++VP+ + + +Y+LD+FDPAP  +   T  + ++ P  N      +E IG   L  PE
Sbjct  12    FSIIVPLFISIALYKLDTFDPAPVTSDAFTSSTTSLPPLLNENFRTGAEFIGFDVLHKPE  71

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             DI Y   +G+IYTGC+DGWVKRV V +S   DS +E+WVNTG RPLGLA GLHGEVIVAD
Sbjct  72    DIAYHKDSGLIYTGCVDGWVKRVKVADS-VNDSVIENWVNTGSRPLGLAFGLHGEVIVAD  130

Query  432   AEIGLLNVTSDGK-VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             A  GLLN++ DGK  +++T EA+G++F LTDAV VA++G+LYFTDAS KY L     E  
Sbjct  131   AYKGLLNISGDGKKTELLTDEAEGLRFNLTDAVVVADNGVLYFTDASSKYNLHQLNLEMF  190

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             E +P+GRLLSYDP T+ T+VL+ DL+FANG+ + PDQ+ +IFCET +++C KYYI  E++
Sbjct  191   EMRPYGRLLSYDPTTRVTRVLLRDLYFANGITISPDQTHIIFCETPLKKCSKYYIE-EER  249

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               +    ++LPG  DNIRYDGEG +WI I    T  + +  +YP LRK+  +M KYGV  
Sbjct  250   VEVXSQXQDLPGYVDNIRYDGEGHYWIAIPTGVTTLWNISLKYPFLRKLAAMMAKYGVDI  309

Query  969   NMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
                 + G+  VD++GNP+A+Y++   + ++T  KIG Y+YCG + +  IL +++ + PA
Sbjct  310   MFMVDAGVMQVDLDGNPIAYYHDPKLSHIATCDKIGKYLYCGSLMHSHILRVDIQKYPA  368



>gb|AAG13594.1|AC051633_10 mucin-like protein [Oryza sativa Japonica Group]
 gb|AAP54868.1| Strictosidine synthase family protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ16859.1| hypothetical protein OsJ_32333 [Oryza sativa Japonica Group]
Length=369

 Score =   352 bits (902),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 171/358 (48%), Positives = 244/358 (68%), Gaps = 8/358 (2%)
 Frame = +3

Query  75    AVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPED  254
             A LV V+ GV +Y  + F PAP P  E + G+P  AP+   R L  SE++G GRL  PED
Sbjct  14    AALV-VLAGVALYSPEGFSPAPMPP-EYSYGAPVSAPRHEPRALAASERVGEGRLPAPED  71

Query  255   IVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADA  434
             + YD   G +YTGC DGWV+RV+V+        VEDW  TGGRPLG+A    G ++VADA
Sbjct  72    LAYDAAGGWLYTGCGDGWVRRVSVSSGD-----VEDWARTGGRPLGVALTADGGLVVADA  126

Query  435   EIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEG  614
             +IGLL V+ D  V+++T EA+GVKF LTD VDVA DG++YFTDAS K+ L +F+ + LE 
Sbjct  127   DIGLLKVSPDKAVELLTDEAEGVKFALTDGVDVAGDGVIYFTDASHKHSLAEFMVDVLEA  186

Query  615   KPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGS  794
             +PHGRL+S+DP T++T VL   L+FANGVAV PDQ  ++FCET+MRRC +Y+I G+K G+
Sbjct  187   RPHGRLMSFDPSTRRTTVLARGLYFANGVAVSPDQDSLVFCETVMRRCSRYHINGDKAGT  246

Query  795   IEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVR-PN  971
             ++ FI +LPG PDNIRYDGEG +WI I    T  ++++ R P +RK++ +++++ V  P+
Sbjct  247   VDKFIGDLPGFPDNIRYDGEGRYWIAISAGRTLQWDVLTRSPFVRKLVYMVDRFVVAVPH  306

Query  972   MEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPA  1145
               KN G   V + G PV+ Y +    L +  +K+G+Y+Y G +   ++  ++L ++PA
Sbjct  307   NLKNAGAMSVTLAGEPVSMYSDPGLALTTGWLKVGDYLYYGSLTKPYLSRIDLAKSPA  364



>dbj|BAK05159.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score =   351 bits (900),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 232/356 (65%), Gaps = 6/356 (2%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
             VL PV++ V +Y    F PA  P    + G    AP+ + R+L  SE+IG G L GPED+
Sbjct  15    VLAPVVISVALYSPKDFSPAALPPEYSSFGGDVSAPRHDARVLAASERIGEGLLPGPEDL  74

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
              YD   G +YTGC DGWV+RV+V         VEDW  TGGRPLG+     G +IVADA+
Sbjct  75    AYDAAGGWLYTGCADGWVRRVSVPGGD-----VEDWAYTGGRPLGVVLAGEGGIIVADAD  129

Query  438   IGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGK  617
              GLL V  D  VQ++T  A+G+KF LTD VD+A DG +YFTDAS+KY L  ++ + LE +
Sbjct  130   KGLLKVRPDKTVQLLTDAAEGLKFALTDGVDIAADGTIYFTDASYKYSLAKYMLDVLEAR  189

Query  618   PHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSI  797
             PHGRL+S+DP T +T VL  DL+FANGVAV PDQ  +IFCETIMRRC +Y+IRG+K G++
Sbjct  190   PHGRLMSFDPSTHRTTVLARDLYFANGVAVAPDQDSLIFCETIMRRCSRYHIRGDKAGTV  249

Query  798   EVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKY-GVRPNM  974
             E FI +LPGMPDNIRYDGEG +WI +    T   +++   PL+RK++ ++EKY    P  
Sbjct  250   ESFINSLPGMPDNIRYDGEGRYWIALSSGRTLQSDVLMWSPLVRKLVYMVEKYVTAVPQG  309

Query  975   EKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNP  1142
              ++ G   V + G PV  Y +    L +  +K+G+Y+Y G +   +I  ++LT+ P
Sbjct  310   LRDSGTMSVALNGEPVTMYTDPGLALATGALKVGDYLYYGSLASSYISRVDLTKLP  365



>ref|XP_002467566.1| hypothetical protein SORBIDRAFT_01g030270 [Sorghum bicolor]
 gb|EER94564.1| hypothetical protein SORBIDRAFT_01g030270 [Sorghum bicolor]
Length=366

 Score =   348 bits (894),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 234/345 (68%), Gaps = 8/345 (2%)
 Frame = +3

Query  111   YQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
             Y    F PAP P  E + G    AP+   R L  SE++G GRL GPED+ +D   G +YT
Sbjct  25    YSPRDFSPAPMPP-EYSYGPDVSAPRHERRALQRSERVGEGRLPGPEDLAFDAAGGWLYT  83

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSD--  464
             GC DGWV+RV+V         VEDWV TGGRPLGL     G +IVADA IGLL V+ D  
Sbjct  84    GCADGWVRRVSVPGGD-----VEDWVRTGGRPLGLVLASDGALIVADANIGLLKVSPDPD  138

Query  465   GKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYD  644
              KV+++T  A+G+KF LTD VDVA DG +YFTDAS+KY L++ + + LE +PHGRL+S+D
Sbjct  139   RKVELLTDSAEGLKFALTDGVDVAGDGTIYFTDASYKYNLDNHMTDILEARPHGRLMSFD  198

Query  645   PHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPG  824
             P T++T VL  DL+FANGV+V PDQS +I+CET+M+RC +Y+I GEKKG+I+ FI+NLPG
Sbjct  199   PSTRRTAVLARDLYFANGVSVSPDQSSLIYCETVMKRCSRYHIAGEKKGTIQKFIDNLPG  258

Query  825   MPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVD  1004
              PDNIRYDGEG +WI +    T  ++L+ +YP +RK++ + EK+   P+  KN G   V 
Sbjct  259   FPDNIRYDGEGRYWIALSAGRTLQWDLLMKYPFIRKLVYLAEKFVAVPHALKNSGAMSVA  318

Query  1005  MEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQN  1139
             ++G PV  Y ++   L +  +K+G ++Y G +   ++  ++LT++
Sbjct  319   LDGKPVTMYSDQGLALATGWLKVGEHLYYGSLTESYLSKIDLTKS  363



>emb|CAN68626.1| hypothetical protein VITISV_008834 [Vitis vinifera]
Length=599

 Score =   353 bits (907),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 177/384 (46%), Positives = 246/384 (64%), Gaps = 61/384 (16%)
 Frame = +3

Query  15    KKKKNQDKILRTKMSGLWPFA----VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVA  182
             + + +Q  + R + S  WP      +L PV   +++YQLD +DPAP P HE +Q  P V 
Sbjct  272   QTQTSQSSMDRRRSS--WPLGLLTLILAPVAAAMLLYQLDPYDPAPVPIHEFSQ-QPMVV  328

Query  183   PKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVED  362
             PK N R+L  SE IGVG+L GPEDI Y P + +IYTGC DGW                 +
Sbjct  329   PKLNSRMLQGSEMIGVGKLLGPEDIAYHPDSHLIYTGCDDGW-----------------N  371

Query  363   WVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAED  542
             W  TGGRPLG+A G +G+++VADAE GLL VT+DG V+ +T EA+               
Sbjct  372   WAFTGGRPLGVALGRYGQLVVADAEKGLLEVTTDGMVKTLTDEAE---------------  416

Query  543   GMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQS  722
                                   EG+PHGRL+S+DP TK+TKVLV DLFFANGV V PDQ+
Sbjct  417   ----------------------EGRPHGRLMSFDPSTKETKVLVRDLFFANGVIVSPDQN  454

Query  723   FVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFE  902
              VIFCE++M+ C KYYI+GE+KGS++ FI+NL   PDNI YDGEG +WI + +  + A++
Sbjct  455   SVIFCESVMKMCLKYYIQGERKGSMDKFIBNLSSTPDNILYDGEGXYWIALPMGNSLAWD  514

Query  903   LIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNY  1082
             L  +YP +RK++ ++E+Y VRP+MEKNGG+ VVD+EGNP A+YY+   + V++G+KIGN+
Sbjct  515   LALKYPWIRKVVAIVERYKVRPHMEKNGGVLVVDLEGNPTAYYYDPGLSEVTSGVKIGNH  574

Query  1083  MYCGFVKYGFILSLNLTQNPAVAS  1154
             +YCG +   +++ L+L Q+ A A+
Sbjct  575   LYCGSITAPYMIQLDLHQHAARAT  598


 Score =   297 bits (760),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 144/245 (59%), Positives = 182/245 (74%), Gaps = 10/245 (4%)
 Frame = +3

Query  48   TKMSGLWPFA----VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDS  215
             + S  WP      +L PV   +++YQLD +DPAP P HE +Q  P V PK N R+L  S
Sbjct  12   ARRSSSWPLGLLTLILAPVAAAMLLYQLDPYDPAPVPIHEFSQ-QPMVVPKLNPRMLQGS  70

Query  216  EKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGL  395
            E IGVG+L  PEDI Y P + +IYTGC DGWVKR+T+N     DS V++W  TGGRPLG+
Sbjct  71   EMIGVGKLLSPEDIAYHPDSHLIYTGCDDGWVKRITLN-----DSMVQNWAFTGGRPLGV  125

Query  396  AHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWK  575
            A G HG+++VADAE GLL VT+DG V+ +T EA+G+KFKLTD VDVA DGM+YFTDAS+K
Sbjct  126  ALGRHGQLVVADAEKGLLEVTADGMVKTLTDEAEGLKFKLTDGVDVAVDGMIYFTDASYK  185

Query  576  YGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRR  755
            YGL++ I + LEG+PHGRL+S+DP TK+TKVLV DLFFANGV V PDQ+ VI CE++M+ 
Sbjct  186  YGLKEHIQDILEGRPHGRLMSFDPSTKETKVLVRDLFFANGVVVSPDQNSVIVCESVMQV  245

Query  756  CKKYY  770
            C  +Y
Sbjct  246  CPXHY  250



>ref|XP_008802853.1| PREDICTED: protein YLS2-like [Phoenix dactylifera]
Length=383

 Score =   346 bits (888),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 245/370 (66%), Gaps = 5/370 (1%)
 Frame = +3

Query  42    LRTKMSGLWPFAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEK  221
             L ++  GL    + VPV+L  +++    FDPAP P    + G     P+R+  +L  SE+
Sbjct  19    LTSRFLGLL-LLIFVPVVLAAILFHPPDFDPAPLPGDH-SFGDSIAVPERHDHVLEASER  76

Query  222   IGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAH  401
             IG G L GPED+ YD + G +YTGC DGW++RV + +   A+  VEDW   GGRPLGLA 
Sbjct  77    IGEGLLPGPEDLAYDAEKGYLYTGCSDGWIRRVGLKD---AELKVEDWAFVGGRPLGLAM  133

Query  402   GLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYG  581
             G  G ++VAD+  G+L V  D  V++MT EA+G+ F+LTD +DVA DG++YFTDAS+KY 
Sbjct  134   GPGGSLVVADSYKGVLLVKPDQTVELMTNEAEGLNFRLTDGIDVASDGLIYFTDASYKYN  193

Query  582   LEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCK  761
             LE  + + LEG+PHGRL+S++P T QT VL +DL+FANGVA+ PDQ  +IFCET +RRCK
Sbjct  194   LEMTMLDILEGRPHGRLMSFNPSTNQTVVLAHDLYFANGVAISPDQCSIIFCETPLRRCK  253

Query  762   KYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILG  941
             +Y+I G+K G+ E FIENLPG PDNIRY GEG +WI +    T +++++ ++P +RK+  
Sbjct  254   RYHIEGDKNGTTENFIENLPGYPDNIRYSGEGHYWIALSSGRTISWDILFKFPFIRKMAA  313

Query  942   VMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILS  1121
             ++ K+     + ++ G+  V +EG P+  Y +R   LV+ G+KIG  +Y G +   +I  
Sbjct  314   ILAKFFSPFYLSQDSGMLSVTLEGQPLTIYSDRHLILVTGGLKIGKNLYYGSLHESYIKR  373

Query  1122  LNLTQNPAVA  1151
             +  ++ P  +
Sbjct  374   VRRSKVPTSS  383



>emb|CBI38401.3| unnamed protein product [Vitis vinifera]
Length=269

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 216/267 (81%), Gaps = 0/267 (0%)
 Frame = +3

Query  354   VEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDV  533
             V++W  TGGRPLG+A G HG+++VADAE GLL VT+DG V+ +T EA+G+KFKLT+ VDV
Sbjct  2     VQNWAFTGGRPLGVALGRHGQLVVADAEKGLLEVTADGMVKTLTDEAEGLKFKLTNGVDV  61

Query  534   AEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFP  713
             A DGM+YFTDAS+KYGL++ I + LEG+PHGRL+S+DP T++TKVLV DLFFANGV V P
Sbjct  62    AVDGMIYFTDASYKYGLKEHIRDILEGRPHGRLMSFDPSTEETKVLVRDLFFANGVVVSP  121

Query  714   DQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTH  893
             DQ+ VI CE++MRRC KY+I+GE+KGS++ FI+NLPG PDNI YDGEG +WI + +  + 
Sbjct  122   DQNSVIVCESVMRRCLKYHIQGERKGSMDKFIDNLPGPPDNILYDGEGHYWIALPMGNSL  181

Query  894   AFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKI  1073
             A++L  +YP +RK++ +ME+Y VRP++EKNGG+  VD+EG P A+Y++   + VS+G+KI
Sbjct  182   AWDLALKYPWIRKVVAIMERYKVRPHIEKNGGVLAVDLEGKPTAYYHDPGLSEVSSGVKI  241

Query  1074  GNYMYCGFVKYGFILSLNLTQNPAVAS  1154
             GNY+YCG V   +++ L+L Q+ A A+
Sbjct  242   GNYLYCGSVAKPYMIRLDLHQHVARAT  268



>ref|XP_010113254.1| Adipocyte plasma membrane-associated protein [Morus notabilis]
 gb|EXC35261.1| Adipocyte plasma membrane-associated protein [Morus notabilis]
Length=387

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/316 (53%), Positives = 231/316 (73%), Gaps = 17/316 (5%)
 Frame = +3

Query  216   EKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGL  395
             E +G+  L GPED+ Y  K+ +IYTGC+DGW+KRVTVNES   D+ V+ WV+TGGRPLG+
Sbjct  75    ELVGLALLEGPEDLAYHSKSRLIYTGCVDGWIKRVTVNES-GVDTVVKKWVDTGGRPLGI  133

Query  396   AHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWK  575
             A G H EVIV D + GLLN+T  GK++V+T      KFKL D+VDVAE+G++YFT+AS+K
Sbjct  134   AFGRHNEVIVTDPKKGLLNITQAGKMKVLTKGTKDEKFKLIDSVDVAENGVIYFTEASYK  193

Query  576   YGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRR  755
             Y L++F+ + LEGKPHGRL SYDP TK+TK+L+ +L+FANG+A+ PDQ+ V+FCET+M R
Sbjct  194   YSLDEFVLDILEGKPHGRLWSYDPSTKKTKLLLRNLYFANGLAISPDQNSVVFCETVMMR  253

Query  756   CKKYYIRGEKKGSIEVFIENLPGMPDNIRYD-GEGLFWIGIGI-EYTHAFELIQRYPLLR  929
             C+KY+IRG+KKGS++ FI+ LPG PDNI YD GE  +WI + +   +++ EL  +Y L R
Sbjct  254   CRKYFIRGKKKGSVKDFID-LPGFPDNIHYDIGEDHYWIALAMASSSNSSELAHKYSLRR  312

Query  930   KILGVMEKYGVRPNMEK------NGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYC  1091
              I G       +PN +K       GG+ VVD +GNP +HYY   F+L+S+G+KI N++YC
Sbjct  313   SING-------QPNDQKESINTTTGGVIVVDTKGNPTSHYYGPQFSLISSGVKIRNFVYC  365

Query  1092  GFVKYGFILSLNLTQN  1139
             G +   +++ +N  QN
Sbjct  366   GSLFNLYMVRINNLQN  381



>ref|XP_002521694.1| Adipocyte plasma membrane-associated protein, putative [Ricinus 
communis]
 gb|EEF40681.1| Adipocyte plasma membrane-associated protein, putative [Ricinus 
communis]
Length=312

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 207/267 (78%), Gaps = 3/267 (1%)
 Frame = +3

Query  72   FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
            F++++P++  +++YQLDSF+ AP P HELT   P    K N  +L  SE +GVG+L  PE
Sbjct  23   FSLIIPILAAILVYQLDSFESAPMPIHELTHPLPTPTMK-NDHILKGSEFLGVGQLLAPE  81

Query  252  DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
            DIVYD  + VIYTGC+DGW+KRVT+N+S  ADS VE+WV+TGGRPLGLA G  GEVIVAD
Sbjct  82   DIVYDTGSKVIYTGCVDGWIKRVTINDS-VADSVVENWVHTGGRPLGLALGHRGEVIVAD  140

Query  432  AEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
            A  GLL ++ +G V+++T EA+GVKFKLTD V VAEDG +YFTDAS KY L D +W+ LE
Sbjct  141  AYKGLLKISRNGAVELLTDEAEGVKFKLTDGVAVAEDGTIYFTDASHKYDLHDCMWDILE  200

Query  612  GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
            G+PHGRLLSYDP TK+T+VLV+ L+FANG+A+ PDQ +++F ET M RCKKYYI G KKG
Sbjct  201  GEPHGRLLSYDPSTKKTQVLVHHLYFANGIAISPDQDYLVFSETPMGRCKKYYIHGNKKG  260

Query  792  SIEVFIENLPGMPDNIRYDGEGLFWIG  872
             IE FI +LPG+ DNI YDG G FWI 
Sbjct  261  RIEKFI-DLPGLLDNIHYDGHGHFWIA  286



>ref|XP_003574275.1| PREDICTED: protein YLS2-like [Brachypodium distachyon]
Length=370

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/358 (46%), Positives = 238/358 (66%), Gaps = 10/358 (3%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAV---APKRNGRLLHDSEKIGVGRLSGP  248
             VL PV++ VV+Y    F PA  P  E + G+  V   A + + R L  SE++G G L GP
Sbjct  15    VLAPVLISVVLYSPKDFSPAAMPP-EYSFGADDVSVPASRHDARALDTSERVGEGLLPGP  73

Query  249   EDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVA  428
             ED+ YD   G +YTGC DGWV+RV     S    AVEDW  TGGRPLG+     G +IVA
Sbjct  74    EDLAYDAAGGWLYTGCADGWVRRV-----SMPGGAVEDWAYTGGRPLGVVLAGDGGLIVA  128

Query  429   DAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             DA+ GLL V+ D +V+++T  A+G +F LTD VDVA DG++YFTDAS+K+ L +F+ + L
Sbjct  129   DADKGLLKVSPDREVELLTDAAEGFRFALTDGVDVAADGIIYFTDASYKHSLAEFMLDIL  188

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             E +PHGRL+ +DP T+QT VL  D +F+NGVA+ PDQS +IFCET+MRRC +Y+IRG+K 
Sbjct  189   EARPHGRLMKFDPSTRQTTVLARDFYFSNGVALAPDQSSLIFCETVMRRCSRYHIRGDKA  248

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVR-  965
             G++E FI+ LPG PDN+RYDG+G +WI +    T  ++++   PLLRK++ +++KY V  
Sbjct  249   GTVERFIDRLPGFPDNVRYDGDGRYWIALSAGRTLQWDVMMGSPLLRKLVYLVDKYVVMV  308

Query  966   PNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQN  1139
             P   +  G   V ++G PV  Y +    L +  +K+G+Y+Y G +   +I  ++LT++
Sbjct  309   PKSLERAGTISVTLDGTPVTMYSDPGLALSTVWLKVGDYLYYGSLHSSYISRIDLTKS  366



>ref|XP_010943944.1| PREDICTED: LOW QUALITY PROTEIN: protein YLS2-like [Elaeis guineensis]
Length=402

 Score =   332 bits (850),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 239/366 (65%), Gaps = 7/366 (2%)
 Frame = +3

Query  42    LRTKMSGLWPFAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEK  221
             L ++  GL    + VPV+L  + +Q   FDPAP P+      S AV  +R+ R+L  SE+
Sbjct  37    LTSRFLGLL-LLIFVPVLLAAIFFQPPDFDPAPLPSDHSFADSIAVQ-ERHNRVLEASER  94

Query  222   IGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAH  401
             IG G L GPED+ YD + G +YTGC DGW++RV + +    +  VEDW   GGRPLGLA 
Sbjct  95    IGEGLLPGPEDLAYDAEKGYLYTGCSDGWIRRVGLED---GEPKVEDWAYVGGRPLGLAL  151

Query  402   GLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYG  581
             G  G ++VA++  GLL V  D  V++MT E +G+KF LTD +D+A DGM+YFT+AS+KY 
Sbjct  152   GPSGSLVVAESYKGLLLVKLDQTVELMTNEGEGLKFSLTDGIDIASDGMIYFTNASYKYN  211

Query  582   LEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCK  761
              E    + LEG+PHGRL+S++P T    V  +DL+FANGVA  PDQ  +IFCET +RRCK
Sbjct  212   FEMHTLDILEGRPHGRLMSFNPSTNXIVVFAHDLYFANGVATSPDQCSLIFCETPLRRCK  271

Query  762   KYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILG  941
             +Y+I+G+KKG  E FIENLPG PDNIRY GEG +WI +    T +++++ ++P  RK+  
Sbjct  272   RYHIQGDKKGMTENFIENLPGYPDNIRYGGEGHYWITLSSGRTISWDILFKFPFARKMAR  331

Query  942   VMEKYGVRPN-MEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFIL  1118
             ++EK+ V+P+ + ++ GI  V ++  P+  Y  R    V+ G+ +G  +Y G +   +I 
Sbjct  332   ILEKF-VKPSYLLQDSGILSVTLQRQPLTIYSGRRLIFVTCGLNVGKNLYYGSLYASYIS  390

Query  1119  SLNLTQ  1136
              ++ TQ
Sbjct  391   KIDFTQ  396



>ref|XP_008337329.1| PREDICTED: protein YLS2-like [Malus domestica]
Length=319

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 197/238 (83%), Gaps = 0/238 (0%)
 Frame = +3

Query  441   GLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKP  620
             GLLNVTS+G+V+V+  +A+GVKF LTDAVDVA DGM+YFTDAS+KY ++D +W+ LEG+P
Sbjct  80    GLLNVTSEGEVKVLADKAEGVKFLLTDAVDVAVDGMIYFTDASYKYNMKDHVWDILEGRP  139

Query  621   HGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIE  800
             HGRL+SYD  TKQT VL+ DL+FANGV V PDQS VI+CET MRRC+K+YI+GEKKGS++
Sbjct  140   HGRLMSYDSATKQTTVLLRDLYFANGVVVSPDQSHVIYCETPMRRCRKFYIQGEKKGSVD  199

Query  801   VFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEK  980
              FI++LPG+PDNIRYDGEG +WI + +  + A++L  RYP +RK+  +MEKY +RP++EK
Sbjct  200   TFIDHLPGLPDNIRYDGEGHYWIAMSMGLSLAWDLAVRYPFIRKVXAIMEKYKLRPSVEK  259

Query  981   NGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVAS  1154
             NGG+  VD+EGN +AHYY+   +++S+GIKIGNY+YCG   Y ++L LN+ +NP +A+
Sbjct  260   NGGVLAVDIEGNLIAHYYDPGLSMISSGIKIGNYIYCGSPIYPYMLRLNIQENPPIAA  317



>ref|XP_003574276.2| PREDICTED: protein YLS2-like [Brachypodium distachyon]
Length=372

 Score =   328 bits (840),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 163/358 (46%), Positives = 233/358 (65%), Gaps = 10/358 (3%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAV---APKRNGRLLHDSEKIGVGRLSGP  248
             VL PV + V +Y    F PA  P  E + G+  V   A + + R L  SE++G GRL GP
Sbjct  17    VLAPVFISVALYSPKDFSPAAMPP-EYSFGADDVSVPASRHDARALDASERVGEGRLPGP  75

Query  249   EDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVA  428
             ED+ YD   G +YTGC DGWV+RV+V        AV++W  TGGRPLG+A    G +IVA
Sbjct  76    EDLAYDAAGGWLYTGCADGWVRRVSVPSG-----AVKNWAYTGGRPLGVALTGDGGIIVA  130

Query  429   DAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             DA+ GLL V  D  V+++T  A+G++F LTD VDVA DG +YFTDAS K+ L +FI + L
Sbjct  131   DADKGLLRVGLDKSVELLTDAAEGLRFALTDGVDVATDGTIYFTDASHKHSLRNFILDVL  190

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             E +PHGRL+S+DP T++T VL  DL+F NGVA+ PDQ  +IFCETIMR C +Y+I+G+K+
Sbjct  191   EARPHGRLMSFDPSTRRTTVLARDLYFPNGVALAPDQGSLIFCETIMRMCSRYHIKGDKE  250

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKY-GVR  965
             G +E FI+ LPG+PDN+RYDG+G +WI +    T  ++++   PLLRK++ ++ +Y    
Sbjct  251   GMVERFIDRLPGLPDNVRYDGDGRYWIALSAGRTLLWDMLMGSPLLRKLVYLVNRYVAAV  310

Query  966   PNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQN  1139
             P      G   V ++G PV  Y +    L +   K+G+Y+Y G ++  +I  ++LT++
Sbjct  311   PKSTGGAGTLSVGLDGTPVTMYSDPRLVLATGWFKVGDYLYYGSLQNSYISRIDLTKS  368



>ref|XP_008354638.1| PREDICTED: protein YLS2-like [Malus domestica]
Length=243

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 190/238 (80%), Gaps = 0/238 (0%)
 Frame = +3

Query  441   GLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKP  620
             GLLNVTS+G+V+V+T + +GVKF LTDAVDV  DGM+YFTDAS+KY L+D +W+FLEG+P
Sbjct  4     GLLNVTSEGEVKVLTXKVEGVKFSLTDAVDVXVDGMIYFTDASYKYSLKDHVWDFLEGRP  63

Query  621   HGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIE  800
             HGRL+SYD  TK T V+V DL+FANGV V PDQS VI+CET MRRC KYYI+G+KKGS++
Sbjct  64    HGRLVSYDSATKXTTVMVRDLYFANGVVVSPDQSHVIYCETPMRRCTKYYIQGQKKGSVD  123

Query  801   VFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEK  980
              FI++LPG PDNIRYDGEG +WI + +  + A +L  RYP +RK++ +MEKY +R ++EK
Sbjct  124   TFIDHLPGYPDNIRYDGEGRYWIALSLAPSLAXDLAVRYPSIRKVMAIMEKYKLRASVEK  183

Query  981   NGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVAS  1154
             NGG+  VD+EGN + HYY+   ++VS+GIKIG Y+YCG + + ++  LN+ +NP V +
Sbjct  184   NGGVLAVDLEGNLIDHYYDPRLSMVSSGIKIGTYIYCGSILHPYMPXLNIQENPPVTA  241



>emb|CBI38407.3| unnamed protein product [Vitis vinifera]
Length=323

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 187/245 (76%), Gaps = 10/245 (4%)
 Frame = +3

Query  66   WPFA----VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVG  233
            WP      +L PV   +++YQLD + PAP P HE +Q  P V PK N R+L  SE  GVG
Sbjct  45   WPLGLLTLILAPVAAAMLLYQLDPYHPAPVPIHEFSQ-QPMVVPKHNSRMLQGSEMTGVG  103

Query  234  RLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHG  413
            +L GPEDI Y P + +IYTGC DGWVKRVT+N     DS V++W  TGGRPLG+A G HG
Sbjct  104  KLLGPEDIAYHPDSHLIYTGCADGWVKRVTLN-----DSVVQNWAFTGGRPLGVALGRHG  158

Query  414  EVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDF  593
            ++IVADAE GLL VT+DG V+ +T EA+G+KFKLTD VDVA DGM+YFTDAS+KY L+++
Sbjct  159  QLIVADAEKGLLEVTTDGMVKTLTDEAEGIKFKLTDGVDVAVDGMIYFTDASYKYSLKEY  218

Query  594  IWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYI  773
            IW+ LEG+PHGRL+S+DP TK+TKVLV DLFFANGV V PDQ+ VIFCE++M+ C KYYI
Sbjct  219  IWDILEGRPHGRLMSFDPSTKETKVLVRDLFFANGVIVSPDQNSVIFCESVMKMCLKYYI  278

Query  774  RGEKK  788
            + E+K
Sbjct  279  QDERK  283



>emb|CAN70332.1| hypothetical protein VITISV_001431 [Vitis vinifera]
Length=242

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 191/237 (81%), Gaps = 0/237 (0%)
 Frame = +3

Query  441   GLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKP  620
             GLL VT+DG V+ +T EA+G+KFKLTD VDVA DGM+YFTDAS+KYGL++ I + LEG+P
Sbjct  4     GLLEVTADGMVKTLTDEAEGLKFKLTDGVDVAVDGMIYFTDASYKYGLKEHIXDILEGRP  63

Query  621   HGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIE  800
             HGRL+S+DP TK+TKVLV DLFFANGV V PDQ+ VI CE++MRRC KY+I+GEKKGS++
Sbjct  64    HGRLMSFDPSTKETKVLVRDLFFANGVVVSPDQNSVIVCESVMRRCLKYHIQGEKKGSVD  123

Query  801   VFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEK  980
              FI+NLPG PDNI YDGEG +WI + +  + A++L  +YP +RK++ +ME+Y VRP++EK
Sbjct  124   KFIDNLPGPPDNILYDGEGHYWIALPMGNSLAWDLALKYPWIRKVVAIMERYKVRPHIEK  183

Query  981   NGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVA  1151
             NGG+  VD+EG P A+Y++   + VS+G+KIGNY+YCG V   +++ L+L Q+ A A
Sbjct  184   NGGVLAVDLEGKPTAYYHDPGLSEVSSGVKIGNYLYCGSVAKPYMIRLDLHQHVARA  240



>ref|XP_009350729.1| PREDICTED: protein YLS2-like, partial [Pyrus x bretschneideri]
Length=300

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 195/239 (82%), Gaps = 1/239 (0%)
 Frame = +3

Query  441   GLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKP  620
             GLL ++ +G ++++T EA+GVKFKLTD VDVAEDGM+YFTDAS+KY L++FI + LEG+P
Sbjct  61    GLLKISEEGIIELLTDEAEGVKFKLTDCVDVAEDGMIYFTDASYKYSLDEFILDILEGRP  120

Query  621   HGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIE  800
             +GR LSY+P TK+TKVLV +L+FANGVAV PDQ++VIFCET+MRRC+KYY++G KKGS+E
Sbjct  121   YGRFLSYNPLTKETKVLVRNLYFANGVAVSPDQNYVIFCETVMRRCRKYYLQGSKKGSVE  180

Query  801   VFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKY-GVRPNME  977
              FI+ LPG PDNIRYDGEG +WI +  +    ++L  RYP +RK+L ++++Y G  P++E
Sbjct  181   NFIDQLPGTPDNIRYDGEGHYWIALATDVKPYWDLALRYPFIRKVLAIVKRYAGGWPHLE  240

Query  978   KNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVAS  1154
             KN G+FVV+++G P+AHY + +  L+++GIKIG Y+YCG V Y +I+ L+L ++PA A+
Sbjct  241   KNAGVFVVNLDGEPIAHYSDPELFLITSGIKIGKYLYCGSVFYPYIIRLDLDRHPAHAT  299



>gb|ABG66230.1| Strictosidine synthase family protein, expressed [Oryza sativa 
Japonica Group]
Length=287

 Score =   305 bits (781),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 192/267 (72%), Gaps = 7/267 (3%)
 Frame = +3

Query  75   AVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPED  254
            A LV V+ GV +Y  + F PAP P  E + G+P  AP+   R L  SE++G GRL  PED
Sbjct  14   AALV-VLAGVALYSPEGFSPAPMPP-EYSYGAPVSAPRHEPRALAASERVGEGRLPAPED  71

Query  255  IVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADA  434
            + YD   G +YTGC DGWV+RV+V+        VEDW  TGGRPLG+A    G ++VADA
Sbjct  72   LAYDAAGGWLYTGCGDGWVRRVSVSSGD-----VEDWARTGGRPLGVALTADGGLVVADA  126

Query  435  EIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEG  614
            +IGLL V+ D  V+++T EA+GVKF LTD VDVA DG++YFTDAS K+ L +F+ + LE 
Sbjct  127  DIGLLKVSPDKAVELLTDEAEGVKFALTDGVDVAGDGVIYFTDASHKHSLAEFMVDVLEA  186

Query  615  KPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGS  794
            +PHGRL+S+DP T++T VL   L+FANGVAV PDQ  ++FCET+MRRC +Y+I G+K G+
Sbjct  187  RPHGRLMSFDPSTRRTTVLARGLYFANGVAVSPDQDSLVFCETVMRRCSRYHINGDKAGT  246

Query  795  IEVFIENLPGMPDNIRYDGEGLFWIGI  875
            ++ FI +LPG PDNIRYDGEG +WI I
Sbjct  247  VDKFIGDLPGFPDNIRYDGEGRYWIAI  273



>emb|CBI38398.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   306 bits (785),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/240 (62%), Positives = 186/240 (78%), Gaps = 2/240 (1%)
 Frame = +3

Query  78   VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDI  257
            +L PV   + +YQLDSFDPA  P HE +Q  P   PK N R+L  SE IG G L GPEDI
Sbjct  117  ILTPVAAAIFLYQLDSFDPASLPTHEFSQ-EPMPVPKLNPRMLQGSEMIGQGNLLGPEDI  175

Query  258  VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
             YD  + +IYTGC DGWVKRVT+NES AA+S V +W  TGGRPLG+A G  GEV+VADAE
Sbjct  176  AYDANSHLIYTGCADGWVKRVTLNES-AANSVVHNWAFTGGRPLGVALGRVGEVLVADAE  234

Query  438  IGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGK  617
             GLL ++ DG ++++T EA+G+KFK T+AVDVA DGM+YFTDAS+KYGL +FIWE LE +
Sbjct  235  KGLLEISGDGVMKLLTDEAEGLKFKQTNAVDVAVDGMIYFTDASYKYGLIEFIWEILEVR  294

Query  618  PHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSI  797
            PHGRLLS+DP T++T VL+ DL+ ANGV V PDQ+ V+FCET+M+R  KYYI+G++KGS+
Sbjct  295  PHGRLLSFDPSTQETIVLLRDLYLANGVVVSPDQTSVVFCETLMKRYTKYYIQGKRKGSV  354



>ref|XP_006828750.1| hypothetical protein AMTR_s00001p00067420 [Amborella trichopoda]
 gb|ERM96166.1| hypothetical protein AMTR_s00001p00067420 [Amborella trichopoda]
Length=373

 Score =   305 bits (782),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 153/350 (44%), Positives = 228/350 (65%), Gaps = 9/350 (3%)
 Frame = +3

Query  108   IYQLDSFDPAPYPAHELTQGSPAVAPKR--NGRLLHDSEKIGVGRLSGPEDIVYDPKTGV  281
             ++ ++ FD +P P ++     P +   R  N R+  D E++  G + GPED+ YD + G 
Sbjct  30    LWIVEPFDTSPIPDYD-----PEIRHVREQNLRVARDLERVAEGLVMGPEDLAYDAQEGA  84

Query  282   IYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTS  461
             +Y    DGWVK+V    +   + AV +   TGGRPLG+A G   EV V DA  GLL V +
Sbjct  85    VYVTTADGWVKKVE-GVAYGGEIAVRNLSFTGGRPLGVALGPSKEVFVCDAYKGLLKV-A  142

Query  462   DGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSY  641
             D KV+V++  A+GVKFKL D +DVA DG +YFTDAS+KY L+  + +  EG+PHGRLL +
Sbjct  143   DNKVEVLSDGAEGVKFKLADGLDVASDGTIYFTDASYKYDLDHHMLDIFEGRPHGRLLRF  202

Query  642   DPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLP  821
             +P T +T VL+  L+FANG+A+ P+Q F+++CE+ + RC KY+I G+KKGS E+FI+ LP
Sbjct  203   EPSTGETHVLLKGLYFANGLALSPNQDFLVYCESTLARCVKYWIEGDKKGSTEIFIDKLP  262

Query  822   GMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVV  1001
             G+PDNIRYDGEG FWIG+    T  F ++ +Y ++RK + ++ K+ + P  + NGG+  V
Sbjct  263   GVPDNIRYDGEGRFWIGLATGKTAFFNIMLKYAVVRKAMVIVSKFIMLPEFQMNGGVLAV  322

Query  1002  DMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVA  1151
              + G  +A Y + + + V+ GIKIG Y+Y G++   +I  L+L +  A A
Sbjct  323   SLTGEAIALYSDPELSKVTGGIKIGKYLYIGYLDKSYIGRLDLKKYAASA  372



>gb|KHN09361.1| Adipocyte plasma membrane-associated protein [Glycine soja]
Length=286

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/314 (46%), Positives = 201/314 (64%), Gaps = 33/314 (11%)
 Frame = +3

Query  213   SEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLG  392
             SE++G G L GPED+ YD    V+YTGC DGW+KRVTVN+S                   
Sbjct  5     SERVGEGHLEGPEDLAYDAAARVVYTGCEDGWIKRVTVNDS-------------------  45

Query  393   LAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASW  572
                       V D+  GLL V+S+ +++++  E +G+KFKLTD VD+A+DG +YFTDAS 
Sbjct  46    ----------VLDS--GLLRVSSEKEIELLVDEFEGLKFKLTDGVDIADDGTIYFTDASH  93

Query  573   KYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMR  752
             KY ++D +++ LEGKP+GR  SY+P TK+T +L  DL+FANGVAV  DQ FV+FCE+++ 
Sbjct  94    KYPVKDAVFDVLEGKPNGRFFSYNPATKKTTLLAQDLYFANGVAVSADQQFVVFCESVLM  153

Query  753   RCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRK  932
             RC KY++ G K G+IE F  +LPGMPDNI YDG+G + I +    +   EL  RYP +RK
Sbjct  154   RCNKYFVLGPKTGTIEKFC-DLPGMPDNIHYDGQGHYLIAMFTALSPELELAYRYPFIRK  212

Query  933   ILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGF  1112
                +  KY    ++ KNGG+ VVD+EG P AHYY+    L S  IKIGN++Y G + Y F
Sbjct  213   AFAIFTKYVGSLSISKNGGVLVVDLEGKPTAHYYDPKLALTS-AIKIGNHIYAGSIFYPF  271

Query  1113  ILSLNLTQNPAVAS  1154
             +   ++ + PA+ +
Sbjct  272   VTRFDVEKYPALPT  285



>ref|XP_002985221.1| hypothetical protein SELMODRAFT_157072 [Selaginella moellendorffii]
 gb|EFJ13715.1| hypothetical protein SELMODRAFT_157072 [Selaginella moellendorffii]
Length=361

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 209/318 (66%), Gaps = 15/318 (5%)
 Frame = +3

Query  201   LLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGG  380
             LL + +++GVG L GPEDI  D   GV+YTGC DGW+KR+           V++WV  GG
Sbjct  52    LLQELDELGVGELPGPEDIAVD-DNGVLYTGCADGWIKRIFPETGE-----VQNWVQVGG  105

Query  381   RPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFT  560
              PLGLA G HG ++V +   GLLN+T+D  ++V++ EADGVK+KLTD +DVA+DG +YFT
Sbjct  106   HPLGLAWGHHGNLLVCEPTRGLLNITADKALEVLSNEADGVKYKLTDGLDVAKDGSIYFT  165

Query  561   DASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCE  740
             DA+ ++G+    ++ L+G+P+GRLL YDP T+ T VL  +++FANGVA+   Q F++ CE
Sbjct  166   DATHEFGMNTSDFDILQGRPNGRLLKYDPSTRTTTVLRKNMYFANGVALSAKQDFLVVCE  225

Query  741   TIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYP  920
             T M RC KY+++GEKKG++EVFI+NLPG PDNIR++G   FWIG+    T   + + +  
Sbjct  226   TSMVRCMKYWLQGEKKGTMEVFIDNLPGHPDNIRHNGRDRFWIGLIAGRTRLTDTLMKIA  285

Query  921   LLRKIL---GVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RDFTLVSTGIKIGNY  1082
              L+ IL   GV++K      M K   +  V  +G P+A Y +   +   LV+T +++G+Y
Sbjct  286   PLKHILALPGVLQKISTSSKMAK---VLAVGEDGVPLAFYEDPTGKSIALVTTALEVGDY  342

Query  1083  MYCGFVKYGFILSLNLTQ  1136
             +Y G +   ++  L L Q
Sbjct  343   LYLGNLARNYVGKLKLRQ  360



>gb|ABR18309.1| unknown [Picea sitchensis]
Length=365

 Score =   283 bits (723),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/327 (43%), Positives = 212/327 (65%), Gaps = 13/327 (4%)
 Frame = +3

Query  183   PKRNGRLLHD-----SEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAAD  347
             P+R G   H+     + K+G G +S PED+  D + G +YTG  DGW+KR++  ++   D
Sbjct  41    PQRLGVFAHNNRLQNAHKLGSGLISNPEDLAVDSQ-GRLYTGSGDGWIKRISFVDN--LD  97

Query  348   SAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAV  527
               VE+W   GGRPLGLA G+HGE++V +   GLLNVT +G V+++  EADG+KFK  D V
Sbjct  98    VLVENWTYVGGRPLGLAFGIHGELLVCEPSQGLLNVT-EGHVEILAEEADGLKFKFADGV  156

Query  528   DVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAV  707
             D + +G +YFTDAS+KYG  D + + LE +PHGRLL YD  TK T VL+ DL+F NGVA+
Sbjct  157   DASREGAVYFTDASYKYGFHDHLLDMLEYRPHGRLLKYDSSTKTTSVLLKDLYFPNGVAL  216

Query  708   FPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEY  887
                Q F++FCET + RC+KY++ G +KG++E FI+NLPG+PDNI YDG G FWI +    
Sbjct  217   SAKQDFLVFCETTLYRCQKYWLEGPEKGTVESFIDNLPGLPDNIHYDGNGTFWIALATSR  276

Query  888   THAFELIQRYPLLRKILGVMEKY---GVRPNMEKNGGIFVVDMEGNPVAHYYERDFT-LV  1055
             T ++ +  ++P +R +L ++ +     V   +     +  V+  GNP+A Y + + +  +
Sbjct  277   TLSWTIATKFPSVRHVLALIARLAPGAVIDAIVNEPSVLAVNEMGNPIALYADPNLSNQI  336

Query  1056  STGIKIGNYMYCGFVKYGFILSLNLTQ  1136
             ++G+K+G+ +Y G +   +I  + LT+
Sbjct  337   NSGLKMGDSLYYGSLTADYIGHVPLTE  363



>ref|XP_002970033.1| hypothetical protein SELMODRAFT_171056 [Selaginella moellendorffii]
 gb|EFJ29157.1| hypothetical protein SELMODRAFT_171056 [Selaginella moellendorffii]
Length=361

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/318 (45%), Positives = 208/318 (65%), Gaps = 15/318 (5%)
 Frame = +3

Query  201   LLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGG  380
             LL + +++GVG L GPEDI  D   GV+YTGC DGW+KR+           V++WV  GG
Sbjct  52    LLQELDELGVGELPGPEDIAVD-DNGVLYTGCADGWIKRIFPETGE-----VQNWVQVGG  105

Query  381   RPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFT  560
              PLGLA G HG ++V +   GLLNVT+D  ++V++ EADGVK+KLTD +DVA+DG +YFT
Sbjct  106   HPLGLAWGHHGNLLVCEPTRGLLNVTADKALEVLSNEADGVKYKLTDGLDVAKDGSIYFT  165

Query  561   DASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCE  740
             DA+ K+G+     + L+G+P+GRLL YDP T+ T VL  +++FANGVA+   Q F++ CE
Sbjct  166   DATHKFGMNTSDLDILQGRPNGRLLKYDPSTRTTTVLRKNMYFANGVALSAKQDFLVVCE  225

Query  741   TIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYP  920
             T M RC KY+++GE++G++EVFI+NLPG PDNIR++G   FWIG+    T   + + +  
Sbjct  226   TSMVRCMKYWLQGEREGTMEVFIDNLPGHPDNIRHNGRDRFWIGLVAGRTRLTDTLVKIA  285

Query  921   LLRKIL---GVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RDFTLVSTGIKIGNY  1082
              L+ IL   GV++K      M K   +  V  +G P+A Y +   +   LV+T +++G+Y
Sbjct  286   PLKHILALPGVLQKISASSKMAK---VLAVGEDGVPLAFYEDPTGKSIALVTTALEVGDY  342

Query  1083  MYCGFVKYGFILSLNLTQ  1136
             +Y G +   ++  L L Q
Sbjct  343   LYLGNLARNYVGKLKLRQ  360



>gb|KHN00425.1| Adipocyte plasma membrane-associated protein [Glycine soja]
Length=475

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/269 (51%), Positives = 191/269 (71%), Gaps = 2/269 (1%)
 Frame = +3

Query  348   SAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAV  527
             S + +WVNTGGRPLGL    +GE+IVADAE GLL V+S+ +++++  E +G+KFKLTD V
Sbjct  208   SLISNWVNTGGRPLGLTLKPNGELIVADAEKGLLRVSSEREIELLVDEYEGLKFKLTDGV  267

Query  528   DVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAV  707
             DVA+DG +YFTDAS KY ++D + + LEGKP+GR  SY+P TK+T +L  DL+FANGVAV
Sbjct  268   DVADDGTIYFTDASHKYPVKDAVLDILEGKPNGRFFSYNPATKKTTLLAKDLYFANGVAV  327

Query  708   FPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEY  887
               DQ FV+FCE+++  C+KYY++G KKG+IE F + LPGMPDNI YDG+G + I +    
Sbjct  328   SADQQFVVFCESVLMICEKYYVQGPKKGTIEKFCD-LPGMPDNIHYDGQGHYLIAMVTAL  386

Query  888   THAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGI  1067
             T   EL  RYP +RK   ++ KY     + KNGG+ VVD+EG   AHYY+   +L S  I
Sbjct  387   TPELELAYRYPFIRKTFAIVTKYVGSLPISKNGGVLVVDLEGKLTAHYYDPKLSLTS-AI  445

Query  1068  KIGNYMYCGFVKYGFILSLNLTQNPAVAS  1154
             KIGN++Y G + Y F+   ++ + PA+ +
Sbjct  446   KIGNHIYGGSIFYPFVTRFDIEKYPALPT  474


 Score =   243 bits (621),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 158/219 (72%), Gaps = 2/219 (1%)
 Frame = +3

Query  420   IVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIW  599
             +VADA  GLL VT   KV+V+  E +G+KF LTD VDVAEDG +YFTDA++K+ L+D+  
Sbjct  1     MVADAFKGLLRVTRKKKVEVLADEVEGLKFNLTDGVDVAEDGTIYFTDATYKHSLDDYYN  60

Query  600   EFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRG  779
             + +EGKPHGR ++Y+P TK+  VL  +L+F NGV V  DQ FVI+CETIM+RC+KYYI G
Sbjct  61    DIIEGKPHGRFMNYNPETKKVTVLARNLYFPNGVVVSHDQHFVIYCETIMKRCRKYYIEG  120

Query  780   EKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYG  959
              KKG I  F  +LPGMPDNI Y G+G ++I +    T  ++L+ RYP ++K+  ++ KY 
Sbjct  121   PKKGRIGEFCRDLPGMPDNIHYVGQGQYYIAMATSLTPEWDLLLRYPFIQKVAAMVTKYV  180

Query  960   VRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIG  1076
             ++P  ++NGG+ VVD+EG P AHYY+ + +L+S  +  G
Sbjct  181   LQP--KENGGVLVVDLEGKPTAHYYDSELSLISNWVNTG  217



>ref|XP_003629183.1| Adipocyte plasma membrane-associated protein [Medicago truncatula]
Length=271

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 170/238 (71%), Gaps = 2/238 (1%)
 Frame = +3

Query  441   GLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKP  620
             GLL VT + +++V+  E DG+KFK+ D VDVA DG +YFT+AS KY  +D + + LEG P
Sbjct  35    GLLRVTREKEIEVLVTEIDGLKFKVIDGVDVAHDGTIYFTEASSKYSYKDSVLDILEGNP  94

Query  621   HGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIE  800
             +GR  SY+P TK+T +LV DL+ ANGVAV PDQ+FV+FCET M  CKKYYI G KKGS E
Sbjct  95    NGRFFSYNPATKKTTLLVRDLYIANGVAVSPDQNFVVFCETSMMNCKKYYIGGTKKGSTE  154

Query  801   VFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEK  980
              F + LPGMPDNI YDG+G +WIGI   ++   +LI +YP +RK+L ++ K  +  N  K
Sbjct  155   KFCD-LPGMPDNIHYDGQGQYWIGIATAFSPELDLIFKYPFIRKVLAIIIKKVLSLNFSK  213

Query  981   NGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVAS  1154
             NGG+ +VD+EG P  HYY+   +L + GIKIGN++YCG + Y FI  L++ + PA+ +
Sbjct  214   NGGVIIVDLEGKPTTHYYDPKLSL-TGGIKIGNHLYCGSILYPFITRLDIEKYPALPT  270



>gb|EMT15958.1| Adipocyte plasma membrane-associated protein [Aegilops tauschii]
Length=284

 Score =   266 bits (679),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 178/261 (68%), Gaps = 1/261 (0%)
 Frame = +3

Query  360   DWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAE  539
             DW  TGGRPLG+     G ++VADA+ GLL V  D  V+++T  A+G+KF LTD VD+A 
Sbjct  20    DWAYTGGRPLGVVLAGDGGLVVADADKGLLKVRPDKTVEMLTDAAEGLKFALTDGVDIAA  79

Query  540   DGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQ  719
             DG +YFTDAS+KY L D   + LE +PHGRL+S+DP T++T VL  DL+FANGVAV PDQ
Sbjct  80    DGTIYFTDASYKYSLADHFLDVLEARPHGRLMSFDPSTRRTSVLARDLYFANGVAVAPDQ  139

Query  720   SFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAF  899
               +IFCET+MRRC +Y+IRG+K G++E FI++LPG+PDNIRY+GEG +WI +    T   
Sbjct  140   DSLIFCETVMRRCSRYHIRGDKAGTVESFIDSLPGLPDNIRYNGEGRYWIALSAGRTLQL  199

Query  900   ELIQRYPLLRKILGVMEKYGVR-PNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIG  1076
             +++   PL+RK++ ++ KY +  P   ++ G   V + G P   Y +    L +  +K+G
Sbjct  200   DVLMWSPLVRKLVYMVGKYVMAVPQGLRDSGTMSVALNGEPATMYTDPGLALATGWLKVG  259

Query  1077  NYMYCGFVKYGFILSLNLTQN  1139
              Y+Y G +   +I  ++LT++
Sbjct  260   GYLYYGSLASSYISRVDLTKS  280



>gb|KHF98690.1| Adipocyte plasma membrane-associated [Gossypium arboreum]
Length=254

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 170/238 (71%), Gaps = 3/238 (1%)
 Frame = +3

Query  450   NVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGR  629
              +  DG ++V+  EA+ +KFKLTD VDVA+DG +YFTDAS+KY L +F  + +EG+P GR
Sbjct  16    TINKDGAIEVLADEAEALKFKLTDGVDVAKDGTVYFTDASYKYNLHEFFQDIMEGRPRGR  75

Query  630   LLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFI  809
             L+S+DP +K+  VL+ DL+FANG+AV P Q  VIFCET MRRC+KYYI G KKG +E FI
Sbjct  76    LISFDPISKRPNVLLTDLYFANGIAVSPHQDCVIFCETPMRRCRKYYIEGHKKGHVEKFI  135

Query  810   ENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEK---YGVRPNMEK  980
             +NLPGMPDNI+YDG+G +WI +    T  +++  RY ++RK   ++++   +  R   EK
Sbjct  136   DNLPGMPDNIKYDGDGHYWIALPTGNTMFWDIAMRYSMVRKAAAMVDRWIGWIGRIKSEK  195

Query  981   NGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVAS  1154
             NGG+ VVD+ G PVAHY + + T+V++G K+ N++Y G     +I+ ++L Q+PA  S
Sbjct  196   NGGMLVVDINGKPVAHYRDVELTMVTSGFKLKNHLYIGSFILPYIIRIDLDQHPARHS  253



>ref|XP_001766712.1| predicted protein [Physcomitrella patens]
 gb|EDQ68565.1| predicted protein [Physcomitrella patens]
Length=359

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/337 (42%), Positives = 201/337 (60%), Gaps = 19/337 (6%)
 Frame = +3

Query  135   APYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVK  314
             AP+P  E        AP     LL   EK+G G+L  PEDI+ DP    +Y    DGW+K
Sbjct  37    APFPKAE-----GVYAPNT---LLQSVEKLGTGKLLQPEDIIVDPSGKFLYVSTSDGWIK  88

Query  315   RVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEA  494
             ++ +     AD +VEDW + GGRPLGLA G  GEV+V +   GLL VT +G V+V+  E 
Sbjct  89    KLYL-----ADGSVEDWKHVGGRPLGLAVGNDGEVLVCEPSTGLLKVTDEG-VEVLVTEV  142

Query  495   DGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLV  674
             +G K    DAV VA+DG++YFTDAS KY L+DF+ + LE +PHGRLL Y+P  K +++L 
Sbjct  143   EGTKLNFVDAVAVAKDGLIYFTDASTKYPLDDFVLDNLESRPHGRLLVYNPEDKTSRILR  202

Query  675   NDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGE  854
              DL+ ANG+ +  D  +++F ET+  R  KYY++G KKGSIE+  ENLPG PDN+ YD E
Sbjct  203   KDLYMANGITLSKDDEYLVFAETVAARISKYYLKGNKKGSIEIINENLPGFPDNVHYDSE  262

Query  855   -GLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKY-GVRPNMEKNGGIFVVDMEGNPVAH  1028
               L +IGI  +   A ++  + P L+K + + E   G   N  K G + V+D  G PV  
Sbjct  263   RELLYIGIVGQRDAALDVFLKTPWLKKFVALYESVRGAVDNSNKMGRVLVIDNNGTPVKS  322

Query  1029  YYERDFTLV---STGIKIGNYMYCGFVKYGFILSLNL  1130
             Y +    +V   + G+++  Y+Y G ++  ++  + L
Sbjct  323   YQDPTGKVVGFTTGGVEVDGYVYVGGLRDDYVGRVKL  359



>ref|XP_002993328.1| hypothetical protein SELMODRAFT_136874 [Selaginella moellendorffii]
 gb|EFJ05653.1| hypothetical protein SELMODRAFT_136874 [Selaginella moellendorffii]
Length=363

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 205/330 (62%), Gaps = 21/330 (6%)
 Frame = +3

Query  180   APKRNG-----RLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAA  344
              PKR G      +L  +E IGVG L GPEDI  D   GV+YTGC DGW+KRV     S  
Sbjct  40    TPKREGLFAVNTVLQQAEVIGVGELPGPEDISLDDDNGVLYTGCSDGWIKRV-----SRK  94

Query  345   DSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDA  524
                VE+WVN GG  LG+  G    ++V     GLLN+T D +V+V+++EADGVKF + + 
Sbjct  95    TGEVENWVNVGGPTLGVVRGQQKNLLVCVPGRGLLNITRDKRVEVLSSEADGVKFMVANG  154

Query  525   VDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVA  704
             +DVA+DG +YFTDA+ K+ LE    + L+ +P+GRLL YDP T+ T VL  ++FFANGV+
Sbjct  155   LDVAKDGTIYFTDATSKFPLEKAKLDVLQCRPNGRLLKYDPATRTTTVLRKNMFFANGVS  214

Query  705   VFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIE  884
             +   + F++  ET M  C KY+++G+K G++EVF++NL G PDN++ DG G FWI +   
Sbjct  215   LSAKEDFLVVSETSM--CMKYWLKGKKAGTMEVFMDNLLGQPDNVKRDGHGGFWIALVSG  272

Query  885   YTHAFELIQRYPLLRKILG---VMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RDF  1046
              T   ++I + P L+ I+    V++K+     M K   +  V  +G P+A Y +   +  
Sbjct  273   RTWLSDMILKIPALKYIIAQPEVLDKFFGNARMAK---VLRVSEDGRPLAFYEDPTGKVV  329

Query  1047  TLVSTGIKIGNYMYCGFVKYGFILSLNLTQ  1136
               V+TG+++G+Y+Y G ++  FI  LNL +
Sbjct  330   GFVTTGLEVGDYLYLGSLERKFIGGLNLQE  359



>ref|NP_001065198.1| Os10g0543500 [Oryza sativa Japonica Group]
 dbj|BAF27112.1| Os10g0543500, partial [Oryza sativa Japonica Group]
Length=255

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 176/246 (72%), Gaps = 1/246 (0%)
 Frame = +3

Query  411   GEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLED  590
             G ++VADA+IGLL V+ D  V+++T EA+GVKF LTD VDVA DG++YFTDAS K+ L +
Sbjct  5     GGLVVADADIGLLKVSPDKAVELLTDEAEGVKFALTDGVDVAGDGVIYFTDASHKHSLAE  64

Query  591   FIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYY  770
             F+ + LE +PHGRL+S+DP T++T VL   L+FANGVAV PDQ  ++FCET+MRRC +Y+
Sbjct  65    FMVDVLEARPHGRLMSFDPSTRRTTVLARGLYFANGVAVSPDQDSLVFCETVMRRCSRYH  124

Query  771   IRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVME  950
             I G+K G+++ FI +LPG PDNIRYDGEG +WI I    T  ++++ R P +RK++ +++
Sbjct  125   INGDKAGTVDKFIGDLPGFPDNIRYDGEGRYWIAISAGRTLQWDVLTRSPFVRKLVYMVD  184

Query  951   KYGVR-PNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLN  1127
             ++ V  P+  KN G   V + G PV+ Y +    L +  +K+G+Y+Y G +   ++  ++
Sbjct  185   RFVVAVPHNLKNAGAMSVTLAGEPVSMYSDPGLALTTGWLKVGDYLYYGSLTKPYLSRID  244

Query  1128  LTQNPA  1145
             L ++PA
Sbjct  245   LAKSPA  250



>ref|XP_002979226.1| hypothetical protein SELMODRAFT_110343 [Selaginella moellendorffii]
 gb|EFJ19634.1| hypothetical protein SELMODRAFT_110343 [Selaginella moellendorffii]
Length=364

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 129/327 (39%), Positives = 203/327 (62%), Gaps = 16/327 (5%)
 Frame = +3

Query  180   APKRNG-----RLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAA  344
             AP+R G       L   EKIGVG  SG ED+  D + G IY+G  DGW+KR        A
Sbjct  37    APERQGIYAANAALQRVEKIGVGFFSGAEDLAVD-QEGRIYSGGKDGWIKRYF-----PA  90

Query  345   DSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDA  524
                +E+W+  GG PLG+A G +GE+I  +  +GLLNVT D  V++++ EADG+K+K+ D 
Sbjct  91    TGRIENWIYVGGHPLGMAIGKYGELIAVEPVMGLLNVT-DAGVEILSNEADGLKYKIADE  149

Query  525   VDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVA  704
             + VA D  +YFTDAS K+ + D   + LE +P+GR+L +DP ++ T VL+ DL+F NGVA
Sbjct  150   LVVARDNTIYFTDASTKFDVADCRLDILESRPNGRILKFDPSSRTTSVLLKDLYFPNGVA  209

Query  705   VFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIE  884
             +  D+++++FCET   RC+KY++RGEK GSIE F++NLP  PDNI  +  G FWI +  +
Sbjct  210   LSRDENYLVFCETSKARCRKYWLRGEKMGSIENFLDNLPAFPDNIHINAGGNFWIALVSD  269

Query  885   YTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RDFTLV  1055
                  ELI   PLL+K++  +  +    +++ +  +  VD +G P+  Y +   ++   V
Sbjct  270   RLWHIELISNSPLLKKLVSHLVPFLPDESLQ-SAKVLAVDPDGRPLEFYEDPTGKEMAFV  328

Query  1056  STGIKIGNYMYCGFVKYGFILSLNLTQ  1136
             ++ +++G+++Y G +   +I  + L+ 
Sbjct  329   TSALQVGDHLYLGNLAKSYIGRIKLSS  355



>gb|ABK25036.1| unknown [Picea sitchensis]
Length=367

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/318 (41%), Positives = 193/318 (61%), Gaps = 5/318 (2%)
 Frame = +3

Query  138   PYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKR  317
             P P H L +  PA         L+++ K+G G + G ED+  D +    +TGC DGW+KR
Sbjct  35    PLPVHLLPR-PPAEGVYAPNFRLNNAVKVGSGLIPGGEDLAVDREGRSFFTGCSDGWIKR  93

Query  318   VTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEAD  497
             V +++  A    VE+W   GGRPLGLA G   E+IV   + GLLNVT D KV+V+  EA 
Sbjct  94    VWIDQPDA--ERVENWTFVGGRPLGLALGPMDELIVCAGDRGLLNVTGD-KVEVLCTEAG  150

Query  498   GVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVN  677
             G+ FK  D VDV ++G++YFT+ ++KY  +D +    E  PHGRLL YDP TK   VL+ 
Sbjct  151   GLPFKTVDGVDVTKEGVVYFTELTYKYSPKDILLGVFEYLPHGRLLRYDPSTKSATVLLT  210

Query  678   DLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEG  857
             DL+F N VA+   + F I+CET++ RC+KY++ GEK G +E FIENLPG PDN+  D +G
Sbjct  211   DLYFPNAVALSKKEDFFIYCETLIFRCRKYWLEGEKAGKVETFIENLPGFPDNVILDDDG  270

Query  858   LFWIGIGIEYTHAFELIQRYPLLRKILGVMEKY-GVRPNMEKNGGIFVVDMEGNPVAHYY  1034
              +WIG+  E    ++L  +Y  LR +L  +  +  + P +    G+  V  +G  +A+Y 
Sbjct  271   TYWIGLIGERNIFWDLAAKYTSLRHLLLRISSFINLDPFLFPTAGVVGVREDGEAIAYYS  330

Query  1035  ERDFTLVSTGIKIGNYMY  1088
             +   + +++G+K+G  +Y
Sbjct  331   DPKRSFITSGVKMGGRLY  348



>gb|ABK21480.1| unknown [Picea sitchensis]
 gb|ADE76417.1| unknown [Picea sitchensis]
Length=367

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/318 (41%), Positives = 193/318 (61%), Gaps = 5/318 (2%)
 Frame = +3

Query  138   PYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKR  317
             P P H L +  PA         L+++ K+G G + G ED+  D +    +TGC DGW+KR
Sbjct  35    PLPVHLLPR-PPAEGVYAPNFRLNNAVKVGSGLIPGGEDLAVDREGRSFFTGCSDGWIKR  93

Query  318   VTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEAD  497
             V +++  A    VE+W   GGRPLGLA G   E+IV   + GLLNVT D KV+V+  EA 
Sbjct  94    VWIDQPDA--ERVENWTFVGGRPLGLALGPMDELIVCAGDRGLLNVTGD-KVEVLCTEAG  150

Query  498   GVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVN  677
             G+ FK  D VDV ++G++YFT+ ++KY  +D +    E  PHGRLL YDP TK   VL+ 
Sbjct  151   GLPFKTVDGVDVTKEGVVYFTELTYKYSPKDILLGVFEYLPHGRLLKYDPITKSATVLLT  210

Query  678   DLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEG  857
             DL+F N VA+   + F I+CET++ RC+KY++ GEK G +E FIENLPG PDN+  D +G
Sbjct  211   DLYFPNAVALSKKEDFFIYCETVIFRCRKYWLEGEKAGKVETFIENLPGFPDNVILDDDG  270

Query  858   LFWIGIGIEYTHAFELIQRYPLLRKILGVMEKY-GVRPNMEKNGGIFVVDMEGNPVAHYY  1034
              +WIG+  E    ++L  +Y  LR +L  +  +  + P +    G+  V  +G  +A+Y 
Sbjct  271   TYWIGLIGERNIFWDLAAKYTSLRHLLLRISSFINLDPFLFPTAGVVGVREDGEAIAYYS  330

Query  1035  ERDFTLVSTGIKIGNYMY  1088
             +   + +++G+K+G  +Y
Sbjct  331   DPKRSFITSGVKMGGRLY  348



>gb|EAY79392.1| hypothetical protein OsI_34518 [Oryza sativa Indica Group]
Length=281

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/243 (47%), Positives = 171/243 (70%), Gaps = 3/243 (1%)
 Frame = +3

Query  426   ADAE--IGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIW  599
             ADA   +GLL V+ D  V+++T EA+GVKF LTD VDVA DG++YFTDAS K+ L +F+ 
Sbjct  34    ADAARVLGLLKVSPDKAVELLTDEAEGVKFALTDGVDVAGDGVIYFTDASHKHSLAEFMV  93

Query  600   EFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRG  779
             + LE +PHGRL+S+DP T++T VL   L+FANGVAV PDQ  ++FCET+MRRC +Y+I G
Sbjct  94    DVLEARPHGRLMSFDPSTRRTTVLARGLYFANGVAVSPDQDSLVFCETVMRRCSRYHING  153

Query  780   EKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYG  959
             +K G+++ FI +LPG PDNIRYDGEG +WI I    T  ++++ R P +RK++ +++++ 
Sbjct  154   DKAGTVDKFIGDLPGFPDNIRYDGEGRYWIAISAGRTLQWDVLTRSPFVRKLVYMVDRFV  213

Query  960   VR-PNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQ  1136
             V  P+  KN G   V + G PV+ Y +    L +  +K+G+Y+Y G +   ++  ++L +
Sbjct  214   VAVPHNLKNAGAMSVTLAGEPVSMYSDPGLALTTGWLKVGDYLYYGSLTKPYLSRIDLAK  273

Query  1137  NPA  1145
             +PA
Sbjct  274   SPA  276



>ref|XP_002979137.1| hypothetical protein SELMODRAFT_153129, partial [Selaginella 
moellendorffii]
 gb|EFJ19545.1| hypothetical protein SELMODRAFT_153129, partial [Selaginella 
moellendorffii]
Length=356

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/304 (40%), Positives = 190/304 (63%), Gaps = 12/304 (4%)
 Frame = +3

Query  216   EKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGL  395
             E+IG G + G ED   D     +Y  C DGW++++ +      D +V++W   GGRPLG+
Sbjct  58    ERIGEGLIPGAEDFAVDQDERYLYAACSDGWIRQIDL-----VDHSVKNWSYVGGRPLGI  112

Query  396   AHGLH-GEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASW  572
             A GL   E++V + ++GLL+VT +G V+V++ +ADG+ +KL D +DVA DG +YFTDAS 
Sbjct  113   AAGLSKDEMLVCEPQMGLLSVTENG-VRVLSGQADGLSYKLADGLDVARDGTVYFTDAST  171

Query  573   KYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMR  752
              YGL DF  + LEG+P+GRLL Y P T QT VL+  LFF NGVA+  ++ F++FCET   
Sbjct  172   SYGLHDFDLDLLEGRPYGRLLEYRPRTNQTTVLLRSLFFPNGVALSENEDFLVFCETSQA  231

Query  753   RCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRK  932
             R ++Y++RG+K G+ EV+++NLPG+PDN+   G   FWI +    +  +E   ++PL++ 
Sbjct  232   RLQRYWLRGDKAGTAEVYVDNLPGLPDNVHRFGNH-FWIALLGGRSFLWEQALKFPLVKH  290

Query  933   ILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHY---YERDFTLVSTGIKIGNYMYCGFVK  1103
             ILG  ++  +         +  VD +G P+  Y          ++TG+++GN++Y G + 
Sbjct  291   ILGS-QRLLLHYLHTSYSRVLTVDEDGKPLDMYESLQSESIGFMTTGMRVGNFLYLGSLS  349

Query  1104  YGFI  1115
               +I
Sbjct  350   ANYI  353



>gb|EMS45922.1| Adipocyte plasma membrane-associated protein [Triticum urartu]
Length=258

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/236 (47%), Positives = 161/236 (68%), Gaps = 2/236 (1%)
 Frame = +3

Query  438   IGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGK  617
             +GLL V  D  V+++T  A+G+KF LTD VD+A DG +YFTDAS+KY L     + LE +
Sbjct  19    VGLLKVRPDKTVELLTDAAEGLKFALTDGVDIAADGTIYFTDASYKYSLAHHFLDVLEAR  78

Query  618   PHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSI  797
             PHGRL+S+DP T++T VL  DL+FANGVAV PDQ  +IFCET+MRRC +Y+IRG K G++
Sbjct  79    PHGRLMSFDPSTRRTSVLARDLYFANGVAVAPDQDSLIFCETVMRRCSRYHIRGNKAGTV  138

Query  798   EVFIENLPGMPDNIRYDGE-GLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVR-PN  971
             E FI++LPG+PDNIRYDGE G +WI +    T   +++   PL+RK++ ++EKY +  P 
Sbjct  139   ESFIDSLPGLPDNIRYDGEQGRYWIALSAGRTLQLDVLMWSPLVRKLVYMVEKYVMAVPQ  198

Query  972   MEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQN  1139
               ++ G   V + G PV  Y +    L +  +K+G Y+Y G +   +I  ++LT++
Sbjct  199   GLRDSGTMSVALNGEPVTMYTDPGLALATGWLKVGGYLYYGSLASSYISRVDLTKS  254



>ref|XP_002988510.1| hypothetical protein SELMODRAFT_128345 [Selaginella moellendorffii]
 gb|EFJ10306.1| hypothetical protein SELMODRAFT_128345 [Selaginella moellendorffii]
Length=305

 Score =   235 bits (599),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 122/306 (40%), Positives = 192/306 (63%), Gaps = 15/306 (5%)
 Frame = +3

Query  216   EKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGL  395
             E+IG G + G ED   D     +Y  C DGW++++ +      D +V++W   GGRPLG+
Sbjct  2     ERIGEGLIPGAEDFAVDQDERYLYAACSDGWIRQIDL-----VDHSVKNWSYVGGRPLGI  56

Query  396   AHGLH-GEVIVADAEI-GLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDAS  569
             A GL   E++V + ++ GLL+VT +G V+V++ +ADG+ +KL D +DVA DG +YFTDAS
Sbjct  57    AAGLSKDEMLVCEPQMKGLLSVTENG-VRVLSGQADGLSYKLADGLDVARDGTVYFTDAS  115

Query  570   WKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIM  749
               YGL DF  + LEG+P+GRLL Y P T QT VL+  LFF NGVA+  ++ F++FCET  
Sbjct  116   TSYGLHDFDLDLLEGRPYGRLLEYSPRTNQTTVLLRSLFFPNGVALSENEDFLVFCETSQ  175

Query  750   RRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIG-IGIEYTHAFELIQRYPLL  926
              R ++Y++RG+K G+ EV+++NLPG+PDN+   G   FWI  +G+  T   ++  ++PL+
Sbjct  176   ARLQRYWLRGDKAGTAEVYVDNLPGLPDNVHRFGNH-FWIALLGVSLT-VLKMPLKFPLV  233

Query  927   RKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHY---YERDFTLVSTGIKIGNYMYCGF  1097
             + ILG  ++  +         +  VD +G P+  Y          ++TG+++GN++Y G 
Sbjct  234   KHILGS-QRLLLHYLHTSYSRVLTVDEDGKPLDMYESLQSESIGFMTTGMRVGNFLYLGS  292

Query  1098  VKYGFI  1115
             +   +I
Sbjct  293   LSANYI  298



>ref|WP_003120501.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|EJY60260.1| hypothetical protein PACIG1_3958 [Pseudomonas aeruginosa CIG1]
 gb|EKA46934.1| hypothetical protein PABE173_4446 [Pseudomonas aeruginosa ATCC 
25324]
 gb|EMZ53085.1| hypothetical protein HMPREF1223_10225 [Pseudomonas aeruginosa 
str. Stone 130]
 gb|ERV10578.1| hypothetical protein Q073_03183 [Pseudomonas aeruginosa BL19]
 gb|ERX61436.1| hypothetical protein Q006_00791 [Pseudomonas aeruginosa UDL]
 gb|ERY01043.1| hypothetical protein Q077_04850 [Pseudomonas aeruginosa BL23]
Length=353

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 192/328 (59%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+++  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVEILAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>emb|CEI19183.1| hypothetical protein PAMH19_4775 [Pseudomonas aeruginosa]
Length=353

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS  +   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSMFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+ P++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSPNEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_023117492.1| hypothetical protein [Pseudomonas aeruginosa]
 gb|ERW53903.1| hypothetical protein Q031_01324 [Pseudomonas aeruginosa BWHPSA018]
Length=353

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVSFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_031640700.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|ETV25944.1| hypothetical protein Q047_02674 [Pseudomonas aeruginosa BWHPSA042]
Length=353

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 192/328 (59%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P + L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PINPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_033993819.1| gluconolactonase [Pseudomonas aeruginosa]
Length=353

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLE------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLINETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_034053102.1| gluconolactonase [Pseudomonas aeruginosa]
Length=353

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/357 (37%), Positives = 202/357 (57%), Gaps = 22/357 (6%)
 Frame = +3

Query  51    KMSGLWPFAVLVPVILGVVIY---QLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEK  221
             K+SG+    VL+P   G  +Y   +    DP  + A    Q +  + P      L  +E 
Sbjct  3     KLSGI---IVLLPA--GAALYLALKTSPIDPLAWDAPAAPQMTGVLEPNDT---LMKAEL  54

Query  222   IGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAH  401
             +G G+L GPED   D + G +Y G  DG V R+       A   VE +V+TGGRPLG+  
Sbjct  55    LGQGQLHGPEDTAVDSQ-GRVYAGLADGRVVRLD------ASGKVETFVDTGGRPLGMDF  107

Query  402   GLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYG  581
                G +I+ADA  GLL +   GKV+ +  EADGV F  TD +D+A DG +YF+DAS K+ 
Sbjct  108   DAAGNLILADAWKGLLRIDPQGKVETLATEADGVPFAFTDDLDIASDGRIYFSDASSKFH  167

Query  582   LEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCK  761
               D+I + LE +PHGRLL YDP T +T+VL+ DL+FANGVA+  ++ FV+  ET   R  
Sbjct  168   QPDYILDLLEARPHGRLLRYDPSTGKTEVLLKDLYFANGVALSANEDFVLVNETYRYRIT  227

Query  762   KYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILG  941
             +Y+++GEK G  EVFI+NLPG+PDN++ D +G FW+ +        + + R+P L+  L 
Sbjct  228   RYWLKGEKAGQHEVFIDNLPGLPDNLQGDRKGTFWVALPTPRKADADFLHRHPWLKAQLA  287

Query  942   VMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              + +  + P     G +  +D +G  V   ++       ++++   +G+ +Y G ++
Sbjct  288   KLPRMFL-PKPTAYGLVIAIDEQGRIVRSLHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_003116037.1| gluconolactonase [Pseudomonas aeruginosa]
 ref|YP_006483810.1| hypothetical protein PADK2_19175 [Pseudomonas aeruginosa DK2]
 gb|EIE48501.1| putative enzyme [Pseudomonas aeruginosa PADK2_CF510]
 gb|AFM66108.1| putative enzyme [Pseudomonas aeruginosa DK2]
 gb|ERU78519.1| hypothetical protein Q086_04226 [Pseudomonas aeruginosa C23]
 gb|ERU78827.1| hypothetical protein Q085_04228 [Pseudomonas aeruginosa C20]
 gb|ERW02935.1| hypothetical protein Q037_03821 [Pseudomonas aeruginosa BWHPSA024]
 gb|ERW19744.1| hypothetical protein Q034_03117 [Pseudomonas aeruginosa BWHPSA021]
 gb|ERW23336.1| hypothetical protein Q036_01380 [Pseudomonas aeruginosa BWHPSA023]
 gb|ERW27840.1| hypothetical protein Q035_00694 [Pseudomonas aeruginosa BWHPSA022]
 gb|ERW55753.1| hypothetical protein Q027_00634 [Pseudomonas aeruginosa BWHPSA014]
 gb|ERW62887.1| hypothetical protein Q025_03851 [Pseudomonas aeruginosa BWHPSA012]
 gb|ERW73701.1| hypothetical protein Q024_02982 [Pseudomonas aeruginosa BWHPSA011]
 gb|ERW81016.1| hypothetical protein Q018_04128 [Pseudomonas aeruginosa BWHPSA005]
 gb|ERW94668.1| hypothetical protein Q017_03112 [Pseudomonas aeruginosa BWHPSA004]
 gb|ERY64263.1| hypothetical protein Q056_01080 [Pseudomonas aeruginosa BL02]
 gb|ERY97165.1| hypothetical protein Q023_00616 [Pseudomonas aeruginosa BWHPSA010]
 gb|ESR67528.1| gluconolactonase [Pseudomonas aeruginosa VRFPA05]
 gb|ETU85530.1| hypothetical protein Q053_03479 [Pseudomonas aeruginosa BWHPSA048]
 gb|ETV38390.1| hypothetical protein Q045_03793 [Pseudomonas aeruginosa BWHPSA040]
 gb|EWH26680.1| gluconolactonase [Pseudomonas aeruginosa SG17M]
 gb|EZN49374.1| hypothetical protein AJ76_01826 [Pseudomonas aeruginosa BWH036]
 gb|EZN74654.1| hypothetical protein AJ71_01140 [Pseudomonas aeruginosa BWH031]
 gb|EZP13299.1| hypothetical protein V552_03030 [Pseudomonas aeruginosa BWH051]
 dbj|GAJ52306.1| strictosidine synthase precursor [Pseudomonas aeruginosa RB]
 emb|CEI79395.1| Uncharacterized protein PAE221_05019 [Pseudomonas aeruginosa]
Length=353

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLE------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_034043384.1| gluconolactonase [Pseudomonas aeruginosa]
Length=353

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_003082649.1| MULTISPECIES: gluconolactonase [Pseudomonas]
 ref|YP_002441472.1| putative enzyme [Pseudomonas aeruginosa LESB58]
 ref|YP_005976193.1| hypothetical protein PAM18_3610 [Pseudomonas aeruginosa M18]
 ref|YP_005980421.1| hypothetical protein NCGM2_2178 [Pseudomonas aeruginosa NCGM2.S1]
 ref|YP_007710580.1| hypothetical protein G655_18700 [Pseudomonas aeruginosa B136-33]
 ref|YP_008131853.1| gluconolactonase [Pseudomonas aeruginosa RP73]
 ref|YP_008807500.1| Strictosidine synthase precursor [Pseudomonas aeruginosa PA1R]
 ref|YP_008813849.1| Strictosidine synthase precursor [Pseudomonas aeruginosa PA1]
 ref|YP_008886306.1| gluconolactonase [Pseudomonas aeruginosa MTB-1]
 ref|YP_008944021.1| gluconolactonase [Pseudomonas aeruginosa LES431]
 ref|YP_008983124.1| Strictosidine synthase precursor [Pseudomonas aeruginosa SCV20265]
 ref|YP_008551503.1| strictosidine synthase family protein [Pseudomonas aeruginosa 
c7447m]
 gb|EAZ51857.1| hypothetical protein PACG_00264 [Pseudomonas aeruginosa C3719]
 emb|CAW28626.1| putative enzyme [Pseudomonas aeruginosa LESB58]
 gb|EFQ37619.1| putative enzyme [Pseudomonas aeruginosa 39016]
 dbj|GAA16833.1| putative enzyme [Pseudomonas aeruginosa NCMG1179]
 gb|AEO76091.1| putative enzyme [Pseudomonas aeruginosa M18]
 dbj|BAK89036.1| hypothetical protein NCGM2_2178 [Pseudomonas aeruginosa NCGM2.S1]
 gb|EHF12995.1| hypothetical protein HMPREF1030_03231 [Pseudomonas sp. 2_1_26]
 gb|EKA31493.1| hypothetical protein PABE171_4053 [Pseudomonas aeruginosa ATCC 
14886]
 gb|EKA37757.1| hypothetical protein PABE177_3975 [Pseudomonas aeruginosa ATCC 
700888]
 emb|CCQ89094.1| Strictosidine synthase precursor [Pseudomonas aeruginosa 18A]
 gb|EME94506.1| hypothetical protein H123_06667 [Pseudomonas aeruginosa PA21_ST175]
 gb|EMZ48518.1| hypothetical protein HMPREF1224_10393 [Pseudomonas sp. P179]
 gb|AGI82656.1| hypothetical protein G655_18700 [Pseudomonas aeruginosa B136-33]
 gb|ENH95101.1| hypothetical protein H734_01882 [Pseudomonas aeruginosa PA45]
 gb|EOQ80269.1| hypothetical protein K652_12126 [Pseudomonas aeruginosa VRFPA02]
 gb|EOT12208.1| hypothetical protein L346_03236 [Pseudomonas aeruginosa MSH-10]
 gb|AGO39139.1| gluconolactonase [Pseudomonas aeruginosa RP73]
 gb|EQL41410.1| gluconolactonase [Pseudomonas aeruginosa VRFPA03]
 gb|ERF07820.1| gluconolactonase [Pseudomonas aeruginosa HB13]
 gb|AGV65910.1| strictosidine synthase family protein [Pseudomonas aeruginosa 
c7447m]
 gb|ERU34604.1| hypothetical protein Q093_03858 [Pseudomonas aeruginosa CF614]
 gb|ERU38109.1| hypothetical protein Q092_03381 [Pseudomonas aeruginosa CF77]
 gb|ERU48126.1| hypothetical protein Q091_01016 [Pseudomonas aeruginosa C52]
 gb|ERU56351.1| hypothetical protein Q089_03621 [Pseudomonas aeruginosa C48]
 gb|ERU57518.1| hypothetical protein Q090_00847 [Pseudomonas aeruginosa C51]
 gb|ERU68371.1| hypothetical protein Q087_03190 [Pseudomonas aeruginosa C40]
 gb|ERU70476.1| hypothetical protein Q088_01396 [Pseudomonas aeruginosa C41]
 gb|ERU89685.1| hypothetical protein Q084_02814 [Pseudomonas aeruginosa M9A.1]
 gb|ERU94774.1| hypothetical protein Q081_02893 [Pseudomonas aeruginosa M8A.2]
 gb|ERV01886.1| hypothetical protein Q080_00489 [Pseudomonas aeruginosa M8A.1]
 gb|ERV13122.1| hypothetical protein Q071_04084 [Pseudomonas aeruginosa BL17]
 gb|ERV14408.1| hypothetical protein Q072_03037 [Pseudomonas aeruginosa BL18]
 gb|ERV31737.1| hypothetical protein Q069_03055 [Pseudomonas aeruginosa BL15]
 gb|ERV37173.1| hypothetical protein Q065_06182 [Pseudomonas aeruginosa BL11]
 gb|ERV41742.1| hypothetical protein Q064_03890 [Pseudomonas aeruginosa BL10]
 gb|ERV44106.1| hypothetical protein Q068_03315 [Pseudomonas aeruginosa BL14]
 gb|ERV53131.1| hypothetical protein Q063_04326 [Pseudomonas aeruginosa BL09]
 gb|ERV63366.1| hypothetical protein Q062_02663 [Pseudomonas aeruginosa BL08]
 gb|ERV74721.1| hypothetical protein Q061_00499 [Pseudomonas aeruginosa BL07]
 gb|ERV77215.1| hypothetical protein Q058_03100 [Pseudomonas aeruginosa BL04]
 gb|ERV88616.1| hypothetical protein Q039_03965 [Pseudomonas aeruginosa BWHPSA026]
 gb|ERW06893.1| hypothetical protein Q038_00786 [Pseudomonas aeruginosa BWHPSA025]
 gb|ERW35053.1| hypothetical protein Q033_04146 [Pseudomonas aeruginosa BWHPSA020]
 gb|ERW35458.1| hypothetical protein Q032_00997 [Pseudomonas aeruginosa BWHPSA019]
 gb|ERW57776.1| hypothetical protein Q030_00954 [Pseudomonas aeruginosa BWHPSA017]
 gb|ERW61670.1| hypothetical protein Q026_04106 [Pseudomonas aeruginosa BWHPSA013]
 gb|ERW78697.1| hypothetical protein Q019_04010 [Pseudomonas aeruginosa BWHPSA006]
 gb|ERX00889.1| hypothetical protein Q016_03141 [Pseudomonas aeruginosa BWHPSA003]
 gb|ERX04210.1| hypothetical protein Q015_02968 [Pseudomonas aeruginosa BWHPSA002]
 gb|ERX05863.1| hypothetical protein Q014_03362 [Pseudomonas aeruginosa BWHPSA001]
 gb|ERX19992.1| hypothetical protein Q013_02890 [Pseudomonas aeruginosa X13273]
 gb|ERX21668.1| hypothetical protein Q012_02411 [Pseudomonas aeruginosa S35004]
 gb|ERX34247.1| hypothetical protein Q009_03480 [Pseudomonas aeruginosa U2504]
 gb|ERX38450.1| hypothetical protein Q011_03341 [Pseudomonas aeruginosa 6077]
 gb|ERX51244.1| hypothetical protein Q002_03137 [Pseudomonas aeruginosa CF18]
 gb|ERX55913.1| hypothetical protein Q005_03020 [Pseudomonas aeruginosa X24509]
 gb|ERX70344.1| hypothetical protein P999_01168 [Pseudomonas aeruginosa MSH3]
 gb|ERX79685.1| hypothetical protein P997_01112 [Pseudomonas aeruginosa 62]
 gb|ERX90198.1| hypothetical protein Q083_00645 [Pseudomonas aeruginosa M8A.4]
 gb|ERY05708.1| hypothetical protein Q078_00870 [Pseudomonas aeruginosa BL24]
 gb|ERY12374.1| hypothetical protein Q076_02905 [Pseudomonas aeruginosa BL22]
 gb|ERY16159.1| hypothetical protein Q075_04158 [Pseudomonas aeruginosa BL21]
 gb|ERY25774.1| hypothetical protein Q074_04037 [Pseudomonas aeruginosa BL20]
 gb|ERY28493.1| hypothetical protein Q067_04284 [Pseudomonas aeruginosa BL13]
 gb|ERY30088.1| hypothetical protein Q066_05988 [Pseudomonas aeruginosa BL12]
 gb|ERY47602.1| hypothetical protein Q060_04026 [Pseudomonas aeruginosa BL06]
 gb|ERY52706.1| hypothetical protein Q057_05248 [Pseudomonas aeruginosa BL03]
 gb|ERY66948.1| hypothetical protein Q055_03825 [Pseudomonas aeruginosa BL01]
 gb|ERY79956.1| hypothetical protein Q028_03657 [Pseudomonas aeruginosa BWHPSA015]
 gb|ERY83400.1| hypothetical protein Q029_00623 [Pseudomonas aeruginosa BWHPSA016]
 gb|ERY95361.1| hypothetical protein Q022_03637 [Pseudomonas aeruginosa BWHPSA009]
 gb|ERY98408.1| hypothetical protein Q021_01123 [Pseudomonas aeruginosa BWHPSA008]
 gb|ERZ12006.1| hypothetical protein Q008_03870 [Pseudomonas aeruginosa JJ692]
 gb|ERZ21906.1| hypothetical protein Q007_01963 [Pseudomonas aeruginosa S54485]
 gb|ERZ24495.1| hypothetical protein Q004_02958 [Pseudomonas aeruginosa CF5]
 gb|ERZ26564.1| hypothetical protein Q003_03782 [Pseudomonas aeruginosa CF27]
 gb|ERZ35597.1| hypothetical protein Q001_04353 [Pseudomonas aeruginosa CF127]
 gb|ERZ39902.1| hypothetical protein Q000_03234 [Pseudomonas aeruginosa MSH10]
 gb|ERZ48608.1| hypothetical protein Q082_01004 [Pseudomonas aeruginosa M8A.3]
 gb|ESR98959.1| gluconolactonase [Pseudomonas aeruginosa DHS01]
 gb|AHA20806.1| Strictosidine synthase precursor [Pseudomonas aeruginosa PA1]
 gb|AHA26605.1| Strictosidine synthase precursor [Pseudomonas aeruginosa PA1R]
 emb|CDH78367.1| hypothetical protein PAMH27_3981 [Pseudomonas aeruginosa MH27]
 gb|ESZ83829.1| gluconolactonase [Pseudomonas aeruginosa DHS29]
 gb|AHB57092.1| gluconolactonase [Pseudomonas aeruginosa MTB-1]
 gb|ETD91033.1| gluconolactonase [Pseudomonas aeruginosa VRFPA06]
 gb|AHC66535.1| gluconolactonase [Pseudomonas aeruginosa LES431]
 gb|AHC78230.1| Strictosidine synthase precursor [Pseudomonas aeruginosa SCV20265]
 emb|CDH72030.1| hypothetical protein P38_3806 [Pseudomonas aeruginosa MH38]
 gb|ETU75133.1| hypothetical protein Q095_04019 [Pseudomonas aeruginosa PS50]
 gb|ETU90743.1| hypothetical protein Q054_00735 [Pseudomonas aeruginosa Z61]
 gb|ETU93177.1| hypothetical protein Q094_02475 [Pseudomonas aeruginosa PS42]
 gb|ETV05751.1| hypothetical protein Q051_01594 [Pseudomonas aeruginosa BWHPSA046]
 gb|ETV09251.1| hypothetical protein Q052_00773 [Pseudomonas aeruginosa BWHPSA047]
 gb|ETV16578.1| hypothetical protein Q050_01733 [Pseudomonas aeruginosa BWHPSA045]
 gb|ETV33301.1| hypothetical protein Q048_00965 [Pseudomonas aeruginosa BWHPSA043]
 gb|ETV46777.1| hypothetical protein Q044_03891 [Pseudomonas aeruginosa BWHPSA039]
 gb|ETV53976.1| hypothetical protein Q043_03694 [Pseudomonas aeruginosa BWHPSA038]
 gb|ETV61935.1| hypothetical protein Q042_01085 [Pseudomonas aeruginosa BWHPSA037]
 emb|CDI89460.1| putative enzyme [Pseudomonas aeruginosa PA38182]
 gb|AHH50197.1| gluconolactonase [Pseudomonas aeruginosa YL84]
 gb|AHK84764.1| gluconolactonase [Pseudomonas aeruginosa LESlike5]
 gb|AHK90665.1| gluconolactonase [Pseudomonas aeruginosa LESlike7]
 gb|AHK96643.1| gluconolactonase [Pseudomonas aeruginosa LES400]
 gb|AHL02608.1| gluconolactonase [Pseudomonas aeruginosa LESB65]
 gb|AHL08529.1| gluconolactonase [Pseudomonas aeruginosa LESlike1]
 gb|AHL14483.1| gluconolactonase [Pseudomonas aeruginosa LESlike4]
 gb|EYU00753.1| Strictosidine synthase precursor [Pseudomonas aeruginosa PA103]
 gb|EYU00868.1| Strictosidine synthase precursor [Pseudomonas aeruginosa PA99]
 gb|AHW72096.1| hypothetical protein PA96_3615 [Pseudomonas aeruginosa PA96]
 gb|EZN56656.1| hypothetical protein AJ73_00829 [Pseudomonas aeruginosa BWH033]
 gb|EZN58422.1| hypothetical protein AJ75_01744 [Pseudomonas aeruginosa BWH035]
 gb|EZN64055.1| hypothetical protein AJ72_02941 [Pseudomonas aeruginosa BWH032]
 gb|EZN76915.1| hypothetical protein AJ70_02100 [Pseudomonas aeruginosa BWH030]
 gb|EZN83798.1| hypothetical protein AJ69_00082 [Pseudomonas aeruginosa BWH029]
 gb|EZN87130.1| hypothetical protein AJ67_04862 [Pseudomonas aeruginosa 3580]
 gb|EZN95807.1| hypothetical protein AJ68_01393 [Pseudomonas aeruginosa 3581]
 gb|EZO04759.1| hypothetical protein AJ66_01701 [Pseudomonas aeruginosa 3579]
 gb|EZO05688.1| hypothetical protein AJ64_03276 [Pseudomonas aeruginosa 3577]
 gb|EZO11655.1| hypothetical protein AJ65_03768 [Pseudomonas aeruginosa 3578]
 gb|EZO21272.1| hypothetical protein AJ63_02101 [Pseudomonas aeruginosa 3576]
 gb|EZO27441.1| hypothetical protein AJ62_00800 [Pseudomonas aeruginosa 3575]
 gb|EZO40100.1| hypothetical protein AJ61_00210 [Pseudomonas aeruginosa 3574]
 gb|EZO48894.1| hypothetical protein V561_01403 [Pseudomonas aeruginosa BWH060]
 gb|EZO51559.1| hypothetical protein V562_03099 [Pseudomonas aeruginosa PS75]
 gb|EZO67383.1| hypothetical protein V560_03156 [Pseudomonas aeruginosa BWH059]
 gb|EZO69232.1| hypothetical protein V558_04516 [Pseudomonas aeruginosa BWH057]
 gb|EZO74929.1| hypothetical protein V557_04899 [Pseudomonas aeruginosa BWH056]
 gb|EZO82861.1| hypothetical protein V556_02921 [Pseudomonas aeruginosa BWH055]
 gb|EZO93598.1| hypothetical protein V555_03962 [Pseudomonas aeruginosa BWH054]
 gb|EZO95616.1| hypothetical protein V554_03326 [Pseudomonas aeruginosa BWH053]
 gb|EZO98825.1| hypothetical protein V553_03296 [Pseudomonas aeruginosa BWH052]
 gb|EZP22890.1| hypothetical protein V550_02736 [Pseudomonas aeruginosa BWH049]
 gb|KAJ15638.1| gluconolactonase [Pseudomonas aeruginosa IGB83]
 gb|KAJ24324.1| gluconolactonase [Pseudomonas aeruginosa 148]
 gb|KDR46293.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|KEA13461.1| gluconolactonase [Pseudomonas aeruginosa C1913C]
 gb|KEA14546.1| gluconolactonase [Pseudomonas aeruginosa C2159M]
 gb|KEA23762.1| gluconolactonase [Pseudomonas aeruginosa C2773C]
 gb|KEA28499.1| gluconolactonase [Pseudomonas aeruginosa C0324C]
 gb|KEF94449.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|KEI26860.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|AID72509.1| putative enzyme [Pseudomonas aeruginosa PAO1H2O]
 dbj|BAP24353.1| hypothetical protein NCGM1900_5281 [Pseudomonas aeruginosa]
 gb|KFL10848.1| strictosidine synthase family protein [Pseudomonas aeruginosa]
 emb|CDO80346.1| putative enzyme [Pseudomonas aeruginosa]
 dbj|BAP51936.1| hypothetical protein NCGM1984_3974 [Pseudomonas aeruginosa]
 gb|KGB86561.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|KGD93028.1| gluconolactonase [Pseudomonas sp. YS-1p]
 emb|CDM52969.1| hypothetical protein PAWS394_4107 [Pseudomonas aeruginosa WS394]
 gb|KHE32440.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|KHE56389.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|KHE65422.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|AJD59062.1| gluconolactonase [Pseudomonas aeruginosa]
 emb|CDM46958.1| hypothetical protein PaWS136_3986 [Pseudomonas aeruginosa WS136]
Length=353

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_003145301.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|EKA52575.1| hypothetical protein PAE2_3676 [Pseudomonas aeruginosa E2]
 gb|ERX75119.1| hypothetical protein P998_03107 [Pseudomonas aeruginosa E2]
Length=353

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_003109273.1| gluconolactonase [Pseudomonas aeruginosa]
 ref|YP_791952.1| hypothetical protein PA14_47490 [Pseudomonas aeruginosa UCBPP-PA14]
 gb|ABJ10481.1| putative enzyme [Pseudomonas aeruginosa UCBPP-PA14]
 gb|EKA41954.1| hypothetical protein PACI27_3833 [Pseudomonas aeruginosa CI27]
 gb|EOT21037.1| hypothetical protein CIA_01216 [Pseudomonas aeruginosa PA14]
 gb|ERV30154.1| hypothetical protein Q070_03131 [Pseudomonas aeruginosa BL16]
 gb|ERV88289.1| hypothetical protein Q040_03243 [Pseudomonas aeruginosa BWHPSA027]
 gb|ESQ65597.1| gluconolactonase [Pseudomonas aeruginosa HB15]
 gb|ETV15276.1| hypothetical protein Q049_03597 [Pseudomonas aeruginosa BWHPSA044]
 gb|EZO58468.1| hypothetical protein V559_05239 [Pseudomonas aeruginosa BWH058]
 gb|KAJ13975.1| gluconolactonase [Pseudomonas aeruginosa ID4365]
Length=353

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKANADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGKIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_023092021.1| hypothetical protein [Pseudomonas aeruginosa]
 gb|ERX94574.1| hypothetical protein Q079_02125 [Pseudomonas aeruginosa BL25]
 gb|ETD54421.1| gluconolactonase [Pseudomonas aeruginosa VRFPA07]
 gb|EZP15069.1| hypothetical protein V551_03156 [Pseudomonas aeruginosa BWH050]
Length=362

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 129/340 (38%), Positives = 195/340 (57%), Gaps = 17/340 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQN  1139
              ++       ++++   +G+ +Y G ++   I  L + + 
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLENDRIGRLAIPEK  355



>ref|WP_016253680.1| hypothetical protein [Pseudomonas aeruginosa]
 gb|EOT13375.1| hypothetical protein PAK_04074 [Pseudomonas aeruginosa PAK]
 gb|KAJ89019.1| gluconolactonase [Pseudomonas aeruginosa PAK]
Length=353

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKANADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_022580880.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|ETD55686.1| gluconolactonase [Pseudomonas aeruginosa VRFPA08]
 gb|AID84066.1| gluconolactonase [Pseudomonas aeruginosa VRFPA04]
Length=353

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|XP_001753951.1| predicted protein [Physcomitrella patens]
 gb|EDQ81273.1| predicted protein [Physcomitrella patens]
Length=306

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 122/313 (39%), Positives = 196/313 (63%), Gaps = 15/313 (5%)
 Frame = +3

Query  216   EKIGVGRLSGPEDIVYDPKTGVIYTGCM-DGWVKRVTVNESSAADSAVEDWVNTGGRPLG  392
             EK+G G L  PED+V  P    +Y  C   GW+K++ +     AD +VEDW + GG PLG
Sbjct  1     EKLGEGNLVWPEDLVLGPDGKFLYVSCAGSGWIKKLHL-----ADHSVEDWQHVGGVPLG  55

Query  393   LAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASW  572
             LA G  GEV+VADA  GL+ VT +G V+V+ +E DG K    D V V  DG++Y +D S+
Sbjct  56    LALGPDGEVLVADALQGLVKVTDEG-VEVLASEVDGSKITFADGVAVDRDGLIYLSDVSF  114

Query  573   KYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMR  752
             KY +    +EF EGKP+GRL+ YDP  K +++L+++++   G+ +  D+  +IF E ++ 
Sbjct  115   KYNVSAHWFEFWEGKPNGRLIVYDPKAKSSRLLLDNIYSPTGLTLTKDEDALIFTENVVA  174

Query  753   RCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD-GEGLFWIGIGIEYTHAFELIQRYPLLR  929
             R  KYY++G+KKG++E+  ENLPG PDNI Y+  EG++++GI  + +  F+LI + P L+
Sbjct  175   RITKYYVKGDKKGTMEIMNENLPGHPDNIHYNYDEGVYYVGIVGQRSALFDLIWKTPFLK  234

Query  930   KILGVMEKYGVRPNME---KNGGIFVVDMEGNPVAHYYERD---FTLVSTGIKIGNYMYC  1091
             K++ V+ +  VR +++   +   + ++D  G  +  Y + D     +V+ GIK+G+Y+Y 
Sbjct  235   KLVMVLPE-AVRLSLDAAARTARLLIIDDSGRALRQYQDPDAKAVGIVTGGIKVGDYLYV  293

Query  1092  GFVKYGFILSLNL  1130
               +K  F+  + L
Sbjct  294   SSMKETFVGRIKL  306



>ref|WP_034053170.1| gluconolactonase [Pseudomonas aeruginosa]
Length=353

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VIRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_027897266.1| gluconolactonase [Pseudomonas thermotolerans]
Length=353

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 125/327 (38%), Positives = 190/327 (58%), Gaps = 17/327 (5%)
 Frame = +3

Query  138   PYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMD  302
             P P   L   +PA AP   G L     L  +E +  G++ GPED   D + G +Y G  D
Sbjct  23    PSPIDPLPWDAPA-APPLTGVLEPNDTLMKAELLAQGQIHGPEDTAVDAQ-GRVYAGLHD  80

Query  303   GWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVM  482
             G V R+        D  +E + +TGGRPLG+     G +IVADA  GLL++   G++ V+
Sbjct  81    GRVVRI------GTDGRLETFADTGGRPLGMDFDAQGNLIVADAYKGLLSIDPQGRIAVL  134

Query  483   TAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQT  662
             T EADGV F+ TD +D+A DG +YFTDAS K+   D++ + LE +PHGRLLSYDP + +T
Sbjct  135   TTEADGVPFRFTDDLDIASDGRIYFTDASAKFRQPDYLLDLLEARPHGRLLSYDPASGKT  194

Query  663   KVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIR  842
             + L+ DL+FANGVA+  ++ FV+  ET   R ++Y+++G K GS EVFI+NLPG+PDN++
Sbjct  195   ETLLGDLYFANGVALSQNEDFVLVNETYRYRIQRYWLKGAKAGSHEVFIDNLPGLPDNLQ  254

Query  843   YDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPV  1022
              D  G FW+ +        + + R+P L+  L  + +  + P     G +  +D  G  +
Sbjct  255   GDRAGTFWVALPSPRKADADFLHRHPWLKAQLAKLPR-ALWPKATPYGLVIALDENGRII  313

Query  1023  AHYYERD---FTLVSTGIKIGNYMYCG  1094
                ++       +V++   +G+Y+Y G
Sbjct  314   RSLHDTSGAHLRMVTSVKPVGDYLYLG  340



>ref|WP_012663252.1| gluconolactonase [Desulfobacterium autotrophicum]
 ref|YP_002602176.1| hypothetical protein HRM2_08990 [Desulfobacterium autotrophicum 
HRM2]
 gb|ACN14012.1| conserved hypothetical protein [Desulfobacterium autotrophicum 
HRM2]
Length=353

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 126/347 (36%), Positives = 196/347 (56%), Gaps = 21/347 (6%)
 Frame = +3

Query  81    LVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIV  260
             ++ VI+ V + +    DP  Y   +L   S  + P  +   L  +E + +G++ GPE++ 
Sbjct  11    ILAVIIVVFLVKPSPIDPVAYTPGKLQALSGVLEPNTH---LQKAELLALGKIHGPEEVA  67

Query  261   YDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEI  440
              D   G +Y G  DG + RV  N +      +E +  T GRPLG+    HG +IV DA  
Sbjct  68    VD-SLGRVYGGTQDGSIVRVLANGN------LETFAETQGRPLGIQFDTHGNLIVCDAFK  120

Query  441   GLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKP  620
             GLL++  DG+++V+   ADGV FK TDA+D+A DG +YFTDAS KY   +++++ LE KP
Sbjct  121   GLLSINPDGQIKVLATSADGVAFKFTDALDIARDGTIYFTDASAKYSPNEYLYDLLESKP  180

Query  621   HGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIE  800
             HGR + YDP + Q KVL+NDL+FANGVA+   + FV+  ET   R  +Y+++G   G+ E
Sbjct  181   HGRFMRYDPDSGQVKVLLNDLYFANGVALSSQEDFVLINETYRYRVLRYWLKGPGAGTWE  240

Query  801   VFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEK  980
             +FI+NLPG PDNI  + +G FW+ +      A + +Q YP ++  +  + +  + P  + 
Sbjct  241   IFIDNLPGFPDNISTNHKGTFWLALFTVRNKAVDRLQSYPFVKAQMAKLPQ-NLWPLPKP  299

Query  981   NGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYM----YCGFVKYG  1109
              G +  +D +GN     ++      STG  +G       Y GF+  G
Sbjct  300   YGLVLALDEQGNITQSLHD------STGEHLGAITSAREYNGFLYLG  340



>ref|WP_023126343.1| hypothetical protein [Pseudomonas aeruginosa]
 gb|ERX35987.1| hypothetical protein Q010_03236 [Pseudomonas aeruginosa 19660]
Length=353

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEAQPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_033984214.1| gluconolactonase, partial [Pseudomonas aeruginosa]
Length=350

 Score =   229 bits (583),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_033969040.1| gluconolactonase [Pseudomonas aeruginosa]
Length=353

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 126/328 (38%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADG+ F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGIPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_019725984.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|ERZ08853.1| hypothetical protein Q020_01323 [Pseudomonas aeruginosa BWHPSA007]
 gb|ETV36423.1| hypothetical protein Q046_02894 [Pseudomonas aeruginosa BWHPSA041]
Length=353

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 126/328 (38%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   +E +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKIETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_017939602.1| gluconolactonase [Pseudomonas thermotolerans]
Length=353

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/327 (38%), Positives = 189/327 (58%), Gaps = 17/327 (5%)
 Frame = +3

Query  138   PYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMD  302
             P P   L   +PA AP   G L     L  +E +  G++ GPED   D + G +Y G  D
Sbjct  23    PSPIDPLPWDAPA-APPLTGVLEPNDTLMKAELLAQGQIHGPEDTAVDAQ-GRVYAGLHD  80

Query  303   GWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVM  482
             G V R+        D  VE + +TGGRPLG+     G +IVADA  GLL++   G++ V+
Sbjct  81    GRVVRI------GTDGRVETFADTGGRPLGMDFDAQGNLIVADAYKGLLSIDPQGRIAVL  134

Query  483   TAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQT  662
             T EADGV F+ TD +D+A DG +YFTDAS K+   D++ + LE +PHGRLL YDP + +T
Sbjct  135   TTEADGVPFRFTDDLDIASDGRIYFTDASAKFRQPDYLLDLLEARPHGRLLRYDPASGKT  194

Query  663   KVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIR  842
             + L+ DL+FANGVA+  ++ FV+  ET   R ++Y+++G K GS EVFI+NLPG+PDN++
Sbjct  195   ETLLGDLYFANGVALSQNEDFVLVNETYRYRIQRYWLKGAKAGSHEVFIDNLPGLPDNLQ  254

Query  843   YDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPV  1022
              D  G FW+ +        + + R+P L+  L  + +  + P     G +  +D  G  +
Sbjct  255   GDRAGTFWVALPSPRKANADFLHRHPWLKAQLAKLPR-ALWPKATPYGLVIALDENGRII  313

Query  1023  AHYYERD---FTLVSTGIKIGNYMYCG  1094
                ++       +V++   +G+Y+Y G
Sbjct  314   RSLHDTSGAHLRMVTSVKPVGDYLYLG  340



>ref|WP_023105431.1| hypothetical protein [Pseudomonas aeruginosa]
 gb|ERY46176.1| hypothetical protein Q059_03033 [Pseudomonas aeruginosa BL05]
Length=353

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 190/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+   + FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSAKEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_037053513.1| gluconolactonase [Pseudomonas oleovorans]
Length=354

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/338 (37%), Positives = 196/338 (58%), Gaps = 14/338 (4%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDG  305
              DP P+ A E    +  + P      L  +E +  G++ GPED   D + G +Y G  DG
Sbjct  27    IDPLPWEAPEAPPMTAVLEPNDT---LMKAELLARGQIHGPEDTAVDAQ-GRVYAGLHDG  82

Query  306   WVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMT  485
              V RV       AD +VE + +TGGRPLG+     G +I+ADA  GLL +   G+++V++
Sbjct  83    RVVRVL------ADDSVETFADTGGRPLGMDFDAAGNLILADAYKGLLRIDPQGRIEVLS  136

Query  486   AEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTK  665
              EADG+ F  TD +D+A DG++YF+DAS ++   D++ + LE +PHGRLLSYDP T +T+
Sbjct  137   TEADGLPFAFTDDLDIASDGIIYFSDASSRFQQPDYLLDLLEARPHGRLLSYDPSTGETR  196

Query  666   VLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRY  845
             VL++ L+FANGVA+  ++ FV+  ET   R  +Y+++GE+ G  EVFI+NLPG+PDN++ 
Sbjct  197   VLLDGLYFANGVALSANEDFVLVNETYRYRITRYWLKGERAGQHEVFIDNLPGLPDNLQG  256

Query  846   DGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVA  1025
             D +G FW+ +        + + R+P L+  L  + +  + P     G    +D  G  V 
Sbjct  257   DRKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPR-ALWPKAIPYGFAIALDENGKIVR  315

Query  1026  HYYERDFT---LVSTGIKIGNYMYCGFVKYGFILSLNL  1130
               ++   T   +V++   +G+Y+Y G +    I  L L
Sbjct  316   SLHDTSGTHLRMVTSVKPVGDYLYFGSLDNDRIGKLPL  353



>ref|WP_004348796.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|EAZ57107.1| hypothetical protein PA2G_00287 [Pseudomonas aeruginosa 2192]
 gb|EQM88384.1| gluconolactonase [Pseudomonas aeruginosa WC55]
 gb|ERV86516.1| hypothetical protein Q041_03185 [Pseudomonas aeruginosa BWHPSA028]
 gb|EZO48052.1| hypothetical protein AJ60_03281 [Pseudomonas aeruginosa 3573]
Length=353

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 190/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G    +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLAIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_033990195.1| gluconolactonase [Pseudomonas aeruginosa]
 gb|EVT86692.1| gluconolactonase [Pseudomonas aeruginosa VRFPA09]
Length=353

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/328 (38%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             +ADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   DADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_033980895.1| gluconolactonase [Pseudomonas aeruginosa]
Length=353

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 190/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+   + FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSAIEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_024916611.1| gluconolactonase [Pseudomonas aeruginosa]
Length=353

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/328 (38%), Positives = 191/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADG+ F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGIPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  +VFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHDVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_034047829.1| gluconolactonase [Pseudomonas aeruginosa]
Length=353

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 126/328 (38%), Positives = 190/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++ EK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKSEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_003112360.1| gluconolactonase [Pseudomonas aeruginosa]
 ref|NP_249984.1| hypothetical protein PA1293 [Pseudomonas aeruginosa PAO1]
 ref|YP_008557167.1| strictosidine synthase family protein [Pseudomonas aeruginosa 
PAO581]
 ref|YP_008693139.1| strictosidine synthase family protein [Pseudomonas aeruginosa 
PAO1-VE2]
 ref|YP_008705420.1| strictosidine synthase family protein [Pseudomonas aeruginosa 
PAO1-VE13]
 gb|AAG04682.1|AE004559_1 hypothetical protein PA1293 [Pseudomonas aeruginosa PAO1]
 gb|EHS35960.1| hypothetical protein O1Q_27532 [Pseudomonas aeruginosa MPAO1/P2]
 gb|EHS39912.1| hypothetical protein O1O_00785 [Pseudomonas aeruginosa MPAO1/P1]
 gb|EJZ75989.1| hypothetical protein A161_06625 [Pseudomonas aeruginosa PAO579]
 gb|AGV57948.1| strictosidine synthase family protein [Pseudomonas aeruginosa 
PAO581]
 gb|AGY67263.1| strictosidine synthase family protein [Pseudomonas aeruginosa 
PAO1-VE2]
 gb|AGY69745.1| strictosidine synthase family protein [Pseudomonas aeruginosa 
PAO1-VE13]
 gb|EZO38470.1| hypothetical protein V563_00665 [Pseudomonas aeruginosa PAO1-GFP]
 gb|KAJ26226.1| gluconolactonase [Pseudomonas aeruginosa M10]
Length=353

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 126/328 (38%), Positives = 190/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EAD V F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADSVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>emb|CBI38403.3| unnamed protein product [Vitis vinifera]
Length=196

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 138/191 (72%), Gaps = 10/191 (5%)
 Frame = +3

Query  48   TKMSGLWPFA----VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDS  215
             + S  WP      +L PV   +++YQLD +DPAP P HE +Q  P V PK N R+L  S
Sbjct  12   ARRSSSWPLGLLTLILAPVAAAMLLYQLDPYDPAPVPIHEFSQ-QPMVVPKLNSRMLQGS  70

Query  216  EKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGL  395
            E IGVG+L GPEDI Y P + +IYTGC DGWVKRVT+N     DS V++W  TGGRPLG+
Sbjct  71   EMIGVGKLLGPEDIAYHPDSHLIYTGCADGWVKRVTLN-----DSVVQNWAFTGGRPLGV  125

Query  396  AHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWK  575
            A G HG++IVADAE GLL VT+DG V+ +T EA+G+KFKLTD VDVA DG++YFTDAS+K
Sbjct  126  ALGRHGQLIVADAEKGLLEVTTDGMVKTLTDEAEGIKFKLTDGVDVAVDGVIYFTDASYK  185

Query  576  YGLEDFIWEFL  608
            Y L+++IW+  
Sbjct  186  YSLKEYIWDIF  196



>ref|WP_033984591.1| gluconolactonase [Pseudomonas aeruginosa]
Length=353

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 127/328 (39%), Positives = 190/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D +  V Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQDRV-YAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_034038032.1| gluconolactonase [Pseudomonas aeruginosa]
Length=353

 Score =   227 bits (578),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/328 (38%), Positives = 190/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+       +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAADNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_034049694.1| gluconolactonase [Pseudomonas aeruginosa]
Length=353

 Score =   226 bits (577),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 126/328 (38%), Positives = 190/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP+  G L     L  +E +G G+L GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APQMTGVLEPNDTLMKAELLGQGQLHGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+       A   VE +V+TGGRPLG+       +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------ASGKVETFVDTGGRPLGMDFDAGDNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D
Sbjct  197   LLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+ +Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDQLYFGSLE  343



>ref|WP_012076580.1| gluconolactonase [Pseudomonas aeruginosa]
 ref|YP_001349452.1| hypothetical protein PSPA7_4098 [Pseudomonas aeruginosa PA7]
 gb|ABR82640.1| hypothetical protein PSPA7_4098 [Pseudomonas aeruginosa PA7]
 gb|KFF33808.1| gluconolactonase [Pseudomonas aeruginosa VRFPA01]
Length=353

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/328 (38%), Positives = 190/328 (58%), Gaps = 17/328 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP   G L     L  +E +G G++ GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APPMTGVLEPNDTLMKAELLGQGQVDGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+           VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------GSGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS ++   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSRFHQPDYILDLLEARPHGRLLRYDPATGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  +VFI+NLPG+PDN++ D
Sbjct  197   LLEDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHDVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMYCGFVK  1103
              ++       ++++   +G+Y+Y G ++
Sbjct  316   LHDTSGHHLRMITSAKPVGDYLYFGSLE  343



>ref|WP_036988887.1| gluconolactonase [Pseudomonas sp. P818]
Length=354

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/343 (37%), Positives = 198/343 (58%), Gaps = 24/343 (7%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
              DP P+ A        A AP   G L     L  +E +  G++ GPED   D + G +Y 
Sbjct  27    IDPLPWDA--------APAPAMTGVLEPNDILMKAELLARGQIHGPEDTAVDAE-GRVYA  77

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGK  470
             G  DG + RV       AD ++E + +TGGRPLG+     G +IVADA  GLL++   G 
Sbjct  78    GLHDGRIVRVL------ADDSLETFADTGGRPLGMNFDADGNLIVADAYKGLLSIDPQGA  131

Query  471   VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPH  650
             ++V+T EADG+ F  TD +D+A DG +YF+DAS ++   D++ + LE +PHGRLLSYDP 
Sbjct  132   IKVLTTEADGLPFAFTDDLDIASDGTIYFSDASSRFQQPDYLLDLLEARPHGRLLSYDPA  191

Query  651   TKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMP  830
             + +T+VL++ L+FANGVA+  ++ FV+  ET   R  +Y+++G+K G  ++FI+NLPG+P
Sbjct  192   SGETRVLLDGLYFANGVALSANEDFVLVNETYRYRITRYWLKGDKAGQHDIFIDNLPGLP  251

Query  831   DNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDME  1010
             DN++ D +G FW+ +        + + R+P L+  L  + +  + P     G    +D +
Sbjct  252   DNLQGDRKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPR-ALWPKAIPYGFAIALDEQ  310

Query  1011  GNPVAHYYERDFT---LVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             GN V   ++   T   +V++   +G+Y+Y G +    I  L L
Sbjct  311   GNIVRSLHDTSGTHLRMVTSVKPVGDYLYFGSLDNDRIGRLEL  353



>ref|WP_021442626.1| gluconolactonase [Pseudomonas sp. EGD-AK9]
 gb|ERI53520.1| gluconolactonase [Pseudomonas sp. EGD-AK9]
Length=353

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/327 (38%), Positives = 193/327 (59%), Gaps = 17/327 (5%)
 Frame = +3

Query  138   PYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMD  302
             P P   L   +PA AP   G L     L  +E +  G+L GPED   D + G +Y G  D
Sbjct  23    PSPIDPLGWDAPA-APAMTGVLEPNDTLMKAELLARGQLHGPEDTAVDAE-GRVYAGLHD  80

Query  303   GWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVM  482
             G + RV       AD +VE +V+T GRPLG+     G +IVADA  GLL++   G V+V+
Sbjct  81    GRIVRVL------ADDSVETFVDTSGRPLGMDFDASGNLIVADAYEGLLSIDPQGNVKVL  134

Query  483   TAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQT  662
             T EA+G+ F  TD +D+A DG +YF+DAS ++   D++ + LE +PHGRLL+YDP T QT
Sbjct  135   TTEAEGLPFAFTDDLDIASDGTIYFSDASSRFQQPDYLLDLLEARPHGRLLAYDPATGQT  194

Query  663   KVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIR  842
             +VL+ DL+FANGVA+  ++ FV+  ET   R  +Y+++G+K G  ++FI+NLPG+PDN++
Sbjct  195   RVLLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGDKAGQHDIFIDNLPGLPDNLQ  254

Query  843   YDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPV  1022
              D +G FW+ +        + + R+P L+  L  + +  + P     G    ++ +G  V
Sbjct  255   GDRKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPR-ALWPKAIPYGFAIALNEQGEIV  313

Query  1023  AHYYERDFT---LVSTGIKIGNYMYCG  1094
                ++   T   +V++   +G+++Y G
Sbjct  314   RSLHDTSGTHLRMVTSVKPVGDHLYFG  340



>ref|WP_011394057.1| gluconolactonase [Hahella chejuensis]
 ref|YP_431405.1| strictosidine synthase family protein [Hahella chejuensis KCTC 
2396]
 gb|ABC26980.1| strictosidine synthase family protein [Hahella chejuensis KCTC 
2396]
Length=362

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 203/353 (58%), Gaps = 16/353 (5%)
 Frame = +3

Query  90    VILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDP  269
             ++L   ++     +P  Y A        + AP  N RLL ++E IG GRL GPED+  D 
Sbjct  14    ILLTYFLFSPAVINPEAYDAPSAPDLEGSYAP--NQRLL-EAELIGQGRLDGPEDVAQD-  69

Query  270   KTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLL  449
               G IY G  +G + R+        D  ++   NTGGRPLGL     G++IVADA  GLL
Sbjct  70    ADGAIYAGLANGDIVRIN------KDGELKVLANTGGRPLGLEFNPAGDLIVADAAKGLL  123

Query  450   NVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGR  629
              +  +GK+ V+T++AD + F + D VDV EDG++YF+DASW++G+ +   + +E +PHGR
Sbjct  124   QLDKEGKLTVLTSKADNLPFGVADDVDVGEDGVIYFSDASWRWGVHEHRLDLIESRPHGR  183

Query  630   LLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFI  809
             LL YDP    T VL+ DL+FANGVA+  ++ FV  CET   R ++Y+++G K+G+ ++ I
Sbjct  184   LLRYDPGAGVTTVLLEDLYFANGVALSQNEDFVAVCETGRYRVRRYWLQGPKQGTSDILI  243

Query  810   ENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGG  989
             ENLPG PD +  +G G FWI +        + +  +P L+  +  + +  ++P  E+ G 
Sbjct  244   ENLPGFPDGVSSNGAGEFWIALIAPRNGVLDFMHSFPWLKSRMSKLPE-ALQPQAERYGF  302

Query  990   IFVVDMEGNPVAHYY----ERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQ  1136
             +  V+ +G  + +      ER  T+ S   ++G+ +  G +   +I  L+LT+
Sbjct  303   VLGVNEQGEILHNLQDPEGERLHTITSVE-QVGDVLLFGTLTGDWIGRLSLTR  354



>ref|WP_007154291.1| gluconolactonase [Marinobacter algicola]
 gb|EDM47215.1| putative enzyme [Marinobacter algicola DG893]
Length=363

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 124/320 (39%), Positives = 182/320 (57%), Gaps = 23/320 (7%)
 Frame = +3

Query  78   VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPA-----VAPKRNGRLLHDSEKIGVGRLS  242
            +L  +++G ++       P+P  +      SP      +AP    RL   ++ +  G + 
Sbjct  4    LLGALLIGFLVLGGFLLSPSPINSQSWNAPSPQPLTGNLAPNERLRL---ADLLARGEVY  60

Query  243  GPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVI  422
            GPED   D   G++YTG  DGW+ RV+       D  +E W+ TGGRPLG+    HG +I
Sbjct  61   GPEDTTVD-DDGILYTGTQDGWIVRVS------PDGQMEKWLETGGRPLGMVFDRHGNLI  113

Query  423  VADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWE  602
            VADA  GLL++  D  V V+T EA+G+ F+ TD VD+A DG +YFTDAS ++   ++  +
Sbjct  114  VADAWKGLLSIAPDKTVTVLTREAEGLPFRFTDDVDIAPDGRIYFTDASSQFRQPEYRLD  173

Query  603  FLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGE  782
             LE +PHGRLL YDP T +T+VL+N+L FANGVAV PD  +++  ET   R  KY+I G 
Sbjct  174  LLEMRPHGRLLRYDPATGKTEVLLNNLHFANGVAVSPDGEYLLVNETWKYRILKYWIGGR  233

Query  783  KKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVM-----  947
              G  EVF +NLPG PDN+  D EG +W+          + + R P L+ +L  +     
Sbjct  234  YPGQAEVFADNLPGFPDNLAVDHEGRYWVAFPTLRNAQVDALHRQPWLKDLLAKLPDYFK  293

Query  948  ---EKYGVRPNMEKNGGIFV  998
               ++YG+   M++NGG+  
Sbjct  294  PKPQEYGLVVAMDENGGVIT  313



>ref|WP_033998906.1| gluconolactonase [Pseudomonas aeruginosa]
Length=353

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 123/323 (38%), Positives = 187/323 (58%), Gaps = 17/323 (5%)
 Frame = +3

Query  144   PAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGW  308
             P   L   +PA AP   G L     L  +E +G G++ GPED   D + G +Y G  DG 
Sbjct  25    PIDPLAWDAPA-APPMTGVLEPNDTLMKAELLGQGQVDGPEDTAVDSQ-GRVYAGLADGR  82

Query  309   VKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTA  488
             V R+           VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  
Sbjct  83    VVRLD------GSGKVETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLAT  136

Query  489   EADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKV  668
             EADGV F  TD +D+A DG +YF+DAS ++   D+I + LE +PHGRLL YDP T +T+V
Sbjct  137   EADGVPFAFTDDLDIASDGRIYFSDASSRFHQPDYILDLLEARPHGRLLRYDPATGKTEV  196

Query  669   LVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYD  848
             L+ DL+FANGVA+  ++ FV+  ET   R  +Y+++GEK G  +VFI+NLPG+PDN++ D
Sbjct  197   LLEDLYFANGVALSANEDFVLVNETYRYRITRYWLKGEKAGQHDVFIDNLPGLPDNLQGD  256

Query  849   GEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAH  1028
              +G FW+ +        + + R+P L+  L  + +  + P     G +  +D +G  V  
Sbjct  257   RKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRS  315

Query  1029  YYE---RDFTLVSTGIKIGNYMY  1088
              ++       ++++   +G+Y+Y
Sbjct  316   LHDTSGHHLRMITSAKPVGDYLY  338



>ref|WP_017677447.1| gluconolactonase [Pseudomonas alcaliphila]
Length=354

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 191/331 (58%), Gaps = 24/331 (7%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDG  305
              DP P+ A      + A+ P      L  +E +  G++ GPED   D + G +Y G  DG
Sbjct  27    IDPLPWDAAPAPAMTGALEPNDT---LMKAELLARGQVHGPEDTAVDSQ-GRVYAGLHDG  82

Query  306   WVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMT  485
              + RV       AD ++E + +TGGRPLG+     G +IVADA  GLL++   G ++V+T
Sbjct  83    RIVRVL------ADDSLETFADTGGRPLGMNFDASGNLIVADAYKGLLSIDPQGAIKVLT  136

Query  486   AEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTK  665
              EA+G++F  TD +D+A DG +YF+DAS ++   D++ + LE +PHGRLLSYDP + +T+
Sbjct  137   TEAEGLRFAFTDDLDIASDGTIYFSDASSRFEQPDYLLDLLEARPHGRLLSYDPASGETR  196

Query  666   VLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRY  845
             VL+ DL+FANGVA+  ++ FV+  ET   R  +Y+++G+K G  ++FI+NLPG+PDN++ 
Sbjct  197   VLLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGDKAGQHDIFIDNLPGLPDNLQG  256

Query  846   DGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEK--------YGVRPNMEKNGGIFVV  1001
             D  G FW+ +        + + R+P L+  L  + +        YG    + +NG I V 
Sbjct  257   DRNGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRALWPKAIPYGFAIALNENGEI-VR  315

Query  1002  DMEGNPVAHYYERDFTLVSTGIKIGNYMYCG  1094
              +      H       +V++   +G+Y+Y G
Sbjct  316   SLHDTSGTH-----LRMVTSVKPVGDYLYFG  341



>ref|WP_021490043.1| gluconolactonase [Pseudomonas mendocina]
 gb|ERH48752.1| gluconolactonase [Pseudomonas mendocina EGD-AQ5]
Length=354

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/331 (37%), Positives = 190/331 (57%), Gaps = 24/331 (7%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDG  305
              DP P+ A      + A+ P      L  +E +  G++ GPED   D + G +Y G  DG
Sbjct  27    IDPLPWDAAPAPAMTGALEPNDT---LMKAELLARGQVHGPEDTAVDSQ-GRVYAGLHDG  82

Query  306   WVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMT  485
              + RV       AD ++E + +TGGRPLG+     G +IVADA  GLL++   G ++V+T
Sbjct  83    RIVRVL------ADDSLETFADTGGRPLGMNFDAGGNLIVADAYKGLLSIDPQGAIKVLT  136

Query  486   AEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTK  665
              EA+G++F  TD +D+A DG +YF+DAS ++   D++ + LE +PHGRLLSYDP + +T+
Sbjct  137   TEAEGLRFAFTDDLDIASDGTIYFSDASSRFEQPDYLLDLLEARPHGRLLSYDPASGETR  196

Query  666   VLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRY  845
             VL+ DL+FANGVA+   + FV+  ET   R  +Y+++GEK G  ++FI+NLPG+PDN++ 
Sbjct  197   VLLKDLYFANGVALSAKEDFVLVNETYRYRITRYWLKGEKAGQHDIFIDNLPGLPDNLQG  256

Query  846   DGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEK--------YGVRPNMEKNGGIFVV  1001
             D  G FW+ +        + + R+P L+  L  + +        YG    + +NG I V 
Sbjct  257   DRNGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRALWPKAIPYGFAIALNENGEI-VR  315

Query  1002  DMEGNPVAHYYERDFTLVSTGIKIGNYMYCG  1094
              +      H       +V++   +G+Y+Y G
Sbjct  316   SLHDTSGTH-----LRMVTSVKPVGDYLYFG  341



>emb|CBI38404.3| unnamed protein product [Vitis vinifera]
Length=175

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = +3

Query  633   LSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIE  812
             +S+DP TK+TKVLV DLFFANGV V PDQ+ VIFCE++M+ C KYYI+GE+KGS++ FI+
Sbjct  1     MSFDPSTKETKVLVRDLFFANGVIVSPDQNSVIFCESVMKMCLKYYIQGERKGSMDKFID  60

Query  813   NLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGI  992
             NL G PDNI YDGEG +WI + +  + A++L  +YP +RK++ +ME+Y VRP+MEKNGG+
Sbjct  61    NLSGTPDNILYDGEGHYWIALPMGNSLAWDLALKYPWIRKVVAIMERYKVRPHMEKNGGV  120

Query  993   FVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAVAS  1154
              VVD+EGNP A+YY+   + V++G+KIGN++YCG +   +++ L++ Q+ A A+
Sbjct  121   LVVDLEGNPTAYYYDLGLSEVTSGVKIGNHLYCGSITTRYMIRLDIHQHAARAT  174



>ref|XP_010042604.1| PREDICTED: protein YLS2-like, partial [Eucalyptus grandis]
Length=163

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  441  GLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKP  620
            GLLNV+  G V+++T EA+GVKFKLTD V VA DG +YFTDAS+KY   +FIW+ LEG+P
Sbjct  1    GLLNVSKHGMVELLTDEAEGVKFKLTDGVAVASDGTIYFTDASYKYTFGEFIWDILEGRP  60

Query  621  HGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIE  800
            HGRLLSYDP TK+T+VL  DL+F NG+A+ P+QSFVIFCETIMRRCK+YYI GE+KG I+
Sbjct  61   HGRLLSYDPATKETQVLARDLYFPNGIALSPNQSFVIFCETIMRRCKRYYINGERKGHID  120

Query  801  VFIENLPGMPDNIRYDGEGLFWIGI  875
             FI  LPG PDNI+YDGEG +WI +
Sbjct  121  TFIGGLPGYPDNIKYDGEGHYWIAL  145



>gb|AHI30776.1| gluconolactonase [Marinobacter salarius]
Length=361

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 127/349 (36%), Positives = 189/349 (54%), Gaps = 19/349 (5%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPA-----VAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
               P+P  +      SP      +AP    RL   ++ +  G + GPED   D   G++YT
Sbjct  18    LSPSPINSQAWNAPSPQPLTGKLAPNERLRL---ADLLARGEVYGPEDTTVD-DDGILYT  73

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGK  470
             G  DGW+ RV        D   E W+ TGGRPLG+    HG +IVADA  GLL++  D  
Sbjct  74    GTQDGWIVRVK------PDGQTEKWLETGGRPLGMVFDRHGNLIVADAWKGLLSIAPDKT  127

Query  471   VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPH  650
             V V+T EA+G+ F+ TD VD+A DG +YFTDAS ++   ++  + LE +PHGRLL YDP 
Sbjct  128   VTVLTREAEGLPFRFTDDVDIAPDGRIYFTDASSRFRQPEYQLDLLEMRPHGRLLRYDPA  187

Query  651   TKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMP  830
             T +T+VL+++L FANGVAV PD  +++  ET   R  KY+I G   G  EVF +NLPG P
Sbjct  188   TGKTEVLLSNLHFANGVAVSPDGEYLLVNETWKYRILKYWIGGRYPGQAEVFADNLPGFP  247

Query  831   DNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDME  1010
             DN+  D EG +W+          + + R P L+ +L  +  Y  +P  ++ G +  +D +
Sbjct  248   DNLAVDHEGRYWVAFPTLRNAQVDALHRQPWLKDLLAKLPDY-FKPKPQEYGLVVAMDAD  306

Query  1011  GNPVAHYYERDFTLVSTGIKIG---NYMYCGFVKYGFILSLNLTQNPAV  1148
             G+ +   ++   T +     +     ++Y G +    I  L L+  P +
Sbjct  307   GSVITSLHDTKGTHLREITSVNPHDGHLYFGSLHNDRIGRLALSAIPGL  355



>ref|WP_036203082.1| gluconolactonase [Marinobacter sp. MCTG268]
Length=363

 Score =   222 bits (565),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 122/325 (38%), Positives = 183/325 (56%), Gaps = 16/325 (5%)
 Frame = +3

Query  78    VLVPVILGVVIYQLDSFDPAPYPAHELTQGSPA-----VAPKRNGRLLHDSEKIGVGRLS  242
             +L  +++G ++       P+P  +      SP      +AP    RL   ++ +  G + 
Sbjct  4     LLGALLIGFLVLGGFLLSPSPINSQAWNAPSPQPLTGKLAPNERLRL---ADLLARGEVF  60

Query  243   GPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVI  422
             GPED   D   G++YTG  DGW+ RV        D   E W+ TGGRPLG+    HG +I
Sbjct  61    GPEDTTVD-DDGILYTGTQDGWIVRVK------PDGQTEKWLETGGRPLGMVFDRHGNLI  113

Query  423   VADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWE  602
             VADA  GLL++  D  V V+T EA+G+ F+ TD VD+A DG +YFTDAS ++   ++  +
Sbjct  114   VADAWKGLLSIAPDKTVTVLTREAEGLPFRFTDDVDIAPDGRIYFTDASSRFRQPEYQLD  173

Query  603   FLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGE  782
              LE +PHGRLL YDP T +T+VL+++L FANGVAV PD  +++  ET   R  KY+I G 
Sbjct  174   LLEMRPHGRLLRYDPATGKTEVLLSNLHFANGVAVSPDGEYLLVNETWKYRILKYWIGGR  233

Query  783   KKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGV  962
               G  EVF +NLPG PDN+  D EG +W+          + + R P L+ +L  +  Y  
Sbjct  234   YPGQAEVFADNLPGFPDNLAVDHEGRYWVAFPTLRNAQVDALHRQPWLKDLLAKLPDY-F  292

Query  963   RPNMEKNGGIFVVDMEGNPVAHYYE  1037
             +P  ++ G +  +D +G+ +   ++
Sbjct  293   KPKPQEYGLVVAMDADGSVITSLHD  317



>ref|WP_015476341.1| hypothetical protein [Pseudomonas denitrificans]
 ref|YP_007657011.1| hypothetical protein H681_07975 [Pseudomonas denitrificans ATCC 
13867]
 gb|AGI23471.1| hypothetical protein H681_07975 [Pseudomonas denitrificans ATCC 
13867]
Length=353

 Score =   221 bits (564),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 186/320 (58%), Gaps = 16/320 (5%)
 Frame = +3

Query  168   SPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNE  332
             +P  AP   G +     L  +E +  G++ GPED   D + G ++ G  DG + R+    
Sbjct  32    TPPKAPPMTGVMEPNDTLMKAELLAQGQIVGPEDTAVDSQ-GRVFAGLDDGRIVRI----  86

Query  333   SSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFK  512
                AD   E +V TGGRPLGLA    G++IVADA  GLL V   GK++V+T  ADG+ F 
Sbjct  87    --GADGKAETFVETGGRPLGLAFDKSGKLIVADAWKGLLEVDPQGKIRVLTDSADGIPFA  144

Query  513   LTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFA  692
              TD +D+A DG +YF+DAS ++   D+I + LE +PHGRLL YDP T +T+ L+ DL+FA
Sbjct  145   FTDDLDIASDGRIYFSDASSRFHQPDYILDLLEARPHGRLLRYDPATGKTETLLKDLYFA  204

Query  693   NGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIG  872
             NGVA+  ++ FV+  ET   R  +Y+++GEK G  +VFI+NLPG+PDN+  D  G FW+ 
Sbjct  205   NGVALSQNEDFVLVNETYRYRITRYWLKGEKAGQHDVFIDNLPGLPDNLASDRSGTFWVA  264

Query  873   IGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RD  1043
             +        +LIQ+ P L++ L  + +  V P     G +  V+ +G  V   ++   + 
Sbjct  265   LPSPRKADADLIQQMPWLKRQLTKLPR-AVLPKPVPYGLVIQVNEKGEIVRSLHDTSGQH  323

Query  1044  FTLVSTGIKIGNYMYCGFVK  1103
               +V++   +   +Y G ++
Sbjct  324   LRMVTSAKPVNGVLYLGSLE  343



>ref|XP_001768837.1| predicted protein [Physcomitrella patens]
 gb|EDQ66390.1| predicted protein [Physcomitrella patens]
Length=314

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 184/311 (59%), Gaps = 9/311 (3%)
 Frame = +3

Query  192   NGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVN  371
             + +LLH   K+G G+L  PED+V DP    +YT   DGW+K+  ++  S     VE+WVN
Sbjct  2     HNKLLHGLAKLGDGQLLQPEDMVADPTEMFLYTTNSDGWIKKYYLSNGS-----VENWVN  56

Query  372   TGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGML  551
              GGRPL +A G  GEV+V +   G + V   G  +++  EA G++F L DAV V+ +G++
Sbjct  57    VGGRPLAIALGNEGEVLVCEPVQGHVQVDKLGTKEILATEAGGIEFGLIDAVTVSSNGLI  116

Query  552   YFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVI  731
             YFTDAS K+ L  + ++ LEG+  GR+  Y+P  K T+VL+++L+F NG+A+   +   I
Sbjct  117   YFTDASTKHPLGTWHFDMLEGQVSGRIAVYNPEDKSTRVLLDELYFPNGIALSKSEDHFI  176

Query  732   FCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNI-RYDGEGLFWIGIGIEYTHAFELI  908
              CET + RC K+++RGEK+G+I+ FIENLPG PDNI R    G F+IGI        + +
Sbjct  177   NCETTVARCMKFFLRGEKEGTIKTFIENLPGHPDNIHRNLKNGRFYIGIPGNRNGLTDFV  236

Query  909   QRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERD---FTLVSTGIKIGN  1079
              R P+ ++IL          +M K G +F VD  G P+  Y +        V+T +++  
Sbjct  237   ARTPVAKQILAFSPVLYKLLDMRKMGRVFEVDPSGKPLQVYEDPTGEVIGFVTTVVEVDW  296

Query  1080  YMYCGFVKYGF  1112
             Y+Y G  +  F
Sbjct  297   YLYVGGFRDSF  307



>ref|WP_025167244.1| gluconolactonase [Pseudomonas taeanensis]
 gb|KFX67781.1| gluconolactonase [Pseudomonas taeanensis MS-3]
Length=353

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/327 (37%), Positives = 190/327 (58%), Gaps = 17/327 (5%)
 Frame = +3

Query  138   PYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMD  302
             P P   L   +P  AP   G L     L  ++ +G GR+ GPED   D + G +Y+G  D
Sbjct  23    PSPIDPLAWEAPK-APAMTGVLEPNDTLMKAQLLGKGRIHGPEDTAVDAQ-GRVYSGLHD  80

Query  303   GWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVM  482
             G + R+       AD +VE + +T GRPLG+     G +IVADA  GLL++T  G++ V+
Sbjct  81    GTIVRIE------ADDSVEPFADTQGRPLGMDFDAAGNLIVADAYKGLLSITPQGQITVL  134

Query  483   TAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQT  662
             T EA+GV F+ TD +D+A DG +YF+DAS ++   D++ + LE +P GRLLSYDP T  T
Sbjct  135   TTEAEGVPFRFTDDLDIASDGTIYFSDASQRFEQPDYLLDLLEARPWGRLLSYDPATGVT  194

Query  663   KVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIR  842
             KVL+ DL+FANGVA+  ++ FV+  ET   R  +Y+++G K G+ +VFI+NLPG+PDN++
Sbjct  195   KVLLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGAKAGTHDVFIDNLPGLPDNLQ  254

Query  843   YDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPV  1022
              D  G FW+ +        + + R+P L+  L  + +  + P     G    ++ +G  V
Sbjct  255   GDRAGTFWVALPTPRKADADFLHRHPWLKTQLAKLPR-ALWPKAVPYGFAIAINEQGEIV  313

Query  1023  AHYYERD---FTLVSTGIKIGNYMYCG  1094
                ++       +V++   +G+ +Y G
Sbjct  314   RSLHDTSGSHLRMVTSVKPVGDSLYFG  340



>gb|KFJ93264.1| gluconolactonase [Pseudomonas sp. 1-7]
Length=353

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/336 (36%), Positives = 192/336 (57%), Gaps = 34/336 (10%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
              DP P+ A        A AP   G L     L  +E +  G++ GPED   D + G +Y 
Sbjct  26    IDPLPWDA--------APAPAMTGVLEPNDTLMKAELVVRGQVHGPEDTAVDSQ-GRVYA  76

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGK  470
             G  DG + RV       AD ++E + +TGGRPLG+     G +IVADA  GLL++   G 
Sbjct  77    GLHDGRIVRVL------ADDSLETFADTGGRPLGMNFDASGHLIVADAYKGLLSIDPQGA  130

Query  471   VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPH  650
             ++V++ EA+G++F  TD +D+A DG +YF+DAS ++   D++ + LE +PHGRLLSYDP 
Sbjct  131   IKVLSTEAEGLRFAFTDDLDIASDGTIYFSDASSRFEQPDYLLDLLEARPHGRLLSYDPA  190

Query  651   TKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMP  830
             + +T+VL+ DL+FANGVA+  ++ FV+  ET   R  +Y+++G+K G  ++FI+NLPG+P
Sbjct  191   SGETRVLLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGDKTGQHDIFIDNLPGLP  250

Query  831   DNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEK--------YGVRPNMEKNG  986
             DN++ D  G FW+ +        + + R+P L+  L  + +        YG    + +NG
Sbjct  251   DNLQGDRNGTFWVALPTPRKADADFLHRHPWLKAQLAKLPRALWPKAVPYGFAIALNENG  310

Query  987   GIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCG  1094
              I V  +      H       +V++   +G+Y+Y G
Sbjct  311   EI-VRSLHDTSGTH-----LRMVTSVKPVGDYLYFG  340



>ref|WP_027830770.1| gluconolactonase [Marinobacter sp. HL-58]
Length=363

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/349 (36%), Positives = 188/349 (54%), Gaps = 19/349 (5%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPA-----VAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
               P+P  +      SP      +AP    RL   ++ +  G + GPED   D   GV+YT
Sbjct  20    LSPSPINSQSWKAPSPQPLTGELAPNERLRL---ADLLARGEVYGPEDTTVD-DDGVLYT  75

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGK  470
             G  DGW+ RV        D  VE W+ T GRPLG+     G +IVADA  GLL++  D  
Sbjct  76    GTQDGWIVRVW------PDGRVERWLETEGRPLGMVFDRDGNLIVADAWKGLLSIAPDKT  129

Query  471   VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPH  650
             V ++T EA+G+ F+ TD VD+A DG +YFTDAS ++   D++ + LE +PHGRLL YDP 
Sbjct  130   VTLLTREAEGLPFRFTDDVDIAPDGRIYFTDASSRFRQPDYLLDLLEMRPHGRLLRYDPQ  189

Query  651   TKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMP  830
             T++T+VL+++L FANGVAV PD  +V+  ET   R  KY+I G   G  EVF +NLPG P
Sbjct  190   TQRTEVLLSNLHFANGVAVSPDGEYVLVNETWKYRILKYWIGGRNPGQAEVFADNLPGFP  249

Query  831   DNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDME  1010
             DN+  D EG +W+          + + R P L+ +L  + ++ + P  ++ G +  +D +
Sbjct  250   DNLAVDDEGRYWVAFPTLRNPRVDAMHRQPWLKDLLAKLPEWFL-PTPQQYGLVVALDEQ  308

Query  1011  GNPVAHYYERDFTLVSTGIKIG---NYMYCGFVKYGFILSLNLTQNPAV  1148
                +   ++   T +     +     Y+Y G +    I  L L   P +
Sbjct  309   AEVITSLHDTRGTHLQEITSVNPHDGYLYFGSLHNDRIGRLALAAIPGL  357



>gb|EZH79532.1| gluconolactonase [Pseudomonas pseudoalcaligenes AD6]
Length=353

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 119/331 (36%), Positives = 192/331 (58%), Gaps = 24/331 (7%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
              DP P+ A        A AP   G L     L  +E +  G++ GPED   D + G +Y 
Sbjct  26    IDPLPWDA--------APAPAMTGVLEPNDTLMKAELLARGQVHGPEDTAVDSQ-GRVYA  76

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGK  470
             G  DG + RV        D ++E + +TGGRPLG+     G +IVADA  GLL++   G 
Sbjct  77    GLHDGRIVRVL------HDDSLETFADTGGRPLGMNFDASGNLIVADAYKGLLSIDPQGA  130

Query  471   VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPH  650
             ++V+T EADG++F  TD +D+A DG +YF+DAS ++   D++ + LE +PHGRLLSY+P 
Sbjct  131   IKVLTTEADGLRFAFTDDLDIASDGTIYFSDASSRFEQPDYLLDLLEARPHGRLLSYNPA  190

Query  651   TKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMP  830
             + +T VL+ DL+FANGVA+  ++ FV+  ET   R  +Y+++G+K G  ++FI+NLPG+P
Sbjct  191   SGETHVLLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGDKAGQHDIFIDNLPGLP  250

Query  831   DNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDME  1010
             DN++ D +G FW+ +        + + R+P L+  +  + +  + P     G    ++ +
Sbjct  251   DNLQGDRKGTFWVALPTPRKADADFLHRHPWLKSQMAKLPR-ALWPKAIPYGFAIALNEQ  309

Query  1011  GNPVAHYYERDFT---LVSTGIKIGNYMYCG  1094
             G  V   ++   T   +V++   +G+Y+Y G
Sbjct  310   GEIVRSLHDTSGTHLRMVTSVKPVGDYLYFG  340



>ref|WP_003244587.1| gluconolactonase [Pseudomonas mendocina]
 gb|EJO93649.1| gluconolactonase [Pseudomonas mendocina DLHK]
Length=354

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 196/343 (57%), Gaps = 24/343 (7%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
              DP P+ A        A AP   G L     L  +E +  G++ GPED   D + G +Y 
Sbjct  27    IDPLPWDA--------APAPAMTGVLEANDTLMKAELLARGQVHGPEDTAVDGE-GRVYA  77

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGK  470
             G  DG + RV       AD +VE +V+TGGRPLG+     G +IVADA  GLL++   G 
Sbjct  78    GLHDGRIVRVL------ADDSVETFVDTGGRPLGMNFDAAGNLIVADAYKGLLSIDPQGA  131

Query  471   VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPH  650
             + V+T EADGV F  TD +D+A DG +YF+DAS ++   D++ + LE +PHGRLL+YDP 
Sbjct  132   ITVLTTEADGVPFAFTDDLDIASDGTIYFSDASSRFQQPDYLLDLLEARPHGRLLAYDPA  191

Query  651   TKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMP  830
             + +T+VL++ L+FANGVA+  ++ FV+  ET   R  +Y+++G+K G  ++FI+NLPG+P
Sbjct  192   SGETRVLLDGLYFANGVALSANEDFVLVNETYRYRITRYWLKGDKAGQHDIFIDNLPGLP  251

Query  831   DNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDME  1010
             DN++ D  G FW+ +        + + R+P L+  L  + +  + P     G    ++ +
Sbjct  252   DNLQGDRNGTFWVALPTPRKADADFLHRHPWLKAQLAKLPR-ALWPKAIPYGFAIALNEQ  310

Query  1011  GNPVAHYYERDFT---LVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             G  V   ++   T   ++++   +G+++Y G +    I  L L
Sbjct  311   GEIVRSLHDTSGTHLRMITSVKPVGDHLYFGSLDNDRIGRLEL  353



>ref|WP_037002501.1| gluconolactonase [Pseudomonas pseudoalcaligenes]
Length=354

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 119/331 (36%), Positives = 193/331 (58%), Gaps = 24/331 (7%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
              DP P+ A        A AP   G L     L  +E +  G++ GPED   D + G +Y 
Sbjct  27    IDPLPWDA--------APAPAMTGVLEPNDTLMKAELLARGQVHGPEDTAVDSQ-GRVYA  77

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGK  470
             G  DG + RV  ++S      +E + +TGGRPLG+     G +IVADA  GLL++   G 
Sbjct  78    GLHDGRIVRVLHDDS------LETFADTGGRPLGMNFDASGNLIVADAYKGLLSIDPQGA  131

Query  471   VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPH  650
             ++V+T EADG++F  TD +D+A DG +YF+DAS ++   D++ + LE +PHGRLLSY+P 
Sbjct  132   IKVLTTEADGLRFAFTDDLDIASDGTIYFSDASSRFEQPDYLLDLLEARPHGRLLSYNPA  191

Query  651   TKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMP  830
             + +T VL+ DL+FANGVA+  ++ FV+  ET   R  +Y+++G+K G  ++FI+NLPG+P
Sbjct  192   SGETHVLLKDLYFANGVALSANEDFVLVNETYRYRITRYWLKGDKAGQHDIFIDNLPGLP  251

Query  831   DNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDME  1010
             DN++ D +G FW+ +        + + R+P L+  +  + +  + P     G    ++ +
Sbjct  252   DNLQGDRKGTFWVALPTPRKADADFLHRHPWLKSQMAKLPR-ALWPKAIPYGFAIALNEQ  310

Query  1011  GNPVAHYYERDFT---LVSTGIKIGNYMYCG  1094
             G  V   ++   T   +V++   +G+Y+Y G
Sbjct  311   GEIVRSLHDTSGTHLRMVTSVKPVGDYLYFG  341



>ref|WP_014420374.1| gluconolactonase [Marinobacter hydrocarbonoclasticus]
 ref|YP_005428345.1| strictosidine synthase [Marinobacter hydrocarbonoclasticus ATCC 
49840]
 emb|CCG93922.1| strictosidine synthase,involved in the biosynthesis of the monoterpenoid 
indole alkaloids [Marinobacter hydrocarbonoclasticus 
ATCC 49840]
Length=363

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 166/280 (59%), Gaps = 11/280 (4%)
 Frame = +3

Query  177   VAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAV  356
             +AP    RL   ++ +  G + GPED    P  GV+YTG  DGW+ RV        D  V
Sbjct  43    LAPNERLRL---ADLLARGEVYGPEDTTIGPD-GVLYTGTQDGWIVRV------HPDGTV  92

Query  357   EDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVA  536
             E W+ TGGRPLGL    +G +IVADA  GLL++T  G + V+T EA+G  F+ TD V +A
Sbjct  93    EHWLETGGRPLGLVFDSNGNLIVADAWKGLLSITPQGDITVLTREAEGTPFRFTDDVVIA  152

Query  537   EDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPD  716
              DG +YFTDAS ++   D++ + LE +PHGRLL Y+P T++T+VL+ +L FANGVAV P 
Sbjct  153   PDGRIYFTDASSRFQQPDYVLDLLEMRPHGRLLRYNPKTRKTEVLLGNLHFANGVAVAPQ  212

Query  717   QSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHA  896
               +V+  ET   R  +Y+I G K G  EVF +NLPG PDN+  DGEG +W+         
Sbjct  213   GDYVLVNETWKYRILRYWISGPKAGRAEVFADNLPGFPDNLAVDGEGRYWVAFPTLRNPR  272

Query  897   FELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGN  1016
              + + + P L+ ++  + +  ++P  +  G +   D +G 
Sbjct  273   VDAMHKSPWLKDLVAKLPE-SLKPKPQNYGLVVAFDSKGQ  311



>gb|KER99317.1| gluconolactonase [Pseudomonas mendocina]
 gb|KFB14396.1| gluconolactonase [Pseudomonas mendocina S5.2]
Length=353

 Score =   219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 121/331 (37%), Positives = 193/331 (58%), Gaps = 24/331 (7%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
              DP P+ A        A AP   G L     L  +E +  G++ GPED   D + G +Y 
Sbjct  26    IDPLPWDA--------APAPAMTGVLEPNDTLMKAELLARGQVHGPEDTAVDGQ-GRVYA  76

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGK  470
             G  DG + RV       AD ++E++ +TGGRPLG+     G +IVADA  GLL++   G 
Sbjct  77    GLHDGRIVRVL------ADDSLENFADTGGRPLGMNFDASGNLIVADAYKGLLSIDPQGA  130

Query  471   VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPH  650
             ++V+T EADG+ F  TD +D+A DG +YF+DAS ++   D++ + LE +PHGRLLSYDP 
Sbjct  131   IKVLTTEADGLPFAFTDDLDIASDGTIYFSDASSRFEQPDYLLDLLEARPHGRLLSYDPA  190

Query  651   TKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMP  830
             + +T VL++ L+FANGVA+  ++ FV+  ET   R  +Y+++G+K G  ++FI+NLPG+P
Sbjct  191   SGKTHVLLDGLYFANGVALSANEDFVLVNETYRYRITRYWLKGDKAGQHDIFIDNLPGLP  250

Query  831   DNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDME  1010
             DN++ D +G FW+ +        + + R+P L+  L  + +  + P     G    ++ +
Sbjct  251   DNLQGDRKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPR-AMWPKAIPYGFAIALNEK  309

Query  1011  GNPVAHYYERDFT---LVSTGIKIGNYMYCG  1094
             G  V   ++   T   +V++   +G+Y+Y G
Sbjct  310   GEIVRSLHDTSGTHLRMVTSVKPVGDYLYFG  340



>ref|WP_013716188.1| gluconolactonase [Pseudomonas mendocina]
 ref|YP_004380872.1| gluconolactonase [Pseudomonas mendocina NK-01]
 gb|AEB59120.1| gluconolactonase [Pseudomonas mendocina NK-01]
Length=354

 Score =   219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 121/331 (37%), Positives = 193/331 (58%), Gaps = 24/331 (7%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
              DP P+ A        A AP   G L     L  +E +  G++ GPED   D + G +Y 
Sbjct  27    IDPLPWDA--------APAPAMTGVLEPNDTLMKAELLARGQVHGPEDTAVDGQ-GRVYA  77

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGK  470
             G  DG + RV       AD ++E++ +TGGRPLG+     G +IVADA  GLL++   G 
Sbjct  78    GLHDGRIVRVL------ADDSLENFADTGGRPLGMNFDASGNLIVADAYKGLLSIDPQGA  131

Query  471   VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPH  650
             ++V+T EADG+ F  TD +D+A DG +YF+DAS ++   D++ + LE +PHGRLLSYDP 
Sbjct  132   IKVLTTEADGLPFAFTDDLDIASDGTIYFSDASSRFEQPDYLLDLLEARPHGRLLSYDPA  191

Query  651   TKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMP  830
             + +T VL++ L+FANGVA+  ++ FV+  ET   R  +Y+++G+K G  ++FI+NLPG+P
Sbjct  192   SGKTHVLLDGLYFANGVALSANEDFVLVNETYRYRITRYWLKGDKAGQHDIFIDNLPGLP  251

Query  831   DNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDME  1010
             DN++ D +G FW+ +        + + R+P L+  L  + +  + P     G    ++ +
Sbjct  252   DNLQGDRKGTFWVALPTPRKADADFLHRHPWLKAQLAKLPR-AMWPKAIPYGFAIALNEK  310

Query  1011  GNPVAHYYERDFT---LVSTGIKIGNYMYCG  1094
             G  V   ++   T   +V++   +G+Y+Y G
Sbjct  311   GEIVRSLHDTSGTHLRMVTSVKPVGDYLYFG  341



>ref|WP_012018271.1| gluconolactonase [Pseudomonas mendocina]
 ref|YP_001187268.1| gluconolactonase [Pseudomonas mendocina ymp]
 gb|ABP84536.1| gluconolactonase [Pseudomonas mendocina ymp]
Length=354

 Score =   218 bits (556),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 196/343 (57%), Gaps = 24/343 (7%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
              DP P+ A        A AP   G L     L  +E +  G++ GPED   D + G +Y 
Sbjct  27    IDPLPWDA--------APAPAMTGVLEANDTLMKAELLARGQVHGPEDTAVDGE-GRVYA  77

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGK  470
             G  DG + RV       AD +VE +V+TGGRPLG+     G +IVADA  GLL++   G 
Sbjct  78    GLHDGRIVRVL------ADDSVETFVDTGGRPLGMNFDAAGNLIVADAYKGLLSIDPHGA  131

Query  471   VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPH  650
             + V+T EADGV F  TD +D+A DG +YF+DAS ++   D++ + LE +PHGRLL+YDP 
Sbjct  132   ITVLTTEADGVPFAFTDDLDIASDGTIYFSDASSRFQQPDYLLDLLEARPHGRLLAYDPA  191

Query  651   TKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMP  830
             + +T+VL++ L+FANGVA+  ++ FV+  ET   R  +Y+++G+K G  ++FI+NLPG+P
Sbjct  192   SGETRVLLDGLYFANGVALSANEDFVLVNETYRYRITRYWLKGDKAGQHDIFIDNLPGLP  251

Query  831   DNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDME  1010
             DN++ D  G FW+ +        + + R+P L+  L  + +  + P     G    ++ +
Sbjct  252   DNLQGDRNGTFWVALPTPRKADADFLHRHPWLKAQLAKLPR-ALWPKAIPYGFAIALNEQ  310

Query  1011  GNPVAHYYERDFT---LVSTGIKIGNYMYCGFVKYGFILSLNL  1130
             G  V   ++   T   ++++   +G+++Y G +    I  L L
Sbjct  311   GEIVRSLHDTSGTHLRMITSVKPVGDHLYFGSLDNDRIGRLEL  353



>ref|WP_003461681.1| gluconolactonase [Pseudomonas pseudoalcaligenes]
 emb|CCH38499.1| unnamed protein product [Pseudomonas pseudoalcaligenes CECT 5344]
 emb|CDM40196.1| Gluconolactonase [Pseudomonas pseudoalcaligenes CECT 5344]
 emb|CDR90823.1| Gluconolactonase [Pseudomonas pseudoalcaligenes]
Length=354

 Score =   218 bits (556),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 119/331 (36%), Positives = 193/331 (58%), Gaps = 24/331 (7%)
 Frame = +3

Query  126   FDPAPYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYT  290
              DP P+ A        A AP   G L     L  +E +  G++ GPED   D + G +Y 
Sbjct  27    IDPLPWDA--------APAPAMTGVLEPNDTLMKAELVVRGQVHGPEDTAVDSQ-GRVYA  77

Query  291   GCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGK  470
             G  DG + RV       AD ++E + +TGGRPLG+     G +IVADA  GLL++   G 
Sbjct  78    GLHDGRIVRVL------ADDSLETFADTGGRPLGMNFDASGNLIVADAYKGLLSIDPQGA  131

Query  471   VQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPH  650
             ++V+T EA+G++F  TD +D+A DG +YF+DAS ++   D++ + LE +PHGRLLSYDP 
Sbjct  132   IKVLTTEAEGLRFAFTDDLDIASDGTIYFSDASSRFQQPDYLLDLLEARPHGRLLSYDPT  191

Query  651   TKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMP  830
             + +T+VL++ L+FANGVA+  ++ FV+  ET   R  +Y+++G+K G  ++FI+NLPG+P
Sbjct  192   SGETRVLLDGLYFANGVALSANEDFVLVNETYRYRITRYWLKGDKAGQHDIFIDNLPGLP  251

Query  831   DNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDME  1010
             DN++ D  G FW+ +        + + R+P L+  +  + +  + P     G    ++ +
Sbjct  252   DNLQGDRNGTFWVALPTPRKADADFLHRHPWLKAQMAKLPR-ALWPKAIPYGFAIALNEQ  310

Query  1011  GNPVAHYYERDFT---LVSTGIKIGNYMYCG  1094
             G  V   ++   T   +V++   +G+Y+Y G
Sbjct  311   GEIVRSLHDTSGTHLRMVTSVKPVGDYLYFG  341



>ref|WP_007616709.1| adipocyte plasma membrane-associated protein [Glaciecola arctica]
 dbj|GAC17680.1| adipocyte plasma membrane-associated protein [Glaciecola arctica 
BSs20135]
Length=355

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/302 (36%), Positives = 184/302 (61%), Gaps = 11/302 (4%)
 Frame = +3

Query  198   RLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTG  377
             +LLH +E + +G+++GPE++  D + G +Y G  DG +  +T       D  ++ + +T 
Sbjct  49    KLLHKAELLALGQINGPEEVAVDSQ-GRVYGGTQDGKIMVLTT------DGKLDVFADTQ  101

Query  378   GRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYF  557
             GRPLG+    +  +IV DA+ GLL++   GK+ V+   A+G  FK TDA+D++ DG++YF
Sbjct  102   GRPLGMQFDQNENLIVCDADKGLLSINLQGKITVLATSANGTPFKFTDALDISSDGIIYF  161

Query  558   TDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFC  737
             TDAS KYG ++++++ LE KPHGRLLSY+  T + K+L++DL+FANGVA+   Q FV+  
Sbjct  162   TDASAKYGHKEYLYDLLESKPHGRLLSYNLSTGEIKLLLSDLYFANGVALSQQQDFVLVN  221

Query  738   ETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRY  917
             ET   R  KY+++G + G+ E+FI+NLPG PDNI  +G+G FW+ +        + +  Y
Sbjct  222   ETYRYRIVKYWLKGPQAGTHEIFIDNLPGFPDNISSNGKGTFWLALFTVRNDVLDSLHPY  281

Query  918   PLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RDFTLVSTGIKIGNYMY  1088
             P L+  +  + K  + P  +  G +  ++ +G+     +E   +    +++  +   Y+Y
Sbjct  282   PFLKTQMSKLPK-SMWPKPQPYGLVLALNEQGDITQSLHEPSGQHLKEITSAKEHDGYLY  340

Query  1089  CG  1094
              G
Sbjct  341   LG  342



>ref|WP_021699192.1| hypothetical protein [Pseudomonas alcaligenes]
 dbj|GAD61098.1| hypothetical protein PA6_004_00510 [Pseudomonas alcaligenes NBRC 
14159]
Length=352

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/317 (37%), Positives = 185/317 (58%), Gaps = 17/317 (5%)
 Frame = +3

Query  168   SPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNE  332
              P  AP   G L     L  +E +  G++ GPED   D + G +Y G  DG V R+    
Sbjct  32    QPQPAPLMTGVLEPNDSLMKAELLAQGQIHGPEDTAVDAQ-GRVYAGLHDGRVVRI----  86

Query  333   SSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFK  512
                AD  VE + NTGGRPLG+     G +++ADA  GLL +   GK++V+ + ADGV F 
Sbjct  87    ---ADGKVETFANTGGRPLGMDFDAQGNLVLADAYKGLLRIDPAGKIEVLASAADGVPFA  143

Query  513   LTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFA  692
              TD +D+A DG +YFTDAS K+   D++ + LEG+P+GRL+ +DP + +T+VL+ DL+FA
Sbjct  144   FTDDLDIASDGRIYFTDASSKFQQPDYLLDLLEGRPYGRLMVFDPASGKTEVLLKDLYFA  203

Query  693   NGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIG  872
             NGVA+  ++ FV+  ET   R ++Y+++G+K G+ ++F +NLPGMPDN++ D  G FW+ 
Sbjct  204   NGVALSQNEDFVLVNETYRYRIQRYWLKGDKAGTHDLFADNLPGMPDNLQGDRAGTFWVA  263

Query  873   IGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFT-  1049
             +        + +Q  P L+  L  + +  + P     G    ++ +G  V   ++   T 
Sbjct  264   LPTPRKGDADFLQNQPWLKAQLAKLPR-ALWPKPASYGLAIALNEQGEIVQSLHDTSGTH  322

Query  1050  --LVSTGIKIGNYMYCG  1094
               +V++   +G+Y+Y G
Sbjct  323   LRMVTSVKPVGDYLYLG  339



>ref|WP_004578969.1| strictosidine synthase family protein [Marinobacter nanhaiticus]
 gb|ENO14672.1| strictosidine synthase family protein [Marinobacter nanhaiticus 
D15-8W]
Length=376

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/327 (38%), Positives = 186/327 (57%), Gaps = 14/327 (4%)
 Frame = +3

Query  66    WPFAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGR--LLHDSEKIGVGRL  239
             W +AV V + L +  +    F P+P  +       P        R  LL  +E + VG +
Sbjct  3     WVYAVCVVIFLAIGGFL---FTPSPVDSRAWNPPEPPPLEGELARNELLQQAELLAVGDV  59

Query  240   SGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEV  419
              GPED+  DP  G +Y G  DG + RV        D  VE W  TGGRPLG+A   +G +
Sbjct  60    YGPEDVDVDP-AGRVYGGTQDGKIVRVW------PDGRVETWAETGGRPLGMAFDRNGNL  112

Query  420   IVADAEIGLLNV-TSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFI  596
             IVADA  GLL++    G ++ ++ EA+G+ F+ TD VD+   GM+YFTDAS ++   +++
Sbjct  113   IVADAYKGLLSIDPPSGTIRTLSKEAEGLPFRFTDDVDIGPRGMIYFTDASSRFNQSEYM  172

Query  597   WEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIR  776
              + LE +PHGRLL Y+P T++T+VL+ DL FANGVAV  D  FV+  ET   R  +Y++ 
Sbjct  173   LDLLEMRPHGRLLQYNPATRKTEVLLRDLHFANGVAVSRDGKFVLVNETWKYRTLRYWLG  232

Query  777   GEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKY  956
             G K GS+EVF++NLPG PD I  D EG FW+ +        + I  YP +++ +  +   
Sbjct  233   GPKAGSVEVFVDNLPGFPDGIAADSEGRFWLALATTRNAFMDRIHPYPWVKEQIAKLPD-  291

Query  957   GVRPNMEKNGGIFVVDMEGNPVAHYYE  1037
              ++P  E+ G +  +D +G  +A  ++
Sbjct  292   SLKPPPEEYGLVLALDRDGKIIASLHD  318



>ref|WP_020988177.1| strictosidine synthase [Leptospira inadai]
 gb|EQA38316.1| strictosidine synthase [Leptospira inadai serovar Lyme str. 10]
Length=360

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/342 (36%), Positives = 198/342 (58%), Gaps = 20/342 (6%)
 Frame = +3

Query  123   SFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMD  302
             ++DP P P          +      +LL  +E I +G++ GPEDI  D   G +Y+   D
Sbjct  32    AYDPPPAPG--------MIGLFAENQLLKSAELIALGKIHGPEDIEAD-ADGNVYSASED  82

Query  303   GWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVM  482
             G V  ++       D  ++   +TGGRPLG+     G + VADA  GLL +  +G+V+V+
Sbjct  83    GKVYFIS------KDGEMKAHASTGGRPLGMKLISDGTLYVADAVKGLLRINPNGRVEVL  136

Query  483   TAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQT  662
             + EA+G+ FK TD +DVA+DG +YF+DAS+KYG  +++++ +EG PHGRLL YDP TK+T
Sbjct  137   STEAEGIPFKFTDDLDVAKDGTVYFSDASYKYGAPEYLYDLMEGVPHGRLLKYDPKTKKT  196

Query  663   KVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIR  842
              VL+ D+FFANGVA+  ++ FV+  ET   R  +Y+++G K G+ E++IENLPG PDNI 
Sbjct  197   TVLLKDIFFANGVALSENEDFVVLNETYKYRIHRYWLKGPKAGTSEIWIENLPGFPDNIS  256

Query  843   YDGEGLFWIGI-GIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNP  1019
              DG+G F++ +  +       L+   P  + ++  + K+ + P  +  G   +++ +G  
Sbjct  257   SDGKGTFYLALFTVRNPMMDNLLHPRPWAKVVVAKLPKF-LWPKPKPYGFAVLLNEDGRV  315

Query  1020  VAHYYE---RDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQ  1136
             +A + E        +++  + G+Y+Y G +    I    L Q
Sbjct  316   LASFQEPSGNHLKEITSVKRKGDYLYLGSLHNDRIGKFELPQ  357



>gb|ERS04722.1| gluconolactonase [Marinobacter sp. EN3]
Length=363

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/300 (40%), Positives = 171/300 (57%), Gaps = 16/300 (5%)
 Frame = +3

Query  132   PAPYPAHELTQGSP-----AVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGC  296
             P+P  +      SP      +AP    RL   ++ +  G + GPED    P  GV+YTG 
Sbjct  23    PSPIDSKAWEAPSPPAMTGVLAPNERLRL---ADLLARGEVYGPEDTTIGPD-GVLYTGT  78

Query  297   MDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQ  476
              DGW+ RV        D  VE W+ TGGRPLGL    +G +IVADA  GLL++T  G + 
Sbjct  79    QDGWIVRV------HPDGTVEHWLETGGRPLGLVFDSNGNLIVADAWKGLLSITPQGDIT  132

Query  477   VMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTK  656
             V+T EA+G  F+ TD V +A DG +YFTDAS ++   D++ + LE +PHGRLL Y+P T+
Sbjct  133   VLTREAEGTPFRFTDDVVIAPDGRIYFTDASSRFQQPDYVLDLLEMRPHGRLLRYNPKTR  192

Query  657   QTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDN  836
             +T+VL+ +L FANGVAV P   +V+  ET   R  +Y+I G K G  EVF +NLPG PDN
Sbjct  193   KTEVLLGNLHFANGVAVSPQGDYVLVNETWKYRILRYWIGGPKAGRAEVFADNLPGFPDN  252

Query  837   IRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGN  1016
             +  DGEG +W+          + + + P L+ ++  +    ++P  +  G +   D +G 
Sbjct  253   LAVDGEGRYWVAFPTLRNPRVDAMHKSPWLKDLVAKLPD-SLKPKPQNYGLVVAFDSKGQ  311



>ref|WP_031211619.1| gluconolactonase [Marinobacter sp. EN3]
Length=362

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 119/300 (40%), Positives = 171/300 (57%), Gaps = 16/300 (5%)
 Frame = +3

Query  132   PAPYPAHELTQGSP-----AVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGC  296
             P+P  +      SP      +AP    RL   ++ +  G + GPED    P  GV+YTG 
Sbjct  22    PSPIDSKAWEAPSPPAMTGVLAPNERLRL---ADLLARGEVYGPEDTTIGPD-GVLYTGT  77

Query  297   MDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQ  476
              DGW+ RV        D  VE W+ TGGRPLGL    +G +IVADA  GLL++T  G + 
Sbjct  78    QDGWIVRV------HPDGTVEHWLETGGRPLGLVFDSNGNLIVADAWKGLLSITPQGDIT  131

Query  477   VMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTK  656
             V+T EA+G  F+ TD V +A DG +YFTDAS ++   D++ + LE +PHGRLL Y+P T+
Sbjct  132   VLTREAEGTPFRFTDDVVIAPDGRIYFTDASSRFQQPDYVLDLLEMRPHGRLLRYNPKTR  191

Query  657   QTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDN  836
             +T+VL+ +L FANGVAV P   +V+  ET   R  +Y+I G K G  EVF +NLPG PDN
Sbjct  192   KTEVLLGNLHFANGVAVSPQGDYVLVNETWKYRILRYWIGGPKAGRAEVFADNLPGFPDN  251

Query  837   IRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGN  1016
             +  DGEG +W+          + + + P L+ ++  +    ++P  +  G +   D +G 
Sbjct  252   LAVDGEGRYWVAFPTLRNPRVDAMHKSPWLKDLVAKLPD-SLKPKPQNYGLVVAFDSKGQ  310



>gb|ADE76402.1| unknown [Picea sitchensis]
Length=363

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/319 (38%), Positives = 182/319 (57%), Gaps = 17/319 (5%)
 Frame = +3

Query  186   KRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADS  350
             KR G L     L   EK+G G L  PED   D + G+IYT   DGWVKR+ +N S     
Sbjct  43    KREGHLAKNNALQAVEKLGEGFLDRPEDTAVDSR-GLIYTATQDGWVKRMHLNGSW----  97

Query  351   AVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVD  530
               E+W   G   +GL     G+V+V    +GLL V SD ++ ++ +E DG+  +L +AV 
Sbjct  98    --ENWKMVGLASIGLTVSKSGDVLVCTPGLGLLKV-SDDQISLLASEIDGIPIRLANAVV  154

Query  531   VAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVF  710
              A DG +YF+DAS K+  + ++ E LE KP+GRLL YDP T++T VL++ L+FANGV + 
Sbjct  155   EASDGSVYFSDASTKFENDKWVLELLEAKPYGRLLKYDPITRKTTVLLDGLWFANGVTLS  214

Query  711   PDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGL-FWIGIGIEY  887
             P + +++ CET+  RC K++I+GEK GS E+FIENLPG PDNI    +G  +WI +    
Sbjct  215   PREDYIVICETLKFRCLKHWIKGEKLGSTEIFIENLPGGPDNIHIAADGRSYWIALVGIR  274

Query  888   THAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERD---FTLVS  1058
             +   E + RY +L+ +              K   +  V  EG P+    + +    + V+
Sbjct  275   SRTLEFVYRYGILKHVFATYPNLLEWIGFAKRAMVVKVGEEGEPIISLEDPNGKVMSFVT  334

Query  1059  TGIKIGNYMYCGFVKYGFI  1115
             + +++GNY+Y G V   F+
Sbjct  335   SAMEVGNYLYLGSVNANFL  353



>ref|WP_017518494.1| gluconolactonase [Pseudomonas nitroreducens]
Length=353

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 184/320 (58%), Gaps = 16/320 (5%)
 Frame = +3

Query  168   SPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNE  332
             +P  AP   G +     L  +E +  G++ GPED   D + G ++ G  DG + R+    
Sbjct  32    TPPKAPAMTGVMEPNDTLMKAELLAQGQIVGPEDTAVDSQ-GRVFAGLDDGRIVRI----  86

Query  333   SSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFK  512
                AD   E +V T GRPLGLA    G +IVADA  GLL V   G+++V++  ADGV F 
Sbjct  87    --GADGKAETFVETRGRPLGLAFDKSGNLIVADAWKGLLQVDPQGRMRVLSDSADGVPFA  144

Query  513   LTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFA  692
              TD +D+A DG +YF+DAS ++   D+I + LE +PHGRLL YDP T +T+ L+ DL+FA
Sbjct  145   FTDDLDIASDGRIYFSDASSRFHQPDYILDLLEARPHGRLLRYDPATGRTETLLKDLYFA  204

Query  693   NGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIG  872
             NGVA+  ++ FV+  ET   R  +Y+++GE+ G  EVFI+NLPG+PDN+  D  G FW+ 
Sbjct  205   NGVALSQNEDFVLVNETYRYRITRYWLKGERAGQHEVFIDNLPGLPDNLASDRSGTFWVA  264

Query  873   IGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RD  1043
             +        ++IQ+ P L++ L  + +  V P     G +  V+ +G  V   ++   + 
Sbjct  265   LPSPRKADADVIQQMPWLKRQLTKLPR-AVLPKPVAYGLVIQVNEKGEIVRSLHDTSGQH  323

Query  1044  FTLVSTGIKIGNYMYCGFVK  1103
               +V++   +   +Y G ++
Sbjct  324   LRMVTSAKPVNGVLYLGSLE  343



>ref|WP_009623600.1| putative enzyme [Pseudomonas sp. M1]
 gb|ETM68275.1| gluconolactonase [Pseudomonas sp. M1]
Length=353

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 118/329 (36%), Positives = 187/329 (57%), Gaps = 17/329 (5%)
 Frame = +3

Query  168   SPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNE  332
             +P  AP   G L     L  +E +G+G++ GPED   D + G +Y G  DG V R+    
Sbjct  33    NPPPAPPMTGVLEPNDTLMKAELLGLGQVKGPEDTAVDAQ-GRVYAGLDDGRVVRLD---  88

Query  333   SSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFK  512
                 +  V  +  TGGRPLG+     G +IVADA  GLL + + GK+ V++ EADGV F 
Sbjct  89    ----NGQVTTFAETGGRPLGMDFDAQGNLIVADAWKGLLKIDAQGKITVLSTEADGVPFA  144

Query  513   LTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFA  692
               D +D+A DG +YF+DAS ++   D+I ++LE +PHGRLL YDP T +T+ L+ DL+FA
Sbjct  145   FADDLDIASDGRIYFSDASSRFHQPDYILDYLETRPHGRLLRYDPATGKTETLLKDLYFA  204

Query  693   NGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIG  872
             NGV +  ++ FV+  ET   R  +Y+++G K G  ++FI+NLPG+PDN++ D +G FW+ 
Sbjct  205   NGVTLSANEDFVLVNETYRYRIARYWLKGPKAGQQDIFIDNLPGLPDNLQGDRKGTFWVA  264

Query  873   IGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RD  1043
             +        + I   P L++ L  + +  + P     G +  VD  G  V   ++   + 
Sbjct  265   LPTPRKADADFILAQPWLKRQLTKLPR-ALLPKPVPYGLVIAVDENGQIVRSLHDTSGQH  323

Query  1044  FTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
               ++++   +G+Y+Y G ++   I  L +
Sbjct  324   LRMITSAKPVGDYLYFGSLENDRIGRLKI  352



>ref|WP_039660610.1| gluconolactonase [Smithella sp. SC_K08D17]
 gb|KIE17389.1| gluconolactonase [Smithella sp. SC_K08D17]
Length=359

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/338 (36%), Positives = 193/338 (57%), Gaps = 27/338 (8%)
 Frame = +3

Query  111   YQLDS-FDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIY  287
             ++L+S  DP  Y A    + +  + P     LL  +E +  G+++GPE++  D + G IY
Sbjct  25    FKLESPIDPVAYDAPAKPEMTGVLEPND---LLQQAELLARGKVNGPEEVAVDAQ-GRIY  80

Query  288   TGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDG  467
              G   G + R+        D  +E +  TGGRPLG+     G +IVAD+  GLL+V ++G
Sbjct  81    FGTPAGTISRLL------PDGVIEKFTETGGRPLGMKFDQKGNLIVADSIKGLLSVDAEG  134

Query  468   KVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDP  647
              + ++   ADGV FK TDA+D+A++G +YFTDAS K+ L+D++++ LE +PHGR + YDP
Sbjct  135   MIMILATSADGVPFKCTDALDIAKNGTIYFTDASDKFSLKDYLFDMLEARPHGRFMRYDP  194

Query  648   HTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGM  827
              T    VL+ DL FANGVA+  ++ FV+  ET      +Y+I G K G  E+FIENLPG 
Sbjct  195   ATGTVTVLMRDLKFANGVALSRNEDFVLVNETYTYSIHRYWISGPKAGKSEIFIENLPGF  254

Query  828   PDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVM--------EKYGVRPNMEKN  983
             PDNI  +G+G FW+ +        +++ +YP+++ +L  +        ++YG    +++ 
Sbjct  255   PDNISSNGKGKFWLALFTVRNGMLDMLHQYPMIKSLLSKLPVSWWSKSKRYGFVVALDER  314

Query  984   GGIFVVDMEGNPVA-HYYERDFTLVSTGIKIGNYMYCG  1094
             G I   +   +P   H Y+     V++  +   Y+Y G
Sbjct  315   GNI--TETLQDPTGEHLYD-----VTSAQEYAGYLYLG  345



>gb|ADE76543.1| unknown [Picea sitchensis]
Length=363

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/335 (37%), Positives = 187/335 (56%), Gaps = 20/335 (6%)
 Frame = +3

Query  147   AHELTQGSPAV---APKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMD  302
             AH     +P +   + KR G L     L   EK+G G L  PED   D + G+IYT   D
Sbjct  27    AHSPISPTPLILQPSYKREGHLAKNNALQAVEKLGEGFLDRPEDTAVDSR-GLIYTATQD  85

Query  303   GWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVM  482
             GWVKR+ +N S       E+W   G   +GL     G+V+V    +GLL V SD ++ ++
Sbjct  86    GWVKRMHLNGSW------ENWKMVGLASIGLTVSKSGDVLVCTPSLGLLKV-SDDQISLL  138

Query  483   TAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQT  662
              +E DG+  +L +AV  A DG +YF+DAS K+  + ++ + LE KP+GRLL YDP T++T
Sbjct  139   ASEIDGIPIRLANAVVEASDGSVYFSDASTKFENDKWVLDLLEAKPYGRLLKYDPITRKT  198

Query  663   KVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIR  842
              VL++ L+FANGVA+ P + +++ CET   RC K++I+GEK GS E+ IENLPG PDNI 
Sbjct  199   TVLLDGLWFANGVALSPREDYIVICETWKFRCLKHWIKGEKLGSTEILIENLPGAPDNIH  258

Query  843   YDGEGL-FWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNP  1019
                +G  +WI +    +   E + RY +L+ +              K+  +  V  EG P
Sbjct  259   IAADGRSYWIALVGIRSRTLEFVYRYGILKHVFATYPNLLEWIGFAKSAMVVKVGEEGEP  318

Query  1020  VAHYYERD---FTLVSTGIKIGNYMYCGFVKYGFI  1115
             +    + +      V++ +++GNY+Y G V   F+
Sbjct  319   IISLEDPNGKVMPFVTSAMEVGNYLYLGSVNANFL  353



>ref|WP_021222721.1| gluconolactonase [Pseudomonas alcaligenes]
 gb|EQM65947.1| gluconolactonase [Pseudomonas alcaligenes OT 69]
Length=353

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/300 (37%), Positives = 177/300 (59%), Gaps = 11/300 (4%)
 Frame = +3

Query  204   LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGR  383
             L  +E +  G++ GPED   D + G +Y G  DG V R+T      AD  VE +  TGGR
Sbjct  49    LMKAELLAKGQIHGPEDTAVDAQ-GRVYAGLHDGRVVRIT------ADGKVETFATTGGR  101

Query  384   PLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTD  563
             PLG+     G +IV DA  GLL++   G+++V+  EA+G  F+ TD +D+A DG +YFTD
Sbjct  102   PLGMDFDAQGNLIVGDAYKGLLSIDPQGQIKVLATEAEGGPFRFTDDLDIASDGRIYFTD  161

Query  564   ASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCET  743
             AS K+   D++ + LEG+PHGRL+ YDP T + +VL+ DL+F NGVA+   + FV+  ET
Sbjct  162   ASAKFEQPDYLLDLLEGRPHGRLMRYDPATGKVEVLLKDLYFGNGVALSAKEDFVLVNET  221

Query  744   IMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPL  923
                R  +Y++ GEK G+ +VFI+NLPG+PDN++ D +G FW+ +        + +     
Sbjct  222   YRYRITRYWLSGEKAGTHDVFIDNLPGLPDNLQGDRKGTFWVALPSPRKADADFLHTQSW  281

Query  924   LRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFT---LVSTGIKIGNYMYCG  1094
             L+  +  + +  + P  EK G +  +D  G  +   ++   T   ++++   +G+Y+Y G
Sbjct  282   LKAQIAKLPR-ALWPKAEKYGLVIALDENGQIIRSLHDTSGTHLRMITSVKPVGDYLYFG  340



>ref|WP_010568638.1| gluconolactonase [Leptospira broomii]
 gb|EQA44194.1| strictosidine synthase [Leptospira broomii serovar Hurstbridge 
str. 5399]
Length=397

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/342 (35%), Positives = 199/342 (58%), Gaps = 20/342 (6%)
 Frame = +3

Query  123   SFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMD  302
             ++DP P P          +      +LL  +E I +G++ GPEDI  D + G +Y+   D
Sbjct  69    AYDPPPAPG--------MIGLFAENQLLKSAELIALGKIHGPEDIEAD-EDGNVYSASED  119

Query  303   GWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVM  482
             G V  ++       D  ++   +TGGRPLG+     G + VADA  GLL +  +G+++V+
Sbjct  120   GKVYFIS------KDGEMKAHASTGGRPLGMKLISDGTLYVADAVKGLLKINPNGRIEVL  173

Query  483   TAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQT  662
             + EA+G+ FK TD +DV +DG +YF+DAS+KYG  +++++ +EG PHGRLL YDP TK+T
Sbjct  174   STEAEGIPFKFTDDLDVTKDGTVYFSDASYKYGAPEYLYDLMEGVPHGRLLKYDPRTKKT  233

Query  663   KVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIR  842
              VL+ D+FFANGVA+  ++ FV+  ET   R  +Y+++G K G+ E++IENLPG PDNI 
Sbjct  234   TVLLKDIFFANGVALSKNEDFVVLNETYKYRIHRYWLKGPKAGTSEIWIENLPGFPDNIS  293

Query  843   YDGEGLFWIGI-GIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNP  1019
              DG+G F++ +  +       L+  +P  + ++  + K+ + P  +  G   +++ +G  
Sbjct  294   SDGKGTFYLALFTVRNPMMDNLLHPHPWAKVVVAKLPKF-LWPKPKPYGFAVLLNEDGRV  352

Query  1020  VAHYYE---RDFTLVSTGIKIGNYMYCGFVKYGFILSLNLTQ  1136
             +A + +        +++  + G+Y+Y G +    I    L Q
Sbjct  353   LASFQDPSGNHLKEITSVKRKGDYLYLGSLHNDRIGKFELPQ  394



>ref|WP_003454827.1| Strictosidine synthase precursor [Pseudomonas pseudoalcaligenes]
 gb|ELS27811.1| Strictosidine synthase precursor [Pseudomonas pseudoalcaligenes 
KF707]
Length=353

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/317 (37%), Positives = 180/317 (57%), Gaps = 21/317 (7%)
 Frame = +3

Query  204   LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGR  383
             L  +E I  G++ GPED   D + G +Y G  DG V R+       AD  V+ +  TGGR
Sbjct  49    LMKAELIAQGQVHGPEDTAVDAQ-GRVYAGLHDGRVVRI------GADGQVQTFAETGGR  101

Query  384   PLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTD  563
             PLG+     G +I+ADA  GLL +   G++ V+  EADGV F+ TD +D+A DG +YFTD
Sbjct  102   PLGMDFDAAGNLILADAYKGLLKIDPQGRISVLATEADGVPFRFTDDLDIARDGRIYFTD  161

Query  564   ASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCET  743
             AS ++   D++ + LE +PHGRLL YDP + +T+VL+ DL+FANGVA+   + FV+  ET
Sbjct  162   ASSRFEQPDYLLDLLEARPHGRLLRYDPASGKTEVLLKDLYFANGVALSAKEDFVLVNET  221

Query  744   IMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPL  923
                R  +Y++ GEK G+ EVFI+NLPG+PDN++ D +G FW+ +        +L+   P 
Sbjct  222   YRYRITRYWLSGEKAGTHEVFIDNLPGLPDNLQGDRQGSFWVALPSPRKADADLLHTLPW  281

Query  924   LRKILGVMEK--------YGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGN  1079
             ++  L  + +        YG+   + +NG I +  +      H       +V++   +G+
Sbjct  282   VKAQLAKLPRLFWPKPVPYGLAIQLNENGEI-IRSLHDTSGTH-----LRMVTSVKPVGD  335

Query  1080  YMYCGFVKYGFILSLNL  1130
              +Y G +    I  L L
Sbjct  336   SLYFGSLDNDRIGKLTL  352



>ref|WP_028628995.1| gluconolactonase [Pseudomonas resinovorans]
Length=353

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/333 (36%), Positives = 187/333 (56%), Gaps = 27/333 (8%)
 Frame = +3

Query  135   APYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCM  299
              P P   L   +P  AP   G L     L  +E +  G++ GPED   D + G +Y G  
Sbjct  22    TPSPIDPLAWDAPK-APDMTGVLEPNDTLMKAELVAQGQVHGPEDTAVDGQ-GRLYAGLH  79

Query  300   DGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQV  479
             DG + R+      A +  VE + +TGGRPLG+     G +IV DA  GLL +   GK+ V
Sbjct  80    DGRIVRI------AENGQVETFADTGGRPLGMDFDAAGNLIVGDAYKGLLRIDPQGKITV  133

Query  480   MTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQ  659
             + +EA+GV F+ TD +D+A+DG +YFTDAS K+   D++ + LE +PHGRL+ +DP T +
Sbjct  134   LASEAEGVPFRFTDDLDIAQDGRIYFTDASSKFQQPDYLLDLLEARPHGRLMRFDPATGK  193

Query  660   TKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNI  839
             T VL+ DL+FANGVA+  ++ FV+  ET   R  +Y++ GEK G+ +VFI+NLPG+PDN+
Sbjct  194   TDVLLKDLYFANGVALSANEDFVLVNETYRYRITRYWLSGEKAGTHDVFIDNLPGLPDNL  253

Query  840   RYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEK--------YGVRPNMEKNGGIF  995
             + D +G FW+ +        + +   P L+  +  + +        YG+   + +NG I 
Sbjct  254   QGDHQGTFWVALPSPRKADADFLHTQPWLKAQIAKLPRMFWPKPVPYGLVLQLNENGEI-  312

Query  996   VVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCG  1094
             V  +      H       +V++   +G+Y+Y G
Sbjct  313   VHSLHDTSGTH-----LRMVTSVKPVGDYLYLG  340



>emb|CDF85380.1| hypothetical protein PKB_4051 [Pseudomonas knackmussii B13]
Length=354

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/329 (36%), Positives = 184/329 (56%), Gaps = 16/329 (5%)
 Frame = +3

Query  168   SPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNE  332
             +P  APK  G L     L  +E +G G++ GPED   D K G +Y G  DG V R+  N 
Sbjct  33    TPPTAPKLTGVLEPNDTLMKAELLGQGQVHGPEDTAVD-KDGRVYAGLADGRVVRLDGN-  90

Query  333   SSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFK  512
                    V+ + +TGGRPLG+     G +IV DA  GLL +   G++ V++ +ADG  F 
Sbjct  91    -----GQVQTFADTGGRPLGMDFDAQGNLIVCDAWKGLLKIDPQGQITVLSTQADGQPFG  145

Query  513   LTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFA  692
              TD +D+A DG +YFTDAS ++   D++ + LE +PHGRLL YDP + +T+ L+ DL+FA
Sbjct  146   FTDDLDIASDGRIYFTDASSRFHQPDYVLDLLESRPHGRLLRYDPASGKTETLLKDLYFA  205

Query  693   NGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIG  872
             NGVA+   + FV+  ET   R  +Y++ G K G  EVF++NLPG+PDN++ D  G FW+ 
Sbjct  206   NGVALSAHEDFVLVNETYRYRITRYWLTGPKAGQNEVFVDNLPGLPDNLQGDRAGTFWVA  265

Query  873   IGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RD  1043
             +        + I  +P L+  L  + +  + P     G +  +D  G  +   ++   + 
Sbjct  266   LPSPRKADADFILPHPWLKAQLAKLPR-PLLPKPTPYGLVLALDESGKVLRSLHDTSGQH  324

Query  1044  FTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
               ++++   +G+Y+Y G ++   I  L +
Sbjct  325   LRMITSAKPVGDYLYFGSLENDRIGRLQI  353



>ref|WP_016491774.1| hypothetical protein [Pseudomonas resinovorans]
 ref|YP_008102179.1| hypothetical protein PCA10_18420 [Pseudomonas resinovorans NBRC 
106553]
 dbj|BAN47574.1| hypothetical protein PCA10_18420 [Pseudomonas resinovorans NBRC 
106553]
Length=353

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/349 (35%), Positives = 194/349 (56%), Gaps = 21/349 (6%)
 Frame = +3

Query  72    FAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGR  236
              +V   V++ + +Y        P P   L   +P  AP   G L     L  +E I  G+
Sbjct  5     LSVFALVLVALTVY----LAVTPSPIDPLAWQAPK-APAMTGVLEPNDTLMKAELIAQGQ  59

Query  237   LSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGE  416
             + GPED   D + G +Y G  DG + R+  N        VE +  TGGRPLG+     G 
Sbjct  60    VHGPEDTAVDAQ-GRLYAGLHDGRIVRIGEN------GQVETFAETGGRPLGMDFDAAGN  112

Query  417   VIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFI  596
             +IV DA  GLL +   GK+ V+ +EA+GV F+ TD +D+A+DG +YFTDAS ++   D++
Sbjct  113   LIVGDAYKGLLRIDPQGKITVLASEAEGVPFRFTDDLDIAQDGRIYFTDASSRFEQPDYL  172

Query  597   WEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIR  776
              + LE +PHGRL+ +DP T +T+VL+ DL+FANGVA+  ++ FV+  ET   R  +Y++ 
Sbjct  173   LDLLEARPHGRLMRFDPLTGKTEVLLKDLYFANGVALSANEDFVLVNETYRYRISRYWLS  232

Query  777   GEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKY  956
             GEK G+ +VFI+NLPG+PDN++ D +G FW+ +        + +   P L+  +  + + 
Sbjct  233   GEKAGTHDVFIDNLPGLPDNLQGDHQGNFWVALPTPRKADADFLHTQPWLKAQMAKLPRM  292

Query  957   GVRPNMEKNGGIFVVDMEGNPVAHYYERDFT---LVSTGIKIGNYMYCG  1094
                P     G +  ++ +G  V   ++   T   ++++   +G+Y+Y G
Sbjct  293   -FWPKAVPYGLVIQLNEQGEIVHSLHDTSGTHLRMITSAKPVGDYLYFG  340



>gb|ERS86402.1| gluconolactonase [Marinobacter sp. EVN1]
 gb|ERS87220.1| gluconolactonase [Marinobacter sp. C1S70]
Length=363

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/300 (39%), Positives = 170/300 (57%), Gaps = 16/300 (5%)
 Frame = +3

Query  132   PAPYPAHELTQGSP-----AVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGC  296
             P+P  +      SP      +AP    RL   ++ +  G + GPED    P  GV+Y+G 
Sbjct  23    PSPIDSKAWQAPSPPAMTGVLAPNERLRL---ADLLARGEVYGPEDTTIGPD-GVLYSGT  78

Query  297   MDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQ  476
              DGW+ RV        D  VE W+ TGGRPLGL    +G +IVADA  GLL++T  G + 
Sbjct  79    QDGWIVRV------HPDGTVEHWLETGGRPLGLVFDSNGNLIVADAWKGLLSITPQGDIT  132

Query  477   VMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTK  656
             V+T EA+G  F+ TD V +A DG +YFTDAS ++   D++ + LE +PHGRLL Y+P T+
Sbjct  133   VLTREAEGTPFRFTDDVVIAPDGRIYFTDASSRFQQPDYVLDLLEMRPHGRLLRYNPKTR  192

Query  657   QTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDN  836
             +T+VL+ +L FANGVAV P   +V+  ET   R  +Y+I G K G  EVF +NLPG PDN
Sbjct  193   KTEVLLGNLHFANGVAVSPQGDYVLVNETWKYRILRYWISGPKAGRAEVFADNLPGFPDN  252

Query  837   IRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGN  1016
             +  DG G +W+          + + + P L+ ++  +    ++P  +  G +   D +G 
Sbjct  253   LAVDGGGRYWVAFPTLRNPRVDAMHKSPWLKDLVAKLPD-SLKPKPQNYGLVVAFDSKGQ  311



>ref|WP_016548796.1| strictosidine synthase [Leptospira fainei]
 gb|EPG75086.1| strictosidine synthase [Leptospira fainei serovar Hurstbridge 
str. BUT 6]
Length=360

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/328 (36%), Positives = 193/328 (59%), Gaps = 20/328 (6%)
 Frame = +3

Query  123   SFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMD  302
             ++DP P P          +       LL+ +E I +G++ GPEDI  D   G +Y+   D
Sbjct  32    AYDPPPAPG--------MIGLFAENHLLNSAELIALGKIHGPEDIEAD-SEGNVYSASED  82

Query  303   GWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVM  482
             G V  ++       D  ++   +TGGRPLG+     G + VADA  GLL +  +G+V+V+
Sbjct  83    GKVYFIS------KDGEMKAHASTGGRPLGMKLISDGTLYVADAVKGLLKINPNGRVEVL  136

Query  483   TAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQT  662
             + EA+G+ FK TD +DVA+DG +YF+DAS+KYG  +++++ +EG PHGRLL YDP TK+T
Sbjct  137   STEAEGIPFKFTDDLDVAKDGTVYFSDASYKYGAPEYLYDLMEGVPHGRLLKYDPRTKKT  196

Query  663   KVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIR  842
              VL+ ++FFANGVA+  ++ FV+  ET   R  +Y+++G K G+ E++IENLPG PDNI 
Sbjct  197   TVLLKEIFFANGVALSKNEDFVVLNETYKYRIHRYWLKGPKAGTSEIWIENLPGFPDNIS  256

Query  843   YDGEGLFWIGI-GIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNP  1019
              DG+G F++ +  +       L+   P  + ++  + K+ + P  +  G   +++ +   
Sbjct  257   SDGKGTFYLALFTVRNPMMDNLLHPRPWAKVVVAKLPKF-LWPKPKPYGFAVLLNEDARV  315

Query  1020  VAHYYE---RDFTLVSTGIKIGNYMYCG  1094
             +A + E        +++  + G+Y+Y G
Sbjct  316   LASFQEPSGNHLKEITSVKRKGDYLYLG  343



>ref|WP_011784053.1| gluconolactonase [Marinobacter hydrocarbonoclasticus]
 ref|YP_957796.1| strictosidine synthase [Marinobacter hydrocarbonoclasticus VT8]
 gb|ABM17609.1| gluconolactonase [Marinobacter hydrocarbonoclasticus VT8]
Length=363

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/299 (39%), Positives = 170/299 (57%), Gaps = 16/299 (5%)
 Frame = +3

Query  132   PAPYPAHELTQGSP-----AVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGC  296
             P+P  +      SP      +AP    RL   ++ +  G + GPED    P  GV+Y+G 
Sbjct  23    PSPIDSKAWQAPSPPAMTGVLAPNERLRL---ADLLARGEVYGPEDTTIGPD-GVLYSGT  78

Query  297   MDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQ  476
              DGW+ RV        D  VE W+ TGGRPLGL    +G +IVADA  GLL++T  G + 
Sbjct  79    QDGWIVRV------HPDGTVEHWLETGGRPLGLVFDSNGNLIVADAWKGLLSITPQGDIT  132

Query  477   VMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTK  656
             V+T EA+G  F+ TD V +A DG +YFTDAS ++   D++ + LE +PHGRLL Y+P T+
Sbjct  133   VLTREAEGTPFRFTDDVVIAPDGRIYFTDASSRFQQPDYVLDLLEMRPHGRLLRYNPKTR  192

Query  657   QTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDN  836
             +T+VL+ +L FANGVAV P   +V+  ET   R  +Y+I G K G  EVF +NLPG PDN
Sbjct  193   KTEVLLGNLHFANGVAVSPQGDYVLVNETWKYRILRYWISGPKAGRAEVFADNLPGFPDN  252

Query  837   IRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEG  1013
             +  DG G +W+          + + + P L+ ++  +    ++P  +  G +   D +G
Sbjct  253   LAVDGGGRYWVAFPTLRNPRVDAMHKSPWLKDLVAKLPD-SLKPKPQNYGLVVAFDRKG  310



>gb|ERP99132.1| gluconolactonase [Marinobacter sp. ES-1]
Length=362

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 161/270 (60%), Gaps = 8/270 (3%)
 Frame = +3

Query  204   LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGR  383
             L  +E +  G++ GPED   D   GV+YTG  DG + RV        D  VE W+ T GR
Sbjct  49    LRQAELLARGQVYGPEDTTVD-ANGVLYTGTQDGKIVRV------FPDGRVETWLQTEGR  101

Query  384   PLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTD  563
             PLG+     G +IVADA  GLL++  DG++ V+T EA+G  F+ TD V VA DG +YFTD
Sbjct  102   PLGMVFDRQGNLIVADAWKGLLSIAPDGEITVLTREAEGTPFRFTDDVVVATDGRIYFTD  161

Query  564   ASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCET  743
             AS ++   D+I + LE +PHGRLL Y+P T++T+VL+ +L+FANGVAV PD  +++  ET
Sbjct  162   ASSRFRQPDYILDLLEMRPHGRLLRYNPKTRRTEVLLRNLYFANGVAVSPDGDYLLVNET  221

Query  744   IMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPL  923
                R  KY+I G K G  EVF +NLPG PDN+  D +G +W+          + + R P 
Sbjct  222   WKYRILKYWINGPKAGRTEVFADNLPGFPDNLAVDEQGRYWVAFPTLRNPQVDAMHRRPW  281

Query  924   LRKILGVMEKYGVRPNMEKNGGIFVVDMEG  1013
             ++ ++  +   G +P  E+ G +   +  G
Sbjct  282   MKNLVARLPA-GFQPEPEEYGLVVAFNDRG  310



>ref|WP_031209904.1| MULTISPECIES: gluconolactonase [Marinobacter]
Length=362

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/300 (39%), Positives = 170/300 (57%), Gaps = 16/300 (5%)
 Frame = +3

Query  132   PAPYPAHELTQGSP-----AVAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGC  296
             P+P  +      SP      +AP    RL   ++ +  G + GPED    P  GV+Y+G 
Sbjct  22    PSPIDSKAWQAPSPPAMTGVLAPNERLRL---ADLLARGEVYGPEDTTIGPD-GVLYSGT  77

Query  297   MDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQ  476
              DGW+ RV        D  VE W+ TGGRPLGL    +G +IVADA  GLL++T  G + 
Sbjct  78    QDGWIVRV------HPDGTVEHWLETGGRPLGLVFDSNGNLIVADAWKGLLSITPQGDIT  131

Query  477   VMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTK  656
             V+T EA+G  F+ TD V +A DG +YFTDAS ++   D++ + LE +PHGRLL Y+P T+
Sbjct  132   VLTREAEGTPFRFTDDVVIAPDGRIYFTDASSRFQQPDYVLDLLEMRPHGRLLRYNPKTR  191

Query  657   QTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDN  836
             +T+VL+ +L FANGVAV P   +V+  ET   R  +Y+I G K G  EVF +NLPG PDN
Sbjct  192   KTEVLLGNLHFANGVAVSPQGDYVLVNETWKYRILRYWISGPKAGRAEVFADNLPGFPDN  251

Query  837   IRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGN  1016
             +  DG G +W+          + + + P L+ ++  +    ++P  +  G +   D +G 
Sbjct  252   LAVDGGGRYWVAFPTLRNPRVDAMHKSPWLKDLVAKLPD-SLKPKPQNYGLVVAFDSKGQ  310



>ref|WP_036218657.1| gluconolactonase [Marinobacter sp. ES-1]
Length=361

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 161/270 (60%), Gaps = 8/270 (3%)
 Frame = +3

Query  204   LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGR  383
             L  +E +  G++ GPED   D   GV+YTG  DG + RV        D  VE W+ T GR
Sbjct  48    LRQAELLARGQVYGPEDTTVD-ANGVLYTGTQDGKIVRV------FPDGRVETWLQTEGR  100

Query  384   PLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTD  563
             PLG+     G +IVADA  GLL++  DG++ V+T EA+G  F+ TD V VA DG +YFTD
Sbjct  101   PLGMVFDRQGNLIVADAWKGLLSIAPDGEITVLTREAEGTPFRFTDDVVVATDGRIYFTD  160

Query  564   ASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCET  743
             AS ++   D+I + LE +PHGRLL Y+P T++T+VL+ +L+FANGVAV PD  +++  ET
Sbjct  161   ASSRFRQPDYILDLLEMRPHGRLLRYNPKTRRTEVLLRNLYFANGVAVSPDGDYLLVNET  220

Query  744   IMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPL  923
                R  KY+I G K G  EVF +NLPG PDN+  D +G +W+          + + R P 
Sbjct  221   WKYRILKYWINGPKAGRTEVFADNLPGFPDNLAVDEQGRYWVAFPTLRNPQVDAMHRRPW  280

Query  924   LRKILGVMEKYGVRPNMEKNGGIFVVDMEG  1013
             ++ ++  +   G +P  E+ G +   +  G
Sbjct  281   MKNLVARLPA-GFQPEPEEYGLVVAFNDRG  309



>ref|WP_024766451.1| gluconolactonase [Pseudomonas nitroreducens]
Length=353

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/320 (37%), Positives = 182/320 (57%), Gaps = 16/320 (5%)
 Frame = +3

Query  168   SPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNE  332
             +P  AP   G +     L  +E +  G++ GPED   D + G ++ G  DG + R+    
Sbjct  32    TPPKAPPMTGVMEPNDTLMKAELLAQGQIVGPEDTAVDSQ-GQVFAGLDDGRIVRI----  86

Query  333   SSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFK  512
                 D   + +V TGGRPLGLA    G +IVADA  GLL +   GK++V+T  ADGV F 
Sbjct  87    --GDDGKAQTFVETGGRPLGLAFDQAGNLIVADAWKGLLQIDPQGKIRVLTDSADGVPFA  144

Query  513   LTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFA  692
              TD +D+A DG +YF+DAS ++   D+I + LE +PHGRLL YDP T +T+ L+ DL+FA
Sbjct  145   FTDDLDIASDGRIYFSDASSRFHQPDYILDLLEARPHGRLLRYDPATGKTETLLKDLYFA  204

Query  693   NGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIG  872
             NGVA+   + FV+  ET   R  +Y+++GEK G  +V I+NLPG+PDN+  D  G FW+ 
Sbjct  205   NGVALSQHEDFVLVNETYRYRITRYWLKGEKAGQHDVLIDNLPGLPDNLASDRSGTFWVA  264

Query  873   IGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RD  1043
             +        ++IQ+ P L++ L  + +  V P     G +  V+ +G  +   ++   + 
Sbjct  265   LPSPRKADADVIQQMPWLKRQLTKLPR-AVLPKPVPYGLVIQVNEKGEILRSLHDTSGQH  323

Query  1044  FTLVSTGIKIGNYMYCGFVK  1103
               +V++   +   +Y G ++
Sbjct  324   LRMVTSAKPVNGVLYLGSLE  343



>ref|XP_008802475.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Phoenix dactylifera]
Length=354

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 126/336 (38%), Positives = 189/336 (56%), Gaps = 32/336 (10%)
 Frame = +3

Query  171   PAVAPKRN---GRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSA  341
             P++ P        LL   +++G GRL GPE +  D + G +YT   DGW+KR+  N S  
Sbjct  34    PSLRPSSRITPNNLLKTVDRLGEGRLEGPEAVCVDGE-GTLYTATRDGWIKRMQPNGS--  90

Query  342   ADSAVEDWVNTGGRPL-GLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLT  518
                  EDW   GG  L G+A  + G+++V DA+ GLL V  DG V  + +E DG      
Sbjct  91    ----WEDWKQPGGSALLGIAVSMTGDILVCDADKGLLRVGEDG-VATLASEVDGSPIIFA  145

Query  519   DAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANG  698
             D V  A DG +YF+DAS K+G  D+  + LE +PHGRLL YDP TK+T V++ +L FANG
Sbjct  146   DDVVEASDGSVYFSDASTKFGFHDWFLDLLEARPHGRLLRYDPFTKKTYVVLANLTFANG  205

Query  699   VAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGI-  875
             V +  DQ F++ CET   RC K++++GE++G  EVFI+NLPG PDNI    +G FWI + 
Sbjct  206   VTLSQDQDFLVVCETWRFRCLKHWLKGEQEGKTEVFIDNLPGGPDNINLAPDGSFWIALL  265

Query  876   -----GIEYTHAFELIQR----YPLLRKILGVMEKYGVRPNMEKNGGI--FVVDMEGNPV  1022
                   I++ H   + +R    +P L +I+  M+   +  N+  NG I   + D +G  +
Sbjct  266   QLRSRWIDWIHCSCMTKRVLATFPKLVEIINPMKSGAMVVNVASNGKITRMLDDSDGTVM  325

Query  1023  AHYYERDFTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
                     + V++ ++   ++Y G ++  FI  L+L
Sbjct  326   --------SFVTSAMEFDGHLYLGSLQTNFIGKLSL  353



>ref|XP_010939896.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Elaeis guineensis]
Length=353

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/315 (38%), Positives = 179/315 (57%), Gaps = 13/315 (4%)
 Frame = +3

Query  201   LLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGG  380
             LL   +K+G GRL GPE +  D + G +YT   DGW+KR+  N S       EDW   GG
Sbjct  46    LLKTVDKLGEGRLEGPEAVCVDGE-GTLYTATRDGWIKRMQPNGS------WEDWKLLGG  98

Query  381   RPL-GLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYF  557
               L G+   + G+++V DA+ GLL V  DG V  + +E DG   +  D V  A DG +YF
Sbjct  99    SALLGMTVSMTGDLLVCDADKGLLKVGEDG-VITLASEVDGTPIRFADDVVEASDGSVYF  157

Query  558   TDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFC  737
             +DAS K+GL+D+I + LE +PHGRLL YDP   +T V++++L F NGV +  DQ FV+ C
Sbjct  158   SDASTKFGLQDWILDLLEARPHGRLLRYDPAANKTSVVLSNLGFPNGVTLSQDQDFVVVC  217

Query  738   ETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRY  917
             ET   RC K++++GE++G  EVFI+NLPG PDNI    +G FWI +    +   +LI R 
Sbjct  218   ETWKFRCLKHWLKGEQEGKTEVFIDNLPGGPDNINLAPDGSFWIALLQLRSKWLDLIHRS  277

Query  918   PLLRKILGVMEKY-GVRPNMEKNGGIFVVDMEGNPVAHYYERDFTL---VSTGIKIGNYM  1085
              + +++L  + K  G+   +     +  V   G       + D T+   V++ ++   ++
Sbjct  278   SMAKRVLATLPKLVGIMQRIRSGAMVVNVASNGKITRVLDDSDGTVMFFVTSAMEFEGHL  337

Query  1086  YCGFVKYGFILSLNL  1130
             Y G +   FI  L L
Sbjct  338   YLGSLHTNFIGKLPL  352



>gb|KES22899.1| gluconolactonase [Pseudomonas sp. AAC]
Length=352

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/329 (36%), Positives = 186/329 (57%), Gaps = 17/329 (5%)
 Frame = +3

Query  168   SPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNE  332
             +P  AP   G L     L  +E +G+ ++ GPED   D + G +Y G  DG V R+    
Sbjct  32    NPPPAPPMTGVLEPNDTLMKAELLGLDQVKGPEDTAVDAQ-GRVYAGLDDGRVVRLD---  87

Query  333   SSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFK  512
                 +  V  +  TGGRPLG+     G +IVADA  GLL + + GK+ V++ EADGV F 
Sbjct  88    ----NGQVTTFAETGGRPLGMDFDAQGNLIVADAWKGLLKIDAQGKITVLSTEADGVPFA  143

Query  513   LTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFA  692
               D +D+A DG +YF+DAS ++   D+I ++LE +PHGRLL YDP T +T+ L+ DL+FA
Sbjct  144   FADDLDIASDGRIYFSDASSRFHQPDYILDYLETRPHGRLLRYDPATGKTETLLKDLYFA  203

Query  693   NGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIG  872
             NGV +  ++ FV+  ET   R  +Y+++G K G  ++FI+NLPG+PDN++ D +G FW+ 
Sbjct  204   NGVTLSANEDFVLVNETYRYRIARYWLKGPKAGQQDIFIDNLPGLPDNLQGDRKGTFWVA  263

Query  873   IGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RD  1043
             +        + I   P L++ L  + +  + P     G +  VD  G  V   ++   + 
Sbjct  264   LPTPRKADADFILGQPWLKRQLTKLPR-ALLPKPVPYGLVIAVDENGQIVRSLHDTSGQH  322

Query  1044  FTLVSTGIKIGNYMYCGFVKYGFILSLNL  1130
               ++++   +G+Y+Y G ++   I  L +
Sbjct  323   LRMITSAKPVGDYLYFGSLENDRIGRLKI  351



>ref|XP_006452820.1| hypothetical protein CICLE_v10008683mg [Citrus clementina]
 gb|ESR66060.1| hypothetical protein CICLE_v10008683mg [Citrus clementina]
Length=373

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 127/366 (35%), Positives = 200/366 (55%), Gaps = 31/366 (8%)
 Frame = +3

Query  84    VPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSE------KIGVGRLSG  245
             VPV  G+V+  L +F    +    ++     + P  +  L+  +       ++G G L+G
Sbjct  19    VPVCSGIVLSCLLAFTLQIFFFSPISPDLLLLPPASSASLIPTTSDIQSVTRLGEGILNG  78

Query  246   PEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPL-GLAHGLHGEVI  422
             PED+  D + GV+YT   DGW+KR+  N         E+W   GG  L G+      E++
Sbjct  79    PEDVCVD-RNGVLYTATRDGWIKRLHKN------GTWENWKLIGGDTLLGITTTQENEIL  131

Query  423   VADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWE  602
             V DA+ GLL VT +G V V+ +  +G +  L D +  A DG +YF+ AS K+GL ++  +
Sbjct  132   VCDADKGLLKVTEEG-VTVLASHVNGSRINLADDLIAATDGSIYFSVASTKFGLHNWGLD  190

Query  603   FLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGE  782
              LE KPHG+LL YDP   +T +L++ LFFANGVA+  D+ +++ CETI  RC KY+++GE
Sbjct  191   LLEAKPHGKLLKYDPSLNETSILLDSLFFANGVALSKDEDYLVVCETIKFRCLKYWLKGE  250

Query  783   KKGSIEVFIENLPGMPDNIRYDGEGLFWIGI------GIEYTHAFE----LIQRYPLLRK  932
              K   E+F+ENLPG PDNI+   +G FWI I      G+E+ H  +    L+  +P L K
Sbjct  251   SKEQTEIFVENLPGGPDNIKLAPDGSFWIAILQLSSPGLEFVHTSKATKHLLAAFPKLIK  310

Query  933   ILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGF  1112
             ++  + K     N+  NG   V+    +P      +  + V++ ++  +++Y G +   F
Sbjct  311   LVAPLHKKAAVVNVAANG--IVIRKFEDPNG----KVMSFVTSALEFDDHLYLGSLNTNF  364

Query  1113  ILSLNL  1130
             I  L L
Sbjct  365   IGKLPL  370



>ref|WP_012139230.1| strictosidine synthase [Marinobacter lipolyticus]
 gb|EON91164.1| strictosidine synthase [Marinobacter lipolyticus SM19]
Length=362

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 127/360 (35%), Positives = 190/360 (53%), Gaps = 17/360 (5%)
 Frame = +3

Query  93    ILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDI  257
             +L +V   L  F  +P P       +PA  P   G+L     L  S+ +  G++ GPED 
Sbjct  7     LLLIVFVLLGGFLLSPSPVDSKAWKAPA-PPAMTGKLAPNELLRLSDLLARGQVYGPEDT  65

Query  258   VYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAE  437
               D   GV+YTG  DG + RV        D  VE+W+ TGGRPLGL     G +IVADA 
Sbjct  66    TVD-ANGVLYTGTQDGKIVRVW------PDGRVEEWLETGGRPLGLVFDDKGRLIVADAW  118

Query  438   IGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGK  617
              GLL++  D  V +++ E++G  F+ TD VD+A DG +YFTDAS ++   D++ + LE +
Sbjct  119   KGLLSIAPDKSVTLLSRESEGTPFRFTDDVDIAPDGRIYFTDASSRFEQPDYVLDLLEMR  178

Query  618   PHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSI  797
             PHGRLL YDP T +T+ L+ +L FANGVAV P+  +V+  ET   R  +Y+I G + G  
Sbjct  179   PHGRLLRYDPRTGKTETLLRNLHFANGVAVSPEGDYVLVNETWKYRILRYWIHGPRAGQA  238

Query  798   EVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNME  977
             EVF +NLPG PDN+  D  G +W+          + + R P L+ ++  + +    P  +
Sbjct  239   EVFADNLPGFPDNLAVDQAGRYWVAFPTLRNPQVDSMHRQPWLKDLVAKLPE-SFHPKPQ  297

Query  978   KNGGIFVVDMEGNPVAHYYERDFTLVSTGIKI---GNYMYCGFVKYGFILSLNLTQNPAV  1148
             + G +   D +G  +   ++   T +     +   G  +Y G +    I  L L   P +
Sbjct  298   EYGLVLAFDAKGKVITSLHDTRGTHLQEITSVNPHGGNLYFGSLHNDRIGRLPLRAIPGM  357



>ref|WP_010575787.1| gluconolactonase [Leptospira kmetyi]
 gb|EQA53347.1| strictosidine synthase [Leptospira kmetyi serovar Malaysia str. 
Bejo-Iso9]
Length=372

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/323 (36%), Positives = 189/323 (59%), Gaps = 14/323 (4%)
 Frame = +3

Query  78    VLVPVILGVVIY--QLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPE  251
             V + ++ G+V Y  +    DP  Y   E        AP      L ++E IG+G+L GPE
Sbjct  10    VFILILFGIVFYIVKPSPIDPLVYLPPEPPAMEGVYAPNT---FLSEAELIGLGKLQGPE  66

Query  252   DIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVAD  431
             D+  D   G ++  C +G V  ++   +  A +A      T GRPLG      G +IVAD
Sbjct  67    DMEVD-DLGNVFASCENGKVIHISPEGNVKAHAA------TTGRPLGSKLLPDGRLIVAD  119

Query  432   AEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLE  611
             A+ GLL + + G+V+V+T EA+G+ F+ TD +DVA+DG +YF+DAS KYG ++++++ +E
Sbjct  120   ADKGLLQIGTKGEVKVLTTEAEGIPFRFTDDLDVAKDGTVYFSDASDKYGSQEYLYDLME  179

Query  612   GKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKG  791
              +P GRLL YDP T +T VL+ +L+FANGVA+  ++ FV+  ET   R ++Y+++G K G
Sbjct  180   ARPRGRLLKYDPSTGKTTVLLKELYFANGVALSKNEDFVLVNETYRYRIRRYWLKGPKAG  239

Query  792   SIEVFIENLPGMPDNIRYDGEGLFWIGI-GIEYTHAFELIQRYPLLRKILGVMEKYGVRP  968
               + FI+NLPG PDNI  DG G F++ +  +  +    ++   P L+  +  + K+ + P
Sbjct  240   ENDFFIDNLPGFPDNISADGNGTFYLALFTVRNSLMDNVLHPRPALKSFIAKLPKF-LWP  298

Query  969   NMEKNGGIFVVDMEGNPVAHYYE  1037
               +  G + ++D  G P+  + E
Sbjct  299   KAQPYGFVLLLDENGTPLRSFQE  321



>ref|XP_006474715.1| PREDICTED: protein YLS2-like [Citrus sinensis]
Length=373

 Score =   213 bits (541),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 127/366 (35%), Positives = 198/366 (54%), Gaps = 31/366 (8%)
 Frame = +3

Query  84    VPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSE------KIGVGRLSG  245
             VPV  G+V+  L +F    +    ++     + P  +  L+  +       ++G G L+G
Sbjct  19    VPVCAGIVLSCLLAFTLQIFFFSPISPDLLLLPPASSASLIPTTSDIQSVTRLGEGILNG  78

Query  246   PEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPL-GLAHGLHGEVI  422
             PED+  D + GV+YT   DGW+KR+  N         E+W   GG  L G+      E+I
Sbjct  79    PEDVCVD-RNGVLYTATRDGWIKRLHKN------GTWENWKLIGGDTLLGITTTQENEII  131

Query  423   VADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWE  602
             V DA+ GLL VT +G V V+ +  +G +  L D +  A DG +YF+ AS K+GL ++  +
Sbjct  132   VCDADKGLLKVTEEG-VTVLASHVNGSRINLADDLIAATDGSIYFSVASTKFGLHNWGLD  190

Query  603   FLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGE  782
              LE KPHG+LL YDP   +T +L++ LFFANGVA+  D+ +++ CET   RC KY+++GE
Sbjct  191   LLEAKPHGKLLKYDPSLNETSILLDSLFFANGVALSKDEDYLVVCETFKFRCLKYWLKGE  250

Query  783   KKGSIEVFIENLPGMPDNIRYDGEGLFWIGI------GIEYTHAFE----LIQRYPLLRK  932
              K   E+F+ENLPG PDNI+   +G FWI I      G+E+ H  +    L+  +P L K
Sbjct  251   SKEQTEIFVENLPGGPDNIKLAPDGSFWIAILQLSSPGLEFVHTSKATKHLLAAFPKLMK  310

Query  933   ILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYMYCGFVKYGF  1112
             +   + K     N+  NG   V+    +P      +  + V++ ++  +++Y G +   F
Sbjct  311   LAAPLHKKAAVVNVAANG--IVIRKFEDPNG----KVMSFVTSALEFDDHLYLGSLNTNF  364

Query  1113  ILSLNL  1130
             I  L L
Sbjct  365   IGKLPL  370



>gb|ABR17054.1| unknown [Picea sitchensis]
Length=363

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 137/363 (38%), Positives = 197/363 (54%), Gaps = 36/363 (10%)
 Frame = +3

Query  75    AVLVPVILGVVIYQLDSFDP-APYP---AHELTQGSPAVAPKRNGRLLHDSEKIGVGRLS  242
             A+LV   L     QL +  P +P P    H  T+  P    K N  +L   EK+G G L 
Sbjct  11    AILVVGCLVAWFLQLIALSPISPNPLILKHSYTREGPYA--KNN--VLQAVEKLGEGMLD  66

Query  243   GPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVI  422
              PED   D + G+IYT   DGW+KR+  N S       EDW   GG PLGL     G+V+
Sbjct  67    RPEDTAVDSQ-GLIYTATRDGWIKRMHSNGSW------EDWKMVGGAPLGLTVSTSGDVL  119

Query  423   VADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWE  602
             V     GLL V  D ++ ++ +E DGV  +  + V  A DG +YF+D+S KYG   F  +
Sbjct  120   VCMPNQGLLKVNDD-RIFLLASEIDGVPIRFANTVVEASDGSVYFSDSSTKYG--KFFLD  176

Query  603   FLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGE  782
              LE KP+GRLL YDP TK+T VL++ L FANGVA+   + ++I CET   RC K++I+GE
Sbjct  177   LLEAKPYGRLLKYDPITKKTTVLLDGLGFANGVALSSKEDYIIICETWKFRCLKHWIKGE  236

Query  783   KKGSIEVFIENLPGMPDNIRYDGEGL-FWIG-IGIEYTHAFELIQRYPLLRKILGVMEKY  956
             K GS E+FIENLPG PDNI    +G  +WI  +G   +   E + RY +L+ I      +
Sbjct  237   KLGSTEIFIENLPGGPDNINIAADGRSYWIALVGRIRSRTLEFVYRYGILKHI------F  290

Query  957   GVRPNM-------EKNGGIFVVDMEGNPVAHYYERD---FTLVSTGIKIGNYMYCGFVKY  1106
                PN+       ++   +  V   G P+    + +    +LV++ +++G+Y+Y G +  
Sbjct  291   ATYPNLLEWIGFQKRQAMVVKVGEHGQPITSLDDSNGKVMSLVTSAMEVGDYLYLGSLHA  350

Query  1107  GFI  1115
              F+
Sbjct  351   NFL  353



>ref|XP_001773641.1| predicted protein [Physcomitrella patens]
 gb|EDQ61529.1| predicted protein [Physcomitrella patens]
Length=309

 Score =   210 bits (535),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 179/315 (57%), Gaps = 11/315 (3%)
 Frame = +3

Query  198   RLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTG  377
             R L   EK+G G + GPED+V   + G +     DGWVK+V        +  VE+W   G
Sbjct  2     RKLECVEKLGEGLVLGPEDVVV-ARDGSLVVATRDGWVKKVW-----PRNGTVENWKRVG  55

Query  378   GRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYF  557
             G P GLA G+HGE++VAD   GLLNVT D +V+ +T+ A+G      D+V V+  G +YF
Sbjct  56    GYPCGLALGVHGEILVADPLQGLLNVTDDDEVRCITSTAEGTPITFPDSVTVSGKGQIYF  115

Query  558   TDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFC  737
             TDAS K+ L  +  + LE +PHGR+L++DP T +T VL+  L FANG+A+ P + F++ C
Sbjct  116   TDASTKHLLHFWHLDVLESRPHGRVLNFDPTTGRTTVLMKGLAFANGIALSPTEDFLVVC  175

Query  738   ETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEG-LFWIGIGIEYTHAFELIQR  914
             E+   RC +Y++ GE KG++E FI+NLPG+PDNI        FW+G+    +   +L  +
Sbjct  176   ESWKYRCVRYWLEGEFKGTLETFIDNLPGLPDNIHLHAPSQTFWLGLVGGRSWLTDLTLK  235

Query  915   YPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RDFTLVSTGIKIGNYM  1085
               LL+        +    N E+ G +  +++ G  +  Y +     F+  +  +   NY+
Sbjct  236   SALLKHFFAKFWHHVTPFNFER-GELIAINLHGQVIVSYQDPRGARFSFATGAVIQDNYL  294

Query  1086  YCGFVKYGFILSLNL  1130
             Y G +   F+  LNL
Sbjct  295   YIGSLTEPFLGRLNL  309



>gb|ADE77910.1| unknown [Picea sitchensis]
Length=364

 Score =   212 bits (539),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 123/336 (37%), Positives = 190/336 (57%), Gaps = 21/336 (6%)
 Frame = +3

Query  147   AHELTQGSPAV---APKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMD  302
             AH     +P +   + KR G L     L   EK+G G L  PED   D + G+IYT   D
Sbjct  27    AHSPISPTPLILQPSYKREGHLAKNNALQAVEKLGEGFLDRPEDTAVDSR-GLIYTATQD  85

Query  303   GWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVM  482
             GWVKR+ +N S       E+W   G   +GL     G+V+V    +GLL V SD ++ ++
Sbjct  86    GWVKRMHLNGSW------ENWKMVGLASIGLTVSKSGDVLVCTPGLGLLKV-SDDQISLL  138

Query  483   TAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQT  662
              +E +G+  ++ DAV  A DG +YF+DAS K+ ++ ++ + LE KP+GRLL YDP T++T
Sbjct  139   ASEINGIPIRVADAVVEASDGSVYFSDASTKFEIDKWVLDLLEAKPYGRLLKYDPITRKT  198

Query  663   KVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIR  842
              VL++ L+FANGVA+ P + +++ CE+   RC K++I+GEK GS E+ IENLPG PDNI 
Sbjct  199   TVLLDGLWFANGVALSPREDYIVICESWKFRCLKHWIKGEKLGSTEILIENLPGAPDNIH  258

Query  843   YDGEGL-FWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFV-VDMEGN  1016
                +G  +WI +    +   E + RY +L+ +             EK+  + V V  EG 
Sbjct  259   IAADGRSYWIALVGIRSRTLEFVYRYGILKHVFATYPNLLEWIGFEKSRAMVVKVGEEGE  318

Query  1017  PVAHYYERD---FTLVSTGIKIGNYMYCGFVKYGFI  1115
             P+    + +    + V++  ++GNY+Y G +   F+
Sbjct  319   PIISLEDPNGKVMSFVTSANEVGNYLYLGSLNANFL  354



>gb|AAU83366.1| conserved hypothetical protein [uncultured archaeon GZfos27E7]
Length=352

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 175/289 (61%), Gaps = 15/289 (5%)
 Frame = +3

Query  168   SPAVAPKRNGRLLHDS-----EKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNE  332
             +P  AP + G    +S     E+ G G   GPED+  D + G IY G  DG + R   + 
Sbjct  24    TPPEAPAQTGVYEPNSRLAVVERFGTGAGVGPEDVAIDGQ-GRIYCGMEDGRIMRFQADG  82

Query  333   SSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFK  512
             S       E + +T GRPLGL     G ++V DA  GLL++T DG + V++ E  GV F+
Sbjct  83    SQH-----EVFADTEGRPLGLHFDAAGNLVVCDAYKGLLSITPDGSIIVLSTEQGGVPFR  137

Query  513   LTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFA  692
             LTD VD+A DG++YF+DAS+K+   + + + +E +P+GRLL+Y+P TK T++++N+L+FA
Sbjct  138   LTDDVDIAADGIIYFSDASFKFTEAEHMADLMEHRPNGRLLAYNPSTKTTRLVLNNLYFA  197

Query  693   NGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIG  872
             NGVAV PDQSFV+  ET   R ++Y++ G +KG  ++FI+NLPG PD I  +G+  FW+ 
Sbjct  198   NGVAVSPDQSFVLVVETGKYRVQRYWLTGPRKGESDIFIDNLPGFPDGISSNGKDTFWLA  257

Query  873   I--GIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEG  1013
             +  G E     + I   P +RKIL  + +    P  + +G +   DM+G
Sbjct  258   LIQGFESRKDMDSILPQPFIRKILMRLPESASAP--KDDGFVLGWDMDG  304



>ref|WP_010485149.1| gluconolactonase [Pseudomonas sp. S9]
Length=352

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/327 (35%), Positives = 185/327 (57%), Gaps = 18/327 (6%)
 Frame = +3

Query  138   PYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMD  302
             P P + +   +P  AP   G L     L  ++ I  G++ GPED   D + G +Y G  D
Sbjct  23    PSPINPVAWQAPK-APAMTGVLEPNDTLMKAQLIAKGKIHGPEDTAVDAQ-GRVYAGLAD  80

Query  303   GWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVM  482
             G + R+           V+ + NT GRPLG+     G +IVADA  GLL+V   G ++V+
Sbjct  81    GRIVRIE-------GKTVDTFANTQGRPLGMDFDAQGNLIVADAYKGLLSVDPKGSIKVL  133

Query  483   TAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQT  662
             T  A+G+ FK TD + +A DG +YF+DAS ++   D++ + LE +P GRLLSY P T +T
Sbjct  134   TTGAEGLPFKFTDDLAIARDGTIYFSDASSRFEQPDYLLDLLEARPWGRLLSYTPATGET  193

Query  663   KVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIR  842
             KVL+ DL+FANGVA+  ++ F++  ET   R  +Y+++GEK GS +VFI+NLPG+PDN+ 
Sbjct  194   KVLMKDLYFANGVALSANEDFLLVNETYRYRISRYWLKGEKAGSHDVFIDNLPGLPDNLE  253

Query  843   YDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPV  1022
              D  G FW+ +        + + ++P L+  +  + +    P   + G +  ++ +G   
Sbjct  254   SDHAGTFWVAMPSPRKADADFLPQHPWLKAQISKLPRM-FWPKATRYGLVIAINEQGEIT  312

Query  1023  AHYYERD---FTLVSTGIKIGNYMYCG  1094
                ++      +++++   +G+Y+Y G
Sbjct  313   RSLHDTSGSHLSMITSAKPVGDYLYLG  339



>gb|KDO73883.1| hypothetical protein CISIN_1g0173172mg, partial [Citrus sinensis]
Length=307

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 180/315 (57%), Gaps = 25/315 (8%)
 Frame = +3

Query  219   KIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPL-GL  395
             ++G G L+GPED+  D + GV+YT   DGW+KR+  N         E+W   GG  L G+
Sbjct  4     RLGEGILNGPEDVCVD-RNGVLYTATRDGWIKRLHKN------GTWENWKLIGGDTLLGI  56

Query  396   AHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWK  575
                   E++V DA+ GLL VT +G V V+ +  +G +  L D +  A DG +YF+ AS K
Sbjct  57    TTTQENEILVCDADKGLLKVTEEG-VTVLASHVNGSRINLADDLIAATDGSIYFSVASTK  115

Query  576   YGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRR  755
             +GL ++  + LE KPHG+LL YDP   +T +L++ LFFANGVA+  D+ +++ CET   R
Sbjct  116   FGLHNWGLDLLEAKPHGKLLKYDPSLNETSILLDSLFFANGVALSKDEDYLVVCETFKFR  175

Query  756   CKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGI------GIEYTHAFE----L  905
             C KY+++GE K   E+F+ENLPG PDNI+   +G FWI I      G+E+ H  +    L
Sbjct  176   CLKYWLKGESKEQTEIFVENLPGGPDNIKLAPDGSFWIAILQLSSPGLEFVHTSKATKHL  235

Query  906   IQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKIGNYM  1085
             +  +P L K++  + K     N+  NG   V+    +P      +  + V++ ++  +++
Sbjct  236   LAAFPKLIKLVAPLHKKAAVVNVAANG--IVIRKFEDPNG----KVMSFVTSALEFDDHL  289

Query  1086  YCGFVKYGFILSLNL  1130
             Y G +   FI  L L
Sbjct  290   YLGSLNTNFIGKLPL  304



>ref|XP_010090178.1| Adipocyte plasma membrane-associated protein [Morus notabilis]
 gb|EXB38975.1| Adipocyte plasma membrane-associated protein [Morus notabilis]
Length=370

 Score =   209 bits (531),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 130/365 (36%), Positives = 193/365 (53%), Gaps = 20/365 (5%)
 Frame = +3

Query  75    AVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVGRLSGPED  254
             A L  V+   + + L  F  +P  +    Q  P  +       L    K+G G L+GPED
Sbjct  9     AFLSFVLACFLAFALQVFFFSPISSPNSLQLPPPSSALPPNNQLQGVIKLGEGFLNGPED  68

Query  255   IVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDW-VNTGGRPLGLAHGLHG-EVIVA  428
             I  D + G IYT   D W++R+  N S       E+W +      LG+     G +++V 
Sbjct  69    IAVDYEEGTIYTATRDSWLRRLHKNGS------WENWKLLESHTLLGITKANEGGDLVVC  122

Query  429   DAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFL  608
             D E GLL V   G V V+T+  +G K    D V  A DG LYF+ AS K+GL D+  + L
Sbjct  123   DIEEGLLKVGETG-VSVLTSHVNGSKISFADDVIEASDGSLYFSVASTKFGLHDWYLDVL  181

Query  609   EGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKK  788
             E KPHG+LL YDP +KQT +L++DL FANGVA+  DQ +++FCET   RC+KY+++GEKK
Sbjct  182   EAKPHGQLLKYDPSSKQTSILLDDLAFANGVALSKDQDYLVFCETWKYRCRKYWLKGEKK  241

Query  789   GSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHA-------FELIQRYPLLRKILGVM  947
             G  E+FIENLPG PDNI    +G FWI +   + +A        E +    +++K +   
Sbjct  242   GQTEIFIENLPGGPDNINLAPDGSFWIALLQNHLYATQLTPKGLEFVHTSKVIKKFIATF  301

Query  948   EKYGVRPN-MEKNGGIFVVDMEGNPVAHYYE---RDFTLVSTGIKIGNYMYCGFVKYGFI  1115
              K     N +++   +  V  +G    H+ +   +    V+T ++  +++Y G +   FI
Sbjct  302   PKLVDLVNGVKRKATVVNVAADGTITRHFDDSKGKVMNFVTTAVEFEDHLYLGSLNSDFI  361

Query  1116  LSLNL  1130
               L L
Sbjct  362   GKLPL  366



>ref|WP_029654418.1| gluconolactonase [Marinobacter daepoensis]
Length=362

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/319 (37%), Positives = 177/319 (55%), Gaps = 14/319 (4%)
 Frame = +3

Query  96    LGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRL-----LHDSEKIGVGRLSGPEDIV  260
             L VV      F  AP P       +P+ AP   G L     L  +E + +G++ GPED  
Sbjct  8     LLVVFLLAGGFLLAPSPIDSKAWVAPS-APAMTGVLAPNHRLQQAELMALGQVYGPEDTT  66

Query  261   YDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEI  440
              D + GV+YTG  DGW+ RV        D  VE W+ T GRPLG+     G +IVADA  
Sbjct  67    VD-RQGVLYTGTQDGWIVRV------HPDGMVERWLQTEGRPLGMVVDQGGNLIVADAWK  119

Query  441   GLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKP  620
             GLL+++ +G V V+  EA G  F+ TD V +A DG +YFTDAS ++   D++ + LE +P
Sbjct  120   GLLSISPEGDVSVLAREAGGTPFRFTDDVVIAPDGRIYFTDASSRFHQPDYVLDLLEMRP  179

Query  621   HGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIE  800
             HGRLL ++P T++T+VL+ +L FANGVAV P+  +++  ET   R  +Y++ G K G  E
Sbjct  180   HGRLLRFNPKTRKTEVLLGNLHFANGVAVSPEGDYLLVNETWKYRILRYWLSGPKAGRTE  239

Query  801   VFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEK  980
             VF +NLPG PDN+  D  G +W+          + + + P L+ ++  +    ++P  + 
Sbjct  240   VFADNLPGFPDNLAVDDAGRYWVAFPTLRNPQVDSMHQTPWLKDLVAKLPD-SLKPQPQD  298

Query  981   NGGIFVVDMEGNPVAHYYE  1037
              G +   D +G  +   ++
Sbjct  299   YGLVVAFDRDGQMLTSLHD  317



>ref|WP_034062860.1| gluconolactonase, partial [Pseudomonas aeruginosa]
Length=261

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/250 (40%), Positives = 155/250 (62%), Gaps = 4/250 (2%)
 Frame = +3

Query  354   VEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDV  533
             VE +V+TGGRPLG+     G +I+ADA  GLL +   GKV+ +  EADGV F  TD +D+
Sbjct  1     VETFVDTGGRPLGMDFDAAGNLILADAWKGLLRIDPQGKVETLATEADGVPFAFTDDLDI  60

Query  534   AEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFP  713
             A DG +YF+DAS K+   D+I + LE +PHGRLL YDP T +T+VL+ DL+FANGVA+  
Sbjct  61    ASDGRIYFSDASSKFHQPDYILDLLEARPHGRLLRYDPSTGKTEVLLKDLYFANGVALSA  120

Query  714   DQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTH  893
             ++ FV+  ET   R  +Y+++GEK G  EVFI+NLPG+PDN++ D +G FW+ +      
Sbjct  121   NEDFVLVNETYRYRITRYWLKGEKAGQHEVFIDNLPGLPDNLQGDRKGTFWVALPTPRKA  180

Query  894   AFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RDFTLVSTG  1064
               + + R+P L+  L  + +  + P     G +  +D +G  V   ++       ++++ 
Sbjct  181   DADFLHRHPWLKAQLAKLPRMFL-PKPTAYGLVIAIDEQGRIVRSLHDTSGHHLRMITSA  239

Query  1065  IKIGNYMYCG  1094
               +G+ +Y G
Sbjct  240   KPVGDQLYFG  249



>gb|EMJ97366.1| strictosidine synthase [Leptospira sp. B5-022]
Length=362

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/306 (38%), Positives = 181/306 (59%), Gaps = 12/306 (4%)
 Frame = +3

Query  189   RNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWV  368
             +    L  +E I +G++ GPEDI  D + G IY+   DG V  ++       D  ++   
Sbjct  46    QENNTLESAELIALGKIHGPEDIEPD-EDGNIYSASEDGKVYLIS------KDGEMKAHA  98

Query  369   NTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGM  548
              TGGRPLG+     G +IVADA  GLL +  DGKV+V++ E++GV FK TD +DVA+DG 
Sbjct  99    FTGGRPLGMKLLGDGSIIVADAIKGLLKIGKDGKVEVLSTESEGVPFKFTDDLDVAKDGT  158

Query  549   LYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFV  728
             +YF+DAS KYG  +++++ +E  PHGRLL YDP TK+T  L+ DLFF NGVA+  ++ F+
Sbjct  159   IYFSDASDKYGSAEYLYDLMESVPHGRLLKYDPRTKKTTTLMKDLFFPNGVALSKNEDFL  218

Query  729   IFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGI-GIEYTHAFEL  905
             +  ET   R  +Y+I+G K G+ E++ ENLPG PDNI  D +G F++ +  +  +   ++
Sbjct  219   VLNETYKYRIHRYWIKGPKAGTSEIWAENLPGFPDNISSDRKGHFYLALFTVRNSMVDKI  278

Query  906   IQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RDFTLVSTGIKIG  1076
             +   P  + I+  + K+ + P  +  G   ++D  G   A + E   +    +++  + G
Sbjct  279   LHPRPWAKSIVAKLPKF-LWPKPQPYGFAVILDENGVVEASFQEPKGKHLKEITSVKRKG  337

Query  1077  NYMYCG  1094
              Y+Y G
Sbjct  338   EYIYLG  343



>ref|WP_036134224.1| gluconolactonase [Marinobacter sp. AK21]
 gb|KEF30252.1| Strictosidine synthase precursor [Marinobacter sp. AK21]
Length=360

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 195/368 (53%), Gaps = 14/368 (4%)
 Frame = +3

Query  54    MSGLWPFAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPAVAPKRNGRLLHDSEKIGVG  233
             M  L   A+++ V+ G  +      D   + A +    S  +AP     +L  ++ + +G
Sbjct  1     MKWLMAAALVLFVLGGGFLLSPSPIDSEAWQAPKPRSLSGPLAPNE---ILQQADLLALG  57

Query  234   RLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHG  413
              + GPED     + GVIY G  DG + RV        D  VE W++ G RPLG+    +G
Sbjct  58    EVYGPEDTTVS-QNGVIYAGTQDGKIIRVR------PDGQVESWLDLGTRPLGMVFDRNG  110

Query  414   EVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDF  593
              +IVADA  GL++V  D  V ++T EA+G  F+ TD VD+A DG +YF+DAS ++   D+
Sbjct  111   NLIVADAWKGLISVAPDRTVSILTREAEGTLFRFTDDVDIAPDGRIYFSDASSRFHQPDY  170

Query  594   IWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYI  773
               + LE +PHGRLL Y P   +T+V++ DL+FANGVAV PD  FV+  ET   R  ++++
Sbjct  171   RLDLLEMRPHGRLLRYSPGNGKTEVILRDLYFANGVAVSPDGEFVLVNETWKYRILRHWL  230

Query  774   RGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEK  953
             +G + G  E+F +NLPG PDN+  D EG FW+          + + + P L+ ++  + +
Sbjct  231   KGPRAGQTEIFADNLPGFPDNLAVDSEGRFWVAFPTLRNPQVDALHKRPWLKNLVAKLPE  290

Query  954   YGVRPNMEKNGGIFVVDMEGNPVAHYYERDFTLVSTGIKI---GNYMYCGFVKYGFILSL  1124
               ++P  ++ G     D +G  +   ++   T +     +   G+Y+Y G +    I  L
Sbjct  291   -SMQPVPQEYGLAVAFDRDGQVLTSLHDTSGTHLKEITSVNPNGSYLYFGSLHNDRIGRL  349

Query  1125  NLTQNPAV  1148
              L   P +
Sbjct  350   PLRAIPGL  357



>ref|WP_036090792.1| gluconolactonase [Leptospira sp. B5-022]
Length=406

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 125/363 (34%), Positives = 201/363 (55%), Gaps = 24/363 (7%)
 Frame = +3

Query  30    QDKILRTKMSGLWPFAVLVPVILGVVIYQLDSFDPAPYPAHELTQGSPA----VAPKRNG  197
             ++ I+ TK   L   A ++ +I+G  +         P P   +    P     +   +  
Sbjct  41    KEGIVNTKKILLLSAAFIIILIIGFAL--------KPSPIQPIAYQPPIDTGLIGAFQEN  92

Query  198   RLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTG  377
               L  +E I +G++ GPEDI  D + G IY+   DG V  ++       D  ++    TG
Sbjct  93    NTLESAELIALGKIHGPEDIEPD-EDGNIYSASEDGKVYLIS------KDGEMKAHAFTG  145

Query  378   GRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYF  557
             GRPLG+     G +IVADA  GLL +  DGKV+V++ E++GV FK TD +DVA+DG +YF
Sbjct  146   GRPLGMKLLGDGSIIVADAIKGLLKIGKDGKVEVLSTESEGVPFKFTDDLDVAKDGTIYF  205

Query  558   TDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFC  737
             +DAS KYG  +++++ +E  PHGRLL YDP TK+T  L+ DLFF NGVA+  ++ F++  
Sbjct  206   SDASDKYGSAEYLYDLMESVPHGRLLKYDPRTKKTTTLMKDLFFPNGVALSKNEDFLVLN  265

Query  738   ETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGI-GIEYTHAFELIQR  914
             ET   R  +Y+I+G K G+ E++ ENLPG PDNI  D +G F++ +  +  +   +++  
Sbjct  266   ETYKYRIHRYWIKGPKAGTSEIWAENLPGFPDNISSDRKGHFYLALFTVRNSMVDKILHP  325

Query  915   YPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RDFTLVSTGIKIGNYM  1085
              P  + I+  + K+ + P  +  G   ++D  G   A + E   +    +++  + G Y+
Sbjct  326   RPWAKSIVAKLPKF-LWPKPQPYGFAVILDENGVVEASFQEPKGKHLKEITSVKRKGEYI  384

Query  1086  YCG  1094
             Y G
Sbjct  385   YLG  387



>ref|WP_014575868.1| gluconolactonase [Marinobacter adhaerens]
 ref|YP_005883954.1| strictosidine synthase family protein [Marinobacter adhaerens 
HP15]
 gb|ADP96026.1| strictosidine synthase family protein [Marinobacter adhaerens 
HP15]
Length=361

 Score =   206 bits (523),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 122/348 (35%), Positives = 190/348 (55%), Gaps = 21/348 (6%)
 Frame = +3

Query  132   PAPYPAHELTQGSPA-----VAPKRNGRLLHDSEKIGVGRLSGPEDIVYDPKTGVIYTGC  296
             P+P  +      SP      VAP    RL   ++ I  G++ GPED     + GV+YTG 
Sbjct  22    PSPVDSKAWNPPSPPPLTGEVAPNERLRL---ADLIARGQVYGPEDTAVS-EDGVLYTGT  77

Query  297   MDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLAHGLHGEVIVADAEIGLLNVTSDGKVQ  476
              DG++ RV        D  VE+W++T GRPLG+     G +IVAD+  GLL+++ +G++ 
Sbjct  78    QDGFIVRVF------PDGRVENWLSTDGRPLGMVFDSQGNLIVADSWRGLLSISPEGEIT  131

Query  477   VMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKYGLEDFIWEFLEGKPHGRLLSYDPHTK  656
             V+  EA+G  F+ TD VD+A+DG +YFTDAS K+   +++ + LE +PHGRLL Y P T 
Sbjct  132   VLAREAEGTLFRFTDDVDIADDGRIYFTDASSKFHQPEYMLDLLEMRPHGRLLRYSPKTG  191

Query  657   QTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRCKKYYIRGEKKGSIEVFIENLPGMPDN  836
             + +VL+ +L FANGVAV P+  +V+  ET   R  +Y+I+G K G  EVF +NLPG PDN
Sbjct  192   KAEVLLANLHFANGVAVSPEGDYVLVNETWKYRILRYWIQGPKAGQAEVFADNLPGFPDN  251

Query  837   IRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKILGVMEKYGVRPNMEKNGGIFVVDMEGN  1016
             +  D +G +W+          + +   P L+ ++  +    ++P  ++ G +   D +G 
Sbjct  252   LAVDDQGRYWVAFPTLRDSRMDAMHPRPWLKDLVAKLPS-SLKPAPQEYGLVIAFDRDGE  310

Query  1017  PVAHYYERDFT----LVSTGIKIGNYMYCGFVKYGFILSLNLTQNPAV  1148
              +   ++   T    + S     GN +Y G +    I  L L   P +
Sbjct  311   VITSLHDTRGTHLQEITSVNPHDGN-LYFGSLHNDRIGRLPLQAIPGL  357



>ref|WP_014100473.1| gluconolactonase [Candidatus Chloracidobacterium thermophilum]
 ref|YP_004863252.1| gluconolactonase [Candidatus Chloracidobacterium thermophilum 
B]
 gb|AEP12736.1| Gluconolactonase [Candidatus Chloracidobacterium thermophilum 
B]
Length=359

 Score =   205 bits (522),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 171/295 (58%), Gaps = 10/295 (3%)
 Frame = +3

Query  219   KIGVGRLSGPEDIVYDPKTGVIYTGCMDGWVKRVTVNESSAADSAVEDWVNTGGRPLGLA  398
             ++G   + G ED+   P  G +Y G  DG + R+ V   +      E + +TGGRPLGL 
Sbjct  56    RLGAEVIVGSEDVAVGPD-GRLYAGAKDGTIYRLPVEGGTP-----ERFASTGGRPLGLK  109

Query  399   HGLHGEVIVADAEIGLLNVTSDGKVQVMTAEADGVKFKLTDAVDVAEDGMLYFTDASWKY  578
                 G +IVAD   GLL++  DG V V++ EA G  F+ TD +D+A DG +YFTDASWK+
Sbjct  110   FDQRGHLIVADCFRGLLDIAPDGTVSVLSTEAGGKPFRFTDDLDIAADGTIYFTDASWKF  169

Query  579   GLEDFIWEFLEGKPHGRLLSYDPHTKQTKVLVNDLFFANGVAVFPDQSFVIFCETIMRRC  758
             G  ++  +FLE +P+GRLL+Y+P TK T+V++++L+FANGVA+ PDQ F++  ET   R 
Sbjct  170   GQPEYRLDFLEHRPNGRLLAYEPATKTTRVVLDNLYFANGVAISPDQQFLVVAETARYRL  229

Query  759   KKYYIRGEKKGSIEVFIENLPGMPDNIRYDGEGLFWIGIGIEYTHAFELIQRYPLLRKIL  938
              +Y++ GE++G +E  IENLPG PD +     G+FW+ +        + +   P  RK++
Sbjct  230   LRYWLAGERRGQVEPLIENLPGFPDGVSTGQNGVFWVALFARRNPVLDRLLPQPFWRKMV  289

Query  939   GVMEKYGVRPNMEKNGGIFVVDMEGNPVAHYYE---RDFTLVSTGIKIGNYMYCG  1094
               + +   +P  +  G +  ++  G  + +  +     F  V+  ++ G  +Y G
Sbjct  290   VRLPRT-FQPKPDHYGFVLGINDRGEVIRNLQDPAPTAFAPVTNVVEYGGRLYLG  343



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3572047717316