BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19354_g2_i1 len=647 path=[595:0-408 108:409-444 25:445-527
108:528-563 25:564-646]

Length=647
                                                                      Score     E

ref|XP_008220852.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    209   7e-61   
ref|XP_007227292.1|  hypothetical protein PRUPE_ppa017132mg             208   8e-61   
ref|XP_009618855.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    207   1e-60   
ref|XP_007017618.1|  HXXXD-type acyl-transferase family protein         206   3e-60   
ref|XP_004293197.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    206   3e-60   
gb|KDP38549.1|  hypothetical protein JCGZ_04474                         206   3e-60   
emb|CDP07478.1|  unnamed protein product                                203   4e-59   
ref|XP_008347391.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    195   6e-59   
ref|XP_002307677.2|  transferase family protein                         203   7e-59   Populus trichocarpa [western balsam poplar]
ref|XP_008359762.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    202   1e-58   
emb|CBI19745.3|  unnamed protein product                                201   2e-58   
ref|XP_002300751.1|  transferase family protein                         201   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_011048810.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    201   3e-58   
ref|XP_011048809.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    201   3e-58   
ref|XP_002281098.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    201   4e-58   Vitis vinifera
ref|XP_009804186.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    200   7e-58   
gb|KHG27796.1|  Omega-hydroxypalmitate O-feruloyl transferase -li...    200   1e-57   
ref|XP_010110033.1|  Omega-hydroxypalmitate O-feruloyl transferase      199   2e-57   
ref|XP_004238294.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    199   3e-57   
ref|XP_011028892.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    199   3e-57   
ref|XP_002510432.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    198   4e-57   Ricinus communis
ref|XP_009335934.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    197   1e-56   
ref|XP_006341971.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    197   1e-56   
ref|XP_008377198.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    196   3e-56   
gb|KDO84650.1|  hypothetical protein CISIN_1g036687mg                   195   4e-56   
ref|XP_006435052.1|  hypothetical protein CICLE_v10003709mg             196   4e-56   
ref|XP_006473895.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    196   4e-56   
ref|XP_009413689.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    191   1e-54   
ref|XP_008784949.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    190   6e-54   
gb|KEH36187.1|  omega-hydroxypalmitate O-feruloyl transferase           189   2e-53   
gb|KHN22233.1|  Omega-hydroxypalmitate O-feruloyl transferase           187   5e-53   
ref|XP_006415746.1|  hypothetical protein EUTSA_v10007633mg             187   5e-53   
ref|XP_003527683.2|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    187   9e-53   
ref|XP_004500986.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    186   2e-52   
ref|XP_002890739.1|  transferase family protein                         185   2e-52   
emb|CDY11777.1|  BnaC03g58010D                                          185   3e-52   
ref|NP_174083.1|  HXXXD-type acyl-transferase-like protein              184   6e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010936667.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    184   1e-51   
ref|XP_009109793.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    184   1e-51   
emb|CDX90098.1|  BnaA08g18860D                                          184   1e-51   
ref|XP_011083891.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    184   1e-51   
gb|KCW67886.1|  hypothetical protein EUGRSUZ_F01597                     183   3e-51   
ref|XP_009380388.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    182   5e-51   
ref|XP_010060982.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    183   9e-51   
ref|XP_006847545.1|  hypothetical protein AMTR_s00014p00154350          181   2e-50   
ref|XP_010254732.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    180   3e-50   
emb|CDX84920.1|  BnaC05g21350D                                          172   5e-50   
ref|XP_010478102.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    177   3e-49   
ref|XP_007136640.1|  hypothetical protein PHAVU_009G061200g             177   3e-49   
ref|XP_010499244.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    177   4e-49   
ref|XP_010460517.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    176   6e-49   
ref|XP_010552486.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    176   1e-48   
gb|KHN20954.1|  Omega-hydroxypalmitate O-feruloyl transferase           174   8e-48   
ref|XP_010275579.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    173   1e-47   
emb|CDY27624.1|  BnaA09g27830D                                          172   2e-47   
ref|XP_006595924.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    172   2e-47   
ref|XP_009113746.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    172   2e-47   
ref|XP_006304467.1|  hypothetical protein CARUB_v10011142mg             172   4e-47   
tpg|DAA53857.1|  TPA: hypothetical protein ZEAMMB73_145326              161   7e-46   
ref|XP_010673005.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    168   1e-45   
ref|XP_004967933.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    166   7e-45   
tpg|DAA53855.1|  TPA: hypothetical protein ZEAMMB73_145326              159   7e-45   
ref|XP_008444746.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    166   1e-44   
ref|XP_004152770.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    166   1e-44   
gb|KGN62624.1|  hypothetical protein Csa_2G361880                       165   2e-44   
ref|XP_004167735.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    165   2e-44   
gb|EYU32898.1|  hypothetical protein MIMGU_mgv1a005949mg                161   4e-43   
ref|XP_008672227.1|  PREDICTED: uncharacterized protein LOC100194...    159   2e-42   
ref|XP_002455342.1|  hypothetical protein SORBIDRAFT_03g008850          158   1e-41   Sorghum bicolor [broomcorn]
gb|EMS53663.1|  Omega-hydroxypalmitate O-feruloyl transferase           151   5e-40   
gb|EMT27960.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase       145   5e-40   
emb|CDM81296.1|  unnamed protein product                                153   7e-40   
ref|XP_006645912.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    148   7e-40   
dbj|BAK06566.1|  predicted protein                                      150   8e-39   
gb|EMT21160.1|  Anthranilate N-benzoyltransferase protein 1             148   2e-38   
gb|EAZ11983.1|  hypothetical protein OsJ_01862                          143   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003565349.2|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    143   3e-36   
ref|XP_004154910.1|  PREDICTED: LOW QUALITY PROTEIN: omega-hydrox...    140   1e-35   
ref|XP_004147874.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    140   1e-35   
gb|KGN59993.1|  hypothetical protein Csa_3G860290                       139   6e-35   
ref|XP_004513913.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    134   5e-34   
ref|XP_004513917.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    134   9e-34   
gb|EEE53709.1|  hypothetical protein OsJ_00040                          134   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004513915.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    134   3e-33   
ref|XP_004513916.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    134   3e-33   
ref|XP_004513914.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    134   3e-33   
ref|NP_001041768.1|  Os01g0104900                                       133   6e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004513923.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    130   1e-32   
ref|XP_004510923.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    129   2e-31   
ref|NP_001043090.1|  Os01g0382200                                       128   5e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004513919.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    127   1e-30   
ref|XP_004513918.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    126   2e-30   
ref|XP_004513920.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    123   2e-29   
gb|EEE53710.1|  hypothetical protein OsJ_00041                          116   4e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004513921.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    123   4e-29   
gb|EAY72193.1|  hypothetical protein OsI_00045                          118   2e-27   Oryza sativa Indica Group [Indian rice]
gb|KFK36172.1|  hypothetical protein AALP_AA4G087600                    114   2e-25   
ref|XP_006338814.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    105   4e-23   
ref|XP_004240917.2|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    105   5e-23   
ref|XP_010105434.1|  Taxadien-5-alpha-ol O-acetyltransferase            105   5e-23   
ref|XP_010264576.1|  PREDICTED: LOW QUALITY PROTEIN: omega-hydrox...    103   1e-22   
ref|XP_009776129.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    103   2e-22   
gb|KDP44731.1|  hypothetical protein JCGZ_01231                       97.8    2e-20   
dbj|BAD68809.1|  putative hydroxyanthranilate hydroxycinnamoyltra...  97.1    4e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009607746.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  97.1    4e-20   
ref|XP_002315149.1|  transferase family protein                       97.1    5e-20   Populus trichocarpa [western balsam poplar]
emb|CDP13991.1|  unnamed protein product                              97.1    6e-20   
ref|XP_002272886.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  96.7    7e-20   Vitis vinifera
ref|XP_006353446.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  97.4    1e-19   
ref|XP_010499245.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  95.1    1e-19   
ref|XP_006854801.1|  hypothetical protein AMTR_s00063p00166280        95.9    2e-19   
ref|XP_011000729.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  94.7    3e-19   
ref|XP_004500505.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  93.6    7e-19   
ref|XP_002881703.1|  transferase family protein                       93.6    8e-19   
ref|XP_004307660.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  92.4    2e-18   
ref|XP_002312170.2|  hypothetical protein POPTR_0008s07130g           92.0    3e-18   Populus trichocarpa [western balsam poplar]
gb|KDO68916.1|  hypothetical protein CISIN_1g037938mg                 91.3    4e-18   
ref|XP_011035903.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  91.3    6e-18   
ref|XP_008343629.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  90.9    7e-18   
ref|XP_008374183.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  90.9    7e-18   
ref|NP_181552.1|  putative CoA-dependent acyltransferase              90.9    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009345174.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  90.1    2e-17   
gb|EYU20037.1|  hypothetical protein MIMGU_mgv1a006627mg              89.7    2e-17   
ref|XP_003600946.1|  Taxadien-5-alpha-ol O-acetyltransferase          89.4    3e-17   
ref|XP_007141748.1|  hypothetical protein PHAVU_008G222300g           89.0    3e-17   
ref|XP_007008914.1|  HXXXD-type acyl-transferase family protein       89.0    3e-17   
ref|XP_011076829.1|  PREDICTED: LOW QUALITY PROTEIN: taxadien-5-a...  88.6    4e-17   
ref|XP_006411279.1|  hypothetical protein EUTSA_v10016665mg           89.0    4e-17   
ref|XP_002528319.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...  88.6    4e-17   Ricinus communis
emb|CDP22130.1|  unnamed protein product                              85.1    5e-17   
ref|XP_010667734.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  85.9    1e-16   
ref|XP_010508892.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  87.4    1e-16   
ref|XP_010554116.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  87.4    1e-16   
ref|XP_006435775.1|  hypothetical protein CICLE_v10031495mg           87.4    1e-16   
ref|XP_007217976.1|  hypothetical protein PRUPE_ppa005418mg           87.4    2e-16   
ref|XP_010668237.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  84.0    2e-16   
ref|XP_009133424.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  86.7    2e-16   
ref|XP_004498041.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  84.7    2e-16   
ref|XP_010554673.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  86.7    3e-16   
ref|XP_009369195.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  86.3    3e-16   
emb|CDY07068.1|  BnaA04g22470D                                        86.3    3e-16   
ref|XP_004966401.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  86.3    4e-16   
ref|XP_010517439.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  85.9    4e-16   
ref|XP_003518437.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  85.9    4e-16   
ref|XP_002438993.1|  hypothetical protein SORBIDRAFT_10g029610        85.9    4e-16   Sorghum bicolor [broomcorn]
emb|CDY52430.1|  BnaC03g72540D                                        85.9    4e-16   
ref|XP_008355546.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  85.9    5e-16   
ref|XP_008233784.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  85.9    5e-16   
ref|XP_006295748.1|  hypothetical protein CARUB_v10024868mg           85.5    5e-16   
ref|XP_009141876.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  85.5    6e-16   
ref|XP_002437575.1|  hypothetical protein SORBIDRAFT_10g029620        85.1    8e-16   Sorghum bicolor [broomcorn]
emb|CDP21409.1|  unnamed protein product                              85.1    8e-16   
ref|XP_004498016.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  85.1    8e-16   
emb|CDX93209.1|  BnaC04g46870D                                        84.7    9e-16   
ref|XP_010689438.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  85.1    9e-16   
emb|CDY54990.1|  BnaCnng27890D                                        84.7    9e-16   
ref|XP_010507658.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  84.7    1e-15   
ref|XP_004966402.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  84.7    1e-15   
ref|XP_006856294.1|  hypothetical protein AMTR_s00047p00102350        84.3    1e-15   
ref|XP_010528158.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  84.3    2e-15   
ref|XP_010528157.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  84.0    2e-15   
ref|XP_011085895.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...  84.0    2e-15   
ref|XP_010534611.1|  PREDICTED: LOW QUALITY PROTEIN: taxadien-5-a...  84.0    2e-15   
ref|XP_009405177.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  84.0    2e-15   
gb|KDO48023.1|  hypothetical protein CISIN_1g031330mg                 80.5    3e-15   
gb|AAT68601.1|  benzoyl coenzyme A: benzyl alcohol benzoyl transf...  83.6    3e-15   Petunia x hybrida [garden petunia]
ref|XP_003626384.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  80.5    4e-15   
gb|KFK38055.1|  hypothetical protein AALP_AA3G064400                  83.2    5e-15   
ref|XP_004494963.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  82.8    5e-15   
ref|XP_009125170.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  82.8    6e-15   
ref|XP_004171600.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  79.0    6e-15   
emb|CDY65939.1|  BnaAnng21320D                                        82.4    6e-15   
ref|XP_007163565.1|  hypothetical protein PHAVU_001G244800g           82.4    8e-15   
ref|XP_009346788.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  82.0    9e-15   
ref|XP_007145940.1|  hypothetical protein PHAVU_007G280800g           82.0    1e-14   
gb|KFK36909.1|  hypothetical protein AALP_AA4G188700                  81.6    1e-14   
gb|AES82602.2|  benzyl alcohol O-benzoyltransferase                   78.6    1e-14   
ref|XP_002437572.1|  hypothetical protein SORBIDRAFT_10g029590        82.0    1e-14   Sorghum bicolor [broomcorn]
gb|EMT07181.1|  Taxadien-5-alpha-ol O-acetyltransferase               82.0    1e-14   
gb|AFK34239.1|  unknown                                               81.6    1e-14   
gb|ADD62404.1|  fatty omega-hydroxyacid/fatty alcohol 0-hydroxyci...  81.6    1e-14   
ref|XP_007208844.1|  hypothetical protein PRUPE_ppa025565mg           82.0    1e-14   
ref|XP_011085894.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  81.6    1e-14   
ref|XP_003575185.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  81.6    1e-14   
emb|CDP18599.1|  unnamed protein product                              81.6    1e-14   
ref|XP_003616154.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  81.6    2e-14   
ref|NP_197256.1|  HXXXD-type acyl-transferase family protein          81.6    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009143235.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  81.3    2e-14   
ref|XP_011098396.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  81.3    2e-14   
ref|XP_008791113.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  81.3    2e-14   
gb|AES82601.2|  benzyl alcohol O-benzoyltransferase                   81.6    2e-14   
ref|XP_003626383.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  81.6    2e-14   
ref|XP_007209120.1|  hypothetical protein PRUPE_ppa005455mg           81.3    2e-14   
gb|EMT21731.1|  Taxadien-5-alpha-ol O-acetyltransferase               78.6    2e-14   
emb|CDO98678.1|  unnamed protein product                              80.9    2e-14   
gb|EEE62389.1|  hypothetical protein OsJ_17179                        80.1    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010031185.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  80.9    3e-14   
ref|XP_003591040.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  80.5    3e-14   
gb|AFK49108.1|  unknown                                               80.5    3e-14   
ref|XP_008238035.1|  PREDICTED: methanol O-anthraniloyltransferas...  80.9    3e-14   
gb|KCW60630.1|  hypothetical protein EUGRSUZ_H03354                   80.5    3e-14   
ref|XP_010024179.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  80.5    4e-14   
emb|CDY68497.1|  BnaCnng59260D                                        80.5    4e-14   
emb|CAT00082.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...  80.1    4e-14   Coffea arabica [arabica coffee]
gb|EMT26852.1|  10-deacetylbaccatin III 10-O-acetyltransferase        77.8    4e-14   
ref|XP_008379094.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  80.1    4e-14   
ref|XP_006657584.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  80.1    4e-14   
gb|AFK34995.1|  unknown                                               77.0    4e-14   
ref|XP_009804829.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   80.1    5e-14   
ref|XP_004138033.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  80.1    5e-14   
emb|CDX67482.1|  BnaA07g15220D                                        80.1    5e-14   
ref|XP_009140062.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  80.1    5e-14   
ref|XP_002884383.1|  chat-3-HEXEN-1-OL ACETYLTRANSFERASE              80.1    5e-14   
gb|AAQ62868.1|  At3g48720                                             79.7    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006600094.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...  76.6    5e-14   
ref|NP_190441.1|  HXXXD-type acyl-transferase family protein          79.7    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008464403.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  79.7    6e-14   
ref|XP_003626386.1|  Alcohol acetyltransferase                        79.7    6e-14   
gb|AAS55785.1|  putative benzyl alcohol benzoyl transferase           79.7    6e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003554685.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  79.7    6e-14   
ref|XP_006484694.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  79.7    6e-14   
ref|XP_008238086.1|  PREDICTED: methanol O-anthraniloyltransferas...  80.1    6e-14   
ref|XP_007029790.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  79.7    7e-14   
ref|XP_006657332.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  79.3    7e-14   
gb|EEE53174.1|  hypothetical protein OsJ_36018                        76.6    7e-14   Oryza sativa Japonica Group [Japonica rice]
gb|KHN31436.1|  Benzyl alcohol O-benzoyltransferase                   79.3    7e-14   
ref|XP_011073101.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  79.3    7e-14   
ref|XP_003520833.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  79.3    8e-14   
ref|XP_010453955.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  79.3    8e-14   
gb|ACR36326.1|  unknown                                               79.3    9e-14   Zea mays [maize]
ref|XP_006437408.1|  hypothetical protein CICLE_v10031489mg           79.3    9e-14   
ref|NP_001058545.2|  Os06g0710700                                     79.3    9e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003536235.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  79.3    9e-14   
gb|EAZ02323.1|  hypothetical protein OsI_24425                        79.3    9e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_011073100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  79.3    9e-14   
ref|XP_010489657.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  79.0    1e-13   
ref|XP_010926850.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  79.3    1e-13   
gb|EMT25787.1|  10-deacetylbaccatin III 10-O-acetyltransferase        77.8    1e-13   
emb|CDY50708.1|  BnaC05g47750D                                        79.3    1e-13   
ref|XP_008373467.1|  PREDICTED: methanol O-anthraniloyltransferas...  79.0    1e-13   
ref|NP_001148135.1|  taxadien-5-alpha-ol O-acetyltransferase          79.0    1e-13   Zea mays [maize]
ref|XP_006878641.1|  hypothetical protein AMTR_s00011p00264530        75.5    1e-13   
ref|XP_010527080.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  79.0    1e-13   
ref|XP_007029787.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  79.0    1e-13   
ref|XP_002875921.1|  transferase family protein                       78.6    1e-13   
ref|XP_010441266.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  79.0    1e-13   
ref|XP_006289628.1|  hypothetical protein CARUB_v10003180mg           78.6    1e-13   
ref|XP_006405403.1|  hypothetical protein EUTSA_v10027756mg           78.6    1e-13   
gb|KHF99421.1|  Benzyl alcohol O-benzoyltransferase                   78.6    1e-13   
ref|XP_007029786.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  79.0    2e-13   
ref|XP_009381344.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  77.8    2e-13   
ref|XP_007029781.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  78.6    2e-13   
ref|XP_003626388.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  78.2    2e-13   
ref|NP_568587.2|  omega-hydroxypalmitate O-feruloyl transferase       78.2    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870657.1|  transferase family protein                       78.2    2e-13   
ref|NP_851111.1|  omega-hydroxypalmitate O-feruloyl transferase       78.2    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KDO36005.1|  hypothetical protein CISIN_1g041298mg                 74.7    2e-13   
ref|XP_011085899.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  78.2    2e-13   
ref|XP_003518844.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   78.2    2e-13   
ref|XP_009386561.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  78.2    2e-13   
gb|ACY79409.1|  omega-hydroxyacid hydroxycinnamoyltransferase         77.8    2e-13   
ref|XP_002321725.2|  hypothetical protein POPTR_0015s11290g           77.8    2e-13   Populus trichocarpa [western balsam poplar]
emb|CDY48963.1|  BnaA04g10770D                                        77.8    2e-13   
ref|XP_002524021.1|  transferase, putative                            75.9    2e-13   Ricinus communis
ref|XP_008645066.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  77.8    2e-13   
ref|XP_010249109.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  77.8    2e-13   
ref|XP_006400294.1|  hypothetical protein EUTSA_v10013454mg           78.2    2e-13   
gb|AGW30203.1|  alcohol acyl transferase                              77.8    2e-13   
gb|EYU41396.1|  hypothetical protein MIMGU_mgv1a005907mg              77.8    3e-13   
ref|XP_003563544.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  77.8    3e-13   
ref|XP_004151707.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  75.9    3e-13   
ref|XP_006878638.1|  hypothetical protein AMTR_s00011p00264170        77.8    3e-13   
gb|AES82607.2|  benzyl alcohol O-benzoyltransferase                   77.8    3e-13   
emb|CAA64636.1|  hsr201                                               77.8    3e-13   Nicotiana tabacum [American tobacco]
ref|XP_011046333.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  77.8    3e-13   
ref|XP_007147137.1|  hypothetical protein PHAVU_006G098900g           77.8    3e-13   
gb|AGW27210.1|  rosmarinic acid synthase 5                            77.4    3e-13   
gb|KDP39569.1|  hypothetical protein JCGZ_02589                       76.6    3e-13   
ref|XP_002517500.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...  77.4    3e-13   Ricinus communis
ref|XP_009381343.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  77.4    3e-13   
ref|XP_008779984.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  77.4    4e-13   
ref|XP_009131598.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase    77.4    4e-13   
ref|XP_003626389.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  77.8    4e-13   
ref|XP_010672751.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  77.4    4e-13   
ref|XP_009130368.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  77.4    4e-13   
ref|XP_008804093.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  77.0    4e-13   
gb|EYU41386.1|  hypothetical protein MIMGU_mgv1a006089mg              77.0    5e-13   
dbj|BAE72881.1|  benzoyl CoA benzoic acid benzoyltransferase          77.0    5e-13   
gb|EPS58183.1|  hypothetical protein M569_16633                       73.6    5e-13   
ref|XP_009619718.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   77.0    5e-13   
ref|XP_010460389.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  73.9    5e-13   
gb|AGW27209.1|  rosmarinic acid synthase 4                            77.0    5e-13   
ref|XP_003549071.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  77.0    5e-13   
ref|XP_002970966.1|  BAHD family acyltransferase, clade V             77.0    5e-13   
ref|XP_003549135.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...  77.0    5e-13   
ref|XP_002511135.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...  76.6    6e-13   
ref|XP_002962120.1|  BAHD family acyltransferase, clade V             76.6    6e-13   
ref|XP_007029780.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  77.0    6e-13   
ref|XP_007161685.1|  hypothetical protein PHAVU_001G089700g           76.6    6e-13   
gb|AAM61186.1|  putative hypersensitivity-related gene                77.0    6e-13   
ref|XP_009374085.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  77.0    6e-13   
ref|XP_006370913.1|  hypothetical protein POPTR_0019s01680g           76.6    6e-13   
ref|NP_186998.1|  acetyl CoA:(Z)-3-hexen-1-ol acetyltransferase       76.6    6e-13   
gb|KFK38057.1|  hypothetical protein AALP_AA3G064500                  77.4    6e-13   
ref|XP_010941427.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  76.6    6e-13   
ref|XP_009372579.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  76.6    6e-13   
ref|XP_010667725.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  76.6    6e-13   
ref|XP_006290240.1|  hypothetical protein CARUB_v100037960mg          73.2    6e-13   
ref|XP_010420481.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  76.6    7e-13   
ref|XP_008239515.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  76.6    7e-13   
ref|XP_006844599.1|  hypothetical protein AMTR_s00016p00213830        76.6    7e-13   
gb|KHN38523.1|  Omega-hydroxypalmitate O-feruloyl transferase         75.5    8e-13   
gb|KFK33037.1|  hypothetical protein AALP_AA6G322400                  76.6    8e-13   
gb|EYU41388.1|  hypothetical protein MIMGU_mgv1a021683mg              76.3    8e-13   
ref|XP_010275172.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   76.6    8e-13   
sp|Q8GT20.1|BEBT_TOBAC  RecName: Full=Benzyl alcohol O-benzoyltra...  76.6    8e-13   
gb|AIC83789.1|  alcohol acyltransferase                               76.3    8e-13   
ref|XP_008232530.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   76.3    8e-13   
emb|CDY50709.1|  BnaC05g47740D                                        76.3    8e-13   
ref|XP_008359502.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  76.3    8e-13   
ref|XP_004304536.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  76.3    9e-13   
ref|XP_007031933.1|  HXXXD-type acyl-transferase family protein       76.6    9e-13   
ref|XP_009130369.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  76.3    9e-13   
emb|CDX78752.1|  BnaA03g06640D                                        76.3    9e-13   
ref|XP_010086996.1|  Omega-hydroxypalmitate O-feruloyl transferase    76.3    9e-13   
emb|CDY43120.1|  BnaA05g32660D                                        76.3    9e-13   
ref|XP_011045747.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  76.3    9e-13   
ref|XP_010450574.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  76.3    9e-13   
ref|XP_004304535.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  76.3    9e-13   
ref|XP_003634222.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  76.3    1e-12   
ref|XP_010549748.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  76.3    1e-12   
emb|CDP09539.1|  unnamed protein product                              75.9    1e-12   
gb|KFK25971.1|  hypothetical protein AALP_AA8G186800                  76.3    1e-12   
gb|EMT25788.1|  10-deacetylbaccatin III 10-O-acetyltransferase        72.8    1e-12   
ref|XP_009378002.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  75.9    1e-12   
gb|KEH40969.1|  benzyl alcohol O-benzoyltransferase                   76.3    1e-12   
ref|XP_007215405.1|  hypothetical protein PRUPE_ppa005943mg           75.9    1e-12   
emb|CDY11732.1|  BnaC06g13400D                                        75.9    1e-12   
gb|EYU41389.1|  hypothetical protein MIMGU_mgv1a006154mg              75.9    1e-12   
ref|XP_010436043.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  76.3    1e-12   
ref|XP_006283644.1|  hypothetical protein CARUB_v10004701mg           76.3    1e-12   
ref|XP_004297519.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  75.9    1e-12   
gb|EMS58180.1|  Omega-hydroxypalmitate O-feruloyl transferase         72.8    1e-12   
ref|XP_010933015.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   72.8    1e-12   
ref|XP_008341279.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  75.9    1e-12   
ref|XP_010038484.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  75.5    1e-12   
gb|KFK25975.1|  hypothetical protein AALP_AA8G187200                  75.9    1e-12   
gb|KEH17125.1|  benzyl alcohol O-benzoyltransferase                   72.4    2e-12   
gb|AIC83790.1|  alcohol acyltransferase                               75.5    2e-12   
ref|XP_002264599.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   75.5    2e-12   
gb|KFK34173.1|  hypothetical protein AALP_AA5G109900                  75.5    2e-12   
gb|EYU41397.1|  hypothetical protein MIMGU_mgv1a024853mg              75.5    2e-12   
ref|XP_004151058.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  75.5    2e-12   
gb|AJD18611.1|  alcohol acyltransferase                               75.5    2e-12   
ref|XP_010679985.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  75.5    2e-12   
ref|XP_011023948.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  75.5    2e-12   
gb|ABR16192.1|  unknown                                               75.5    2e-12   
ref|XP_007147133.1|  hypothetical protein PHAVU_006G098500g           75.5    2e-12   
gb|EEE62279.1|  hypothetical protein OsJ_17067                        75.5    2e-12   
ref|XP_002325454.2|  transferase family protein                       75.5    2e-12   
ref|XP_008462816.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  75.5    2e-12   
emb|CDY08092.1|  BnaA06g16340D                                        75.1    2e-12   
ref|NP_001054603.1|  Os05g0141300                                     75.1    2e-12   
ref|XP_009379971.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  75.5    2e-12   
ref|XP_011012995.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  75.1    2e-12   
ref|XP_010450554.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase    75.1    2e-12   
gb|EAY96502.1|  hypothetical protein OsI_18404                        75.1    2e-12   
gb|AJD25145.1|  benzoyl-CoA:benzyl alcohol O-benzoyltransferase       75.1    2e-12   
ref|XP_009365763.1|  PREDICTED: methanol O-anthraniloyltransferas...  75.1    2e-12   
ref|XP_009149801.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  75.1    2e-12   
ref|XP_007029789.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  75.1    2e-12   
ref|XP_009365778.1|  PREDICTED: methanol O-anthraniloyltransferas...  75.1    2e-12   
gb|KFK38056.1|  hypothetical protein AALP_AA3G064500                  75.5    2e-12   
gb|AAS48090.1|  alcohol acyl transferase                              75.1    2e-12   
ref|XP_008391402.1|  PREDICTED: methanol O-anthraniloyltransferas...  75.1    2e-12   
ref|XP_011046335.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  74.7    3e-12   
emb|CDY05866.1|  BnaC08g20430D                                        74.7    3e-12   
gb|KCW72712.1|  hypothetical protein EUGRSUZ_E01165                   74.3    3e-12   
gb|KDP22581.1|  hypothetical protein JCGZ_26412                       74.7    3e-12   
gb|EYU41395.1|  hypothetical protein MIMGU_mgv1a006288mg              74.7    3e-12   
gb|ABR16407.1|  unknown                                               74.7    3e-12   
gb|ABR16595.1|  unknown                                               74.7    3e-12   
ref|XP_004290447.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  74.7    3e-12   
ref|XP_007209159.1|  hypothetical protein PRUPE_ppa006018mg           74.3    3e-12   
ref|XP_010941428.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  74.3    4e-12   
ref|XP_007147136.1|  hypothetical protein PHAVU_006G098800g           74.7    4e-12   
ref|XP_004243495.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  74.7    4e-12   
gb|KHN31437.1|  Benzyl alcohol O-benzoyltransferase                   70.5    4e-12   
ref|XP_010558859.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  74.3    4e-12   
dbj|BAF49304.1|  putative acyltransferase                             74.3    4e-12   
ref|XP_010558858.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  74.3    4e-12   
ref|XP_010557044.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  74.3    4e-12   
ref|XP_008384757.1|  PREDICTED: methanol O-anthraniloyltransferas...  74.3    4e-12   
emb|CBI15706.3|  unnamed protein product                              75.1    4e-12   
ref|XP_003553956.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  73.9    5e-12   
ref|XP_010492711.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  74.3    5e-12   
ref|XP_002298644.2|  hypothetical protein POPTR_0001s33390g           73.9    5e-12   
ref|XP_006370914.1|  hypothetical protein POPTR_0019s01690g           73.9    5e-12   
ref|XP_008343918.1|  PREDICTED: methanol O-anthraniloyltransferas...  73.9    5e-12   
gb|AGJ03151.1|  hydroxycinnamoyltransferase                           73.9    5e-12   
ref|XP_008231077.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  73.9    5e-12   
gb|AGW30201.1|  alcohol acyl transferase                              73.9    5e-12   
emb|CBI25251.3|  unnamed protein product                              73.9    5e-12   
ref|XP_008797996.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  71.2    5e-12   
ref|XP_002271603.1|  PREDICTED: methanol O-anthraniloyltransferase    73.9    5e-12   
ref|XP_010058393.1|  PREDICTED: methanol O-anthraniloyltransferas...  74.3    5e-12   
gb|AGW30205.1|  alcohol acyl transferase                              73.9    5e-12   
ref|XP_006404225.1|  hypothetical protein EUTSA_v10010131mg           74.7    5e-12   
sp|Q8GT21.1|BEBT_CLABR  RecName: Full=Benzyl alcohol O-benzoyltra...  73.9    5e-12   
gb|AAR99826.1|  alcohol acyl transferase                              73.9    6e-12   
ref|XP_008778437.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  73.9    6e-12   
gb|EYU34530.1|  hypothetical protein MIMGU_mgv1a006233mg              73.9    6e-12   
ref|XP_007147132.1|  hypothetical protein PHAVU_006G098400g           73.9    6e-12   
ref|XP_009368287.1|  PREDICTED: methanol O-anthraniloyltransferas...  73.9    6e-12   
ref|XP_008373476.1|  PREDICTED: methanol O-anthraniloyltransferas...  73.9    6e-12   
ref|XP_004971119.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  73.9    6e-12   
gb|EPS65560.1|  hypothetical protein M569_09214                       73.6    6e-12   
gb|KCW72711.1|  hypothetical protein EUGRSUZ_E01163                   73.9    6e-12   
ref|XP_007029776.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  73.9    6e-12   
ref|XP_006577743.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  70.1    7e-12   
ref|XP_004506306.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...  73.6    7e-12   
ref|XP_007147135.1|  hypothetical protein PHAVU_006G098700g           73.6    7e-12   
ref|XP_010058392.1|  PREDICTED: methanol O-anthraniloyltransferas...  73.6    7e-12   
gb|KEH40976.1|  benzyl alcohol O-benzoyltransferase                   73.6    7e-12   
dbj|BAJ88238.1|  predicted protein                                    73.6    7e-12   
ref|XP_011007948.1|  PREDICTED: methanol O-anthraniloyltransferas...  73.6    7e-12   
ref|XP_003545226.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  73.6    8e-12   
ref|XP_009803456.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  73.6    8e-12   
ref|XP_008779983.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  70.1    8e-12   
ref|XP_007147134.1|  hypothetical protein PHAVU_006G098600g           73.6    8e-12   
ref|XP_006826688.1|  hypothetical protein AMTR_s00137p00072760        73.6    8e-12   
ref|XP_010058386.1|  PREDICTED: methanol O-anthraniloyltransferas...  73.6    8e-12   
ref|XP_002270240.1|  PREDICTED: methanol O-anthraniloyltransferase    73.2    8e-12   
ref|XP_010250620.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  73.2    8e-12   
ref|XP_002512898.1|  Anthranilate N-benzoyltransferase protein, p...  73.2    9e-12   
gb|ABA98390.1|  Transferase family protein                            72.8    9e-12   
gb|EAZ20409.1|  hypothetical protein OsJ_36017                        73.2    9e-12   
ref|XP_009600109.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  73.2    9e-12   
ref|XP_007029788.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...  73.2    9e-12   
ref|NP_001064997.1|  Os10g0503300                                     73.2    9e-12   
ref|XP_003626382.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...  73.2    1e-11   
ref|XP_010929588.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  73.2    1e-11   
emb|CDY43121.1|  BnaA05g32650D                                        72.8    1e-11   
ref|XP_011084630.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  72.8    1e-11   
gb|KHN31434.1|  Benzyl alcohol O-benzoyltransferase                   73.2    1e-11   
ref|XP_007209131.1|  hypothetical protein PRUPE_ppa005625mg           73.2    1e-11   
gb|AAG13627.1|AC078840_18  putative hypersensitivity-related (hsr...  73.2    1e-11   
ref|XP_009344220.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  72.8    1e-11   
ref|XP_009778012.1|  PREDICTED: methanol O-anthraniloyltransferas...  72.8    1e-11   
gb|KDP39567.1|  hypothetical protein JCGZ_02587                       72.8    1e-11   
emb|CDP11065.1|  unnamed protein product                              69.7    1e-11   
ref|XP_009336752.1|  PREDICTED: methanol O-anthraniloyltransferas...  72.8    1e-11   
ref|XP_009336751.1|  PREDICTED: methanol O-anthraniloyltransferas...  72.8    1e-11   
gb|KDO44966.1|  hypothetical protein CISIN_1g0133462mg                69.7    1e-11   
gb|ACF07921.1|  alcohol acyl transferase                              72.8    1e-11   
ref|XP_006291175.1|  hypothetical protein CARUB_v10017301mg           72.8    1e-11   
ref|XP_006446264.1|  hypothetical protein CICLE_v10015163mg           72.8    1e-11   
gb|KDP32472.1|  hypothetical protein JCGZ_13397                       72.4    1e-11   
ref|XP_006347627.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  72.4    1e-11   
ref|XP_009383405.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  72.4    2e-11   
ref|XP_002464789.1|  hypothetical protein SORBIDRAFT_01g026760        72.8    2e-11   
ref|XP_004294711.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  72.8    2e-11   
ref|NP_001275190.1|  feruloyl transferase                             72.4    2e-11   
ref|XP_006470748.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  72.4    2e-11   
ref|XP_010108950.1|  Benzyl alcohol O-benzoyltransferase              68.6    2e-11   
gb|AAW51125.1|  putative alcohol acyl-transferases                    72.4    2e-11   
ref|XP_004243496.2|  PREDICTED: benzyl alcohol O-benzoyltransferase   72.4    2e-11   
gb|AFK36385.1|  unknown                                               72.4    2e-11   
ref|XP_010042878.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  68.9    2e-11   
ref|XP_011009229.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  72.4    2e-11   
ref|XP_010689157.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  72.4    2e-11   
ref|XP_003521737.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  72.4    2e-11   
gb|AHC32224.2|  alcohol acyl transferase 1                            72.4    2e-11   
gb|ACJ85557.1|  unknown                                               72.4    2e-11   
ref|NP_001066733.1|  Os12g0458100                                     72.0    2e-11   
gb|KEH40971.1|  benzyl alcohol O-benzoyltransferase                   72.0    2e-11   
ref|XP_010058385.1|  PREDICTED: methanol O-anthraniloyltransferas...  71.6    2e-11   
ref|XP_011018694.1|  PREDICTED: methanol O-anthraniloyltransferas...  72.0    2e-11   
ref|XP_006664808.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  72.0    3e-11   
gb|KEH21938.1|  omega-hydroxypalmitate O-feruloyl transferase         71.6    3e-11   
gb|KDP41799.1|  hypothetical protein JCGZ_26817                       71.6    3e-11   
ref|XP_010112404.1|  Omega-hydroxypalmitate O-feruloyl transferase    72.0    3e-11   
ref|XP_010689156.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  71.6    3e-11   
ref|XP_009770247.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  71.6    3e-11   
ref|XP_010557036.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  71.6    3e-11   
ref|XP_010026248.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  71.6    3e-11   
ref|XP_002304071.1|  hypothetical protein POPTR_0003s01420g           71.6    3e-11   
ref|NP_001275839.1|  alcohol acyl transferase                         71.6    3e-11   
ref|XP_010492712.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...  71.6    3e-11   
ref|XP_010550256.1|  PREDICTED: LOW QUALITY PROTEIN: (Z)-3-hexen-...  71.6    3e-11   
gb|AAM62785.1|  acyltransferase-like protein                          71.6    3e-11   
ref|XP_009388282.1|  PREDICTED: benzyl alcohol O-benzoyltransferase   71.6    3e-11   
ref|NP_201161.1|  HXXXD-type acyl-transferase-like protein            71.6    3e-11   
ref|XP_002319765.2|  hypothetical protein POPTR_0013s07220g           71.6    3e-11   
ref|XP_006470570.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  71.6    4e-11   
gb|ABX57719.1|  acyltransferase                                       71.2    4e-11   
ref|XP_002319767.1|  transferase family protein                       71.2    4e-11   
ref|XP_010058390.1|  PREDICTED: methanol O-anthraniloyltransferas...  71.2    4e-11   
ref|XP_003516503.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...  71.2    4e-11   
gb|KDP39576.1|  hypothetical protein JCGZ_02596                       71.2    4e-11   



>ref|XP_008220852.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Prunus 
mume]
Length=475

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDCFYPT P LI P + TP H L LSNLDDQ FLRFSIKYLYLF+ SV +D LK +L++
Sbjct  8    LPDCFYPTQPVLIHPNTPTPKHCLSLSNLDDQKFLRFSIKYLYLFKKSVNLDGLKYALSK  67

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    D  +KL+VDCN  GA+FAEAFMD+TA+EF++LS KPNRSWRKLL
Sbjct  68   VLVDYYPLAGRLRTSADQDQKLEVDCNGEGALFAEAFMDITAEEFLELSRKPNRSWRKLL  127

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            Y+VEA +FL IPPLVVQV+S
Sbjct  128  YRVEAQSFLDIPPLVVQVTS  147



>ref|XP_007227292.1| hypothetical protein PRUPE_ppa017132mg, partial [Prunus persica]
 gb|EMJ28491.1| hypothetical protein PRUPE_ppa017132mg, partial [Prunus persica]
Length=453

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDCFYPT P LI P + TP H L LSNLDDQ FLRFSIKYLYLF+ SV +D LK +L++
Sbjct  8    LPDCFYPTQPVLIHPNTPTPKHCLSLSNLDDQKFLRFSIKYLYLFKKSVNLDGLKYALSK  67

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    D  +KL+VDCN  GA+FAEAFMD+TA+EF++LS KPNRSWRKLL
Sbjct  68   VLVDYYPLAGRLRTSADHDQKLEVDCNGEGALFAEAFMDITAEEFLELSRKPNRSWRKLL  127

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            Y+VEA +FL IPPLVVQV+S
Sbjct  128  YRVEAQSFLDIPPLVVQVTS  147



>ref|XP_009618855.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Nicotiana 
tomentosiformis]
Length=459

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC Y   P  I P S TP+HSL LSNLDDQ FLRFSIKYLYLF  S+ +DRLK SL+R
Sbjct  7    LPDCVYSKDPIFITPISPTPNHSLYLSNLDDQKFLRFSIKYLYLFTKSINLDRLKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL  CP+++ KLQVDCN  GA+FAEAF+DLTADE + +S KP++SWRKLL
Sbjct  67   VLVDYYPLAGRLRTCPENNHKLQVDCNGEGAIFAEAFLDLTADELLVVSNKPDKSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            YKVEA +FL IPPLVVQV++
Sbjct  127  YKVEATSFLDIPPLVVQVTN  146



>ref|XP_007017618.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY14843.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=452

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDCFY   PTLI P + TP HSL LSNLDDQ FLRFSIKYLYLF+ +V++D L+ SL++
Sbjct  7    LPDCFYQNQPTLICPNTPTPKHSLYLSNLDDQKFLRFSIKYLYLFKKAVSLDILRYSLSK  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL  C  D +KL++DCN  GAVFA+AFMD+T+DEF+++S KPNRSWRKLL
Sbjct  67   VLVDYYPLAGRLRTCTLDDQKLEIDCNGEGAVFADAFMDITSDEFLEISRKPNRSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            Y+VEA TFL IPPLVVQV++
Sbjct  127  YRVEAHTFLEIPPLVVQVTN  146



>ref|XP_004293197.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Fragaria vesca subsp. vesca]
Length=459

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +3

Query  21   PLQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            P + LPDC Y T PTLI P + TP H LPLSNLDDQ FLRFSIKYLYLFRTSV +D +K 
Sbjct  4    PPEELPDCLYATQPTLIRPNTPTPKHCLPLSNLDDQKFLRFSIKYLYLFRTSVNLDAMKY  63

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSW  380
            +L++ LV YYPLAGRL   PD  +KL+VDCN  GAVFAEAFMD+TAD+F+QLS KPNRSW
Sbjct  64   ALSKLLVLYYPLAGRLRTNPDHDQKLEVDCNGEGAVFAEAFMDITADQFLQLSEKPNRSW  123

Query  381  RKLLYKVE-APTFLHIPPLVVQVSSSPYSLCFTSTKTAFCV  500
            +KLLY+VE A TFL +PPLVVQV++  +      T    C+
Sbjct  124  KKLLYRVEGAHTFLDVPPLVVQVTNLRFGGMILCTAINHCL  164



>gb|KDP38549.1| hypothetical protein JCGZ_04474 [Jatropha curcas]
Length=452

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDCFY   P LI P   TP+HSL LSNLDDQ FLRFSIKYLYLF+ SV  D LK SL++
Sbjct  8    LPDCFYQNHPVLISPIVPTPNHSLYLSNLDDQKFLRFSIKYLYLFKKSVTSDILKYSLSK  67

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    DD +KL+VDCN  GAVFAEAFMD+TA+ F++LS KPNRSWRKLL
Sbjct  68   VLVDYYPLAGRLRTSSDDDQKLEVDCNGEGAVFAEAFMDITAEHFLELSKKPNRSWRKLL  127

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            YKVEA +FL IPPLVVQV++
Sbjct  128  YKVEAQSFLDIPPLVVQVTN  147



>emb|CDP07478.1| unnamed protein product [Coffea canephora]
Length=440

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDCFY   P LI P+S+TP HSL LSNLDDQNFLRFSIKYLYLFR SV  D LK +L+R
Sbjct  7    LPDCFYSCKPVLITPSSRTPQHSLYLSNLDDQNFLRFSIKYLYLFRKSVNTDCLKVALSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV YYPLAGRL   P++  KL+V+CN  GAVFAE FMDLTADEF ++  KPNR++RKLL
Sbjct  67   LLVYYYPLAGRLKKSPENDHKLEVECNGEGAVFAEGFMDLTADEFAEIFQKPNRTFRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            YKVEAP+FL IPPLVVQV++
Sbjct  127  YKVEAPSFLDIPPLVVQVTN  146



>ref|XP_008347391.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Malus domestica]
Length=192

 Score =   195 bits (496),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC+YP  P LI P S TP H + LSNLDDQ FLRFSIKYLYLF+ SV ++ LK +L+ 
Sbjct  8    LPDCYYPNQPILIXPNSPTPKHCIHLSNLDDQKFLRFSIKYLYLFKKSVNLETLKHALSN  67

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV YYPLAGRL    D  +KL+VDCN  GAVFAEAFMD+TA +F++LS KPNRSWRKLL
Sbjct  68   VLVGYYPLAGRLRSNADHDQKLEVDCNGEGAVFAEAFMDITAQDFLKLSSKPNRSWRKLL  127

Query  393  YKVEAPTFLHIPPLVVQVSSSPYSLCFTSTK  485
            Y+VEA +FL IPPLV+Q   S  +  +   K
Sbjct  128  YRVEALSFLDIPPLVIQRKQSSTAQSYAQDK  158



>ref|XP_002307677.2| transferase family protein [Populus trichocarpa]
 gb|EEE94673.2| transferase family protein [Populus trichocarpa]
Length=454

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDCFY   P+LI P+S TP HSL LSNLDDQ FLRFSIKYLYLF+ S+++D LK SL++
Sbjct  7    LPDCFYQNQPSLICPSSPTPKHSLYLSNLDDQKFLRFSIKYLYLFKKSISLDILKYSLSK  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV YYPLAGRL    +  +KL++DCN  GAVFAEAFMD+TA+EF++LS KPN+SWRKL+
Sbjct  67   VLVHYYPLAGRLRASTEVDQKLEIDCNGEGAVFAEAFMDITAEEFLELSKKPNKSWRKLM  126

Query  393  YKVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCV  500
            YKVEA +FL IPPLVVQV++         T    CV
Sbjct  127  YKVEAQSFLDIPPLVVQVTNLRCGGMIVCTAINHCV  162



>ref|XP_008359762.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Malus domestica]
Length=453

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LP+C+YPT P LI P S TP H L LSNLDDQNFLRFSIKYLYLF+ SV+++ LK +L++
Sbjct  8    LPNCYYPTQPILIRPNSPTPKHCLHLSNLDDQNFLRFSIKYLYLFKKSVSLETLKHALSK  67

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV YYPLAGRL    D  +KL+VDCN  GAVFAEAFMD+TA +F++LS KPNRSWRKLL
Sbjct  68   VLVGYYPLAGRLRTSADHDQKLEVDCNGEGAVFAEAFMDITAQDFLELSSKPNRSWRKLL  127

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            Y+VEA +FL IPPLV+QV++
Sbjct  128  YRVEALSFLDIPPLVIQVTN  147



>emb|CBI19745.3| unnamed protein product [Vitis vinifera]
Length=400

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDCFY   P LI P+  TP HSL LSNLDDQ FLRFSIKYLYLFR S ++D LK SL+R
Sbjct  7    LPDCFYQNQPILISPSRPTPKHSLYLSNLDDQKFLRFSIKYLYLFRKSTSLDVLKYSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    +D +KL++DCN  GAVFAEAFMD +AD+F+++S +PNRSWRKLL
Sbjct  67   VLVDYYPLAGRLRTSSEDEQKLEIDCNGEGAVFAEAFMDCSADDFLEVSSRPNRSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            Y++E  +FL IPPL+VQV+S
Sbjct  127  YRIETHSFLDIPPLIVQVTS  146



>ref|XP_002300751.1| transferase family protein [Populus trichocarpa]
 gb|EEE80024.1| transferase family protein [Populus trichocarpa]
Length=444

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 118/156 (76%), Gaps = 0/156 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDCFY   PTLI P+S TP HSL LSNLDDQ FLRFSIKYLYLF+ S+++D LK SL++
Sbjct  7    LPDCFYQNQPTLIFPSSPTPKHSLYLSNLDDQKFLRFSIKYLYLFKKSISLDILKYSLSK  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV YYPLAGRL    +  +KL+VDCN  GAVFAEAFMD+TA+EF+ LS KPN+SWRKLL
Sbjct  67   VLVHYYPLAGRLRASTEVDQKLEVDCNGEGAVFAEAFMDITAEEFLDLSMKPNKSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCV  500
            Y+VEA +FL IPPLVVQV++         T    CV
Sbjct  127  YRVEAQSFLDIPPLVVQVTTLRCGGMIVCTSINHCV  162



>ref|XP_011048810.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Populus euphratica]
Length=442

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 118/156 (76%), Gaps = 0/156 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDCFY   P+LI P+S TP HSL LSNLDDQ FLRFSIKYLYLF+ S+++D LK SL+ 
Sbjct  7    LPDCFYQNQPSLICPSSPTPKHSLYLSNLDDQKFLRFSIKYLYLFKKSISLDILKYSLSN  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV YYPLAGRL    +  +KL++DCN  GAVFAEAFMD+TA+EF++LS KPN+SWRKL+
Sbjct  67   VLVHYYPLAGRLRASTEVDQKLEIDCNGEGAVFAEAFMDITAEEFLELSKKPNKSWRKLM  126

Query  393  YKVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCV  500
            YKVEA +FL IPPLVVQV++         T    CV
Sbjct  127  YKVEAQSFLDIPPLVVQVTNLRCGGMILCTAINHCV  162



>ref|XP_011048809.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Populus euphratica]
Length=454

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 118/156 (76%), Gaps = 0/156 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDCFY   P+LI P+S TP HSL LSNLDDQ FLRFSIKYLYLF+ S+++D LK SL+ 
Sbjct  7    LPDCFYQNQPSLICPSSPTPKHSLYLSNLDDQKFLRFSIKYLYLFKKSISLDILKYSLSN  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV YYPLAGRL    +  +KL++DCN  GAVFAEAFMD+TA+EF++LS KPN+SWRKL+
Sbjct  67   VLVHYYPLAGRLRASTEVDQKLEIDCNGEGAVFAEAFMDITAEEFLELSKKPNKSWRKLM  126

Query  393  YKVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCV  500
            YKVEA +FL IPPLVVQV++         T    CV
Sbjct  127  YKVEAQSFLDIPPLVVQVTNLRCGGMILCTAINHCV  162



>ref|XP_002281098.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Vitis 
vinifera]
 emb|CAN70093.1| hypothetical protein VITISV_030029 [Vitis vinifera]
Length=450

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDCFY   P LI P+  TP HSL LSNLDDQ FLRFSIKYLYLFR S ++D LK SL+R
Sbjct  7    LPDCFYQNQPILISPSRPTPKHSLYLSNLDDQKFLRFSIKYLYLFRKSTSLDVLKYSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    +D +KL++DCN  GAVFAEAFMD +AD+F+++S +PNRSWRKLL
Sbjct  67   VLVDYYPLAGRLRTSSEDEQKLEIDCNGEGAVFAEAFMDCSADDFLEVSSRPNRSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            Y++E  +FL IPPL+VQV+S
Sbjct  127  YRIETHSFLDIPPLIVQVTS  146



>ref|XP_009804186.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Nicotiana 
sylvestris]
Length=459

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC Y   P  I P S TP+HSL LSNLDDQ FLRFSIKYLYLF  S+ +D+LK SL+R
Sbjct  7    LPDCVYSKEPIFITPISPTPNHSLYLSNLDDQKFLRFSIKYLYLFTKSINLDKLKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGR+  CP++  KLQV CN  GA+FAEAF+DLTADE + +S KP++SWRKLL
Sbjct  67   VLVDYYPLAGRVRKCPENDHKLQVYCNGEGAIFAEAFLDLTADELLVVSNKPDKSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            YKVEA  FL IPPLVVQV++
Sbjct  127  YKVEATNFLDIPPLVVQVTN  146



>gb|KHG27796.1| Omega-hydroxypalmitate O-feruloyl transferase -like protein [Gossypium 
arboreum]
Length=448

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 114/143 (80%), Gaps = 3/143 (2%)
 Frame = +3

Query  33   LPDCFY-PTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLA  209
            LPDCFY    PTLI P + TP+HSL LSNLDDQ FLRFSIKYLYLF  +VA+D LK SL+
Sbjct  7    LPDCFYYQNKPTLITPNTSTPNHSLYLSNLDDQKFLRFSIKYLYLFEKAVAIDILKYSLS  66

Query  210  RALVDYYPLAGRLTPC--PDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWR  383
            + LVDYYPLAGRL PC    D  KL VDCN  GAVFAE FMD++ +EF+Q+S KPNRSWR
Sbjct  67   KVLVDYYPLAGRLRPCGGAGDDDKLVVDCNGEGAVFAEGFMDISCEEFLQISRKPNRSWR  126

Query  384  KLLYKVEAPTFLHIPPLVVQVSS  452
            KLLY+VEA +F+ IPPLVVQV++
Sbjct  127  KLLYRVEAHSFIEIPPLVVQVTN  149



>ref|XP_010110033.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
 gb|EXC25051.1| Omega-hydroxypalmitate O-feruloyl transferase [Morus notabilis]
Length=455

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDCFYP  PTL+ P S TP HSL LSNLDDQ FLRF+IKYLYLF+  V+ + LK SLA+
Sbjct  7    LPDCFYPNQPTLVCPNSPTPKHSLYLSNLDDQKFLRFAIKYLYLFQNPVSSETLKSSLAK  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV YYPLAGRL P   D +KL+VDCN  GAVFAEAFMD+TA EF++ S KPNRSWRKL 
Sbjct  67   VLVHYYPLAGRLRPTSQDDQKLEVDCNGEGAVFAEAFMDITAHEFLEFSRKPNRSWRKLS  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            Y+VEA +FL +PPL+VQV++
Sbjct  127  YRVEALSFLDVPPLIVQVTN  146



>ref|XP_004238294.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Solanum 
lycopersicum]
Length=459

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC Y   PT I P S TP+H+L LSNLDDQ FLRFSIKYLY+F  S+ +++LK SL+R
Sbjct  7    LPDCVYSKEPTFISPISPTPNHTLYLSNLDDQMFLRFSIKYLYIFTKSINLEKLKYSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL  CP ++ KLQVDCN  GA+FAEAF+DL+ADE + +S KP++SWRKLL
Sbjct  67   VLVDYYPLAGRLLKCPQNNHKLQVDCNGKGAIFAEAFLDLSADELLLVSNKPDKSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            YK EA +FL IPPLVVQV++
Sbjct  127  YKDEAQSFLDIPPLVVQVTN  146



>ref|XP_011028892.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Populus euphratica]
Length=455

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 117/156 (75%), Gaps = 0/156 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDCFY   PTLI P+S TP HSL LSNLDDQ FLRFSIKYLYLF+ S+++D LK SL++
Sbjct  7    LPDCFYQNQPTLIFPSSPTPKHSLYLSNLDDQKFLRFSIKYLYLFKKSISLDILKYSLSK  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV YYPLAGRL    +  +KL+VDCN  GAVFAEAFMD+TA+EF+ LS KP +SWRKLL
Sbjct  67   VLVHYYPLAGRLRASTEVDQKLEVDCNGEGAVFAEAFMDITAEEFLDLSMKPTKSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCV  500
            Y+VEA +FL IPPLVVQV++         T    CV
Sbjct  127  YRVEAQSFLDIPPLVVQVTTLRCGGMIVCTSINHCV  162



>ref|XP_002510432.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
 gb|EEF52619.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
Length=455

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  27   QILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSL  206
            Q LP+CFY   P L+ P + TP HSL LSNLDDQ FLRFSIKYLYLF+ SV +D LK SL
Sbjct  11   QELPNCFYQNQPVLVSPLTPTPKHSLYLSNLDDQRFLRFSIKYLYLFKKSVNLDILKYSL  70

Query  207  ARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRK  386
            ++ LVDYYPLAGRL    +   KL+VDCN  G+VFAEAF+D+TA++F++LS KPNRSWRK
Sbjct  71   SKVLVDYYPLAGRLKTSSEGDHKLEVDCNGEGSVFAEAFLDITAEQFLELSKKPNRSWRK  130

Query  387  LLYKVEAPTFLHIPPLVVQVSS  452
            LLY+VEA +FL IPPLVVQV++
Sbjct  131  LLYRVEAQSFLDIPPLVVQVTN  152



>ref|XP_009335934.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Pyrus 
x bretschneideri]
Length=453

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LP+C+YPT P LI P S TP H L LSNLDDQ FLRFSIKYLYLF+ SV+++ LK +L++
Sbjct  8    LPNCYYPTQPILIRPNSPTPKHCLHLSNLDDQKFLRFSIKYLYLFKKSVSLETLKHALSK  67

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV YYPLAGRL    D  +KL VDCN  GAVFAEAFMD+T  +F++LS KPNRSWRKLL
Sbjct  68   VLVGYYPLAGRLRTSADHDQKLDVDCNGEGAVFAEAFMDITTQDFLELSSKPNRSWRKLL  127

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            Y+VEA +FL IPPLV+QV++
Sbjct  128  YRVEALSFLDIPPLVIQVTN  147



>ref|XP_006341971.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Solanum tuberosum]
Length=459

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC Y   P  I P S TP+H+L LSNLDDQ FLRFSIKYLYLF  S+ +++LK SL+R
Sbjct  7    LPDCVYSKEPIFISPISPTPNHTLYLSNLDDQMFLRFSIKYLYLFTKSINLEKLKYSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL  CP+++ KLQVDCN  GA+FAEAF+DL+ADE + +S KP++SWRKLL
Sbjct  67   VLVDYYPLAGRLLKCPENNHKLQVDCNGKGAIFAEAFLDLSADELLVVSNKPDKSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            YK E  +FL IPPLVVQV++
Sbjct  127  YKDETQSFLDIPPLVVQVTN  146



>ref|XP_008377198.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Malus 
domestica]
Length=453

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC+YP  P LI P S TP H + LSNLDDQ FLRFSIKYLYLF+ SV ++ LK +L+ 
Sbjct  8    LPDCYYPNQPILIHPNSPTPKHCIHLSNLDDQKFLRFSIKYLYLFKKSVNLETLKHALSN  67

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV YYPLAGRL    D  +KL+VDCN  GAVFAEAFMD+TA +F++LS KPNRSWRKLL
Sbjct  68   VLVGYYPLAGRLRSNADHDQKLEVDCNGEGAVFAEAFMDITAQDFLKLSSKPNRSWRKLL  127

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            Y+VEA +FL IPPLV+QV++
Sbjct  128  YRVEALSFLDIPPLVIQVTN  147



>gb|KDO84650.1| hypothetical protein CISIN_1g036687mg, partial [Citrus sinensis]
Length=432

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = +3

Query  27   QILPDC-FYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCS  203
            Q LPDC ++P  P LI P++ TP+HSL LSNLDDQ FLRFSIKYLYL++ S+++D LK S
Sbjct  9    QELPDCCYHPNQPILISPSTPTPNHSLYLSNLDDQKFLRFSIKYLYLYKKSISLDFLKYS  68

Query  204  LARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWR  383
            L++ LV+YYPLAGRL    +D  KLQVDCN  GAVFA AFMD+++++F+QLS KPNRSWR
Sbjct  69   LSKVLVEYYPLAGRLRTSSEDDFKLQVDCNGEGAVFAAAFMDISSEDFLQLSRKPNRSWR  128

Query  384  KLLYKVEAPTFLHIPPLVVQVSS  452
            KLLY+VEA +FL +PPLVVQV++
Sbjct  129  KLLYRVEAHSFLQVPPLVVQVTN  151



>ref|XP_006435052.1| hypothetical protein CICLE_v10003709mg [Citrus clementina]
 gb|ESR48292.1| hypothetical protein CICLE_v10003709mg [Citrus clementina]
Length=451

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = +3

Query  27   QILPDC-FYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCS  203
            Q LPDC ++P  P LI P++ TP+HSL LSNLDDQ FLRFSIKYLYL++ S+++D LK S
Sbjct  9    QELPDCCYHPNQPILISPSTPTPNHSLYLSNLDDQKFLRFSIKYLYLYKKSISLDFLKYS  68

Query  204  LARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWR  383
            L++ LV+YYPLAGRL    +D  KLQVDCN  GAVFA AFMD+++++F+QLS KPNRSWR
Sbjct  69   LSKVLVEYYPLAGRLRTSSEDDFKLQVDCNGEGAVFAAAFMDISSEDFLQLSRKPNRSWR  128

Query  384  KLLYKVEAPTFLHIPPLVVQVSS  452
            KLLY+VEA +FL +PPLVVQV++
Sbjct  129  KLLYRVEAHSFLQVPPLVVQVTN  151



>ref|XP_006473895.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Citrus sinensis]
Length=451

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = +3

Query  27   QILPDC-FYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCS  203
            Q LPDC ++P  P LI P++ TP+HSL LSNLDDQ FLRFSIKYLYL++ S+++D LK S
Sbjct  9    QELPDCCYHPNQPILISPSTPTPNHSLYLSNLDDQKFLRFSIKYLYLYKKSISLDFLKYS  68

Query  204  LARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWR  383
            L++ LV+YYPLAGRL    +D  KLQVDCN  GAVFA AFMD+++++F+QLS KPNRSWR
Sbjct  69   LSKVLVEYYPLAGRLRTSSEDDFKLQVDCNGEGAVFAAAFMDISSEDFLQLSRKPNRSWR  128

Query  384  KLLYKVEAPTFLHIPPLVVQVSS  452
            KLLY+VEA +FL +PPLVVQV++
Sbjct  129  KLLYRVEAHSFLQVPPLVVQVTN  151



>ref|XP_009413689.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Musa acuminata subsp. malaccensis]
Length=453

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            +PDC YP  P L+ P+S  P H+L LSNLDDQ FLRFSIKYLY+++ SV V+ L  SL++
Sbjct  12   IPDCCYPKEPVLVRPSSSKPRHTLYLSNLDDQKFLRFSIKYLYVYKRSVGVEALTTSLSK  71

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV+Y+PLAGRL P  +D  K QVDCN  GA+ AEA++DLTA+EF+Q  G+PNRSWRKLL
Sbjct  72   VLVEYHPLAGRLRPVGEDGEKCQVDCNGEGALLAEAYVDLTAEEFLQGCGRPNRSWRKLL  131

Query  393  YKVEAPTFLHIPPLVVQVS  449
            Y+VEA +FL +PPLVVQV+
Sbjct  132  YRVEAQSFLDVPPLVVQVT  150



>ref|XP_008784949.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Phoenix 
dactylifera]
Length=450

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 115/156 (74%), Gaps = 0/156 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            +PDC YPT PTL+ P+S TP H+L LSNLDDQ FLRFSIKYLYL++ SV V+ LK SL++
Sbjct  7    IPDCRYPTEPTLVKPSSTTPRHTLYLSNLDDQKFLRFSIKYLYLYKRSVEVEVLKESLSK  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV+YYPLAGRL    +D  KL+VDCN  GA+FAE ++DL+  EF++ S KPNRSWRKLL
Sbjct  67   VLVEYYPLAGRLRISEEDGEKLEVDCNGEGALFAEGYVDLSVAEFLEGSRKPNRSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCV  500
            Y+VEA +F+ +PPLVVQ +         +T    C+
Sbjct  127  YRVEAQSFVSVPPLVVQATHLSCGGLILTTSINHCL  162



>gb|KEH36187.1| omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
Length=459

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 110/144 (76%), Gaps = 4/144 (3%)
 Frame = +3

Query  33   LPDCFYPTTP-TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLA  209
            LPDC YP  P T IPP+  TP HSL LSNLDDQ FLRFSIKYLY+F+ SV +D LKCSL+
Sbjct  7    LPDCIYPCQPITSIPPSIPTPKHSLYLSNLDDQKFLRFSIKYLYIFKKSVNLDHLKCSLS  66

Query  210  RALVDYYPLAGRLTPCP---DDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSW  380
            R LVDYYPLAGRL  C    DD +KL+VDCN  GA+F EAFM +TA E ++ S  PN+SW
Sbjct  67   RVLVDYYPLAGRLRSCSSNLDDEKKLEVDCNGEGALFVEAFMSITAQELLEPSKLPNKSW  126

Query  381  RKLLYKVEAPTFLHIPPLVVQVSS  452
            RK  YKVE+ +FL +PPL+VQ+++
Sbjct  127  RKFTYKVESQSFLDVPPLIVQLTN  150



>gb|KHN22233.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=448

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            +PDC Y   P +IPP++ TP HSL LSNLDDQ FLRFSIKYLYLF+ S++++ LK SLAR
Sbjct  3    VPDCIYRGQPVIIPPSAPTPKHSLYLSNLDDQKFLRFSIKYLYLFKKSLSLNILKSSLAR  62

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    D   KL+VDCN  GAVFAEAFMD T  E ++ S  PN+SW+K L
Sbjct  63   VLVDYYPLAGRLRSVDDHTHKLEVDCNGEGAVFAEAFMDTTVHELLESSKTPNKSWKKFL  122

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            Y++EA +F+ +PPL++QV++
Sbjct  123  YRIEAQSFIDVPPLIIQVTT  142



>ref|XP_006415746.1| hypothetical protein EUTSA_v10007633mg [Eutrema salsugineum]
 gb|ESQ34099.1| hypothetical protein EUTSA_v10007633mg [Eutrema salsugineum]
Length=445

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 114/143 (80%), Gaps = 2/143 (1%)
 Frame = +3

Query  24   LQILPDCFYPT-TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            +Q LPDC Y    PTLI P S TP+H L LSNLDD +FLRFSIKYLYLF+ S++   LK 
Sbjct  1    MQELPDCLYEGKQPTLITPKSPTPNHFLYLSNLDDHHFLRFSIKYLYLFQKSISSSTLKD  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSW  380
            SL+R LVDYYPLAGR+ P  +D  KL+VDCN  GAVFAEAFMD+T+ EF+QLS +PN+SW
Sbjct  61   SLSRVLVDYYPLAGRIKPF-NDRTKLEVDCNGEGAVFAEAFMDITSQEFLQLSPRPNKSW  119

Query  381  RKLLYKVEAPTFLHIPPLVVQVS  449
            RKLL+KV+A +FL +PPLV+QV+
Sbjct  120  RKLLFKVQASSFLDVPPLVIQVT  142



>ref|XP_003527683.2| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Glycine max]
Length=452

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            +PDC Y   P +IPP++ TP HSL LSNLDDQ FLRFSIKYLYLF+ S++++ LK SLAR
Sbjct  7    VPDCIYRGQPLIIPPSAPTPKHSLYLSNLDDQKFLRFSIKYLYLFKKSLSLNILKSSLAR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    D   KL+VDCN  GAVFAEAFMD T  E ++ S  PN+SW+K L
Sbjct  67   VLVDYYPLAGRLRSVDDHTHKLEVDCNGEGAVFAEAFMDTTVHELLESSKTPNKSWKKFL  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            Y++EA +F+ +PPL++QV++
Sbjct  127  YRIEAQSFIDVPPLIIQVTT  146



>ref|XP_004500986.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
 ref|XP_004500988.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cicer arietinum]
Length=450

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 113/143 (79%), Gaps = 4/143 (3%)
 Frame = +3

Query  33   LPDCFYPTTP-TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLA  209
            LPDC YP  P T I P++ TP HSL LSNLDDQ FLRFSIKYLY+F+ SV+++RLK SL+
Sbjct  7    LPDCIYPCHPVTNIAPSAPTPKHSLYLSNLDDQKFLRFSIKYLYIFKKSVSLNRLKSSLS  66

Query  210  RALVDYYPLAGRL--TPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWR  383
            R LVDYYPLAGRL  +   DDH KL+VDCN  GAVF EAFMD+TA+  I+ S  PN+SWR
Sbjct  67   RVLVDYYPLAGRLRRSFSLDDH-KLEVDCNGEGAVFVEAFMDITAEALIEPSKLPNKSWR  125

Query  384  KLLYKVEAPTFLHIPPLVVQVSS  452
            K LYKVEA +FL +PPL+VQ+++
Sbjct  126  KFLYKVEAQSFLDVPPLIVQITT  148



>ref|XP_002890739.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66998.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=442

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = +3

Query  24   LQILPDCFYP-TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            ++ LPDC Y    PTLI P+S TP+HSL LSNLDD +FLRFSIKYLYLF  S++   LK 
Sbjct  1    MEELPDCLYEGNQPTLITPSSPTPNHSLYLSNLDDHHFLRFSIKYLYLFENSISPLTLKD  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSW  380
            SL+R LVDYYP AGR+    D+  KL+VDCN  GAVFAEAFMD+T  EF+QLS KPN+SW
Sbjct  61   SLSRVLVDYYPFAGRIR-VSDEGSKLEVDCNGEGAVFAEAFMDITCQEFVQLSPKPNKSW  119

Query  381  RKLLYKVEAPTFLHIPPLVVQVS  449
            RKLL+KV+A +FL IPPL++QV+
Sbjct  120  RKLLFKVQAQSFLDIPPLIIQVT  142



>emb|CDY11777.1| BnaC03g58010D [Brassica napus]
Length=441

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = +3

Query  24   LQILPDCFYP-TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            +Q LPDC Y    PTLI P+S TP+HSL LSNLDD +FLRFSIKYLYLF+ S +   LK 
Sbjct  1    MQELPDCLYEGNQPTLITPSSPTPNHSLYLSNLDDHHFLRFSIKYLYLFQKSPSSQTLKD  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSW  380
            SL+R LVDYYPLAGR+    D   KL+VDCN  GAVFAEAFMD+T  EF++ S KPN+SW
Sbjct  61   SLSRVLVDYYPLAGRIK-LSDVSAKLEVDCNGEGAVFAEAFMDITCQEFLEHSPKPNKSW  119

Query  381  RKLLYKVEAPTFLHIPPLVVQVS  449
            RKLL+KV+AP+FL IPPLV+QV+
Sbjct  120  RKLLFKVQAPSFLEIPPLVIQVT  142



>ref|NP_174083.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AAD45999.1|AC005916_11 Similar to gb|Z84571 anthranilate N-hydroxycinnamoyl/benzoyltransferase 
from Dianthus caryophyllus [Arabidopsis thaliana]
 gb|AAF24940.1|AC012375_3 T22C5.6 [Arabidopsis thaliana]
 gb|AAT71925.1| At1g27620 [Arabidopsis thaliana]
 gb|AAU94422.1| At1g27620 [Arabidopsis thaliana]
 gb|AEE30855.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=442

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = +3

Query  24   LQILPDCFYPTT-PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            +Q LPDC Y    PTLI P S TP+HSL LSNLDD +FLRFSIKYLYLF+ S++   LK 
Sbjct  1    MQELPDCLYEENQPTLITPLSPTPNHSLYLSNLDDHHFLRFSIKYLYLFQKSISPLTLKD  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSW  380
            SL+R LVDYYP AGR+    D+  KL+VDCN  GAVFAEAFMD+T  +F+QLS KPN+SW
Sbjct  61   SLSRVLVDYYPFAGRIR-VSDEGSKLEVDCNGEGAVFAEAFMDITCQDFVQLSPKPNKSW  119

Query  381  RKLLYKVEAPTFLHIPPLVVQVS  449
            RKLL+KV+A +FL IPPLV+QV+
Sbjct  120  RKLLFKVQAQSFLDIPPLVIQVT  142



>ref|XP_010936667.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Elaeis guineensis]
Length=456

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 113/156 (72%), Gaps = 0/156 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            +PDC+YP  PTL+ P+S TP H L LSNLDDQ FLRFSIKYLYL++ SV V+ LK SL++
Sbjct  12   IPDCYYPREPTLVRPSSSTPRHRLYLSNLDDQKFLRFSIKYLYLYKRSVEVEVLKVSLSK  71

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV+YYP AGRL     D  KL+VDCN  GA+FAE ++DL+  EF++ S +PN+SW+KLL
Sbjct  72   VLVEYYPFAGRLKISEQDGEKLEVDCNGEGALFAEGYVDLSVAEFLEGSRRPNKSWKKLL  131

Query  393  YKVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCV  500
            ++VE+ +F+ +PPLVVQV+         ST    C+
Sbjct  132  HRVESQSFVSVPPLVVQVTHLSCGGMILSTSINHCL  167



>ref|XP_009109793.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Brassica 
rapa]
Length=441

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = +3

Query  24   LQILPDCFYP-TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            +Q LPDC Y    P LI P+S TP+HSL LSNLDD +FLRFSIKYLYLF+ S +   LK 
Sbjct  1    MQELPDCLYEGNQPALITPSSPTPNHSLYLSNLDDHHFLRFSIKYLYLFQKSPSSQTLKD  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSW  380
            SL+R LVDYYPLAGR+    D   KL+VDCN  GAVFAEAFMD+T  EF++ S KPN+SW
Sbjct  61   SLSRVLVDYYPLAGRIK-VSDVSAKLEVDCNGEGAVFAEAFMDITCQEFLEHSPKPNKSW  119

Query  381  RKLLYKVEAPTFLHIPPLVVQVS  449
            RKLL+KV+AP+FL IPPLV+QV+
Sbjct  120  RKLLFKVQAPSFLEIPPLVIQVT  142



>emb|CDX90098.1| BnaA08g18860D [Brassica napus]
Length=441

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = +3

Query  24   LQILPDCFYP-TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            +Q LPDC Y    P LI P+S TP+HSL LSNLDD +FLRFSIKYLYLF+ S +   LK 
Sbjct  1    MQELPDCLYEGNQPALITPSSPTPNHSLYLSNLDDHHFLRFSIKYLYLFQKSPSSQTLKD  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSW  380
            SL+R LVDYYPLAGR+    D   KL+VDCN  GAVFAEAFMD+T  EF++ S KPN+SW
Sbjct  61   SLSRVLVDYYPLAGRIK-VSDVSAKLEVDCNGEGAVFAEAFMDITCQEFLEHSPKPNKSW  119

Query  381  RKLLYKVEAPTFLHIPPLVVQVS  449
            RKLL+KV+AP+FL IPPLV+QV+
Sbjct  120  RKLLFKVQAPSFLEIPPLVIQVT  142



>ref|XP_011083891.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Sesamum 
indicum]
Length=483

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 115/160 (72%), Gaps = 7/160 (4%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC Y   PTL+ P + TP H+L LSNLDDQ FLRFSIKYLY FR SV    LK SL+R
Sbjct  31   LPDCIYEHQPTLVHPITPTPHHTLYLSNLDDQKFLRFSIKYLYAFRKSVDKQALKHSLSR  90

Query  213  ALVDYYPLAGRLTPC--PDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRK  386
             LV YYPLAGRL  C   DDH KL++ CN  GAVFAEA MDL+A++F++L+ KPNRS RK
Sbjct  91   LLVHYYPLAGRLRRCVEGDDH-KLEIHCNGEGAVFAEANMDLSAEQFLELARKPNRSLRK  149

Query  387  LLYKVEAPTFLHIPPLVVQVSS---SPYSLCFTSTKTAFC  497
            LLY+VEAP FL IPPLV+QV+S       LC T+    FC
Sbjct  150  LLYRVEAPGFLDIPPLVIQVTSLRCGGMILC-TAINHCFC  188



>gb|KCW67886.1| hypothetical protein EUGRSUZ_F01597 [Eucalyptus grandis]
Length=480

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 110/151 (73%), Gaps = 9/151 (6%)
 Frame = +3

Query  27   QILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSL  206
            Q LPDC     P LI P+  TP H+L LSNLDDQ FLRFSIKYLYLFR SV  + LK SL
Sbjct  5    QELPDCHLLKPPILITPSGPTPHHALSLSNLDDQKFLRFSIKYLYLFRKSVPPESLKASL  64

Query  207  ARALVDYYPLAGRLTPCP---------DDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLS  359
            A+ALVDYYPLAGRL             D  ++L+VDCN  GAVFAEA MD+T +EF++LS
Sbjct  65   AKALVDYYPLAGRLRSAGNTDGGGGGGDVDQRLEVDCNGEGAVFAEASMDITGEEFLELS  124

Query  360  GKPNRSWRKLLYKVEAPTFLHIPPLVVQVSS  452
              PNRSWRKLLYKVEA +FL +PPL+VQV++
Sbjct  125  WWPNRSWRKLLYKVEAHSFLGVPPLIVQVTN  155



>ref|XP_009380388.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Musa acuminata subsp. malaccensis]
Length=450

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            +PDC+YP  P+L+ P+S TP H+L LSNLDDQ FLRFSIKYLY ++ +V  + L+ SL++
Sbjct  7    IPDCYYPKEPSLVCPSSSTPRHTLYLSNLDDQKFLRFSIKYLYAYKKAVGWEALRTSLSK  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGR+    +D  KL+VDCN  GA+ AE ++DLT ++F++ S +PNRSWRKLL
Sbjct  67   VLVDYYPLAGRVRTSAEDGEKLEVDCNGEGALLAEGYVDLTVEKFLEGSRRPNRSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVS  449
            YKVEA +F+ +PPL+VQ++
Sbjct  127  YKVEAQSFVAVPPLIVQMT  145



>ref|XP_010060982.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Eucalyptus 
grandis]
Length=538

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 110/151 (73%), Gaps = 9/151 (6%)
 Frame = +3

Query  27   QILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSL  206
            Q LPDC     P LI P+  TP H+L LSNLDDQ FLRFSIKYLYLFR SV  + LK SL
Sbjct  63   QELPDCHLLKPPILITPSGPTPHHALSLSNLDDQKFLRFSIKYLYLFRKSVPPESLKASL  122

Query  207  ARALVDYYPLAGRLTPCP---------DDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLS  359
            A+ALVDYYPLAGRL             D  ++L+VDCN  GAVFAEA MD+T +EF++LS
Sbjct  123  AKALVDYYPLAGRLRSAGNTDGGGGGGDVDQRLEVDCNGEGAVFAEASMDITGEEFLELS  182

Query  360  GKPNRSWRKLLYKVEAPTFLHIPPLVVQVSS  452
              PNRSWRKLLYKVEA +FL +PPL+VQV++
Sbjct  183  WWPNRSWRKLLYKVEAHSFLGVPPLIVQVTN  213



>ref|XP_006847545.1| hypothetical protein AMTR_s00014p00154350 [Amborella trichopoda]
 gb|ERN09126.1| hypothetical protein AMTR_s00014p00154350 [Amborella trichopoda]
Length=475

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 104/139 (75%), Gaps = 0/139 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            +PDC  P  PTLIPP S TP+HSL LSNLDDQ FLRFSIKYL L+R S  V  LK SL+ 
Sbjct  7    IPDCVLPNKPTLIPPLSPTPNHSLYLSNLDDQKFLRFSIKYLLLYRKSPDVGSLKRSLSV  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
            ALV YYPLAGRL   P +  KL+VDCN  GA+FAEA +DLT +EF  +  KPN+SWRKLL
Sbjct  67   ALVGYYPLAGRLRVSPVNEEKLEVDCNGEGALFAEAVLDLTVEEFKGICEKPNKSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVS  449
            Y+ E  +FL IPPLVVQV+
Sbjct  127  YRTEGQSFLSIPPLVVQVT  145



>ref|XP_010254732.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=455

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC+Y   P LI P S TP HSL LSNLDDQ FLRFSIKY+Y+++ +V+ + LK SL+R
Sbjct  7    LPDCYYQNKPILICPESPTPKHSLYLSNLDDQKFLRFSIKYVYVYKKAVSSESLKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    ++  KL++DCN  GA+FAEAFMD T +EF++ S +PNRSWRKLL
Sbjct  67   VLVDYYPLAGRLRLSSENQDKLEIDCNGEGALFAEAFMDFTVEEFLEASRRPNRSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
            Y+V+A +FL IPPLV+QV+S
Sbjct  127  YRVDAQSFLDIPPLVIQVTS  146



>emb|CDX84920.1| BnaC05g21350D [Brassica napus]
Length=172

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 114/168 (68%), Gaps = 9/168 (5%)
 Frame = +3

Query  24   LQILPDCFYP-TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            +Q LPDC Y    PTLI P+S TP+H+L LSNLDD +FLRFSIKYLYLF+ S +   LK 
Sbjct  1    MQELPDCLYEGKQPTLITPSSPTPNHTLYLSNLDDHHFLRFSIKYLYLFQKSPSSLTLKD  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSW  380
            SL+R LVDYYP AGR+     D  KL+VDCN  GAVFAEA MD+T  EF+++S KP  SW
Sbjct  61   SLSRVLVDYYPFAGRIK-VSADKTKLEVDCNGEGAVFAEASMDITRQEFLEISRKPKSSW  119

Query  381  RKLLYKVEAPTFLHIPPLVVQVSSSPYSLCFT-------STKTAFCVY  503
             KLL+KV+A  FL IPPL++QV   P+   F        S  T+FC +
Sbjct  120  TKLLFKVKATGFLDIPPLIIQVPFPPFISVFQFPIYYLRSITTSFCTH  167



>ref|XP_010478102.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Camelina sativa]
Length=442

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = +3

Query  24   LQILPDCFYP-TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            +Q LPDC Y    P+LI P+S TP+ +L LSNLDD +FLRFSIKYLYLF+ S+    LK 
Sbjct  1    MQELPDCLYEGEQPSLITPSSPTPNQTLYLSNLDDHHFLRFSIKYLYLFQKSIPSLTLKN  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFI-QLSGKPNRS  377
            SLAR LVDYYP AGR+    +D RKL+VDCN  GAVFAEAFMD+T  EF+ Q S KPN+S
Sbjct  61   SLARVLVDYYPFAGRIR-VSEDGRKLEVDCNGEGAVFAEAFMDITCQEFLDQHSPKPNKS  119

Query  378  WRKLLYKVEAPTFLHIPPLVVQVS  449
            WRKLL+KV+A  FL IPPLV+QV+
Sbjct  120  WRKLLFKVQAQGFLDIPPLVIQVT  143



>ref|XP_007136640.1| hypothetical protein PHAVU_009G061200g [Phaseolus vulgaris]
 gb|ESW08634.1| hypothetical protein PHAVU_009G061200g [Phaseolus vulgaris]
Length=435

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 105/155 (68%), Gaps = 2/155 (1%)
 Frame = +3

Query  36   PDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLARA  215
            PDC Y      IPPT+ TP HSL LSNLDDQNFLRFSIKYL+LF  S + D LK SL R 
Sbjct  4    PDCIYRGQAVSIPPTAPTPKHSLYLSNLDDQNFLRFSIKYLFLFNKSFSFDVLKSSLGRV  63

Query  216  LVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLY  395
            LVDYYPLAGRL  C DDH KL+VDCN  GA+FAEAF   T  + ++ S  PN+SW+K LY
Sbjct  64   LVDYYPLAGRLR-CVDDH-KLEVDCNGQGALFAEAFTHTTVHQLLESSKTPNKSWKKFLY  121

Query  396  KVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCV  500
            K+EA TF+ +PPL+VQV+          T    CV
Sbjct  122  KLEAHTFIDVPPLIVQVTRLGCGGMILCTAINHCV  156



>ref|XP_010499244.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Camelina sativa]
Length=442

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = +3

Query  24   LQILPDCFYP-TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            +Q LPDC Y    P+LI P+S TP+ +L LSNLDD +FLRFSIKYLYLF+ S+    LK 
Sbjct  1    MQELPDCLYEGEQPSLITPSSPTPNQTLYLSNLDDHHFLRFSIKYLYLFQKSIPSLTLKD  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFI-QLSGKPNRS  377
            SLAR LVDYYP AGR+    DD RKL+VDCN  GAVFAEAFMD+T  EF+ Q S KPN+S
Sbjct  61   SLARVLVDYYPFAGRIR-VSDDGRKLEVDCNGEGAVFAEAFMDITCQEFLDQHSPKPNKS  119

Query  378  WRKLLYKVEAPTFLHIPPLVVQVS  449
            WRKLL+KV+A  FL IPPLV+QV+
Sbjct  120  WRKLLFKVQAQGFLDIPPLVLQVT  143



>ref|XP_010460517.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Camelina 
sativa]
Length=442

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = +3

Query  24   LQILPDCFYP-TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            +Q LPDC Y    P+LI P+S TP+ +L LSNLDD +FLRFSIKYLYLF+ S+    LK 
Sbjct  1    MQELPDCLYEGEQPSLITPSSPTPNQTLYLSNLDDHHFLRFSIKYLYLFQKSIPSLTLKD  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFI-QLSGKPNRS  377
            SLAR LVDYYP AGR+    DD RKL+VDCN  GAVFAEAFMD+   EF+ Q S KPN+S
Sbjct  61   SLARVLVDYYPFAGRIR-ASDDGRKLEVDCNGEGAVFAEAFMDIACQEFLDQHSPKPNKS  119

Query  378  WRKLLYKVEAPTFLHIPPLVVQVS  449
            WRKLL+KV+A  FL IPPLV+QV+
Sbjct  120  WRKLLFKVQAQGFLDIPPLVIQVT  143



>ref|XP_010552486.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
Length=446

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 112/147 (76%), Gaps = 5/147 (3%)
 Frame = +3

Query  24   LQILPDCFYP-TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            +Q LPDC Y    P +I P S TP+H L LSNLDD +FLRFSIKYLY+F+  +  + L+ 
Sbjct  1    MQELPDCVYERDEPNIITPKSPTPNHCLYLSNLDDHHFLRFSIKYLYVFQKPIDCEILRD  60

Query  201  SLARALVDYYPLAGRL---TPCPD-DHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKP  368
            SL+R LVDYYPLAGR+    P  D +  KL++DCN  GAVFAEAFMD+T+++F+QLS KP
Sbjct  61   SLSRVLVDYYPLAGRIRAVKPSGDRNQNKLEIDCNGQGAVFAEAFMDITSNDFLQLSRKP  120

Query  369  NRSWRKLLYKVEAPTFLHIPPLVVQVS  449
            NRSWRKLL+K +A +FL IPPLV+QV+
Sbjct  121  NRSWRKLLFKAQASSFLDIPPLVIQVT  147



>gb|KHN20954.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=448

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 112/146 (77%), Gaps = 7/146 (5%)
 Frame = +3

Query  33   LPDCFYPTTP-TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLA  209
            LPDC YP  P T+IPP + TP HSL LSNLDDQ FLRFSIKY+YLF+ SV++D LK SL+
Sbjct  7    LPDCVYPRPPFTIIPPCAPTPKHSLYLSNLDDQKFLRFSIKYVYLFKKSVSLDLLKSSLS  66

Query  210  RALVDYYPLAGRLT-----PCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNR  374
            R LVDYYPLAGRL       C DDH KL+VDC   GAVFAEAFMD TA+E ++    PN 
Sbjct  67   RVLVDYYPLAGRLIRSSICDCEDDH-KLEVDCKGEGAVFAEAFMDATAEELLESCKVPND  125

Query  375  SWRKLLYKVEAPTFLHIPPLVVQVSS  452
            SWRKLLYKVEA +FL +PPLV+QV+S
Sbjct  126  SWRKLLYKVEAQSFLDVPPLVIQVTS  151



>ref|XP_010275579.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Nelumbo nucifera]
Length=462

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC+Y   PT + P S TP HSL LSNLDDQ FLRFSIKY+Y ++ SV+ + LK SL+R
Sbjct  7    LPDCYYQNKPTFVCPESPTPRHSLYLSNLDDQKFLRFSIKYVYAYKKSVSSESLKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    +D  K ++DCN  GAVFAEAFMD T DEF++ S  PNRSWRKLL
Sbjct  67   VLVDYYPLAGRLRISTEDQDKFEIDCNGEGAVFAEAFMDFTVDEFLEASRAPNRSWRKLL  126

Query  393  YKVEAPTFLHIPPLVVQVS  449
            Y+V+  +FL IPPLV+QV+
Sbjct  127  YRVDGQSFLDIPPLVIQVT  145



>emb|CDY27624.1| BnaA09g27830D [Brassica napus]
Length=440

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = +3

Query  24   LQILPDCFYPT-TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            +Q LPDC Y    PTLI P+S TP+H+L LSNLDD +FLRFSIKYLYLF+ S +   LK 
Sbjct  1    MQELPDCLYEGKQPTLITPSSPTPNHTLYLSNLDDHHFLRFSIKYLYLFQKSPSSLALKD  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSW  380
            SL+R LVDYYP AGR+     D  KL+VDCN  GAVFAEA MD+T  EF+++S KP  SW
Sbjct  61   SLSRVLVDYYPFAGRIK-VSADKTKLEVDCNGEGAVFAEASMDITRQEFLEISRKPKSSW  119

Query  381  RKLLYKVEAPTFLHIPPLVVQVS  449
            RKLL+KV+A  FL IPPL++QV+
Sbjct  120  RKLLFKVQATGFLDIPPLIIQVT  142



>ref|XP_006595924.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Glycine max]
 ref|XP_003545268.2| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Glycine max]
Length=448

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 112/146 (77%), Gaps = 7/146 (5%)
 Frame = +3

Query  33   LPDCFYPTTP-TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLA  209
            LPDC YP  P T+IPP + TP HSL LSNLDDQ FLRFSIKY+YLF+ SV++D LK SL+
Sbjct  7    LPDCVYPRPPFTIIPPCAPTPKHSLYLSNLDDQKFLRFSIKYVYLFKKSVSLDLLKSSLS  66

Query  210  RALVDYYPLAGRLT-----PCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNR  374
            R LVDYYPLAGRL       C DDH KL+VDC   GAVFAEAFMD TA+E ++    PN 
Sbjct  67   RVLVDYYPLAGRLIRSSICDCEDDH-KLEVDCKGEGAVFAEAFMDATAEELLESCKVPND  125

Query  375  SWRKLLYKVEAPTFLHIPPLVVQVSS  452
            SWRKLLYKVEA +FL +PPLV+QV++
Sbjct  126  SWRKLLYKVEAQSFLDVPPLVIQVTN  151



>ref|XP_009113746.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Brassica rapa]
Length=437

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 107/143 (75%), Gaps = 2/143 (1%)
 Frame = +3

Query  24   LQILPDCFYPT-TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            +Q LPDC Y    PTLI P+S TP+H+L LSNLDD +FLRFSIKYLYLF+ S +   LK 
Sbjct  1    MQELPDCLYEGKQPTLITPSSPTPNHTLYLSNLDDHHFLRFSIKYLYLFQKSPSSLTLKD  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSW  380
            SL+R LVDYYP AGR+     D  KL+VDCN  GAVFAEA MD+T  EF+++S KP  SW
Sbjct  61   SLSRVLVDYYPFAGRI-KVSADKTKLEVDCNGEGAVFAEASMDITRQEFLEISRKPKTSW  119

Query  381  RKLLYKVEAPTFLHIPPLVVQVS  449
            RKLL+KV+A  FL IPPL++QV+
Sbjct  120  RKLLFKVQATGFLDIPPLIIQVT  142



>ref|XP_006304467.1| hypothetical protein CARUB_v10011142mg [Capsella rubella]
 gb|EOA37365.1| hypothetical protein CARUB_v10011142mg [Capsella rubella]
Length=442

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 111/144 (77%), Gaps = 3/144 (2%)
 Frame = +3

Query  24   LQILPDCFYP-TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            +Q LP+C Y    P+LI P+S TP+ +L LSNLDD +FLRFSIKYLYLF+ S+    LK 
Sbjct  1    MQELPNCLYEGEQPSLITPSSPTPNQTLYLSNLDDHHFLRFSIKYLYLFQKSIPSLTLKE  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFI-QLSGKPNRS  377
            SL+R LVDYYPLAGR+    ++  KL+VDCN  GAVFAEAFMD+T  EF+ Q S KPN+S
Sbjct  61   SLSRVLVDYYPLAGRIR-VSNEGNKLEVDCNGEGAVFAEAFMDITCQEFLDQHSPKPNKS  119

Query  378  WRKLLYKVEAPTFLHIPPLVVQVS  449
            WRKLL++V+A +FL IPPLV+QV+
Sbjct  120  WRKLLFRVQAQSFLDIPPLVIQVT  143



>tpg|DAA53857.1| TPA: hypothetical protein ZEAMMB73_145326 [Zea mays]
Length=167

 Score =   161 bits (407),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 102/146 (70%), Gaps = 3/146 (2%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAV--DRLK  197
            L+I  +C Y   P L+ P+  TP H+L LSNLDDQ FLRFSIKYLY+F    AV  D L+
Sbjct  9    LEIPGECQYAGDPVLVRPSQPTPRHTLHLSNLDDQRFLRFSIKYLYVFGADAAVPADALR  68

Query  198  CSLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQLSGKPNR  374
             +L R L DYYPLAGRL P  ++  KL VDCNA GA+FAE  +  L A +F+  S +P++
Sbjct  69   AALGRVLADYYPLAGRLRPSAEEDGKLVVDCNAEGALFAEGRLPGLAAADFLSGSDRPHK  128

Query  375  SWRKLLYKVEAPTFLHIPPLVVQVSS  452
            SWRKL Y+VEA +F+ +PPLVVQVS 
Sbjct  129  SWRKLHYRVEAQSFVAVPPLVVQVSE  154



>ref|XP_010673005.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Beta 
vulgaris subsp. vulgaris]
Length=469

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 107/151 (71%), Gaps = 11/151 (7%)
 Frame = +3

Query  33   LPDC-FYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLA  209
            +PDC +Y   P LI P   TP HSL LSNLDDQ FLRFSIKYL+L+  SV V+ LK SL+
Sbjct  11   IPDCCYYSNNPLLITPNLPTPKHSLYLSNLDDQKFLRFSIKYLFLYEKSVCVESLKISLS  70

Query  210  RALVDYYPLAGRL----------TPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLS  359
            + L +YYPLAGRL              +DH+KL VDCN  GA FAEAF+D T  EF++ S
Sbjct  71   KLLTEYYPLAGRLRAQDVVNNHENNNNNDHQKLVVDCNGEGAFFAEAFLDYTVAEFLEFS  130

Query  360  GKPNRSWRKLLYKVEAPTFLHIPPLVVQVSS  452
            GKPN+SWRKLLY V+A TFL +PPLVVQV++
Sbjct  131  GKPNKSWRKLLYTVDALTFLDVPPLVVQVTN  161



>ref|XP_004967933.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Setaria italica]
Length=481

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 105/145 (72%), Gaps = 3/145 (2%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAV--DRLK  197
            L+I  +C Y   P ++ P   TP H+L LSNLDDQ FLRFSIKYLY+F    AV  D L+
Sbjct  12   LEIPGECQYSGEPAVVRPCQPTPRHTLYLSNLDDQRFLRFSIKYLYVFAAPAAVPTDALR  71

Query  198  CSLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQLSGKPNR  374
             +LAR LVDYYPLAGRL P  DD  KL VDCNA GA+FAE  +  LTA EF++   +P++
Sbjct  72   AALARVLVDYYPLAGRLRPSDDDEGKLVVDCNAEGALFAEGCLPGLTAAEFLRRRARPHK  131

Query  375  SWRKLLYKVEAPTFLHIPPLVVQVS  449
            SWRKLLY+VEA +F+ +PPLVVQV+
Sbjct  132  SWRKLLYRVEAQSFVAVPPLVVQVT  156



>tpg|DAA53855.1| TPA: hypothetical protein ZEAMMB73_145326 [Zea mays]
Length=182

 Score =   159 bits (401),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 102/145 (70%), Gaps = 3/145 (2%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAV--DRLK  197
            L+I  +C Y   P L+ P+  TP H+L LSNLDDQ FLRFSIKYLY+F    AV  D L+
Sbjct  9    LEIPGECQYAGDPVLVRPSQPTPRHTLHLSNLDDQRFLRFSIKYLYVFGADAAVPADALR  68

Query  198  CSLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQLSGKPNR  374
             +L R L DYYPLAGRL P  ++  KL VDCNA GA+FAE  +  L A +F+  S +P++
Sbjct  69   AALGRVLADYYPLAGRLRPSAEEDGKLVVDCNAEGALFAEGRLPGLAAADFLSGSDRPHK  128

Query  375  SWRKLLYKVEAPTFLHIPPLVVQVS  449
            SWRKL Y+VEA +F+ +PPLVVQV+
Sbjct  129  SWRKLHYRVEAQSFVAVPPLVVQVT  153



>ref|XP_008444746.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Cucumis 
melo]
Length=481

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 104/147 (71%), Gaps = 7/147 (5%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC Y + P +I P + TP HSL LSNLDDQ+FLRF+IKY++LF   V++  LK SLA 
Sbjct  7    LPDCRYLSPPVVIRPANPTPKHSLYLSNLDDQSFLRFAIKYVFLFEKGVSLCNLKRSLAI  66

Query  213  ALVDYYPLAGRLTPCP-------DDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPN  371
             L  YYP AGRL           +  RKL+VDCN  GAVFAE FMDLTA+EF+Q++  PN
Sbjct  67   VLEHYYPFAGRLRVSGGGGSSSLEFDRKLEVDCNGEGAVFAEGFMDLTAEEFLQMADTPN  126

Query  372  RSWRKLLYKVEAPTFLHIPPLVVQVSS  452
            RSWRKLLY+ E   FL IPPLV+QV++
Sbjct  127  RSWRKLLYRFENLGFLDIPPLVIQVTN  153



>ref|XP_004152770.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
Length=480

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 103/147 (70%), Gaps = 7/147 (5%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC Y + P +I P + TP HSL LSNLDDQ+FLRF+IKY++LF   V++  LK SLA 
Sbjct  7    LPDCRYLSPPVVIRPANPTPKHSLYLSNLDDQSFLRFAIKYVFLFEKGVSLCNLKRSLAI  66

Query  213  ALVDYYPLAGRLTPCPDDH-------RKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPN  371
             L  YYP AGRL              RKL+VDCN  GAVFAE FMDLTA+EF+Q++  PN
Sbjct  67   LLEHYYPFAGRLRVSAGGGGSSLEFDRKLEVDCNGEGAVFAEGFMDLTAEEFLQMADTPN  126

Query  372  RSWRKLLYKVEAPTFLHIPPLVVQVSS  452
            RSWRKLLY+ E   FL IPPL++QV++
Sbjct  127  RSWRKLLYRFENLGFLDIPPLLIQVTN  153



>gb|KGN62624.1| hypothetical protein Csa_2G361880 [Cucumis sativus]
Length=484

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 103/147 (70%), Gaps = 7/147 (5%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC Y + P +I P + TP HSL LSNLDDQ+FLRF+IKY++LF   V++  LK SLA 
Sbjct  8    LPDCRYLSPPVVIRPANPTPKHSLYLSNLDDQSFLRFAIKYVFLFEKGVSLCNLKRSLAI  67

Query  213  ALVDYYPLAGRLTPCPDDH-------RKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPN  371
             L  YYP AGRL              RKL+VDCN  GAVFAE FMDLTA+EF+Q++  PN
Sbjct  68   LLEHYYPFAGRLRVSAGGGGSSLEFDRKLEVDCNGEGAVFAEGFMDLTAEEFLQMADTPN  127

Query  372  RSWRKLLYKVEAPTFLHIPPLVVQVSS  452
            RSWRKLLY+ E   FL IPPL++QV++
Sbjct  128  RSWRKLLYRFENLGFLDIPPLLIQVTN  154



>ref|XP_004167735.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like, partial 
[Cucumis sativus]
Length=466

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 103/147 (70%), Gaps = 7/147 (5%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC Y + P +I P + TP HSL LSNLDDQ+FLRF+IKY++LF   V++  LK SLA 
Sbjct  7    LPDCRYLSPPVVIRPANPTPKHSLYLSNLDDQSFLRFAIKYVFLFEKGVSLCNLKRSLAI  66

Query  213  ALVDYYPLAGRLTPCPDDH-------RKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPN  371
             L  YYP AGRL              RKL+VDCN  GAVFAE FMDLTA+EF+Q++  PN
Sbjct  67   LLEHYYPFAGRLRVSAGGGGSSLEFDRKLEVDCNGEGAVFAEGFMDLTAEEFLQMADTPN  126

Query  372  RSWRKLLYKVEAPTFLHIPPLVVQVSS  452
            RSWRKLLY+ E   FL IPPL++QV++
Sbjct  127  RSWRKLLYRFENLGFLDIPPLLIQVTN  153



>gb|EYU32898.1| hypothetical protein MIMGU_mgv1a005949mg [Erythranthe guttata]
Length=463

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 105/158 (66%), Gaps = 2/158 (1%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC Y   P  + P+  TP+H++ LSNLDDQ FLRFSIKYLY+F  SVA + LK +L+R
Sbjct  7    LPDCVYKNLPVFVCPSCPTPNHTVHLSNLDDQKFLRFSIKYLYIFEKSVAAETLKDALSR  66

Query  213  ALVDYYPL--AGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRK  386
             LV YYP     R        RKL++DCN  GAVFAEA +DL+ +EF++ + KPNRS RK
Sbjct  67   VLVHYYPFAGRVRARAAASGDRKLEIDCNGEGAVFAEADVDLSVEEFVEFAKKPNRSLRK  126

Query  387  LLYKVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCV  500
            L+Y+V+AP FL IPPLV+QV++         T    CV
Sbjct  127  LMYRVDAPGFLDIPPLVIQVTNLRCGGMILCTAINHCV  164



>ref|XP_008672227.1| PREDICTED: uncharacterized protein LOC100194373 isoform X1 [Zea 
mays]
 tpg|DAA53856.1| TPA: hypothetical protein ZEAMMB73_145326 [Zea mays]
Length=475

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 102/145 (70%), Gaps = 3/145 (2%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAV--DRLK  197
            L+I  +C Y   P L+ P+  TP H+L LSNLDDQ FLRFSIKYLY+F    AV  D L+
Sbjct  9    LEIPGECQYAGDPVLVRPSQPTPRHTLHLSNLDDQRFLRFSIKYLYVFGADAAVPADALR  68

Query  198  CSLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQLSGKPNR  374
             +L R L DYYPLAGRL P  ++  KL VDCNA GA+FAE  +  L A +F+  S +P++
Sbjct  69   AALGRVLADYYPLAGRLRPSAEEDGKLVVDCNAEGALFAEGRLPGLAAADFLSGSDRPHK  128

Query  375  SWRKLLYKVEAPTFLHIPPLVVQVS  449
            SWRKL Y+VEA +F+ +PPLVVQV+
Sbjct  129  SWRKLHYRVEAQSFVAVPPLVVQVT  153



>ref|XP_002455342.1| hypothetical protein SORBIDRAFT_03g008850 [Sorghum bicolor]
 gb|EES00462.1| hypothetical protein SORBIDRAFT_03g008850 [Sorghum bicolor]
Length=497

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 105/147 (71%), Gaps = 5/147 (3%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAV--DRLK  197
            L+I  +C Y   P ++ P+  TP H+L LSNLDDQ FLRFSIKYLY+F +  AV  D L+
Sbjct  24   LEIPGECQYAGDPVVVRPSQPTPRHTLHLSNLDDQRFLRFSIKYLYVFASHAAVSADALR  83

Query  198  CSLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQLSGK--P  368
             +L R LVDYYPLAGRL P  ++  KL VDCNA GA+FAE  +  LTA +F++  G   P
Sbjct  84   AALGRVLVDYYPLAGRLRPSDEEEGKLVVDCNAEGALFAEGRLPGLTAADFLRGRGGATP  143

Query  369  NRSWRKLLYKVEAPTFLHIPPLVVQVS  449
            ++SWRKL Y+VEA +F+ +PPLVVQV+
Sbjct  144  HKSWRKLHYRVEAQSFVAVPPLVVQVT  170



>gb|EMS53663.1| Omega-hydroxypalmitate O-feruloyl transferase [Triticum urartu]
Length=369

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 99/145 (68%), Gaps = 5/145 (3%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCS  203
            + I  DC +   P L+ P+  TP+H+L LSNLDDQ  LRFS++YL++F   V VD L+ +
Sbjct  1    MDIAADCEHRMEPVLVTPSQPTPAHTLCLSNLDDQCLLRFSVEYLFVFAGHVDVDALRTA  60

Query  204  LARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQLS--GKPNR  374
            L+R LVDYYPLAGRL   P D  K  VDCNA GA+F   F+  LTADEF+Q S   KP+ 
Sbjct  61   LSRVLVDYYPLAGRLG--PGDDGKHVVDCNAEGALFGGGFLPGLTADEFLQGSAIAKPHE  118

Query  375  SWRKLLYKVEAPTFLHIPPLVVQVS  449
            SWRKLL   E  +FL +PPLVVQV+
Sbjct  119  SWRKLLRGAEPQSFLGVPPLVVQVT  143



>gb|EMT27960.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase [Aegilops tauschii]
Length=151

 Score =   145 bits (366),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 101/145 (70%), Gaps = 5/145 (3%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF--RTSVAVDRLK  197
            L+I  +  Y   P L+PP   TP H+L LSNLDDQ FLRFSIKYLY+F    +V  + L+
Sbjct  5    LEISGEVQYRGDPVLVPPRRPTPRHALYLSNLDDQRFLRFSIKYLYVFAADAAVTAEALR  64

Query  198  CSLARALVDYYPLAGRLTPC-PDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQLSGK-P  368
             SLA ALVDYYPLAGRL P   ++  KL VDCNA GA+FAE  +  L A +F++  G  P
Sbjct  65   SSLAEALVDYYPLAGRLRPGDGEEEGKLAVDCNAEGALFAEGSLPGLVAADFLRGGGATP  124

Query  369  NRSWRKLLYKVEAPTFLHIPPLVVQ  443
            ++SWRKLLY+V+A  F+ +PPLVVQ
Sbjct  125  HKSWRKLLYRVDAHGFVAVPPLVVQ  149



>emb|CDM81296.1| unnamed protein product [Triticum aestivum]
Length=484

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 103/147 (70%), Gaps = 5/147 (3%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAV--DRLK  197
            L+I  +  Y   P L+PP   TP H+L LSNLDDQ FLRFSIKYLY+F    AV  D L+
Sbjct  5    LEISGEVQYRGDPVLVPPRHPTPRHALYLSNLDDQRFLRFSIKYLYVFSAGAAVPADALR  64

Query  198  CSLARALVDYYPLAGRLTPC-PDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQLSGK-P  368
             +LA ALVDYYPLAGRL P   ++  KL VDCNA GA+FAE  +  L A +F++  G  P
Sbjct  65   SALAEALVDYYPLAGRLRPGDGEEEGKLAVDCNAEGALFAEGSLPGLAAADFLRGGGATP  124

Query  369  NRSWRKLLYKVEAPTFLHIPPLVVQVS  449
            ++SWRKLLY+V+A  F+ +PPLVVQV+
Sbjct  125  HKSWRKLLYRVDAHGFVAVPPLVVQVT  151



>ref|XP_006645912.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Oryza brachyantha]
Length=259

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 103/159 (65%), Gaps = 3/159 (2%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHS-LPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKC  200
            ++I  +C Y + P L+ P+  TP H+ L L NLDDQ  L F I Y+Y+F  ++ VD LK 
Sbjct  1    MEITGECIYRSPPLLVAPSEPTPEHTPLCLPNLDDQRLLHFPILYIYVFTGALDVDALKV  60

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQLSGKPNRS  377
            +L+R L DYYPLAGRL  C D   KL VDCNA GA+FAE F+  LTA EF+    KP+ S
Sbjct  61   ALSRVL-DYYPLAGRLRACDDAGDKLVVDCNAEGALFAEGFLSGLTAREFLLGRAKPHES  119

Query  378  WRKLLYKVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAF  494
            WRKL+YKVE  +F+  PPLVVQVS  P S   T   TA 
Sbjct  120  WRKLIYKVEEQSFVCTPPLVVQVSILPDSCGGTILCTAI  158



>dbj|BAK06566.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 102/147 (69%), Gaps = 5/147 (3%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAV--DRLK  197
            L+I  +  Y   P L+PP   TP H+L LSNLDDQ FLRFSIKY+Y+F    AV  D L+
Sbjct  5    LEISGEVQYRGDPVLVPPRRPTPRHALYLSNLDDQRFLRFSIKYMYVFPAGAAVPCDALR  64

Query  198  CSLARALVDYYPLAGRLTPCP-DDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQLSGK-P  368
             +LA ALVDYYPLAGRL P    +  KL VDCNA GA+FAE  +  L A +F++  G  P
Sbjct  65   SALAEALVDYYPLAGRLRPGDVGEEGKLAVDCNAEGALFAEGSLPGLAAADFLRGGGATP  124

Query  369  NRSWRKLLYKVEAPTFLHIPPLVVQVS  449
            ++SWRKLLY+V+A  F+ +PPLVVQV+
Sbjct  125  HKSWRKLLYRVDAHGFVAVPPLVVQVT  151



>gb|EMT21160.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=446

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 100/145 (69%), Gaps = 5/145 (3%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCS  203
            ++I  +C +   P L+ P+    +H+L LSNLDDQ  LRFS++YL++F  +V VD L+ +
Sbjct  1    MEIAAECEHRMEPVLVTPSQPKRAHTLYLSNLDDQCLLRFSVEYLFVFAGAVDVDALRTA  60

Query  204  LARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQLS--GKPNR  374
            L+R LVDYYPLAGRL P  D   KL VDCNA GA+F E F+  L A EF+Q S   KP+ 
Sbjct  61   LSRVLVDYYPLAGRLRPGDDG--KLVVDCNAEGALFEEGFLPGLAASEFLQGSAIAKPHE  118

Query  375  SWRKLLYKVEAPTFLHIPPLVVQVS  449
            SWRKLL   EA +FL +PPLVVQV+
Sbjct  119  SWRKLLRGAEARSFLAVPPLVVQVT  143



>gb|EAZ11983.1| hypothetical protein OsJ_01862 [Oryza sativa Japonica Group]
Length=421

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 103/162 (64%), Gaps = 2/162 (1%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCS  203
            ++I+ +C Y   P L+ P+  TP  +L LSNLDDQ  L F I+Y+Y+F  ++ +D LK +
Sbjct  1    MEIVGECIYNNPPVLVTPSKPTPKLALYLSNLDDQRLLHFPIQYIYVFTGTLDMDTLKVA  60

Query  204  LARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQLSGKPNRSW  380
            L+R LVDYYPLAGRL    +   KL +DCN+ G +FAE F+  LTA +FI    KP++SW
Sbjct  61   LSRVLVDYYPLAGRLRASNEHDGKLIIDCNSEGVLFAEGFLPGLTAGDFILGHAKPHKSW  120

Query  381  RKLLYKVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCVYN  506
            +KLLYK E  +F+  PPLVVQV+          T  A CV +
Sbjct  121  KKLLYKDEQ-SFVCTPPLVVQVTHLSCGGTILCTAIAHCVSD  161



>ref|XP_003565349.2| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Brachypodium 
distachyon]
Length=488

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD--RLK  197
            L+I  DC Y   P LIPP   TP H+L LSNLDDQ FLRFSIKYLY+F  S A+    LK
Sbjct  7    LEIPGDCEYLGPPDLIPPNGPTPRHTLYLSNLDDQRFLRFSIKYLYVFPASGAIPIPTLK  66

Query  198  CSLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRS  377
             +LA ALV+YYPLAGRL P  ++  KL V+CNA GA+FAEA +   A    + +  P++S
Sbjct  67   AALAAALVEYYPLAGRLKPSEEEEGKLVVECNAEGALFAEAALPGIAAADFRGARPPHKS  126

Query  378  WRKLLYKVEAPTFLHIPPLVVQVS  449
            WRKLLY+V++  F+ +PPLVVQV+
Sbjct  127  WRKLLYRVDSNGFVDVPPLVVQVT  150



>ref|XP_004154910.1| PREDICTED: LOW QUALITY PROTEIN: omega-hydroxypalmitate O-feruloyl 
transferase-like [Cucumis sativus]
Length=452

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 94/143 (66%), Gaps = 4/143 (3%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LP C Y   P LI P S+TP H L LS++DDQ FLRFSIK + ++R S+  + LK  L+R
Sbjct  15   LPKCVYRNDPVLIKPMSETPKHILRLSDVDDQTFLRFSIKCVLVYRESIEAEWLKFCLSR  74

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRS--WRK  386
             LVDYYPLAGRL  CP D +KL+VDCN  GA+FAEAF+DL +  F+    KP  S  W K
Sbjct  75   VLVDYYPLAGRLRGCPMDPQKLEVDCNGEGALFAEAFVDLNSHNFLSFCSKPTNSGFWTK  134

Query  387  --LLYKVEAPTFLHIPPLVVQVS  449
              LL+K +    L  PPL +QV+
Sbjct  135  TTLLFKPKLLDPLDFPPLSLQVT  157



>ref|XP_004147874.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
Length=452

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 94/143 (66%), Gaps = 4/143 (3%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LP C Y   P LI P S+TP H L LS++DDQ FLRFSIK + ++R S+  + LK  L+R
Sbjct  15   LPKCVYRNDPVLIKPMSETPKHILRLSDVDDQTFLRFSIKCVLVYRESIEAEWLKFCLSR  74

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRS--WRK  386
             LVDYYPLAGRL  CP D +KL+VDCN  GA+FAEAF+DL +  F+    KP  S  W K
Sbjct  75   VLVDYYPLAGRLRGCPMDPQKLEVDCNGEGALFAEAFVDLNSHNFLSFCSKPTNSAFWTK  134

Query  387  --LLYKVEAPTFLHIPPLVVQVS  449
              LL+K +    L  PPL +QV+
Sbjct  135  TTLLFKPKLLDPLDFPPLSLQVT  157



>gb|KGN59993.1| hypothetical protein Csa_3G860290 [Cucumis sativus]
Length=464

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 92/141 (65%), Gaps = 4/141 (3%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LP C Y   P LI P S+TP H L LS++DDQ FLRFSIK + ++R S+  + LK  L+R
Sbjct  15   LPKCVYRNDPVLIKPMSETPKHILRLSDVDDQTFLRFSIKCVLVYRESIEAEWLKFCLSR  74

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRS--WRK  386
             LVDYYPLAGRL  CP D +KL+VDCN  GA+FAEAF+DL +  F+    KP  S  W K
Sbjct  75   VLVDYYPLAGRLRGCPMDPQKLEVDCNGEGALFAEAFVDLNSHNFLSFCSKPTNSAFWTK  134

Query  387  --LLYKVEAPTFLHIPPLVVQ  443
              LL+K +    L  PPL +Q
Sbjct  135  TTLLFKPKLLDPLDFPPLSLQ  155



>ref|XP_004513913.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Cicer 
arietinum]
Length=318

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 91/140 (65%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC+    P  I P + TP+HSL LSNLDD  ++RF + Y+Y+F+ SV VD LK SL+R
Sbjct  7    LPDCYNYKPPITITPCAPTPNHSLYLSNLDDLMYIRFYMHYVYIFKKSVEVDTLKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    +D  KL VDCN  G +FAEA MD+TA+E +      ++S +KL 
Sbjct  67   VLVDYYPLAGRLRTSSEDENKLVVDCNGEGVLFAEASMDITAEELLIPCMTQHKSLKKLK  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
             K      L  P L++QV++
Sbjct  127  CKGNTKKMLDNPLLLIQVTN  146



>ref|XP_004513917.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like isoform 
X4 [Cicer arietinum]
Length=341

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 90/139 (65%), Gaps = 0/139 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC+    P  I P + TP+HSL LSNLDD  ++RF + Y+Y+F+ SV VD LK SL+R
Sbjct  7    LPDCYNYKPPITITPCAPTPNHSLYLSNLDDLMYIRFYMHYVYIFKKSVEVDTLKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    +D  KL VDCN  G +FAEA MD+TA+E +      ++S +KL 
Sbjct  67   VLVDYYPLAGRLRTSSEDENKLVVDCNGEGVLFAEASMDITAEELLIPCMTQHKSLKKLK  126

Query  393  YKVEAPTFLHIPPLVVQVS  449
             K      L  P L++QV+
Sbjct  127  CKGNTKKMLDNPLLLIQVT  145



>gb|EEE53709.1| hypothetical protein OsJ_00040 [Oryza sativa Japonica Group]
Length=402

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 112/164 (68%), Gaps = 7/164 (4%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF--RTSVAVDRLK  197
            ++I+ +C Y     L+ P+S TP  SL LSNLDDQ FLRFSIKYLY+F    +VA D L+
Sbjct  1    MEIVGECEYRGEAVLVTPSSATPRRSLYLSNLDDQRFLRFSIKYLYVFPPSAAVAADALR  60

Query  198  CSLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQ--LSGKP  368
             +LARALV YYPLAGRL    DD  KL +DCNA GA+FAEAF+  LTA +F++   + KP
Sbjct  61   AALARALVHYYPLAGRLRHHADD--KLVLDCNAEGALFAEAFLPTLTAADFLRAGATAKP  118

Query  369  NRSWRKLLYKVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCV  500
            ++SWRKLLY+V A TF+ +PPLVVQV+          T  + CV
Sbjct  119  HKSWRKLLYRVHAATFVAVPPLVVQVTQLGCGGMVVCTAISHCV  162



>ref|XP_004513915.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like isoform 
X2 [Cicer arietinum]
Length=440

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 90/139 (65%), Gaps = 0/139 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC+    P  I P + TP+HSL LSNLDD  ++RF + Y+Y+F+ SV VD LK SL+R
Sbjct  7    LPDCYNYKPPITITPCAPTPNHSLYLSNLDDLMYIRFYMHYVYIFKKSVEVDTLKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    +D  KL VDCN  G +FAEA MD+TA+E +      ++S +KL 
Sbjct  67   VLVDYYPLAGRLRTSSEDENKLVVDCNGEGVLFAEASMDITAEELLIPCMTQHKSLKKLK  126

Query  393  YKVEAPTFLHIPPLVVQVS  449
             K      L  P L++QV+
Sbjct  127  CKGNTKKMLDNPLLLIQVT  145



>ref|XP_004513916.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like isoform 
X3 [Cicer arietinum]
Length=440

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 91/139 (65%), Gaps = 0/139 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC+    P  I P + TP+HSL LSNLDD  ++R  + Y+Y+F+ SV VD LK SL+R
Sbjct  7    LPDCYNYKPPVTITPCAPTPNHSLYLSNLDDLMYVRLYMHYVYIFKKSVEVDTLKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYP+AGRL    +D  KL VDCN  G +FAEA MD+TA+E +      ++S++KL 
Sbjct  67   VLVDYYPVAGRLRTSSEDENKLVVDCNGEGVLFAEASMDITAEELLLPCMTQHKSFKKLK  126

Query  393  YKVEAPTFLHIPPLVVQVS  449
             K     FL  P L++QV+
Sbjct  127  CKGNTKFFLDTPLLLIQVT  145



>ref|XP_004513914.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like isoform 
X1 [Cicer arietinum]
Length=440

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 90/139 (65%), Gaps = 0/139 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC+    P  I P + TP+HSL LSNLDD  ++RF + Y+Y+F+ SV VD LK SL+R
Sbjct  7    LPDCYNYKPPITITPCAPTPNHSLYLSNLDDLMYIRFYMHYVYIFKKSVEVDTLKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    +D  KL VDCN  G +FAEA MD+TA+E +      ++S +KL 
Sbjct  67   VLVDYYPLAGRLRTSSEDENKLVVDCNGEGVLFAEASMDITAEELLIPCMTQHKSLKKLK  126

Query  393  YKVEAPTFLHIPPLVVQVS  449
             K      L  P L++QV+
Sbjct  127  CKGNTKKMLDNPLLLIQVT  145



>ref|NP_001041768.1| Os01g0104900 [Oryza sativa Japonica Group]
 dbj|BAB16338.1| hsr201 -like [Oryza sativa Japonica Group]
 dbj|BAB16898.1| hsr201 -like [Oryza sativa Japonica Group]
 dbj|BAF03682.1| Os01g0104900 [Oryza sativa Japonica Group]
 dbj|BAH00540.1| unnamed protein product [Oryza sativa Japonica Group]
Length=468

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 112/164 (68%), Gaps = 7/164 (4%)
 Frame = +3

Query  24   LQILPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTS--VAVDRLK  197
            ++I+ +C Y     L+ P+S TP  SL LSNLDDQ FLRFSIKYLY+F  S  VA D L+
Sbjct  1    MEIVGECEYRGEAVLVTPSSATPRRSLYLSNLDDQRFLRFSIKYLYVFPPSAAVAADALR  60

Query  198  CSLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQ--LSGKP  368
             +LARALV YYPLAGRL    DD  KL +DCNA GA+FAEAF+  LTA +F++   + KP
Sbjct  61   AALARALVHYYPLAGRLRHHADD--KLVLDCNAEGALFAEAFLPTLTAADFLRAGATAKP  118

Query  369  NRSWRKLLYKVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCV  500
            ++SWRKLLY+V A TF+ +PPLVVQV+          T  + CV
Sbjct  119  HKSWRKLLYRVHAATFVAVPPLVVQVTQLGCGGMVVCTAISHCV  162



>ref|XP_004513923.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Cicer 
arietinum]
Length=303

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 93/151 (62%), Gaps = 1/151 (1%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC+    P  I P + TP+HSL LSNLDD  + R     +Y+F+ SV VD LK SL+R
Sbjct  7    LPDCYNYKPPITITPCAPTPNHSLYLSNLDDLMYQRLYFNRIYIFKKSVEVDTLKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    +D  KL VDCN  G +FAEA MD+TA+E +      ++S +KL 
Sbjct  67   VLVDYYPLAGRLRTSSEDENKLVVDCNGEGVLFAEASMDITAEELLIPCMTQHKSLKKLK  126

Query  393  YKVEAPTFLHIPPLVVQVS-SSPYSLCFTST  482
             K      L  P L++Q+S +   ++CFT+ 
Sbjct  127  CKGNTKKMLDNPLLLIQLSPARVVNICFTAN  157



>ref|XP_004510923.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Cicer 
arietinum]
Length=435

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 88/139 (63%), Gaps = 0/139 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC+    P  I P + TP+HSL LSNLDDQ + R  I +++LF+ SV VD LK SL+R
Sbjct  7    LPDCYNYKPPITITPCAPTPNHSLYLSNLDDQMYHRELINHVFLFKKSVKVDTLKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    +D  KL VDCN  G +FAEA MD+TA+E +      ++S +KL 
Sbjct  67   VLVDYYPLAGRLRTSSEDENKLVVDCNGEGVLFAEASMDITAEELLIPCMIQHKSLKKLQ  126

Query  393  YKVEAPTFLHIPPLVVQVS  449
             K      L  P LV QV+
Sbjct  127  CKGYTKKILDTPLLVSQVT  145



>ref|NP_001043090.1| Os01g0382200 [Oryza sativa Japonica Group]
 dbj|BAF05004.1| Os01g0382200, partial [Oryza sativa Japonica Group]
Length=440

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 91/141 (65%), Gaps = 2/141 (1%)
 Frame = +3

Query  87   TPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLARALVDYYPLAGRLTPCPDD  266
            TP  +L LSNLDDQ  L F I+Y+Y+F  ++ +D LK +L+R LVDYYPLAGRL    + 
Sbjct  3    TPKLALYLSNLDDQRLLHFPIQYIYVFTGTLDMDTLKVALSRVLVDYYPLAGRLRASNEH  62

Query  267  HRKLQVDCNAAGAVFAEAFM-DLTADEFIQLSGKPNRSWRKLLYKVEAPTFLHIPPLVVQ  443
              KL +DCN+ G +FAE F+  LTA +FI    KP++SW+KLLYK E  +F+  PPLVVQ
Sbjct  63   DGKLIIDCNSEGVLFAEGFLPGLTAGDFILGHAKPHKSWKKLLYKDEQ-SFVCTPPLVVQ  121

Query  444  VSSSPYSLCFTSTKTAFCVYN  506
            V+          T  A CV +
Sbjct  122  VTHLSCGGTILCTAIAHCVSD  142



>ref|XP_004513919.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Cicer 
arietinum]
Length=440

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC+    P  I P++ TP+HSL LSNLDD  + R     +Y+F+ SV VD LK SL+R
Sbjct  7    LPDCYNYKPPITITPSAPTPNHSLYLSNLDDLMYQRLYFSEIYIFKKSVKVDILKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYP+AGRL    +D  KL VDCN  G +FAEA MD+TA+E +      ++S +KL 
Sbjct  67   VLVDYYPVAGRLRTSSEDENKLVVDCNGEGVLFAEASMDITAEELLIPCMTQHKSLKKLK  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
             K      L  P L++QV++
Sbjct  127  CKGNTKKMLDNPLLLIQVTN  146



>ref|XP_004513918.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Cicer 
arietinum]
Length=435

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 90/140 (64%), Gaps = 2/140 (1%)
 Frame = +3

Query  33   LPDCFYPTTPTL-IPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLA  209
            LPDC Y   PT+ I P + TP+HSL LSNLDDQ + R  + +++LF+ SV VD LK SL+
Sbjct  7    LPDC-YNYKPTITITPCAPTPNHSLYLSNLDDQMYHRELVNHVFLFKKSVKVDTLKSSLS  65

Query  210  RALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKL  389
            R LVDYYPLAGRL    +D  KL VDCN  G +FAEA MD+TA+E +      ++S +KL
Sbjct  66   RVLVDYYPLAGRLRTSSEDENKLVVDCNGEGVLFAEASMDITAEELLIPCITQHKSLKKL  125

Query  390  LYKVEAPTFLHIPPLVVQVS  449
              K      L  P LV QV+
Sbjct  126  KCKGYTKKILDTPLLVSQVT  145



>ref|XP_004513920.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Cicer 
arietinum]
Length=440

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
             PDC+    P  I P++ TP+HSL LSNLDD  + R     +Y+F+ SV  D LK SL+R
Sbjct  7    FPDCYNYKPPITITPSAPTPNHSLYLSNLDDLMYQRLYFSEIYIFKKSVKADILKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYP+AGRL    +D  KL VDCN  G +FAEA MD+TA+E +      ++S +KL 
Sbjct  67   VLVDYYPVAGRLRTSSEDENKLVVDCNGEGVLFAEASMDITAEELLIPCMTQHKSLKKLK  126

Query  393  YKVEAPTFLHIPPLVVQVSS  452
             K      L  P L++QV++
Sbjct  127  CKGNTKKMLDNPLLLIQVTN  146



>gb|EEE53710.1| hypothetical protein OsJ_00041 [Oryza sativa Japonica Group]
Length=135

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 93/123 (76%), Gaps = 7/123 (6%)
 Frame = +3

Query  90   PSHSLPLSNLDDQNFLRFSIKYLYLF--RTSVAVDRLKCSLARALVDYYPLAGRLTPCPD  263
            P  SL LSNLDDQ FLRFSIKYLY+F    +VA D L+ +LA+ALV YYPLAGRL    D
Sbjct  2    PRRSLYLSNLDDQRFLRFSIKYLYVFPPSAAVAADALRAALAKALVHYYPLAGRLRHHAD  61

Query  264  DHRKLQVDCNAAGAVFAEAFM-DLTADEFIQ--LSGKPNRSWRKLLYKVEAPTFLHIPPL  434
            D  KL +DCNA GA+FAEAF+  LTA +F++   + KP++SWRKLLY+V A TF+ +PPL
Sbjct  62   D--KLVLDCNAEGALFAEAFLPTLTAADFLRAGATAKPHKSWRKLLYRVHAATFVAVPPL  119

Query  435  VVQ  443
            VVQ
Sbjct  120  VVQ  122



>ref|XP_004513921.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Cicer 
arietinum]
Length=559

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 83/137 (61%), Gaps = 0/137 (0%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLAR  212
            LPDC+    P  I P + TP+H L LSNLDD  + R     +Y+F+ SV VD LK SL+R
Sbjct  7    LPDCYNYKPPVTITPCAPTPNHCLYLSNLDDLMYQRLYFNRIYIFKKSVEVDTLKSSLSR  66

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LVDYYPLAGRL    +D  KL VDCN  G +FAEA MD+TA+E +      ++S +KL 
Sbjct  67   VLVDYYPLAGRLRTSSEDENKLVVDCNGEGVLFAEASMDITAEELLIPCMTQHKSLKKLK  126

Query  393  YKVEAPTFLHIPPLVVQ  443
             K      L  P L++Q
Sbjct  127  CKGNTKKMLDNPLLLIQ  143


 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = +3

Query  138  RFSIKYLYLFRTSVAVDRLKCSLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAE  317
            RF    +Y+F+ SV  D LK SL+R LVDYYPLAGRL    +D  KL VDCN  G +FAE
Sbjct  161  RFYGSEIYIFKKSVKADILKSSLSRVLVDYYPLAGRLRTSSEDENKLVVDCNGEGVLFAE  220

Query  318  AFMDLTADEFIQLSGKPNRSWRKLLYKVEAPTFLHIPPLVVQVSS  452
            A +D+TA+E +      ++S +KL  K      L  P L++QV++
Sbjct  221  ASIDITAEELLIPCMTQHKSLKKLKCKGNTKKMLDNPLLLIQVTN  265



>gb|EAY72193.1| hypothetical protein OsI_00045 [Oryza sativa Indica Group]
Length=436

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 91/142 (64%), Gaps = 7/142 (5%)
 Frame = +3

Query  90   PSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLARALV--DYYPLAGRLTPCPD  263
            P  SL LSNLDDQ FLRFSIKYLY+F  S AV       A A     YYPLAGRL    D
Sbjct  2    PRRSLYLSNLDDQRFLRFSIKYLYVFPPSAAVAADALRAALARALVHYYPLAGRLRHHAD  61

Query  264  DHRKLQVDCNAAGAVFAEAFM-DLTADEFIQL--SGKPNRSWRKLLYKVEAPTFLHIPPL  434
            D  KL +DCNA GA+FAEAF+  LTA +F++   + KP++SWRKLLY+V A TF+ +PPL
Sbjct  62   D--KLVLDCNAEGALFAEAFLPTLTAADFLRAGATAKPHKSWRKLLYRVHAATFVAVPPL  119

Query  435  VVQVSSSPYSLCFTSTKTAFCV  500
            VVQV+          T  + CV
Sbjct  120  VVQVTQLGCGGMVVCTAISHCV  141



>gb|KFK36172.1| hypothetical protein AALP_AA4G087600 [Arabis alpina]
Length=800

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +3

Query  216  LVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLY  395
            LVDYYP AGR+    DD  KL+VDCN  GAVFAE FMD+T+ +F+QLS KPN+SWRKLLY
Sbjct  432  LVDYYPFAGRIR-ASDDPTKLEVDCNGEGAVFAEGFMDITSQDFLQLSSKPNKSWRKLLY  490

Query  396  KVEAPTFLHIPPLVVQVS  449
             V+AP+FL  PPLV+QV+
Sbjct  491  NVQAPSFLDTPPLVIQVT  508



>ref|XP_006338814.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Solanum tuberosum]
Length=446

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 79/137 (58%), Gaps = 12/137 (9%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTS-------VAVDRLKCSLARALVD  224
            LI P+  TP   LPLS LD Q FLRF+I+YL +++ S        AV+R+K +L RALV 
Sbjct  24   LITPSEPTPIQVLPLSALDSQLFLRFTIEYLLVYKPSRHVLDKPAAVNRIKAALGRALVP  83

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKP--NRSWRKLLYK  398
            YYPLAGR+    +    L+V C A GA F +A  DLTA EF    G P  N  WRKLL  
Sbjct  84   YYPLAGRVRARTNGSAGLEVVCRAQGAAFIQAASDLTAKEF---EGAPRHNTQWRKLLSL  140

Query  399  VEAPTFLHIPPLVVQVS  449
                     PPLVVQ++
Sbjct  141  QVTDVLKGAPPLVVQLT  157



>ref|XP_004240917.2| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Solanum 
lycopersicum]
Length=465

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 79/138 (57%), Gaps = 12/138 (9%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTS-------VAVDRLKCSLARALV  221
            TLI P+  TP   LPLS LD Q FLRF+I+YL +++ S         V R+K +L RALV
Sbjct  42   TLITPSDPTPIQVLPLSALDSQLFLRFTIEYLLVYKPSRHVLDKLATVSRIKAALGRALV  101

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKP--NRSWRKLLY  395
             YYPLAGR+    +    L+V C A GA F +A  DLTA+EF    G P  N  WRKLL 
Sbjct  102  PYYPLAGRVRARTNGSAGLEVVCRAQGAAFIQAASDLTAEEF---EGAPRHNTQWRKLLS  158

Query  396  KVEAPTFLHIPPLVVQVS  449
                      PPLVVQ++
Sbjct  159  LQVTDVLKGAPPLVVQLT  176



>ref|XP_010105434.1| Taxadien-5-alpha-ol O-acetyltransferase [Morus notabilis]
 gb|EXC04709.1| Taxadien-5-alpha-ol O-acetyltransferase [Morus notabilis]
Length=433

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 83/135 (61%), Gaps = 7/135 (5%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVD  224
             ++ P+  TPSH+L LS +D Q FLRF+I+YL +++     D      R+K +L++ALV 
Sbjct  11   VVVTPSEPTPSHNLTLSAIDSQLFLRFTIEYLLIYKARPGTDQDSAAARVKSALSKALVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGR+ P PD    L+V C A GAVF EA  + +  +F + + +   SWRKLL    
Sbjct  71   YYPLAGRVRPNPDGSGVLEVVCRAQGAVFIEAVSERSVSDF-ERAPRNVASWRKLLSVHV  129

Query  405  APTFLHIPPLVVQVS  449
            A   +  PPLVVQ++
Sbjct  130  ADVLMGAPPLVVQLT  144



>ref|XP_010264576.1| PREDICTED: LOW QUALITY PROTEIN: omega-hydroxypalmitate O-feruloyl 
transferase [Nelumbo nucifera]
Length=437

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 81/135 (60%), Gaps = 8/135 (6%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVD  224
             L+ P+  TPSH L LS+LD Q FLRF+I+YL ++R     D      R+K +LARALV 
Sbjct  11   VLVAPSDPTPSHVLTLSSLDSQLFLRFTIEYLLVYRPRPCSDRDAIAARIKSALARALVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGR+   PD   KL+V C A GAVF EA  D++  +F Q    P + WR LL    
Sbjct  71   YYPLAGRVRARPDGS-KLEVVCRAQGAVFIEAVSDISISDFDQAPQYPTQ-WRNLLSFYV  128

Query  405  APTFLHIPPLVVQVS  449
            A      PPLVVQ++
Sbjct  129  ADVLRGAPPLVVQLT  143



>ref|XP_009776129.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Nicotiana 
sylvestris]
Length=431

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 80/134 (60%), Gaps = 7/134 (5%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR-----TSVAVDRLKCSLARALVDY  227
             LI P+  TP   LPLS LD Q FLRF+I+YL +++      +  V+R+K +L RALV Y
Sbjct  11   VLITPSEPTPIQILPLSALDSQLFLRFTIEYLLVYKPYGLDKAATVNRVKSALGRALVPY  70

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVEA  407
            YPLAGR+   P+    L+V C A GA F +A  DLTA EF Q + +    WRKLL    A
Sbjct  71   YPLAGRVRARPNGS-GLEVVCRAQGAAFLQAVSDLTASEF-QAAPRHKTQWRKLLSLQVA  128

Query  408  PTFLHIPPLVVQVS  449
                  PPLVVQ++
Sbjct  129  DVLKGAPPLVVQLT  142



>gb|KDP44731.1| hypothetical protein JCGZ_01231 [Jatropha curcas]
Length=436

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 78/134 (58%), Gaps = 8/134 (6%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVDY  227
            LI PT  TP+  L LS LD Q FLRF+I+YL +F+  + +D      R K +L + LV Y
Sbjct  12   LIKPTESTPARLLSLSALDSQLFLRFTIEYLLVFKARLGLDQVDITTRFKAALGKILVPY  71

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVEA  407
            YPLAGR+   PD    L+V C   GAVF EAF D T ++F + + +    WRKLLY   A
Sbjct  72   YPLAGRVRAKPDGS-SLEVLCRGQGAVFVEAFSDNTINDFDR-APRYVTQWRKLLYFYVA  129

Query  408  PTFLHIPPLVVQVS  449
                  P LV+Q++
Sbjct  130  DVLQGAPLLVIQLT  143



>dbj|BAD68809.1| putative hydroxyanthranilate hydroxycinnamoyltransferase 2 [Oryza 
sativa Japonica Group]
 dbj|BAD68494.1| putative hydroxyanthranilate hydroxycinnamoyltransferase 2 [Oryza 
sativa Japonica Group]
Length=406

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 69/109 (63%), Gaps = 2/109 (2%)
 Frame = +3

Query  183  VDRLKCSLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFM-DLTADEFIQLS  359
            +D LK +L+R LVDYYPLAGRL    +   KL +DCN+ G +FAE F+  LTA +FI   
Sbjct  1    MDTLKVALSRVLVDYYPLAGRLRASNEHDGKLIIDCNSEGVLFAEGFLPGLTAGDFILGH  60

Query  360  GKPNRSWRKLLYKVEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCVYN  506
             KP++SW+KLLYK E  +F+  PPLVVQV+          T  A CV +
Sbjct  61   AKPHKSWKKLLYKDE-QSFVCTPPLVVQVTHLSCGGTILCTAIAHCVSD  108



>ref|XP_009607746.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Nicotiana 
tomentosiformis]
Length=433

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 78/136 (57%), Gaps = 9/136 (7%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTS-------VAVDRLKCSLARALV  221
             LI P+  TP   LPLS LD Q FLRF+I+YL +++ S         V+++K +L RALV
Sbjct  11   VLITPSEPTPIQILPLSALDSQLFLRFTIEYLLVYKPSRHGLDKAATVNQVKSALGRALV  70

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGR+     +   L+V C A GA F +A  DLTA EF Q + +    WRKLL   
Sbjct  71   PYYPLAGRVR-ARTNGSGLEVVCRAQGAAFLQAVSDLTASEF-QAAPRHKTQWRKLLSLQ  128

Query  402  EAPTFLHIPPLVVQVS  449
                    PPLVVQ++
Sbjct  129  VVDVLKGAPPLVVQLT  144



>ref|XP_002315149.1| transferase family protein [Populus trichocarpa]
 gb|EEF01320.1| transferase family protein [Populus trichocarpa]
Length=435

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 84/145 (58%), Gaps = 8/145 (6%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT------SVAVDRL  194
            + +  +     +I P+  TPS  L LS LD Q FLRF+++YL++F+       SV  DR+
Sbjct  1    MANSVHVKEAVVIKPSEPTPSRVLSLSALDSQLFLRFTVEYLFVFKARPGLDQSVITDRV  60

Query  195  KCSLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNR  374
            K +LA+ LV YYPLAGR+   PD    L+V C + GAVF EA  DLT ++F + + +   
Sbjct  61   KAALAKILVPYYPLAGRVRAKPDGS-SLEVVCRSQGAVFMEAVSDLTINDFDR-APRYVT  118

Query  375  SWRKLLYKVEAPTFLHIPPLVVQVS  449
             WRKLL    +      P LV+Q++
Sbjct  119  QWRKLLSLNVSDVLKGAPTLVIQLT  143



>emb|CDP13991.1| unnamed protein product [Coffea canephora]
Length=448

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 79/135 (59%), Gaps = 9/135 (7%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT-------SVAVDRLKCSLARALVD  224
            ++ P+  TP+H L LS LD Q FLRF ++YL +++        +    R+K +L+RALV 
Sbjct  12   VVTPSEPTPTHVLRLSALDSQLFLRFPVEYLLVYKAPAHGLDRATTTARVKAALSRALVP  71

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGR+    D    L+V C+A GA+F EAF D TA EF +     N+ WRKLL    
Sbjct  72   YYPLAGRVRAVADGP-GLEVVCSAQGAIFVEAFSDCTASEFERAPRHCNQ-WRKLLSSHV  129

Query  405  APTFLHIPPLVVQVS  449
                   PPLVVQ++
Sbjct  130  DEVLKGAPPLVVQLT  144



>ref|XP_002272886.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Vitis 
vinifera]
 emb|CBI25452.3| unnamed protein product [Vitis vinifera]
Length=440

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT------SVAVDRLKCSLARALVD  224
             L+ P+  TPS  L LS LD Q FLRFSI+YL ++++       V  D +K +L RALV 
Sbjct  12   VLVAPSETTPSRVLALSALDSQLFLRFSIEYLLVYQSRPCSDHGVTADHVKAALGRALVP  71

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGR+         L+V C A GAVF EA  DLT  +F + + +    WRKLL    
Sbjct  72   YYPLAGRVR-VGSSGSNLEVVCRAQGAVFIEAVSDLTVADF-ERTPRHVTQWRKLLSLYV  129

Query  405  APTFLHIPPLVVQVS  449
                   PPLVVQ++
Sbjct  130  EDVLRGAPPLVVQLT  144



>ref|XP_006353446.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Solanum tuberosum]
Length=596

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 74/130 (57%), Gaps = 12/130 (9%)
 Frame = +3

Query  87   TPSHSLPLSNLDDQNFLRFSIKYLYLFRTS-------VAVDRLKCSLARALVDYYPLAGR  245
            TP   LPLS LD Q FLRF+I+YL +++ S        AV+R+K +L RALV YYPLAGR
Sbjct  181  TPIQVLPLSALDSQLFLRFTIEYLLVYKPSRHVLDKPAAVNRIKAALGRALVPYYPLAGR  240

Query  246  LTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKP--NRSWRKLLYKVEAPTFL  419
            +    +    L+V C A GA F +A  DLTA EF    G P  N  W KLL         
Sbjct  241  VRARTNGSAGLEVVCRAQGAAFIQAASDLTAKEF---EGAPRHNTQWMKLLSLQVTDVLK  297

Query  420  HIPPLVVQVS  449
              PPLVVQ++
Sbjct  298  GAPPLVVQLT  307



>ref|XP_010499245.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Camelina sativa]
Length=379

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +3

Query  261  DDHRKLQVDCNAAGAVFAEAFMDLTADEFI-QLSGKPNRSWRKLLYKVEAPTFLHIPPLV  437
            DD RKL+VDCN  GAVFAEAFMD+T  EF+ Q S KPN+SWRKLL+KV+A  FL IPPLV
Sbjct  17   DDGRKLEVDCNGEGAVFAEAFMDITCQEFLDQHSPKPNKSWRKLLFKVQAQGFLDIPPLV  76

Query  438  VQVS  449
            +QV+
Sbjct  77   LQVT  80



>ref|XP_006854801.1| hypothetical protein AMTR_s00063p00166280 [Amborella trichopoda]
 gb|ERN16268.1| hypothetical protein AMTR_s00063p00166280 [Amborella trichopoda]
Length=461

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 81/139 (58%), Gaps = 6/139 (4%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTS--VAVDRLKCSLARALVDYYPL  236
             L+ P+  TPS  L LS +D Q FLRF+I+Y+ ++R      + R++ +L RALV YYPL
Sbjct  44   VLVTPSEPTPSEVLALSTIDSQRFLRFTIEYILVYRDGDQELLHRMRAALGRALVPYYPL  103

Query  237  AGRLTPCPDDH---RKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVEA  407
            AGRL     +H     L+V CNA GA+F EA    +  E ++ + K  + WR  L +++ 
Sbjct  104  AGRLRERNRNHGGGGGLEVVCNAQGALFIEATSTFSLHEMLK-TPKHCKQWRGFLPEIKE  162

Query  408  PTFLHIPPLVVQVSSSPYS  464
              F+  PPL+VQ +   +S
Sbjct  163  NEFIRAPPLIVQATRLVHS  181



>ref|XP_011000729.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Populus 
euphratica]
Length=435

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 79/134 (59%), Gaps = 8/134 (6%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVDY  227
            +I P+  TPS  L LS LD Q FLRF+++YL++F+    +D      R+K +LA+ LV Y
Sbjct  12   VIKPSEPTPSRVLSLSALDSQLFLRFTVEYLFVFKARPGLDQGVITARVKAALAKILVPY  71

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVEA  407
            YPLAGR+     D   L+V C A GAVF EA  D T +EF + + +    WRKLL    A
Sbjct  72   YPLAGRVR-AKLDGSSLEVVCRAQGAVFMEAVSDHTINEFDR-APRYVTQWRKLLSLSVA  129

Query  408  PTFLHIPPLVVQVS  449
                  PPLVVQ++
Sbjct  130  DVLKGAPPLVVQLT  143



>ref|XP_004500505.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Cicer 
arietinum]
Length=432

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 80/136 (59%), Gaps = 9/136 (7%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVD  224
             ++ P+  TP+  L LS LD Q FLRF+I+YL L+R    +D      RLK +LA+ALV 
Sbjct  11   VVVTPSEPTPNAVLLLSPLDSQLFLRFTIEYLLLYRPGPGLDQVTTTSRLKAALAKALVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGR+ P   D+  L+V C A GAVF EA  D      IQ   K    WRKLL  + 
Sbjct  71   YYPLAGRVRP-RQDNSGLEVLCKAQGAVFIEAVSDRYTVNDIQKVPKTVTQWRKLL-SLS  128

Query  405  APTFLHI-PPLVVQVS  449
             P  L+  PPLV+Q++
Sbjct  129  VPDVLNGSPPLVIQLT  144



>ref|XP_002881703.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57962.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 80/138 (58%), Gaps = 13/138 (9%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD-----RLKCSLARALVDY  227
            T+I P+ +TPS  LPLS LD Q FLRF+I+YL ++      D     RLK +L+RALV Y
Sbjct  11   TVITPSDQTPSSVLPLSALDSQLFLRFTIEYLLVYPPVSDPDYSLSGRLKSALSRALVPY  70

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNR---SWRKLLY  395
            +P +GR+   PD    L+V+C   GA+F EA  D LT  +F     KP R   SWRKLL 
Sbjct  71   FPFSGRVRENPDGGGGLEVNCRGQGALFLEAVSDILTCLDF----QKPPRHVTSWRKLLS  126

Query  396  KVEAPTFLHIPPLVVQVS  449
                      PPLVVQ++
Sbjct  127  LHVIDVLAGAPPLVVQLT  144



>ref|XP_004307660.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Fragaria vesca subsp. vesca]
Length=443

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 78/136 (57%), Gaps = 9/136 (7%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF-------RTSVAVDRLKCSLARALV  221
             ++ P+  TPS  L LS +D Q FLRF+I+YL ++         ++   R+K +LA+ALV
Sbjct  11   VVVTPSEPTPSCVLSLSAVDSQLFLRFTIEYLLVYSPRQNTTNQALTATRVKAALAKALV  70

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGR+ P PD    L+V C A GAVF EA  D    EF Q + +    WRKLL   
Sbjct  71   PYYPLAGRVRPKPDGS-GLEVVCCAQGAVFIEAVSDRAVSEF-QHAPRYVTQWRKLLSLQ  128

Query  402  EAPTFLHIPPLVVQVS  449
             A      PP+VVQ++
Sbjct  129  VADVLKGAPPVVVQLT  144



>ref|XP_002312170.2| hypothetical protein POPTR_0008s07130g [Populus trichocarpa]
 gb|EEE89537.2| hypothetical protein POPTR_0008s07130g [Populus trichocarpa]
Length=435

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 79/134 (59%), Gaps = 8/134 (6%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVDY  227
            +I P+  TPS  L LS LD Q FLRF+++YL++F+    +D      R+K +LA+ LV Y
Sbjct  12   VIKPSEPTPSCVLSLSALDSQLFLRFTVEYLFVFKARPGLDQGVITARVKAALAKILVPY  71

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVEA  407
            YPLAGR+     D   L+V C A GAVF EA  D T ++F + + +    WRKLL    A
Sbjct  72   YPLAGRVR-AKLDGSSLEVVCRAQGAVFMEAVSDHTINDFDR-APRYVTQWRKLLSVSVA  129

Query  408  PTFLHIPPLVVQVS  449
                  PPLVVQ++
Sbjct  130  DVLKGAPPLVVQLT  143



>gb|KDO68916.1| hypothetical protein CISIN_1g037938mg, partial [Citrus sinensis]
Length=402

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 81/142 (57%), Gaps = 8/142 (6%)
 Frame = +3

Query  45   FYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR------TSVAVDRLKCSL  206
             +    T+I P+  TPS  L LS LD Q FLRF+I+YL ++R      +   V R+K +L
Sbjct  6    LHGKEATVIYPSEPTPSTVLSLSALDSQLFLRFTIEYLLVYRPRPGLDSLATVARVKSAL  65

Query  207  ARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAF-MDLTADEFIQLSGKPNRSWR  383
            A+ALV YYPLAGR+    +    L+V C   GAVF EA   + T D+F + + +    WR
Sbjct  66   AKALVPYYPLAGRVRAKQEGSGLLEVVCLGQGAVFIEAVDRESTIDDF-ERAPRYVTQWR  124

Query  384  KLLYKVEAPTFLHIPPLVVQVS  449
            KLL    A     +PPLVVQ++
Sbjct  125  KLLSLYVADVLKGVPPLVVQLT  146



>ref|XP_011035903.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Populus 
euphratica]
Length=435

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 82/145 (57%), Gaps = 8/145 (6%)
 Frame = +3

Query  33   LPDCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RL  194
            + +  +     +I P+  TPS  L LS LD Q FLRF+++YL++F+    +D      R+
Sbjct  1    MANSVHVKEAVVIKPSEPTPSRVLSLSALDSQLFLRFTVEYLFVFKARPGLDQSLITTRV  60

Query  195  KCSLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNR  374
            K +LA+ LV YYPLAGR+   P     L+V C + GAVF EA  DLT ++F + + +   
Sbjct  61   KAALAKILVPYYPLAGRVRAKPGGS-SLEVVCRSQGAVFMEAVSDLTINDFDR-APRYVT  118

Query  375  SWRKLLYKVEAPTFLHIPPLVVQVS  449
             WRKLL    +      P LV+Q++
Sbjct  119  QWRKLLSLNVSDVLKGAPTLVIQLT  143



>ref|XP_008343629.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Malus 
domestica]
Length=456

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 77/135 (57%), Gaps = 7/135 (5%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF------RTSVAVDRLKCSLARALVD  224
             ++ P++ TP   L LS +D Q FLRF+I+YL ++        +    R+K +LA+ALV 
Sbjct  11   VVVTPSAPTPPCILNLSAVDSQLFLRFTIEYLLVYTPCPELNQASTASRVKAALAQALVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGR+ P PD    L+V C A GAVF EA  D  A    + + +    WRKLL    
Sbjct  71   YYPLAGRVRPKPDGF-SLEVVCRAQGAVFIEAVSDNVAVSNFERAPRYVTEWRKLLSLQV  129

Query  405  APTFLHIPPLVVQVS  449
            A  F   PPLVVQ++
Sbjct  130  ADVFKGAPPLVVQLT  144



>ref|XP_008374183.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase [Malus domestica]
Length=456

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 77/135 (57%), Gaps = 7/135 (5%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF------RTSVAVDRLKCSLARALVD  224
             ++ P++ TP   L LS +D Q FLRF+I+YL ++        +    R+K +LA+ALV 
Sbjct  11   VVVTPSAPTPPCILNLSAVDSQLFLRFTIEYLLVYTPCPELNQASTASRVKAALAQALVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGR+ P PD    L+V C A GAVF EA  D  A    + + +    WRKLL    
Sbjct  71   YYPLAGRVRPKPDGF-SLEVVCRAQGAVFIEAVSDNVAVSNFERAPRYVTEWRKLLSLQV  129

Query  405  APTFLHIPPLVVQVS  449
            A  F   PPLVVQ++
Sbjct  130  ADVFKGAPPLVVQLT  144



>ref|NP_181552.1| putative CoA-dependent acyltransferase [Arabidopsis thaliana]
 gb|AAD25938.1|AF085279_11 hypothetical protein [Arabidopsis thaliana]
 gb|AAM60946.1| putative anthranilate N-hydroxycinnamoyl/benzoyltransferase [Arabidopsis 
thaliana]
 gb|AEC09799.1| putative CoA-dependent acyltransferase [Arabidopsis thaliana]
Length=433

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 81/139 (58%), Gaps = 15/139 (11%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF------RTSVAVDRLKCSLARALVD  224
            T+I P+ +TPS  L LS LD Q FLRF+I+YL ++        S++  RLK +L+RALV 
Sbjct  11   TVITPSDQTPSSVLSLSALDSQLFLRFTIEYLLVYPPVSDPEYSLS-GRLKSALSRALVP  69

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNR---SWRKLL  392
            Y+P +GR+   PD    L+V+C   GA+F EA  D LT  +F     KP R   SWRKLL
Sbjct  70   YFPFSGRVREKPDGGGGLEVNCRGQGALFLEAVSDILTCLDF----QKPPRHVTSWRKLL  125

Query  393  YKVEAPTFLHIPPLVVQVS  449
                       PPLVVQ++
Sbjct  126  SLHVIDVLAGAPPLVVQLT  144



>ref|XP_009345174.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Pyrus 
x bretschneideri]
Length=456

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 76/135 (56%), Gaps = 7/135 (5%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF------RTSVAVDRLKCSLARALVD  224
             ++ P++ TP   L LS +D Q FLRF+I+YL ++        +    R+K +LA+ALV 
Sbjct  11   VMVTPSAPTPPCILNLSAVDSQLFLRFTIEYLLIYTPCPELNQASTASRVKAALAQALVS  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGR+ P PD    L+V C A GAVF EA  D  A    + + +    WRKLL    
Sbjct  71   YYPLAGRVRPKPDGF-SLEVVCRAQGAVFIEAVSDNVAVSNFERAPRYVTEWRKLLSPQL  129

Query  405  APTFLHIPPLVVQVS  449
            A      PPLVVQ++
Sbjct  130  ADVLKGAPPLVVQLT  144



>gb|EYU20037.1| hypothetical protein MIMGU_mgv1a006627mg [Erythranthe guttata]
Length=437

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 74/145 (51%), Gaps = 12/145 (8%)
 Frame = +3

Query  42   CFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR-------TSVAVDRLKC  200
            C +     +I P   TP+H L LS LD Q F+RF+ +YL +++        +   D +K 
Sbjct  6    CVHVKEAVVIGPCKPTPNHILQLSALDSQLFVRFTFEYLLVYKPRCGSFDKATVTDNVKS  65

Query  201  SLARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRS-  377
            +L RALV YYPLAGR+   PD    L+V C   GAVF  A  D TA       G P R  
Sbjct  66   ALGRALVPYYPLAGRVRARPDGS-GLEVVCRGQGAVFISAVSDSTAAS--DFDGAPCRRA  122

Query  378  -WRKLLYKVEAPTFLHIPPLVVQVS  449
             WRK L    A      PPLVVQ++
Sbjct  123  MWRKFLSFHVADVLKGGPPLVVQLT  147



>ref|XP_003600946.1| Taxadien-5-alpha-ol O-acetyltransferase [Medicago truncatula]
 gb|AES71197.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=434

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 83/137 (61%), Gaps = 11/137 (8%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVD  224
             ++ P+  TP+  L LS LD Q FLRF+++YL ++R    +D      RLK +LARALV 
Sbjct  11   VVVTPSEPTPNCVLSLSALDSQLFLRFTVEYLLVYRPGPGLDKVATTSRLKAALARALVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNRSWRKLLYKV  401
            YYPLAGR+ P   D+  L+V C A GAVF EA  D  T ++F + + K    WR+LL   
Sbjct  71   YYPLAGRVRPS-SDNLGLEVVCKAQGAVFIEAVSDRYTVNDF-EKAPKTVAQWRRLL-SF  127

Query  402  EAPTFLHI-PPLVVQVS  449
              P  L+  PPL++Q++
Sbjct  128  SVPDVLNGSPPLILQLT  144



>ref|XP_007141748.1| hypothetical protein PHAVU_008G222300g [Phaseolus vulgaris]
 gb|ESW13742.1| hypothetical protein PHAVU_008G222300g [Phaseolus vulgaris]
Length=439

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 79/136 (58%), Gaps = 9/136 (7%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVD  224
            ++I P+  TP   L LS LD Q FLRF+I+YL +++    +D      RLK +LARALV 
Sbjct  11   SVITPSEPTPRGVLALSALDSQLFLRFTIEYLLVYKPCPGLDQPNTTARLKSALARALVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAF-MDLTADEFIQLSGKPNRSWRKLLYKV  401
            YYP AGR+ P P+  + L+V C   GAVF EAF     A++F + + K    WR LL   
Sbjct  71   YYPFAGRVRPRPEG-QGLEVVCAGQGAVFIEAFAASYNANDF-EKAPKTVTHWRPLLSLH  128

Query  402  EAPTFLHIPPLVVQVS  449
             A      PPLVVQ++
Sbjct  129  VADVLKGSPPLVVQLT  144



>ref|XP_007008914.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
 gb|EOY17724.1| HXXXD-type acyl-transferase family protein [Theobroma cacao]
Length=446

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 74/138 (54%), Gaps = 14/138 (10%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVD  224
            T++ P   TPS  L LS LD Q FLRF+I+YL ++     +D      R+K +L +ALV 
Sbjct  11   TIVTPCEPTPSRVLSLSALDSQLFLRFTIEYLLVYEGHPGLDQRATVARVKAALGKALVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNR---SWRKLLY  395
            YYP AGR+   PD    L+V C A G  F EA  D + +EF    G+  R    WRK L 
Sbjct  71   YYPFAGRVRAKPDGS-GLEVVCRAQGVWFVEASSDHSVNEF----GRAPRFVTQWRKFLS  125

Query  396  KVEAPTFLHIPPLVVQVS  449
               A      PPLVVQ++
Sbjct  126  FQVADVLKGAPPLVVQLT  143



>ref|XP_011076829.1| PREDICTED: LOW QUALITY PROTEIN: taxadien-5-alpha-ol O-acetyltransferase 
[Sesamum indicum]
Length=417

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 75/137 (55%), Gaps = 21/137 (15%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARALVD  224
             LI P+  TP+H L LS LD Q F+RF+ +YL +++    +DR      +K +L RALV 
Sbjct  11   VLITPSEPTPNHILQLSALDSQLFVRFTFEYLLVYKPRHGLDRAATTENVKSALGRALVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNR--SWRKLLYK  398
            YYPLAGR+     D   L+V C   GAVF +A  D T  EF    G P R   WRK    
Sbjct  71   YYPLAGRVRN-RVDGLGLEVVCRGQGAVFIDAISDSTVSEF---DGAPRRRAQWRK----  122

Query  399  VEAPTFLHIPPLVVQVS  449
                 FL + PLVVQ++
Sbjct  123  -----FLSLXPLVVQLT  134



>ref|XP_006411279.1| hypothetical protein EUTSA_v10016665mg [Eutrema salsugineum]
 gb|ESQ52732.1| hypothetical protein EUTSA_v10016665mg [Eutrema salsugineum]
Length=441

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 80/143 (56%), Gaps = 15/143 (10%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF----RTSVAVDRLKCSLARALVDYY  230
            T+I P+ +TPS  L LS LD Q FLRF+I+YL +F     +    DRLK +L+RALV Y+
Sbjct  11   TVITPSDQTPSSVLSLSALDSQLFLRFTIEYLLVFPPFSDSDSLSDRLKSALSRALVPYF  70

Query  231  PLAGRLTPCPD---------DHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNRSW  380
            P +GR+   PD             L+V+C   GA+F EA  D LT  +F Q + +   SW
Sbjct  71   PFSGRVRERPDGGGGGGGGGGGGSLEVNCRGQGALFLEAISDHLTCLDF-QKAPRHVNSW  129

Query  381  RKLLYKVEAPTFLHIPPLVVQVS  449
            RKLL           PPLVVQ++
Sbjct  130  RKLLSLNVIDVLAGAPPLVVQLT  152



>ref|XP_002528319.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
 gb|EEF34077.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
Length=438

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 85/149 (57%), Gaps = 14/149 (9%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVDY  227
            +I P+S TP+  L LS LD Q FLRF+I+YL +F+    +D      R+K +LA  LV Y
Sbjct  13   VIKPSSPTPTRLLSLSALDSQLFLRFTIEYLLVFKARPGLDYGSITARVKSALANILVPY  72

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNRSWRKLLYKVE  404
            YPLAGR+   PD    L+V C   GAVF EA  D +T ++F + + +    WRKLL    
Sbjct  73   YPLAGRVRAKPDGS-NLEVICRGQGAVFIEAISDSITVNDFDK-APRYVTQWRKLLSFHV  130

Query  405  APTFLHIPPLVVQVS-----SSPYSLCFT  476
            A      P LV+Q++     ++  S+CF+
Sbjct  131  ADVLQGAPLLVIQLTWLKDGAASLSVCFS  159



>emb|CDP22130.1| unnamed protein product [Coffea canephora]
Length=161

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 73/138 (53%), Gaps = 7/138 (5%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA----VDRLKCSLARALVDY  227
            P L+ P   TP     LS++DDQ  LRF I  +  +R+       V  ++ ++A+ALV Y
Sbjct  15   PELVRPAKSTPRECKVLSDIDDQEGLRFQIPVIQFYRSDDGRRDPVKVIREAIAKALVFY  74

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV-E  404
            YP AGRL  C    RKL VDC   G +F EA  ++T +++      P     +LLY V E
Sbjct  75   YPFAGRLRECA--RRKLVVDCTGEGVMFIEADAEVTLEQYGDELQPPFPCLEELLYDVPE  132

Query  405  APTFLHIPPLVVQVSSSP  458
            +   LH P L++QV   P
Sbjct  133  SAGVLHCPLLLIQVQPKP  150



>ref|XP_010667734.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Beta vulgaris subsp. vulgaris]
Length=262

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 75/143 (52%), Gaps = 14/143 (10%)
 Frame = +3

Query  57   TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT-----SVAVDR------LKCS  203
            TP LI P   TP     LSN+DDQ  LRF I  +  +R      S  V R      +K +
Sbjct  20   TPELITPAVSTPYEFKELSNIDDQEALRFHIPIILFYRNNNSSKSTVVGRQDPARVIKEA  79

Query  204  LARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWR  383
            +A+ALV YYP AGRL   P+  RKL V+CN  G +F EA  D+T +EF  +   P    +
Sbjct  80   VAKALVPYYPFAGRLREKPE--RKLVVECNGEGIIFIEADADVTLEEFGDIIQPPFPLKQ  137

Query  384  KLLYKVEAPT-FLHIPPLVVQVS  449
             L Y V   T FL  P L+ QV+
Sbjct  138  LLFYDVPGSTAFLDTPLLLFQVT  160



>ref|XP_010508892.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Camelina 
sativa]
Length=436

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 80/141 (57%), Gaps = 16/141 (11%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVD  224
            T+I P+ +TPS  L LS LD Q FLRF+I+YL ++   V+        RLK +L+RALV 
Sbjct  11   TVITPSDQTPSSVLSLSALDSQLFLRFTIEYLLVYPLPVSDQDYSLSARLKSALSRALVS  70

Query  225  YYPLAGRLTPCPD--DHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNR---SWRK  386
            Y+P +GR+   PD      L+V+C   GA+F EA  D LT  +F     KP R   SWRK
Sbjct  71   YFPFSGRVRERPDGCGGGGLEVNCRGQGALFLEAVSDVLTCLDF----QKPPRHVTSWRK  126

Query  387  LLYKVEAPTFLHIPPLVVQVS  449
            LL           PPLVVQ++
Sbjct  127  LLSLHVIDVLAGAPPLVVQLT  147



>ref|XP_010554116.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
 ref|XP_010554117.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
 ref|XP_010554118.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
 ref|XP_010554119.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
 ref|XP_010554120.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Tarenaya 
hassleriana]
Length=438

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 77/136 (57%), Gaps = 10/136 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVD  224
            PTL+ P S+T      LSNLD QN +   ++ +Y F++       A D LK +L++ LV 
Sbjct  21   PTLVKPISETQKGLYFLSNLD-QN-IAVIVRTIYCFKSEEKGNEEAADVLKNALSKVLVH  78

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV-  401
            YYPLAGRLT CP+   KL VDC   G VF EA  + T DE   ++     +  KL+Y V 
Sbjct  79   YYPLAGRLTICPEG--KLIVDCTEEGVVFVEAEANCTMDEIGDITKPKPETLGKLVYDVP  136

Query  402  EAPTFLHIPPLVVQVS  449
            +A   L IPP+  QV+
Sbjct  137  DAKNILEIPPVTAQVT  152



>ref|XP_006435775.1| hypothetical protein CICLE_v10031495mg [Citrus clementina]
 ref|XP_006486292.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Citrus 
sinensis]
 gb|ESR49015.1| hypothetical protein CICLE_v10031495mg [Citrus clementina]
Length=456

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 79/142 (56%), Gaps = 8/142 (6%)
 Frame = +3

Query  45   FYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTS------VAVDRLKCSL  206
             +    T+I P+  TPS  L LS LD Q FLRF+I+YL ++R        V V R+K +L
Sbjct  6    LHGKEATVIYPSETTPSTVLSLSALDSQLFLRFTIEYLLVYRPRPGLDPLVTVARVKSAL  65

Query  207  ARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAF-MDLTADEFIQLSGKPNRSWR  383
            A+ALV YYPLAGR+    D    L+V C   GAVF EA   + T ++F + + +    WR
Sbjct  66   AKALVPYYPLAGRVRAKQDGSGLLEVVCLGQGAVFIEAVDRESTINDF-ERAPRYVTQWR  124

Query  384  KLLYKVEAPTFLHIPPLVVQVS  449
            KLL    A      P LVVQ++
Sbjct  125  KLLSLYVADVLKGAPLLVVQLT  146



>ref|XP_007217976.1| hypothetical protein PRUPE_ppa005418mg [Prunus persica]
 gb|EMJ19175.1| hypothetical protein PRUPE_ppa005418mg [Prunus persica]
Length=462

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 74/135 (55%), Gaps = 7/135 (5%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF------RTSVAVDRLKCSLARALVD  224
             ++ P+  TP+  L LS++D Q FLRF+I+YL ++             R+K +LA+ALV 
Sbjct  11   VVVAPSEPTPTCVLNLSSIDSQLFLRFTIEYLLVYAPRPVLNQEATTSRVKSALAKALVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGR+ P  D    L+V C A GAVF EA  D       + + +    WRKLL    
Sbjct  71   YYPLAGRVRPKADGS-SLEVVCRAQGAVFIEAVSDRATLSDFERAPRYVAQWRKLLSLQV  129

Query  405  APTFLHIPPLVVQVS  449
            A      PPLVVQ++
Sbjct  130  ADVLKGAPPLVVQLT  144



>ref|XP_010668237.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=174

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 86/154 (56%), Gaps = 15/154 (10%)
 Frame = +3

Query  57   TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR---TSVAVDR------LKCSLA  209
            TP LI P   TP     LS++DDQ  LR+ I ++  +R   T + + R      LK ++A
Sbjct  22   TPELIRPAEPTPYEFKELSDIDDQESLRYQIPFIQFYRNESTHMHMGRRDPVRVLKEAVA  81

Query  210  RALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKL  389
            +ALV YYPLAGRL       RKL+V+CN  G +F EA  D+T ++F  +  +P      L
Sbjct  82   KALVPYYPLAGRLR--EKSGRKLEVECNGEGIIFIEADADVTLEDFGDII-QPPFPLEDL  138

Query  390  LYKVEAPT-FLHIPPLVVQVSSSPYSLCFTSTKT  488
            L+ V   T  L  P +++QV+++  +L F  TKT
Sbjct  139  LFDVPGSTAILGTPLILMQVTAN--TLIFKCTKT  170



>ref|XP_009133424.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Brassica 
rapa]
 emb|CDY07613.1| BnaA03g18980D [Brassica napus]
Length=430

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 82/140 (59%), Gaps = 16/140 (11%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR-----TSVAVDRLKCSLARALVDY  227
            T+I P+ +TPS  L LS LD Q FLRF+I+YL ++       S++ DRLK +L+RALV Y
Sbjct  11   TVITPSDQTPSTVLSLSALDSQLFLRFTIEYLLVYSPVSDPVSLS-DRLKSALSRALVPY  69

Query  228  YPLAGRLTPCPD--DHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNR---SWRKL  389
            +P +GR+   PD      L+V+C   GA+F EA  D LT  +F     KP R   SWRKL
Sbjct  70   FPFSGRVRERPDGGGGGGLEVNCRGQGALFLEAASDHLTCLDF----HKPPRHVTSWRKL  125

Query  390  LYKVEAPTFLHIPPLVVQVS  449
            L           PPLVVQ++
Sbjct  126  LSLNVIDVLAGAPPLVVQLT  145



>ref|XP_004498041.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=251

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 80/152 (53%), Gaps = 9/152 (6%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF------RTSVAVDRLKCSLARALV  221
            P L+ P+  TP+ +  LS++DDQ+ LRF I  +  +      +    VD ++ +LA+ LV
Sbjct  14   PELVKPSKPTPNETKLLSDIDDQDGLRFQIPVVQFYNYDPNMKGKDPVDVIRKALAKTLV  73

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYP AGRL    D  RKL VDCN  G +F EA  D++ +EF      P   W +LL+ V
Sbjct  74   FYYPFAGRLREGND--RKLMVDCNGEGVLFIEADADVSVEEFGGQLQPPFPCWDQLLFDV  131

Query  402  EAPT-FLHIPPLVVQVSSSPYSLCFTSTKTAF  494
               +  ++ P L++Q +     L    T+  F
Sbjct  132  PGSSQVINTPLLLIQFTVVRSYLVSDVTRAGF  163



>ref|XP_010554673.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Tarenaya 
hassleriana]
Length=437

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 78/136 (57%), Gaps = 9/136 (7%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVD  224
            T++ P+  TPS  L LS LD Q FLRF+I+YL+++R     D      R+K +L+R+LV 
Sbjct  11   TVVTPSDPTPSSVLSLSALDSQLFLRFTIEYLFVYRPRPGSDPVSLTGRVKSALSRSLVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNRSWRKLLYKV  401
            Y+P AGR+     D   L+V C   GA+F EA  D LT  +F Q + +   SWRKLL   
Sbjct  71   YFPFAGRVRE-RSDGSGLEVLCRGQGALFLEAVSDNLTCHDF-QRAPRHVTSWRKLLSLN  128

Query  402  EAPTFLHIPPLVVQVS  449
                    PPLVVQ++
Sbjct  129  VGDVLAGGPPLVVQLT  144



>ref|XP_009369195.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Pyrus x bretschneideri]
Length=443

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 74/135 (55%), Gaps = 7/135 (5%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF------RTSVAVDRLKCSLARALVD  224
             ++ P+  TP+  L LS +D Q FLRF+I+YL ++        +    R+K +LA ALV 
Sbjct  11   VVVTPSDPTPTCVLNLSAVDSQLFLRFTIEYLLVYTPCPGLNQASTASRVKAALAHALVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGR+ P PD    LQV C A GAVF EA     A    + + +    WRKLL    
Sbjct  71   YYPLAGRVRPKPDGS-SLQVVCRAQGAVFIEAVSYNVAVSDFERAPRYVAEWRKLLSLQV  129

Query  405  APTFLHIPPLVVQVS  449
            A      PPLVVQ++
Sbjct  130  ADVLKGAPPLVVQLT  144



>emb|CDY07068.1| BnaA04g22470D [Brassica napus]
Length=430

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 82/135 (61%), Gaps = 9/135 (7%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR-----TSVAVDRLKCSLARALVDY  227
            T+I P+ +TPS  L LS LD Q FLRF+I+YL ++       S++  RLK +L+RALV Y
Sbjct  11   TVITPSDQTPSCVLSLSALDSQLFLRFTIEYLLVYSPVSDPVSLS-GRLKSALSRALVPY  69

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNRSWRKLLYKVE  404
            +P +GR+   P+D   L+V+C   GA+F EA  D LT  +F + + +   SWRKLL    
Sbjct  70   FPFSGRVRERPNDG-SLEVNCRGQGALFLEAVTDHLTCLDFHK-APRHVTSWRKLLSLNV  127

Query  405  APTFLHIPPLVVQVS  449
                   PPLVVQ++
Sbjct  128  VDVLAGAPPLVVQLT  142



>ref|XP_004966401.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Setaria 
italica]
Length=450

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 75/132 (57%), Gaps = 10/132 (8%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARALV  221
            P L+ P   TP  + PLS++DD   +RF    ++L+R   A         ++ +LARALV
Sbjct  17   PVLVVPAEPTPRETKPLSDIDDAEGMRFYSSGIHLYRADQARAGQDPARVVREALARALV  76

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL    ++ RKL VDC A G +FAEA  DLTAD+F  +   P   + + +  +
Sbjct  77   PYYPLAGRLRE--EEGRKLVVDCAAQGVMFAEADADLTADDFGDVKSPPFPCFERFI--L  132

Query  402  EAPTFLHIPPLV  437
            E+ T   + P+V
Sbjct  133  ESTTIAGVEPVV  144



>ref|XP_010517439.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Camelina 
sativa]
Length=435

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 80/140 (57%), Gaps = 15/140 (11%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARALVD  224
            T+I P+ +TPS  L LS LD Q FLRF+I+YL ++   V+        RLK +L+RALV 
Sbjct  11   TVITPSDQTPSSVLSLSALDSQLFLRFTIEYLLVYPPPVSDPDYSLSARLKSALSRALVP  70

Query  225  YYPLAGRLTPCPDD-HRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNR---SWRKL  389
            Y+P +GR+   PD     L+V+C   GA+F EA  D LT  +F     KP R   SWRKL
Sbjct  71   YFPFSGRVRERPDGCGGGLEVNCRGQGALFLEAVSDVLTCLDF----QKPPRHVNSWRKL  126

Query  390  LYKVEAPTFLHIPPLVVQVS  449
            L           PPLVVQ++
Sbjct  127  LSLHVIDVLAGAPPLVVQLT  146



>ref|XP_003518437.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Glycine 
max]
Length=440

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 74/135 (55%), Gaps = 7/135 (5%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVD  224
            +++ P+  TPS  L LS LD Q FLRF+I+YL ++     +D      RLK +LA+ALV 
Sbjct  11   SVVTPSEPTPSSVLALSALDSQLFLRFTIEYLLVYNPCPGLDQAATTARLKAALAQALVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYP AGR+   PD    L+V C A GAVF EA  D       + + K    WR LL    
Sbjct  71   YYPFAGRVRTRPDGP-GLEVVCGAQGAVFIEASADRYNVNDFEKAPKAVAHWRSLLSLHV  129

Query  405  APTFLHIPPLVVQVS  449
            A      PPLVVQ++
Sbjct  130  ADVLKGSPPLVVQLT  144



>ref|XP_002438993.1| hypothetical protein SORBIDRAFT_10g029610 [Sorghum bicolor]
 gb|EER90360.1| hypothetical protein SORBIDRAFT_10g029610 [Sorghum bicolor]
Length=450

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 86/163 (53%), Gaps = 16/163 (10%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARALV  221
            P L+ P+S TP  + PLS++DD   +RF    ++L+R + A         ++ +LA+ALV
Sbjct  17   PVLVAPSSPTPRETKPLSDIDDSEGMRFYSSGIHLYRANPAKAGQDPATVIREALAQALV  76

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL     + RKL VDC A G +FAEA  DLTAD+F  +   P   + + +  +
Sbjct  77   PYYPLAGRLREV--EGRKLVVDCAAQGVLFAEADADLTADDFGDVQSPPFPCFEQFI--L  132

Query  402  EAPTFLHIPPLV------VQVSSSPYSLCFTSTKTAFCVYNRP  512
            E+ T   + P+V      VQV+           +   CV + P
Sbjct  133  ESTTVAGVEPVVDRPLLYVQVTRLACGGFIFGQRFCHCVVDAP  175



>emb|CDY52430.1| BnaC03g72540D [Brassica napus]
Length=430

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 82/140 (59%), Gaps = 16/140 (11%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR-----TSVAVDRLKCSLARALVDY  227
            T+I P+ +TPS  L LS LD Q FLRF+I+YL ++       S++ DRLK +L+RALV Y
Sbjct  11   TVITPSDQTPSTVLSLSALDSQLFLRFTIEYLLVYSPVSDPVSLS-DRLKSALSRALVPY  69

Query  228  YPLAGRLTPCPD--DHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNR---SWRKL  389
            +P +GR+   PD      L+V+C   GA+F EA  + LT  +F     KP R   SWRKL
Sbjct  70   FPFSGRVRERPDGGGGGGLEVNCRGQGALFLEAVSNHLTCLDF----QKPPRHVSSWRKL  125

Query  390  LYKVEAPTFLHIPPLVVQVS  449
            L           PPLVVQ++
Sbjct  126  LSLNVIDVLAGAPPLVVQLT  145



>ref|XP_008355546.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Malus 
domestica]
Length=458

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 77/136 (57%), Gaps = 9/136 (7%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF-------RTSVAVDRLKCSLARALV  221
             ++ P+  TP+  L LS +D Q FLRF+I+YL ++       +TS A  R+K +LA ALV
Sbjct  11   VVVTPSDPTPTCVLNLSAVDSQLFLRFTIEYLLVYTPCPGLNQTSTA-SRVKAALAHALV  69

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGR+ P PD    L+V C A GAVF EA     A    + + +    WRKLL   
Sbjct  70   PYYPLAGRVHPKPDG-SSLEVVCRAQGAVFIEAVSYNVAVSDFERAPRYVAEWRKLLSLQ  128

Query  402  EAPTFLHIPPLVVQVS  449
             A      PPLVVQ++
Sbjct  129  VADVLKGAPPLVVQLT  144



>ref|XP_008233784.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase [Prunus mume]
Length=461

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 73/135 (54%), Gaps = 7/135 (5%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF------RTSVAVDRLKCSLARALVD  224
             ++ P+  TP+  L LS +D Q FLRF+I+YL ++             R+K +LA+ALV 
Sbjct  11   VVVAPSEPTPTCVLNLSAIDSQLFLRFTIEYLLVYAPRPVLNQEATTTRVKTALAKALVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGR+ P  D    L+V C A GAVF EA  D       + + +    WRKLL    
Sbjct  71   YYPLAGRVRPKADGS-SLEVVCRAQGAVFIEAVSDRATLSDFERAPRYVAQWRKLLSLQV  129

Query  405  APTFLHIPPLVVQVS  449
            A      PPLVVQ++
Sbjct  130  ADVLKGAPPLVVQLT  144



>ref|XP_006295748.1| hypothetical protein CARUB_v10024868mg [Capsella rubella]
 gb|EOA28646.1| hypothetical protein CARUB_v10024868mg [Capsella rubella]
Length=432

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 82/139 (59%), Gaps = 16/139 (12%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF------RTSVAVDRLKCSLARALVD  224
            T+I P+ +TPS  L LS LD Q FLRF+I+YL ++        S++V RLK +L+RALV 
Sbjct  11   TVITPSDQTPSSVLSLSALDSQLFLRFTIEYLLVYPPVSDPDYSLSV-RLKSALSRALVP  69

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNR---SWRKLL  392
            Y+P +GR+   PD    L+V+C   GA+F EA  + LT  +F     KP R   SWRKLL
Sbjct  70   YFPFSGRVREKPDGG-GLEVNCRGQGALFLEAVSNILTCLDF----QKPPRHVTSWRKLL  124

Query  393  YKVEAPTFLHIPPLVVQVS  449
                       PPLVVQ++
Sbjct  125  SLHVIDVLAGAPPLVVQLT  143



>ref|XP_009141876.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Brassica 
rapa]
Length=430

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 82/138 (59%), Gaps = 15/138 (11%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR-----TSVAVDRLKCSLARALVDY  227
            T+I P+ +TPS  L LS LD Q FLRF+I+YL ++       S++  RLK +L+RALV Y
Sbjct  11   TVITPSDQTPSCVLSLSALDSQLFLRFTIEYLLVYSPVSDPVSLS-GRLKSALSRALVPY  69

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNR---SWRKLLY  395
            +P +GR+   P+    L+V+C + GA+F EA  D LT  +F     KP R   SWRKLL 
Sbjct  70   FPFSGRVRERPNGG-SLEVNCRSQGALFLEAVTDHLTCLDF----QKPPRHVTSWRKLLS  124

Query  396  KVEAPTFLHIPPLVVQVS  449
                      PPLVVQ++
Sbjct  125  LNVVDVLAGAPPLVVQLT  142



>ref|XP_002437575.1| hypothetical protein SORBIDRAFT_10g029620 [Sorghum bicolor]
 gb|EER88942.1| hypothetical protein SORBIDRAFT_10g029620 [Sorghum bicolor]
Length=450

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 87/163 (53%), Gaps = 16/163 (10%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARALV  221
            P L+ P+S TP  + PLS++DD   +RF    ++L+R + +         ++ +LA+ALV
Sbjct  17   PVLVAPSSPTPRETKPLSDIDDSEGMRFYSSGIHLYRANPSKAGQDPATVIREALAQALV  76

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL     + RKL VDC A G +FAEA +DLTAD+F  +   P   + + +  +
Sbjct  77   PYYPLAGRLREV--EGRKLVVDCAAQGVLFAEADVDLTADDFGDVQSPPFPCFEQFI--L  132

Query  402  EAPTFLHIPPLV------VQVSSSPYSLCFTSTKTAFCVYNRP  512
            E+ T   + P+V      VQV+           +   CV + P
Sbjct  133  ESTTVAGVEPVVDRPLLYVQVTRLACGGFIFGQRFCHCVVDAP  175



>emb|CDP21409.1| unnamed protein product [Coffea canephora]
Length=456

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 74/135 (55%), Gaps = 7/135 (5%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA----VDRLKCSLARALVDY  227
            P L+ P   TP     LS++DDQ  LRF I  +  +R+       V  ++ ++A+ALV Y
Sbjct  15   PELVRPAKSTPRECKLLSDIDDQEGLRFQIPVIQFYRSDDGRRDPVKVIREAIAKALVFY  74

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV-E  404
            YP AGRL  C    RKL VDC   G +F EA  ++T ++F +    P     +LLY V E
Sbjct  75   YPFAGRLRECAG--RKLVVDCTGEGVMFIEADAEVTLEQFGEELQPPFPCLEELLYDVPE  132

Query  405  APTFLHIPPLVVQVS  449
            +   LH P L++QV+
Sbjct  133  SAGVLHCPLLLIQVT  147



>ref|XP_004498016.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=463

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 77/137 (56%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF------RTSVAVDRLKCSLARALV  221
            P L+ P+  TP+ +  LS++DDQ+ LRF I  +  +      +    VD ++ +LA+ LV
Sbjct  14   PELVKPSKPTPNETKLLSDIDDQDGLRFQIPVVQFYNYDPNMKGKDPVDVIRKALAKTLV  73

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYP AGRL    D  RKL VDCN  G +F EA  D++ +EF      P   W +LL+ V
Sbjct  74   FYYPFAGRLREGND--RKLMVDCNGEGVLFIEADADVSVEEFGGQLQPPFPCWDQLLFDV  131

Query  402  EAPT-FLHIPPLVVQVS  449
               +  ++ P L++QV+
Sbjct  132  PGSSQVINTPLLLIQVT  148



>emb|CDX93209.1| BnaC04g46870D [Brassica napus]
Length=430

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 81/135 (60%), Gaps = 9/135 (7%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR-----TSVAVDRLKCSLARALVDY  227
            T+I P+ +TPS  L LS LD Q FLRF+I+YL ++       S++  RLK SL+RALV Y
Sbjct  11   TVITPSDQTPSCVLSLSALDSQLFLRFTIEYLLVYSPVSNPVSLS-GRLKSSLSRALVPY  69

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNRSWRKLLYKVE  404
            +P +GR+   P+    L+V+C   GA+F EA  D LT  +F + + +   SWRKLL    
Sbjct  70   FPFSGRVRERPNGG-SLEVNCRGQGALFLEAVTDHLTCLDFHK-APRHVTSWRKLLSLNV  127

Query  405  APTFLHIPPLVVQVS  449
                   PPLVVQ++
Sbjct  128  VDVLAGAPPLVVQLT  142



>ref|XP_010689438.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Beta 
vulgaris subsp. vulgaris]
Length=441

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 76/135 (56%), Gaps = 13/135 (10%)
 Frame = +3

Query  69   IPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVDYY  230
            I P+  TP+ +L LS LD Q FLRF+I+YL ++  S  +D      R+K +L RALV YY
Sbjct  14   ITPSQPTPNCTLSLSTLDSQLFLRFTIEYLLVYNPSHGLDRRQFVARIKSALGRALVQYY  73

Query  231  PLAGRLTPCPDDHRK--LQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            PLAGR+     + R   LQV C A GAVF EA       +F + + +    WR+LL+   
Sbjct  74   PLAGRV----QERRGGPLQVVCRAQGAVFVEAVSGYKRPDF-ERAPRYVEEWRQLLWLQV  128

Query  405  APTFLHIPPLVVQVS  449
                   PPLVVQ++
Sbjct  129  DDVLKGDPPLVVQLT  143



>emb|CDY54990.1| BnaCnng27890D [Brassica napus]
Length=430

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 80/138 (58%), Gaps = 17/138 (12%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR-----TSVAVDRLKCSLARALVDY  227
            T+I P+ +TPS  L LS LD Q FLRF+I+YL ++       S++  RLK +L+RALV Y
Sbjct  11   TVINPSDQTPSTVLSLSALDSQLFLRFTIEYLLVYSPVSDPVSLS-GRLKSALSRALVPY  69

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNR---SWRKLLY  395
            +P +GR+    D    L+V+C   GA+F EA  D LT  +F     KP R   SWRKLL 
Sbjct  70   FPFSGRVR---DGGGSLEVNCRGQGALFLEAVTDHLTCLDF----QKPPRHVTSWRKLLS  122

Query  396  KVEAPTFLHIPPLVVQVS  449
                      PPLVVQ++
Sbjct  123  LNVIDVLAGAPPLVVQLT  140



>ref|XP_010507658.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like, partial 
[Camelina sativa]
Length=421

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 78/139 (56%), Gaps = 16/139 (12%)
 Frame = +3

Query  69   IPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARALVDYY  230
            I P+ +TPS  L LS LD Q FLRF+I+YL ++   V+        RLK +L+RALV Y+
Sbjct  1    ITPSDQTPSSVLSLSALDSQLFLRFTIEYLLVYPPPVSDPDYSLSARLKSALSRALVSYF  60

Query  231  PLAGRLTPCPD--DHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNR---SWRKLL  392
            P +GR+   PD      L+V+C   GA+F EA  D LT  +F     KP R   SWRKLL
Sbjct  61   PFSGRVRERPDGCGGGGLEVNCRGQGALFLEAVSDVLTCLDF----QKPPRHVTSWRKLL  116

Query  393  YKVEAPTFLHIPPLVVQVS  449
                       PPLVVQ++
Sbjct  117  SLHVIDVLAGAPPLVVQLT  135



>ref|XP_004966402.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Setaria 
italica]
Length=446

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 75/132 (57%), Gaps = 10/132 (8%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARALV  221
            P L+ P   TP  + PLS++DD   +RF    ++L+R + A         ++ +LARALV
Sbjct  15   PVLVSPAEPTPRETKPLSDIDDGEGMRFYSSGIHLYRANPAKAGQDPARVIRDALARALV  74

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL    +  RKL VDC A G +FAEA  DLTAD+F  +   P   + + +  +
Sbjct  75   PYYPLAGRLRE--EGGRKLVVDCAAQGVMFAEADADLTADDFGDVQSPPFPCFERFI--L  130

Query  402  EAPTFLHIPPLV  437
            E+ +   + P+V
Sbjct  131  ESTSIAGVEPVV  142



>ref|XP_006856294.1| hypothetical protein AMTR_s00047p00102350 [Amborella trichopoda]
 gb|ERN17761.1| hypothetical protein AMTR_s00047p00102350 [Amborella trichopoda]
Length=433

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 73/131 (56%), Gaps = 5/131 (4%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDRLKCSLARALVDYYPLA  239
            PTL+PP  +TP     LSNLD QN +   +K +Y +R       +K +LA+ LVD+YP +
Sbjct  22   PTLVPPEKETPKGLYFLSNLD-QN-IAVIVKTVYCYRAVEEKSEIKQALAKVLVDFYPFS  79

Query  240  GRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV-EAPTF  416
            GRLT   +   KL VDC   GA+F EA  +   ++   +S     +  KL+Y V  A   
Sbjct  80   GRLTISSEG--KLIVDCTGEGALFVEAVAECEIEKLGDISQPDPSTLEKLVYDVPGAKNI  137

Query  417  LHIPPLVVQVS  449
            L IPPLV QV+
Sbjct  138  LEIPPLVAQVT  148



>ref|XP_010528158.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X2 [Tarenaya hassleriana]
Length=439

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 79/136 (58%), Gaps = 10/136 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVD  224
            PTL+ P S+T      LSNLD QN +   I+ +Y F++       AVD +K +L++ LV 
Sbjct  22   PTLVKPESETQKGLYFLSNLD-QN-IAVIIRTIYCFKSGEKGNEDAVDVIKNALSKVLVH  79

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV-  401
            YYPL+GR+T  P+   KL VDC+  G VF EA  + + DE   ++     +  KL+Y V 
Sbjct  80   YYPLSGRITISPEG--KLTVDCSEEGVVFVEAEANCSMDEIGDITKPEPDTLGKLVYDVP  137

Query  402  EAPTFLHIPPLVVQVS  449
            +A T L IPP+  QV+
Sbjct  138  DAKTILEIPPVTAQVT  153



>ref|XP_010528157.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
isoform X1 [Tarenaya hassleriana]
Length=450

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 79/136 (58%), Gaps = 10/136 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVD  224
            PTL+ P S+T      LSNLD QN +   I+ +Y F++       AVD +K +L++ LV 
Sbjct  33   PTLVKPESETQKGLYFLSNLD-QN-IAVIIRTIYCFKSGEKGNEDAVDVIKNALSKVLVH  90

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV-  401
            YYPL+GR+T  P+   KL VDC+  G VF EA  + + DE   ++     +  KL+Y V 
Sbjct  91   YYPLSGRITISPEG--KLTVDCSEEGVVFVEAEANCSMDEIGDITKPEPDTLGKLVYDVP  148

Query  402  EAPTFLHIPPLVVQVS  449
            +A T L IPP+  QV+
Sbjct  149  DAKTILEIPPVTAQVT  164



>ref|XP_011085895.1| PREDICTED: LOW QUALITY PROTEIN: benzyl alcohol O-benzoyltransferase-like 
[Sesamum indicum]
Length=466

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 77/143 (54%), Gaps = 14/143 (10%)
 Frame = +3

Query  57   TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARAL  218
             P LIPP   TP    PLS++DDQ  LRF I  +  +R + A++R      ++ +LARAL
Sbjct  15   NPELIPPAKPTPHELKPLSDIDDQEGLRFQIPLIQFYRRNPAMNRKDPVMVIRDALARAL  74

Query  219  VDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGK-----PNRSWR  383
            V YYP AGRL       RKL V+C   G +F EA  D+T  +F   S       P     
Sbjct  75   VFYYPFAGRLREAAG--RKLVVECTGEGVLFIEADADVTLQQFGDASSAVPLQPPFPCLE  132

Query  384  KLLYKV-EAPTFLHIPPLVVQVS  449
            +LLY V E+   ++ P L++QV+
Sbjct  133  ELLYDVPESAGVVNCPLLLIQVT  155



>ref|XP_010534611.1| PREDICTED: LOW QUALITY PROTEIN: taxadien-5-alpha-ol O-acetyltransferase 
[Tarenaya hassleriana]
Length=431

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 77/136 (57%), Gaps = 9/136 (7%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVD  224
            T++ P+  TPS  L LS +D Q FLRF+I+YL ++R     D      R+K +L+R+LV 
Sbjct  11   TVVTPSDPTPSSVLSLSAIDSQLFLRFTIEYLLVYRPRPGFDPVSITGRVKSALSRSLVP  70

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNRSWRKLLYKV  401
            Y+P AGR+         L+V C   GA+F EA  D LT ++F Q + +   SWRKLL   
Sbjct  71   YFPFAGRVRE-RSGGLGLEVHCRGQGALFLEAVSDNLTCNDF-QRAPRHVTSWRKLLSLH  128

Query  402  EAPTFLHIPPLVVQVS  449
                    PPLVVQ++
Sbjct  129  VGDVLAGAPPLVVQLT  144



>ref|XP_009405177.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like, 
partial [Musa acuminata subsp. malaccensis]
Length=471

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 79/145 (54%), Gaps = 12/145 (8%)
 Frame = +3

Query  42   CFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT-----SVAVDRLKCSL  206
            C     PTL+PP  +T      LSNLD QN +   ++ +Y FR+       A   +K +L
Sbjct  25   CVEQGEPTLVPPEEETAKGLYFLSNLD-QN-IAVIVRTVYCFRSQEKGNEEAAQVIKAAL  82

Query  207  ARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPN-RSWR  383
            A+ LV YYPLAGRL     D  KL VDC   GAVF +A  D   ++   ++ KPN  +  
Sbjct  83   AKVLVHYYPLAGRLA--ISDEGKLIVDCTGEGAVFVKAEADCEMEDVGDIT-KPNPDTLG  139

Query  384  KLLYKV-EAPTFLHIPPLVVQVSSS  455
            KL+Y +  A   L +PPLVVQV +S
Sbjct  140  KLVYTILGANNLLEMPPLVVQVRNS  164



>gb|KDO48023.1| hypothetical protein CISIN_1g031330mg [Citrus sinensis]
Length=161

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 77/148 (52%), Gaps = 9/148 (6%)
 Frame = +3

Query  57   TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARAL  218
             P LI P   TP    PLS++DDQ  LRF I  +  ++ +  V+       ++ ++A+ L
Sbjct  13   APELIAPAKPTPRELKPLSDIDDQEGLRFHIPVIQFYKYNPFVNGKDPVKVIREAIAQTL  72

Query  219  VDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYK  398
            V YYP AGRL   P+  RKL VDC   G +F EA  D+T ++F      P     +LL+ 
Sbjct  73   VSYYPFAGRLREGPN--RKLMVDCTGEGVLFIEADADVTLEQFGDALQPPFPGLEELLFD  130

Query  399  V-EAPTFLHIPPLVVQVSSSPYSLCFTS  479
            V  +   L+ P L++QV +  +S    +
Sbjct  131  VPGSAGVLNCPLLLIQVYTYIFSFIIIN  158



>gb|AAT68601.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Petunia 
x hybrida]
 gb|AAU06226.1| benzoyl-CoA:benzyl alcohol/phenylethanol benzoyltransferase [Petunia 
x hybrida]
Length=460

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 72/137 (53%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARALV  221
            P LI P   TP  +  LS++DDQ  LRF I  +  +R   +      V+ +K ++A  LV
Sbjct  18   PELIAPAKPTPRETKFLSDIDDQEGLRFQIPVINFYRKDSSMGGKDPVEVIKKAIAETLV  77

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYP AGRL    D  RKL VDC   G +F EA  D+T +EF      P     +LLY V
Sbjct  78   FYYPFAGRLREGND--RKLMVDCTGEGVMFVEANADVTLEEFGDELQPPFPCLEELLYDV  135

Query  402  -EAPTFLHIPPLVVQVS  449
              +   LH P L++QV+
Sbjct  136  PGSAGVLHCPLLLIQVT  152



>ref|XP_003626384.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=196

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 81/152 (53%), Gaps = 13/152 (9%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARALV  221
            P L+PP + TP     LS++DDQ  LRF++  ++++R   ++        LK +L++ LV
Sbjct  15   PELVPPAAPTPREVKLLSDIDDQECLRFNMPIIFIYRHEPSMIEKDPAKVLKRALSQTLV  74

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGR+     D  KL VDC   G +F EA  D+T DEF      P   +++L+Y V
Sbjct  75   YYYPLAGRIREGARD--KLMVDCTGEGVMFIEAETDVTLDEFGDALHPPFPCFQELIYDV  132

Query  402  EAPT-FLHIPPLVVQVSSSPYSLCFTSTKTAF  494
                  +  P L++Q+      +   ST+T F
Sbjct  133  PGTNQIIDHPILLIQME----GMATESTRTDF  160



>gb|KFK38055.1| hypothetical protein AALP_AA3G064400 [Arabis alpina]
Length=483

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 73/138 (53%), Gaps = 10/138 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA-----VDRLKCSLARALVD  224
            P L+ P   TP    PLS+LDDQ  LRF I +++ +R +V      V  +K +LA  LV 
Sbjct  24   PELVTPAKPTPRELKPLSDLDDQQGLRFQIPFIFFYRPNVTSNHDPVQVIKKALAETLVY  83

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSG--KPNRSWRKLLYK  398
            YYP AGRL   P  +RKL VDC   GA+F EA  D+   E  +      P     +LL+ 
Sbjct  84   YYPFAGRLREGP--NRKLAVDCTGEGALFIEADADVAFAELEEADALLPPFPCLEELLFD  141

Query  399  VEAPT-FLHIPPLVVQVS  449
            V      L+ P L+VQV+
Sbjct  142  VAGSNDLLNTPLLLVQVT  159



>ref|XP_004494963.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=456

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 77/137 (56%), Gaps = 13/137 (9%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARALVDY  227
            L+ P + TP     LSN+DDQ  LRF+I  ++++R   +      V  LK SL++ LV Y
Sbjct  17   LVSPIAPTPREIKLLSNIDDQEGLRFNIPLIFIYRHEPSMIEKDPVKVLKHSLSQTLVYY  76

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVEA  407
            YP AGR+     D+RKL VDCN  G +F EA  D+T D+F      P   +++LLY  +A
Sbjct  77   YPFAGRIRE--GDNRKLMVDCNGEGVMFIEAEADVTLDQFGDTLQPPFPCFQQLLY--DA  132

Query  408  PTFLHI---PPLVVQVS  449
            P    I   P L +QV+
Sbjct  133  PDIGQIIDCPLLHIQVT  149



>ref|XP_009125170.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Brassica rapa]
Length=452

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 76/139 (55%), Gaps = 10/139 (7%)
 Frame = +3

Query  51   PTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARA  215
            P  P L+ P S+TP     LSNLD QN +   ++ +Y F++       AV  +K +L++ 
Sbjct  33   PKEPALVKPESETPKGLYFLSNLD-QN-IAVIVRTIYCFKSEERGNEDAVQVIKKALSQV  90

Query  216  LVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLY  395
            LV YYPLAGRLT  P+   KL VDC   G VF EA  +   DE   ++     +  KL+Y
Sbjct  91   LVHYYPLAGRLTISPEG--KLTVDCTEEGVVFVEAEANCEMDEIGDITKPDPETLGKLVY  148

Query  396  K-VEAPTFLHIPPLVVQVS  449
              V+A   L +PP+  QV+
Sbjct  149  DVVDAKNILEVPPVTAQVT  167



>ref|XP_004171600.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like, 
partial [Cucumis sativus]
Length=147

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 10/134 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVD  224
            P+LI P  +TP     LSNLD QN +   ++ +Y F++       A   +K +L++ LV 
Sbjct  18   PSLITPAEETPKGLYFLSNLD-QN-IAVIVRTIYSFKSESRGNEDAAQVIKDALSQVLVH  75

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGRLT   D  +KL VDC A GAVF EA  D + ++   ++     +  KL+Y + 
Sbjct  76   YYPLAGRLTISSD--KKLIVDCTAEGAVFVEAEADCSIEDIGDITKPDPDTLGKLVYDIP  133

Query  405  APT-FLHIPPLVVQ  443
              T  L +PPLV Q
Sbjct  134  GATNILQMPPLVAQ  147



>emb|CDY65939.1| BnaAnng21320D [Brassica napus]
Length=431

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 79/138 (57%), Gaps = 16/138 (12%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR-----TSVAVDRLKCSLARALVDY  227
            T+I P+ +TPS  L LS LD Q FLRF+I+YL ++       S++  RLK +L+RALV Y
Sbjct  11   TVITPSDQTPSTVLSLSALDSQLFLRFTIEYLLVYSPVSDPVSLS-GRLKSALSRALVPY  69

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNR---SWRKLLY  395
            +P +GR+         L+V+C   GA+F EA  D LT  +F     KP R   SWRKLL 
Sbjct  70   FPFSGRVRDGGGG--SLEVNCRGQGALFLEAVTDHLTCLDF----QKPPRHVTSWRKLLS  123

Query  396  KVEAPTFLHIPPLVVQVS  449
                      PPLVVQ++
Sbjct  124  LNVIDVLAGAPPLVVQLT  141



>ref|XP_007163565.1| hypothetical protein PHAVU_001G244800g [Phaseolus vulgaris]
 gb|ESW35559.1| hypothetical protein PHAVU_001G244800g [Phaseolus vulgaris]
Length=478

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 74/134 (55%), Gaps = 7/134 (5%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVD------RLKCSLARALVDY  227
            ++ P+  TP+  L LS LD Q FLRF+I+YL+++R    +D      RLK +LA+ALV Y
Sbjct  57   VVTPSEPTPNTVLALSALDSQLFLRFTIEYLFVYRPGPGLDRSSTAARLKTALAKALVPY  116

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVEA  407
            YP AGR+     +   L+V C A GAVF EA  +  +    Q + K    WRKLL     
Sbjct  117  YPFAGRVR-AQAEGLGLEVVCRAQGAVFIEASSERFSVTDFQKAPKTVAQWRKLLSLYVT  175

Query  408  PTFLHIPPLVVQVS  449
                  P LVVQ++
Sbjct  176  DVLKGSPILVVQLT  189



>ref|XP_009346788.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Pyrus x bretschneideri]
Length=445

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 75/136 (55%), Gaps = 10/136 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVD  224
            PTL+PP  +T      LSNLD QN +  +++ +Y F++       A + +K +L + LV 
Sbjct  30   PTLVPPAVETEKGLYFLSNLD-QN-IAVTVRTIYCFKSDAKGNDKAGEVIKDALKKVLVH  87

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV-  401
            YYPLAGRL    +   KL VDC   GAVF EA  D   +E   ++     +  KL+Y V 
Sbjct  88   YYPLAGRLAISAEG--KLIVDCTGEGAVFVEAEADCVIEEIGDITKPDPETLGKLVYDVP  145

Query  402  EAPTFLHIPPLVVQVS  449
             A T L IPPLV QV+
Sbjct  146  GAKTILEIPPLVAQVT  161



>ref|XP_007145940.1| hypothetical protein PHAVU_007G280800g [Phaseolus vulgaris]
 gb|ESW17934.1| hypothetical protein PHAVU_007G280800g [Phaseolus vulgaris]
Length=458

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 71/137 (52%), Gaps = 13/137 (9%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTS--------VAVDRLKCSLARALV  221
            L+ P   TP     LS++DDQ+ LRF I  +  +R          VAV  ++ +LA+ LV
Sbjct  16   LVAPAKATPREVKLLSDIDDQDGLRFQIPVIQFYRYDPSQAGRDPVAV--IREALAKTLV  73

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYP AGRL   P   RKL VDC   G +F EA  D+T D F      P   W  LLY +
Sbjct  74   FYYPFAGRLREGPG--RKLMVDCTGEGVLFIEADADVTLDHFGHSLQPPFPCWENLLYDL  131

Query  402  -EAPTFLHIPPLVVQVS  449
              +   LH P L++QV+
Sbjct  132  PSSQGVLHTPLLLIQVT  148



>gb|KFK36909.1| hypothetical protein AALP_AA4G188700 [Arabis alpina]
Length=426

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 79/137 (58%), Gaps = 14/137 (10%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF----RTSVAVDRLKCSLARALVDYY  230
            T+I P+ +TPS  L LS LD Q FLRF+I+YL ++      +   DRLK +L+RALV Y+
Sbjct  8    TVITPSDQTPSSILSLSALDSQLFLRFTIEYLLIYPPVPDPNPLSDRLKSALSRALVPYF  67

Query  231  PLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNR---SWRKLLYK  398
            P +GR+      +  L+V+C   GA+F EA  D +T  +F     KP R   SWRKLL  
Sbjct  68   PFSGRVR--DGSNSCLEVNCRGQGALFLEAVSDNITCLDF----QKPPRHVTSWRKLLSL  121

Query  399  VEAPTFLHIPPLVVQVS  449
                     PPLVVQ++
Sbjct  122  HVIDVLAGAPPLVVQLT  138



>gb|AES82602.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=153

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 75/138 (54%), Gaps = 9/138 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARALV  221
            P L+PP + TP     LS++DDQ  LRF++  ++++R   ++        LK +L++ LV
Sbjct  15   PELVPPAAPTPREVKLLSDIDDQECLRFNMPIIFIYRHEPSMIEKDPAKVLKRALSQTLV  74

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGR+     D  KL VDC   G +F EA  D+T DEF      P   +++L+Y V
Sbjct  75   YYYPLAGRIREGARD--KLMVDCTGEGVMFIEAETDVTLDEFGDALHPPFPCFQELIYDV  132

Query  402  EAPT-FLHIPPLVVQVSS  452
                  +  P L++Q  S
Sbjct  133  PGTNQIIDHPILLIQALS  150



>ref|XP_002437572.1| hypothetical protein SORBIDRAFT_10g029590 [Sorghum bicolor]
 gb|EER88939.1| hypothetical protein SORBIDRAFT_10g029590 [Sorghum bicolor]
Length=449

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 85/163 (52%), Gaps = 16/163 (10%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARALV  221
            P L+ P++ TP  + PLS++DD   +RF    ++L+R + +         ++ +LA ALV
Sbjct  15   PVLVRPSAPTPRETKPLSDIDDAEGMRFYSSGIHLYRANPSKASQDPARVVREALATALV  74

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL   P   RKL VDC A G +FAEA  DLTAD+F  +   P   + + +  +
Sbjct  75   PYYPLAGRLREEPG--RKLVVDCAAQGVLFAEADADLTADDFGDVKCPPFPCFERFI--L  130

Query  402  EAPTFLHIPPLV------VQVSSSPYSLCFTSTKTAFCVYNRP  512
            E+ T   + P+V      VQV+           +   CV + P
Sbjct  131  ESTTVAGVEPVVDRPLLYVQVTRLKCGGFIFGQRICHCVVDAP  173



>gb|EMT07181.1| Taxadien-5-alpha-ol O-acetyltransferase [Aegilops tauschii]
Length=453

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 66/108 (61%), Gaps = 8/108 (7%)
 Frame = +3

Query  54   TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARA  215
             TP L+ P++ TP  + PLS++DD   +RF    ++L+R  V+ +       ++ +LA+A
Sbjct  13   ATPVLVVPSAPTPQEAKPLSDIDDAAVMRFYSAGVHLYRGDVSKEGQDPARVIREALAKA  72

Query  216  LVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLS  359
            LV YYPLAGRL    +  RKL V+C A G +F EA  DLTAD+F  + 
Sbjct  73   LVPYYPLAGRLR--EEAGRKLVVECYAQGVLFVEADADLTADDFGDIG  118



>gb|AFK34239.1| unknown [Medicago truncatula]
Length=445

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 76/139 (55%), Gaps = 9/139 (6%)
 Frame = +3

Query  54   TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARA  215
            + P L+PP + TP     LS++DDQ  LRF+I  ++++R   +      V  L+ +L++A
Sbjct  13   SQPELVPPAAPTPREVKLLSDIDDQEGLRFNIPMMFIYRHEPSMKEKDPVKVLRHALSQA  72

Query  216  LVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLY  395
            LV YYP AGR+       RKL VDC   G +F EA  D+T DEF      P   + +LLY
Sbjct  73   LVYYYPFAGRIREGAG--RKLMVDCTGEGVMFVEAEADVTLDEFGDALHPPLPCFEELLY  130

Query  396  KVEAPTFLHIPPL-VVQVS  449
             V     +   P+ ++QV+
Sbjct  131  DVPGSELIIDRPIRLIQVT  149



>gb|ADD62404.1| fatty omega-hydroxyacid/fatty alcohol 0-hydroxycinnamoyl transferase 
1 [Quercus suber]
Length=419

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 76/136 (56%), Gaps = 10/136 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT-----SVAVDRLKCSLARALVD  224
            PTL+PP  +T      LSNLD QN +   ++ +Y F++       A + ++ +L + LV 
Sbjct  4    PTLVPPAEETEKGLYFLSNLD-QN-IAVIVRTIYCFKSDEIGNEKAWEVIRNALEKVLVH  61

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV-  401
            YYPLAGRLT   +   KL VDCN  GA+F EA  + +  E   ++     + RKL+Y + 
Sbjct  62   YYPLAGRLTISSEG--KLIVDCNGEGAIFVEAEANCSMKEIGDITKPDPETLRKLVYDIP  119

Query  402  EAPTFLHIPPLVVQVS  449
             A   L +PPLV QV+
Sbjct  120  GAKNILEVPPLVAQVT  135



>ref|XP_007208844.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
 gb|EMJ10043.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
Length=558

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 75/137 (55%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT------SVAVDRLKCSLARALV  221
            P LI P   TP  +  LSN+DDQ  LRF +  +  ++       + AV+ ++ +L+RALV
Sbjct  17   PELITPAKPTPHETKLLSNIDDQESLRFQVPVIMSYKNNPSMKGNDAVEVIREALSRALV  76

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL   P+  RKL V+CN  G +F EA  D+T  +       P+    + LY V
Sbjct  77   YYYPLAGRLREGPN--RKLMVECNGEGVLFIEANADVTLAQLGDTIAPPSPFLEEFLYNV  134

Query  402  -EAPTFLHIPPLVVQVS  449
              +   L  P L++QV+
Sbjct  135  PGSDGILGCPLLLIQVT  151



>ref|XP_011085894.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=444

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 61/108 (56%), Gaps = 8/108 (7%)
 Frame = +3

Query  57   TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARAL  218
             P LIPP   TP    PLS++DDQ  LRF I  +  +R + A++R      ++ +LARAL
Sbjct  15   NPELIPPAKPTPHELKPLSDIDDQEGLRFQIPLIQFYRRNPAMNRKDPVMVIRDALARAL  74

Query  219  VDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSG  362
            V YYP AGRL       RKL V+C   G +F EA  D+T  +F   SG
Sbjct  75   VFYYPFAGRLREAAG--RKLVVECTGEGVLFIEADADVTLQQFGDASG  120



>ref|XP_003575185.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Brachypodium 
distachyon]
Length=453

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 63/105 (60%), Gaps = 8/105 (8%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARALV  221
            P L+ P + TP    PLS++DD   +RF    ++L+R + +         ++ +LARALV
Sbjct  15   PVLVIPAAPTPREVKPLSDIDDGEGMRFYSSGIHLYRRNPSKQNTDPARVIREALARALV  74

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQL  356
             YYPLAGRL    +  RKL VDC A G +FAEA  DLTAD+F  L
Sbjct  75   PYYPLAGRLRE--EAGRKLVVDCGAQGVMFAEADADLTADDFGDL  117



>emb|CDP18599.1| unnamed protein product [Coffea canephora]
Length=460

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 73/139 (53%), Gaps = 11/139 (8%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA--------VDRLKCSLARA  215
            P L+ P   TP     LS++DDQ  LRF +  +  +R+           V  ++ ++A+A
Sbjct  15   PELVRPAKSTPRECKRLSDIDDQEGLRFQVPVIQFYRSDDDHLHSRRDPVKVIREAIAKA  74

Query  216  LVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLY  395
            LV YYP AGRL  C    RKL  DC   G +F EA  ++T ++F +    P     +LLY
Sbjct  75   LVSYYPFAGRLRECAG--RKLVADCTGEGVMFIEADAEVTLEQFGEELQPPFPCLEELLY  132

Query  396  KV-EAPTFLHIPPLVVQVS  449
             V E+   LH P L++QV+
Sbjct  133  DVPESAGVLHSPLLLIQVT  151



>ref|XP_003616154.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
 gb|AES99112.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=460

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 78/139 (56%), Gaps = 13/139 (9%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT--SVA----VDRLKCSLARALV  221
            P L+PP + TP     LS++DDQ  LRF++  ++++R   S+A    +  L+ +L+R LV
Sbjct  15   PELVPPVAPTPREVKLLSDIDDQEGLRFNVPVIFIYRREPSMAEKDPIKVLRHALSRTLV  74

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYP AGR+       RKL VDC   G VF EA  D+T D+F      P   +++LLY V
Sbjct  75   YYYPFAGRIRE--GARRKLMVDCTGEGVVFIEAEADVTLDQFGDALHPPFPCFQQLLYDV  132

Query  402  EAPTFLHI---PPLVVQVS  449
              P   HI   P  ++QV+
Sbjct  133  --PGSEHIIDRPIRLIQVT  149



>ref|NP_197256.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana]
 emb|CAC01898.1| putative protein [Arabidopsis thaliana]
 gb|ACF37204.1| At5g17540 [Arabidopsis thaliana]
 gb|AED92441.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana]
Length=461

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 75/143 (52%), Gaps = 10/143 (7%)
 Frame = +3

Query  45   FYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR-----TSVAVDRLKCSLA  209
             Y   P L+ P   TP    PLS++DDQ  LRF I  ++ +R      S  V  ++ +LA
Sbjct  9    IYRQKPELVSPAKPTPRELKPLSDIDDQEGLRFHIPTIFFYRHNPTTNSDPVAVIRRALA  68

Query  210  RALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSG--KPNRSWR  383
              LV YYP AGRL   P+  RKL VDC   G +F EA  D+T  EF +      P   + 
Sbjct  69   ETLVYYYPFAGRLREGPN--RKLAVDCTGEGVLFIEADADVTLVEFEEKDALKPPFPCFE  126

Query  384  KLLYKVEAP-TFLHIPPLVVQVS  449
            +LL+ VE     L+ P +++QV+
Sbjct  127  ELLFNVEGSCEMLNTPLMLMQVT  149



>ref|XP_009143235.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase-like [Brassica 
rapa]
Length=431

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 78/135 (58%), Gaps = 10/135 (7%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR-----TSVAVDRLKCSLARALVDY  227
            T+I P+ +TPS  L LS LD Q FLRF+I+YL ++       S++  RLK +L+RALV Y
Sbjct  11   TVITPSDQTPSTVLSLSALDSQLFLRFTIEYLLVYSPVSDPVSLS-GRLKSALSRALVPY  69

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMD-LTADEFIQLSGKPNRSWRKLLYKVE  404
            +P +GR+         L+V+C   GA+F EA  D LT  +F Q   +   SWRKLL    
Sbjct  70   FPFSGRVRDGGGG--SLEVNCRGQGALFLEAVTDNLTCLDF-QNPPRHVTSWRKLLSLNV  126

Query  405  APTFLHIPPLVVQVS  449
                   PPLVVQ++
Sbjct  127  IDVLAGAPPLVVQLT  141



>ref|XP_011098396.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=460

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 75/137 (55%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARALV  221
            P LIPP   TP    PLS++DDQ  LRF +  +  +R + A+D       ++ +++RALV
Sbjct  16   PELIPPAKPTPHELKPLSDIDDQESLRFQVPAIQFYRRNPAMDGKDPVMVIRDAVSRALV  75

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL       RKL V+C   G +F EA  D+T  +F      P     +LLY V
Sbjct  76   FYYPLAGRLREAAG--RKLVVECTGEGVLFIEAVADVTLQQFGDALLPPFPCLEELLYDV  133

Query  402  -EAPTFLHIPPLVVQVS  449
              +   ++ P L++QV+
Sbjct  134  PGSGGVVNCPLLLIQVT  150



>ref|XP_008791113.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Phoenix dactylifera]
Length=432

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 75/136 (55%), Gaps = 10/136 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTS-----VAVDRLKCSLARALVD  224
            P L+PP  +T      LSNLD QN +   ++ +Y F++       A + +K +LA+ LV 
Sbjct  18   PKLVPPAEETEKGLYYLSNLD-QN-IAVIVQTIYCFKSEDKGNETAAEVIKEALAKVLVH  75

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            +YPLAGRLT  P+   KL V+C   GAVF EA  D   ++   +S     +  KLLY + 
Sbjct  76   FYPLAGRLTISPEG--KLIVNCTGEGAVFVEAEADCEMEDIGDISKADPLTLGKLLYNIP  133

Query  405  -APTFLHIPPLVVQVS  449
             A   L IPPLV QV+
Sbjct  134  CAKNILEIPPLVAQVT  149



>gb|AES82601.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=502

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 76/139 (55%), Gaps = 9/139 (6%)
 Frame = +3

Query  54   TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARA  215
            + P L+PP + TP     LS++DDQ  LRF+I  ++++R   +      V  L+ +L++A
Sbjct  13   SQPELVPPAAPTPREVKLLSDIDDQEGLRFNIPMMFIYRHEPSMKEKDPVKVLRHALSQA  72

Query  216  LVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLY  395
            LV YYP AGR+       RKL VDC   G +F EA  D+T DEF      P   + +LLY
Sbjct  73   LVYYYPFAGRIREGAG--RKLMVDCTGEGVMFVEAEADVTLDEFGDALHPPLPCFEELLY  130

Query  396  KVEAPTFLHIPPL-VVQVS  449
             V     +   P+ ++QV+
Sbjct  131  DVPGSELIIDRPIRLIQVT  149



>ref|XP_003626383.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=510

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 76/139 (55%), Gaps = 9/139 (6%)
 Frame = +3

Query  54   TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARA  215
            + P L+PP + TP     LS++DDQ  LRF+I  ++++R   +      V  L+ +L++A
Sbjct  13   SQPELVPPAAPTPREVKLLSDIDDQEGLRFNIPMMFIYRHEPSMKEKDPVKVLRHALSQA  72

Query  216  LVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLY  395
            LV YYP AGR+       RKL VDC   G +F EA  D+T DEF      P   + +LLY
Sbjct  73   LVYYYPFAGRIREGAG--RKLMVDCTGEGVMFVEAEADVTLDEFGDALHPPLPCFEELLY  130

Query  396  KVEAPTFLHIPPL-VVQVS  449
             V     +   P+ ++QV+
Sbjct  131  DVPGSELIIDRPIRLIQVT  149



>ref|XP_007209120.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
 gb|EMJ10319.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
Length=460

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 74/135 (55%), Gaps = 9/135 (7%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTS------VAVDRLKCSLARALVDY  227
            LI P   TP  +  LSN+DDQ  LRF +  +  ++ +       AV+ ++ +L+RALV Y
Sbjct  18   LITPAKPTPHETKLLSNIDDQESLRFQVSVIMSYKNNPSMKGNDAVEVIREALSRALVYY  77

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV-E  404
            YPLAGRL   P+  RKL V+CN  G +F EA  D+T  +       P+    + LY V  
Sbjct  78   YPLAGRLREGPN--RKLMVECNGEGVLFIEANADVTLAQLGDTIAPPSPFLEEFLYNVPG  135

Query  405  APTFLHIPPLVVQVS  449
            +   L  P L++QV+
Sbjct  136  SDGILGCPLLLIQVT  150



>gb|EMT21731.1| Taxadien-5-alpha-ol O-acetyltransferase [Aegilops tauschii]
Length=222

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 81/161 (50%), Gaps = 12/161 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTS---VAVD---RLKCSLARALV  221
            P L+ P  +TP  +  LS++DD   +RF    ++L+R +     VD    ++ +LARALV
Sbjct  16   PVLVSPAEQTPRETKTLSDIDDGEGMRFYSSGIHLYRANPDKQGVDPAAVIREALARALV  75

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYK-  398
             YYPLAGRL    +  RKL VDC A G +F EA +DLTA +F  +   P   + + + + 
Sbjct  76   PYYPLAGRLRE--EAGRKLVVDCEAQGVMFVEADVDLTAADFGDVQSPPFPCFEQFILES  133

Query  399  ---VEAPTFLHIPPLVVQVSSSPYSLCFTSTKTAFCVYNRP  512
                   + +  P L +QV+           +   CV + P
Sbjct  134  TTVAGVESVIDRPLLYIQVTRLKCGGFIFGQRFCHCVVDAP  174



>emb|CDO98678.1| unnamed protein product [Coffea canephora]
Length=432

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 79/137 (58%), Gaps = 12/137 (9%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVD  224
            PTLIPP  +T      LSNLD QN +   ++ +Y F++       AV  +K +L++ LV 
Sbjct  18   PTLIPPAEETQKGLYFLSNLD-QN-IAVIVRTIYCFKSGEKGNEEAVRMIKDALSKVLVQ  75

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPN-RSWRKLLYKV  401
            Y+PLAGRLT  P+   KL VDC   GAVF EA  D T ++ I  + KP+  +  KL+Y V
Sbjct  76   YHPLAGRLTISPEG--KLIVDCTGEGAVFVEAEADCTIED-IGDNTKPDPVTLGKLVYDV  132

Query  402  -EAPTFLHIPPLVVQVS  449
              A   L IPPL  QV+
Sbjct  133  PGAKNVLEIPPLAAQVT  149



>gb|EEE62389.1| hypothetical protein OsJ_17179 [Oryza sativa Japonica Group]
Length=382

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 62/115 (54%), Gaps = 7/115 (6%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARALVDY  227
            L+ P   TP    PLS++DDQ  LRF    L+L+R   A+D       L+ +LA ALV Y
Sbjct  15   LVAPARATPHEFKPLSDIDDQEGLRFYRSGLFLYRRRAAMDGVDPAAVLRAALAEALVHY  74

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
            YPLAGR+       RKL V+C   GAVF  A   +  DE  +++G P     +LL
Sbjct  75   YPLAGRIVEA-SPGRKLLVECTGEGAVFVAAESGVAMDELGEVTGPPVPRHEELL  128



>ref|XP_010031185.1| PREDICTED: taxadien-5-alpha-ol O-acetyltransferase [Eucalyptus 
grandis]
Length=447

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 71/138 (51%), Gaps = 12/138 (9%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR-------TSVAVDRLKCSLARALV  221
             LI P+  TP   L LS LD Q FL F+I+YL L++             RLK +LA ALV
Sbjct  11   VLIIPSEPTPFKILALSALDSQLFLGFNIEYLLLYKPRPGWSDRGRVTARLKAALAGALV  70

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNR--SWRKLLY  395
             YYPLAGR+   PD  R L+V C A GA+F EA  D        L   PN    WR LL 
Sbjct  71   PYYPLAGRVEASPDGSR-LEVVCRAQGALFIEAVADNIV--MGDLERPPNHVTEWRGLLS  127

Query  396  KVEAPTFLHIPPLVVQVS  449
               A      PPLVVQ++
Sbjct  128  LHLADLLKEAPPLVVQLT  145



>ref|XP_003591040.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
 gb|AES61291.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=452

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 80/137 (58%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT--SVA----VDRLKCSLARALV  221
            P LI P + TP  +  LS++D Q  LR ++  +  +R   S+A    V+ ++ ++A+ALV
Sbjct  23   PELIIPATLTPHETKLLSDIDTQGGLRANVPIIQFYRNKPSMAGKDPVEVIRNAIAQALV  82

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGR+    D   KL VDCN  G +F EA  D+T ++F +L   P    ++LLY  
Sbjct  83   FYYPLAGRVKEA-DSSGKLMVDCNGEGVMFIEADADVTLEQFGELKA-PFPCLQELLYDA  140

Query  402  EAP-TFLHIPPLVVQVS  449
             AP   L+ P L++QV+
Sbjct  141  AAPEGVLNTPILLIQVT  157



>gb|AFK49108.1| unknown [Medicago truncatula]
Length=452

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 80/137 (58%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT--SVA----VDRLKCSLARALV  221
            P LI P + TP  +  LS++D Q  LR ++  +  +R   S+A    V+ ++ ++A+ALV
Sbjct  23   PELIIPATLTPHETKLLSDIDTQGGLRANVPIIQFYRNKPSMAGKDPVEVIRNAIAQALV  82

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGR+    D   KL VDCN  G +F EA  D+T ++F +L   P    ++LLY  
Sbjct  83   FYYPLAGRVKEA-DSSGKLMVDCNGEGVMFIEADADVTLEQFGELKA-PFPCLQELLYDA  140

Query  402  EAP-TFLHIPPLVVQVS  449
             AP   L+ P L++QV+
Sbjct  141  AAPEGVLNTPILLIQVT  157



>ref|XP_008238035.1| PREDICTED: methanol O-anthraniloyltransferase-like [Prunus mume]
Length=460

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 74/137 (54%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT------SVAVDRLKCSLARALV  221
            P LI P   TP  +  LSN+DDQ  LRF +  +  ++       + AV+ ++ +L+RALV
Sbjct  16   PELITPAKPTPHETKLLSNIDDQESLRFQVPVIMSYKNNPSMKGNDAVEVIREALSRALV  75

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL   P+  RKL V+CN  G +F EA  D+   +       P+    + LY V
Sbjct  76   YYYPLAGRLREGPN--RKLMVECNGEGVLFMEANADVRLAQLGDTIAPPSPFLEEFLYNV  133

Query  402  -EAPTFLHIPPLVVQVS  449
              +   L  P L++QV+
Sbjct  134  PGSDGILGCPLLLIQVT  150



>gb|KCW60630.1| hypothetical protein EUGRSUZ_H03354 [Eucalyptus grandis]
Length=433

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 76/142 (54%), Gaps = 10/142 (7%)
 Frame = +3

Query  42   CFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR-----LKCSL  206
            C     PTL+ P  +T +    LSNLD QN +   I+ +Y F++    +      +K +L
Sbjct  13   CVTQGEPTLVTPAEETENGLYFLSNLD-QN-IAVIIRTIYCFKSIEKGNEHVGEVIKGAL  70

Query  207  ARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRK  386
             + LV YYPLAGRLT  P+   KL VDC   GA+F EA  + T +E   ++     +  K
Sbjct  71   KKVLVHYYPLAGRLTISPEG--KLIVDCTGEGAIFVEAEANCTLEEIGDITKPHPETLGK  128

Query  387  LLYKV-EAPTFLHIPPLVVQVS  449
            L+Y V  A   L +PPLV QV+
Sbjct  129  LVYDVPGAKNILEMPPLVAQVT  150



>ref|XP_010024179.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Eucalyptus 
grandis]
 gb|KCW60629.1| hypothetical protein EUGRSUZ_H03354 [Eucalyptus grandis]
Length=443

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 76/142 (54%), Gaps = 10/142 (7%)
 Frame = +3

Query  42   CFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR-----LKCSL  206
            C     PTL+ P  +T +    LSNLD QN +   I+ +Y F++    +      +K +L
Sbjct  23   CVTQGEPTLVTPAEETENGLYFLSNLD-QN-IAVIIRTIYCFKSIEKGNEHVGEVIKGAL  80

Query  207  ARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRK  386
             + LV YYPLAGRLT  P+   KL VDC   GA+F EA  + T +E   ++     +  K
Sbjct  81   KKVLVHYYPLAGRLTISPEG--KLIVDCTGEGAIFVEAEANCTLEEIGDITKPHPETLGK  138

Query  387  LLYKV-EAPTFLHIPPLVVQVS  449
            L+Y V  A   L +PPLV QV+
Sbjct  139  LVYDVPGAKNILEMPPLVAQVT  160



>emb|CDY68497.1| BnaCnng59260D [Brassica napus]
Length=444

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 75/134 (56%), Gaps = 10/134 (7%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVDYY  230
            L+ P S+TP+    LSNLD QN +   ++ +Y F++       AV  +K +L++ LV YY
Sbjct  42   LVKPESETPNGLYFLSNLD-QN-IAVIVRTIYCFKSEERGNEEAVQVIKKALSQVLVHYY  99

Query  231  PLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYK-VEA  407
            PLAGRLT  P+   KL VDC   G VF EA  +   DE   ++     +  KL+Y  VEA
Sbjct  100  PLAGRLTISPEG--KLTVDCTEEGVVFVEAEANCKMDEIGDITKPDPETLGKLVYDVVEA  157

Query  408  PTFLHIPPLVVQVS  449
               L +PP+  QV+
Sbjct  158  KNILEVPPVTAQVT  171



>emb|CAT00082.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=432

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 79/137 (58%), Gaps = 12/137 (9%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVD  224
            PTLIPP  +T      LSNLD QN +   ++ +Y F++       AV  ++ +L++ LV 
Sbjct  18   PTLIPPAEETQKGLYFLSNLD-QN-IAVIVRTIYCFKSGEKGNEEAVGMIRDALSKVLVQ  75

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPN-RSWRKLLYKV  401
            Y+PLAGRLT  P+   KL VDC   GAVF EA  D T ++ I  + KP+  +  KL+Y V
Sbjct  76   YHPLAGRLTISPEG--KLIVDCTGEGAVFVEAEADCTIED-IGDNTKPDPVTLGKLVYDV  132

Query  402  -EAPTFLHIPPLVVQVS  449
              A   L IPPL  QV+
Sbjct  133  PGAKNVLEIPPLAAQVT  149



>gb|EMT26852.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Aegilops tauschii]
Length=222

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 74/132 (56%), Gaps = 10/132 (8%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTS---VAVD---RLKCSLARALV  221
            P L+ P  +TP  +  LS++DD   +RF    ++L+R +     VD    ++ +LARALV
Sbjct  16   PVLVAPAEQTPRETKTLSDIDDGEGMRFYSSGIHLYRANPDKQGVDPAAVIREALARALV  75

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL    +  RKL  DC A G +F EA +DLTA +F  +   P   + + +  +
Sbjct  76   PYYPLAGRLRE--ETGRKLVGDCEAQGVMFVEADVDLTAADFGDVQNPPFPCFEQFI--L  131

Query  402  EAPTFLHIPPLV  437
            E+ T   + P++
Sbjct  132  ESTTVAGVEPVI  143



>ref|XP_008379094.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Malus domestica]
Length=445

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 74/136 (54%), Gaps = 10/136 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVD  224
            PTL+PP  +T      LSNLD QN +  +++ +Y F++       A + +K +L + LV 
Sbjct  30   PTLVPPAVETEKGLYFLSNLD-QN-IAVTVRTIYCFKSDAKGNDKAGEVIKDALKKVLVH  87

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV-  401
            YYPLAGRL    +   KL VDC   GAVF EA  D   +E   ++     +  KL+Y V 
Sbjct  88   YYPLAGRLAISAEG--KLIVDCTGEGAVFVEAEADCAIEEIGDITKPDPETLGKLVYDVP  145

Query  402  EAPTFLHIPPLVVQVS  449
             A   L IPPLV QV+
Sbjct  146  GAKNMLEIPPLVAQVT  161



>ref|XP_006657584.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Oryza brachyantha]
Length=447

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 76/136 (56%), Gaps = 8/136 (6%)
 Frame = +3

Query  57   TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA--VDRLKCSLARALVDYY  230
             P LI P + TP  +  LS+LDDQ  LR+ +  ++++R   A  VD ++ +LA ALV YY
Sbjct  11   APELIAPAAPTPRETKRLSDLDDQETLRWQVPTVFVYRAGRADPVDTIRRALAAALVPYY  70

Query  231  PLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSG--KPNRSWRKLLYKVE  404
            P AGRL    D  RKL VDC   G +F EA  DL   + ++ +G   P     +LL+ VE
Sbjct  71   PFAGRLREVED--RKLVVDCTGEGVLFIEADADLLVAD-LEAAGLRAPFPCMDQLLFDVE  127

Query  405  APT-FLHIPPLVVQVS  449
                 L  P L++QV+
Sbjct  128  GSAGVLGTPLLLIQVT  143



>gb|AFK34995.1| unknown [Lotus japonicus]
Length=177

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 84/153 (55%), Gaps = 15/153 (10%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT--SVA----VDRLKCSLARALV  221
            P L+ P   TP  +  LS++DDQ  LR ++  +  +R   S+A    VD ++ ++A+ALV
Sbjct  23   PELVAPAVSTPHETKHLSDIDDQAGLRANVPIIQFYRNEPSMAGKDPVDIIRNAVAKALV  82

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL      +  L VDCN  G +F EA  D+T ++F      P   +++LL+  
Sbjct  83   FYYPLAGRLREAAGGN--LVVDCNEEGVMFIEADADITFEQFGDTLKPPFPCFQELLH--  138

Query  402  EAP----TFLHIPPLVVQVSSSPYSL-CFTSTK  485
            EAP      ++ P +++QV   PY L C  S +
Sbjct  139  EAPGSEGVVINSPIILIQVQHLPYLLYCLASRR  171



>ref|XP_009804829.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nicotiana sylvestris]
Length=460

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 72/138 (52%), Gaps = 9/138 (7%)
 Frame = +3

Query  57   TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARAL  218
             P LI P   TP  +  LS++DDQ  LRF I  +  +  + +      V+ +K ++A  L
Sbjct  17   NPELIAPAKPTPRETKFLSDIDDQEGLRFQIPVIQFYSKNSSMEGKDPVNIIKKAIAETL  76

Query  219  VDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYK  398
            V YYP AGRL     + RKL VDC   G +F EA  D+T +EF      P     +LLY 
Sbjct  77   VFYYPFAGRLRE--GNGRKLMVDCTGEGIMFVEADADVTLEEFGDELQPPFPCLEELLYD  134

Query  399  V-EAPTFLHIPPLVVQVS  449
            V  +   LH P L++QV+
Sbjct  135  VPNSAGVLHCPLLLIQVT  152



>ref|XP_004138033.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Cucumis sativus]
 gb|KGN63464.1| hypothetical protein Csa_1G001360 [Cucumis sativus]
Length=433

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 77/136 (57%), Gaps = 10/136 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVD  224
            P+LI P  +TP     LSNLD QN +   ++ +Y F++       A   +K +L++ LV 
Sbjct  18   PSLITPAEETPKGLYFLSNLD-QN-IAVIVRTIYSFKSESRGNEDAAQVIKDALSQVLVH  75

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGRLT   D  +KL VDC A GAVF EA  D + ++   ++     +  KL+Y + 
Sbjct  76   YYPLAGRLTISSD--KKLIVDCTAEGAVFVEAEADCSIEDIGDITKPDPDTLGKLVYDIP  133

Query  405  APT-FLHIPPLVVQVS  449
              T  L +PPLV QV+
Sbjct  134  GATNILQMPPLVAQVT  149



>emb|CDX67482.1| BnaA07g15220D [Brassica napus]
Length=444

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 76/143 (53%), Gaps = 10/143 (7%)
 Frame = +3

Query  39   DCFYPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCS  203
            +     T  L+ P S+TP     LSNLD QN +   ++ +Y F++       AV  +K +
Sbjct  21   EVLQKETAALVKPESETPKGLYFLSNLD-QN-IAVIVRTIYCFKSEERGNEDAVQVIKKA  78

Query  204  LARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWR  383
            L++ LV YYPLAGRLT  P+   KL VDC   G VF EA  +   DE   ++     +  
Sbjct  79   LSQVLVHYYPLAGRLTISPEG--KLTVDCTEEGVVFVEAEANCEMDEIGDITKPDPETLG  136

Query  384  KLLYK-VEAPTFLHIPPLVVQVS  449
            KL+Y  V+A   L +PP+  QV+
Sbjct  137  KLVYDVVDAKNILEVPPVTAQVT  159



>ref|XP_009140062.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Brassica 
rapa]
Length=455

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 74/134 (55%), Gaps = 10/134 (7%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVDYY  230
            L+ P S+TP     LSNLD QN +   ++ +Y F++       AV  +K +L++ LV YY
Sbjct  38   LVKPESETPKGLYFLSNLD-QN-IAVIVRTIYCFKSEERGNEEAVQVIKKALSQVLVHYY  95

Query  231  PLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYK-VEA  407
            PLAGRLT  P+   KL VDC   G VF EA  +   DE   ++     +  KL+Y  VEA
Sbjct  96   PLAGRLTISPEG--KLTVDCTEEGVVFVEAEANCKMDEIGDITKPDPETLGKLVYDVVEA  153

Query  408  PTFLHIPPLVVQVS  449
               L +PP+  QV+
Sbjct  154  KNILEVPPVTAQVT  167



>ref|XP_002884383.1| chat-3-HEXEN-1-OL ACETYLTRANSFERASE [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60642.1| chat-3-HEXEN-1-OL ACETYLTRANSFERASE [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 75/138 (54%), Gaps = 10/138 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR-----LKCSLARALVD  224
            P LI P   TP    PLS++DDQ  LRF I  ++ +R +++ D      +K +LA ALV 
Sbjct  24   PELITPAKPTPRELKPLSDIDDQQGLRFQIPVIFFYRPNLSSDLNPVQVIKKALADALVY  83

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSG--KPNRSWRKLLYK  398
            YYP AGRL      +RKL VDC   G +F EA  D++  E  +      P     +LL+ 
Sbjct  84   YYPFAGRLREL--SNRKLAVDCTGEGVLFIEAEADVSLTELEEADALLPPFPCLDELLFD  141

Query  399  VEAPT-FLHIPPLVVQVS  449
            VE  +  L+ P L+VQV+
Sbjct  142  VEGSSDVLNTPLLLVQVT  159



>gb|AAQ62868.1| At3g48720 [Arabidopsis thaliana]
Length=430

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 77/139 (55%), Gaps = 11/139 (8%)
 Frame = +3

Query  57   TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR-----LKCSLARALV  221
             P LIPP S+TP+    LSNLD QN +   +K LY +++    ++     +K SL+  LV
Sbjct  13   NPELIPPVSETPNGRYYLSNLD-QN-IAIIVKTLYYYKSESRTNQESYNVIKKSLSEVLV  70

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQ-LSGKPNRSWRKLLYK  398
             YYP+AGRLT  P+   K+ V+C   G V  EA  +   D   + +S     +  KL+Y 
Sbjct  71   HYYPVAGRLTISPEG--KIAVNCTGEGVVVVEAEANCGIDTIKEAISENRMETLEKLVYD  128

Query  399  V-EAPTFLHIPPLVVQVSS  452
            V  A   L IPP+VVQV++
Sbjct  129  VPGARNILEIPPVVVQVTN  147



>ref|XP_006600094.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Glycine 
max]
 gb|KHN24394.1| 13-hydroxylupanine O-tigloyltransferase [Glycine soja]
Length=158

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 72/136 (53%), Gaps = 9/136 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLF------RTSVAVDRLKCSLARALV  221
            P L+ P + TP     LS++DDQN LR+ +  +  F           V+ ++ +L++ LV
Sbjct  17   PELVAPANPTPREVKLLSDIDDQNGLRYQLPLVLFFPYQPSMEGKDPVEVIREALSKTLV  76

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYP AGRL   PD   KL VDCN  G +F EA  D+T ++F      P   + +LLY V
Sbjct  77   FYYPFAGRLREGPDG--KLMVDCNGEGVMFIEADADVTIEQFGNNFMPPFPCFDELLYNV  134

Query  402  -EAPTFLHIPPLVVQV  446
              +   +  P L++QV
Sbjct  135  PGSDGMIDTPLLLIQV  150



>ref|NP_190441.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana]
 emb|CAB62361.1| putative protein [Arabidopsis thaliana]
 dbj|BAD43042.1| unknown protein [Arabidopsis thaliana]
 gb|AEE78449.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana]
Length=430

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 77/139 (55%), Gaps = 11/139 (8%)
 Frame = +3

Query  57   TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR-----LKCSLARALV  221
             P LIPP S+TP+    LSNLD QN +   +K LY +++    ++     +K SL+  LV
Sbjct  13   NPELIPPVSETPNGHYYLSNLD-QN-IAIIVKTLYYYKSESRTNQESYNVIKKSLSEVLV  70

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQ-LSGKPNRSWRKLLYK  398
             YYP+AGRLT  P+   K+ V+C   G V  EA  +   D   + +S     +  KL+Y 
Sbjct  71   HYYPVAGRLTISPEG--KIAVNCTGEGVVVVEAEANCGIDTIKEAISENRMETLEKLVYD  128

Query  399  V-EAPTFLHIPPLVVQVSS  452
            V  A   L IPP+VVQV++
Sbjct  129  VPGARNILEIPPVVVQVTN  147



>ref|XP_008464403.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase [Cucumis 
melo]
Length=433

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 76/136 (56%), Gaps = 10/136 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVD  224
            P LI P  +TP     LSNLD QN +   ++ +Y F++       A   +K +L++ LV 
Sbjct  18   PILITPAEETPKGLYFLSNLD-QN-IAVIVRTIYSFKSESRGNEDAAQVIKDALSKVLVH  75

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVE  404
            YYPLAGRLT   D  +KL VDC A GAVF EA  D + ++   ++     +  KL+Y + 
Sbjct  76   YYPLAGRLTISSD--KKLIVDCTAEGAVFVEAEADCSIEDIGDITKPDPDTLGKLVYDIP  133

Query  405  APT-FLHIPPLVVQVS  449
              T  L +PPLV QV+
Sbjct  134  GATNILQMPPLVAQVT  149



>ref|XP_003626386.1| Alcohol acetyltransferase [Medicago truncatula]
 gb|AES82604.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=462

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 77/138 (56%), Gaps = 10/138 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARALV  221
            P L+PP + TP     LS++DDQ  LRF++  ++++R   +      V  LKC+L++ LV
Sbjct  16   PELVPPAAPTPREVKLLSDIDDQECLRFNMPIIFIYRHEPSMVKKDPVKVLKCALSKTLV  75

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAA-GAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYK  398
             YYPLAGR+     D  KL VDC    G +F EA  D+T +EF      P   +++L+Y 
Sbjct  76   YYYPLAGRIREGARD--KLMVDCTGGEGVMFIEAEADVTLNEFGDALHPPFPCFQELIYD  133

Query  399  V-EAPTFLHIPPLVVQVS  449
            V      +  P L++Q++
Sbjct  134  VPSTKQIIDHPILLIQIT  151



>gb|AAS55785.1| putative benzyl alcohol benzoyl transferase [Oryza sativa Japonica 
Group]
 gb|AAV32223.1| putative hypersensitivity-related (hsr) protein [Oryza sativa 
Japonica Group]
 gb|EAY96616.1| hypothetical protein OsI_18527 [Oryza sativa Indica Group]
Length=466

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 59/107 (55%), Gaps = 7/107 (7%)
 Frame = +3

Query  66   LIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARALVDY  227
            L+ P   TP    PLS++DDQ  LRF    L+L+R   A+D       L+ +LA ALV Y
Sbjct  15   LVAPARATPHEFKPLSDIDDQEGLRFYRSGLFLYRRRAAMDGVDPAAVLRAALAEALVHY  74

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKP  368
            YPLAGR+       RKL V+C   GAVF  A   +  DE  +++G P
Sbjct  75   YPLAGRIVEA-SPGRKLLVECTGEGAVFVAAESGVAMDELGEVTGPP  120



>ref|XP_003554685.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
 gb|KHN43218.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=464

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 78/141 (55%), Gaps = 16/141 (11%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT--SVA----VDRLKCSLARALV  221
            P L+ P + TP    PLS++DDQ+  RF +  + ++    S+A    V+ ++ +LA+ LV
Sbjct  17   PELVAPATPTPHQLKPLSDIDDQDGFRFQVPIIQIYHNQPSMAGKDPVEVIRQALAKTLV  76

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGK----PNRSWRKL  389
             YYP AGRL   PD  RKL VDC   G +F EA  D+T     Q  G+    P   +++L
Sbjct  77   FYYPFAGRLREGPD--RKLMVDCTGEGVMFIEADADVT---LYQFGGEALQPPFPCFQEL  131

Query  390  LYKV-EAPTFLHIPPLVVQVS  449
            LY V E     + P L++QV+
Sbjct  132  LYNVPETEEITNTPLLLIQVT  152



>ref|XP_006484694.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Citrus sinensis]
Length=458

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 74/138 (54%), Gaps = 9/138 (7%)
 Frame = +3

Query  57   TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARAL  218
             P LI P   TP    PLS++DDQ  LRF I  +  ++ +  V+       ++ ++A+ L
Sbjct  13   APELIAPAKPTPRELKPLSDIDDQEGLRFHIPVIQFYKYNPFVNGKDPVKVIREAIAQTL  72

Query  219  VDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYK  398
            V YYP AGRL   P+  RKL VDC   G +F EA  D+T ++F      P     +LL+ 
Sbjct  73   VSYYPFAGRLREGPN--RKLMVDCTGEGVLFIEADADVTLEQFGDALQPPFPGLEELLFD  130

Query  399  V-EAPTFLHIPPLVVQVS  449
            V  +   L+ P L++QV+
Sbjct  131  VPGSAGVLNCPLLLIQVT  148



>ref|XP_008238086.1| PREDICTED: methanol O-anthraniloyltransferase-like [Prunus mume]
Length=532

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 75/140 (54%), Gaps = 12/140 (9%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR----TSVAVDR-----LKCSLAR  212
            P LI P+  TP  +  LSN+DDQ  LRF I  +  +R    +S+  +R     ++  L+R
Sbjct  16   PELIKPSKPTPHETKLLSNVDDQESLRFQIPVIMSYRNNNPSSMNANRDPVKVIREGLSR  75

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
            ALV YYP+AGRL   P+  RKL V+CN  G +F E   D+T  +       P+    + L
Sbjct  76   ALVYYYPMAGRLREGPN--RKLMVECNGEGVLFIEGNADVTLAQLGDTIAPPSPFLEEFL  133

Query  393  YKV-EAPTFLHIPPLVVQVS  449
            Y V  +   L  P L++QV+
Sbjct  134  YNVPGSDGILGCPLLLIQVT  153



>ref|XP_007029790.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10292.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=457

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 74/137 (54%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARALV  221
            P L+ P   TP+    LS++DDQ   RF +  +  +R +  +        ++ +LA+ALV
Sbjct  17   PELVGPAKPTPNECKRLSDIDDQESFRFQVPVIQFYRYNPCMQGKDPAMIVREALAQALV  76

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL   P+  RKL VDCN  GA+F EA  D+T ++F      P     +LLY  
Sbjct  77   FYYPLAGRLREGPN--RKLMVDCNGEGALFVEADADVTLEQFGDALQPPFPCLHELLYDT  134

Query  402  -EAPTFLHIPPLVVQVS  449
              +   L+ P L +QV+
Sbjct  135  PSSEGMLNSPLLFIQVT  151



>ref|XP_006657332.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Oryza brachyantha]
Length=452

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 74/132 (56%), Gaps = 10/132 (8%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARALV  221
            P  + P ++TP     LS++DD   +RF    ++L+R + A +       ++ +LA+ALV
Sbjct  16   PGGVAPXARTPREVKALSDIDDGEGMRFYSSGIHLYRNNPAKEGEDPAMVIREALAKALV  75

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL    D  RKL V+C   G +FAEA  DLTAD+F  +   P   + + +  +
Sbjct  76   PYYPLAGRLRE--DAGRKLVVECTGQGVMFAEADADLTADDFGDVQSPPFPCFEQFI--L  131

Query  402  EAPTFLHIPPLV  437
            E+ T   + P++
Sbjct  132  ESTTIAGVEPVI  143



>gb|EEE53174.1| hypothetical protein OsJ_36018 [Oryza sativa Japonica Group]
Length=182

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 70/138 (51%), Gaps = 19/138 (14%)
 Frame = +3

Query  57   TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR--------LKCSLAR  212
             P L+ P   TP  + PLS+L+D   LR+    L  FR +V  DR        ++ +LA 
Sbjct  13   NPELVTPARATPCETKPLSDLNDHWDLRYLQPALRFFR-AVDSDRRPARPGDTIRAALAE  71

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEF--------IQLSGKP  368
            ALV YYP+AGRL   P  H KL V+C   G VF EA  + T ++F        +   G P
Sbjct  72   ALVYYYPIAGRLRELPKGH-KLAVECTGEGVVFVEAEAEATLEDFGDPPIADVLWRRGVP  130

Query  369  NRSWRKLLYKVEAPTFLH  422
             R WR   ++ EA T LH
Sbjct  131  VRCWRCQSHRWEA-TVLH  147



>gb|KHN31436.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=440

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 74/137 (54%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT--SVA----VDRLKCSLARALV  221
            P L+ P   TP    PLS++DDQ  LRF I  + ++R   S+A    V  ++ +LA+ LV
Sbjct  9    PELVAPAIPTPHELKPLSDIDDQEGLRFHIPMIQVYRNQPSMAEKDPVQVIRKALAKTLV  68

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYP AGRL   PD   KL VDC   G +F EA  D+T D+       P   + +LLY V
Sbjct  69   FYYPFAGRLRERPD--HKLMVDCTGEGVLFIEADADVTLDQLGDALQPPFPCFEQLLYNV  126

Query  402  -EAPTFLHIPPLVVQVS  449
             ++      P L++QV+
Sbjct  127  PDSEEITDTPLLLIQVT  143



>ref|XP_011073101.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X2 [Sesamum indicum]
 ref|XP_011073102.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X2 [Sesamum indicum]
Length=432

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 76/136 (56%), Gaps = 10/136 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVD  224
            PTL+PP  +T      LSNLD QN +   ++ +Y F++       AV+ +K +L++ LV 
Sbjct  18   PTLVPPAEETMKGFYFLSNLD-QN-IAVIVRTIYCFKSEERGNEDAVEVIKNALSKVLVH  75

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV-  401
            YYPLAGRLT  P+   KL VDC   GAVF EA  +    +   ++     +  KL+Y + 
Sbjct  76   YYPLAGRLTISPE--MKLIVDCTGEGAVFVEAEAECELQKLGDITKPDPVTLGKLVYDIP  133

Query  402  EAPTFLHIPPLVVQVS  449
             A   L IPPLV QV+
Sbjct  134  GAENVLQIPPLVAQVT  149



>ref|XP_003520833.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=452

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 74/137 (54%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT--SVA----VDRLKCSLARALV  221
            P L+ P   TP    PLS++DDQ  LRF I  + ++R   S+A    V  ++ +LA+ LV
Sbjct  21   PELVAPAIPTPHELKPLSDIDDQEGLRFHIPMIQVYRNQPSMAEKDPVQVIRKALAKTLV  80

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYP AGRL   PD   KL VDC   G +F EA  D+T D+       P   + +LLY V
Sbjct  81   FYYPFAGRLRERPD--HKLMVDCTGEGVLFIEADADVTLDQLGDALQPPFPCFEQLLYNV  138

Query  402  -EAPTFLHIPPLVVQVS  449
             ++      P L++QV+
Sbjct  139  PDSEEITDTPLLLIQVT  155



>ref|XP_010453955.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=461

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTS-------VAVDRLKCSLARAL  218
            P L+ P + TP     LS++DDQ  LRF I  ++ +R +       VAV  ++ +LA  L
Sbjct  14   PELVSPANPTPRELKLLSDIDDQEGLRFHIPTIFFYRHNPKAYSDPVAV--IRRALAETL  71

Query  219  VDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSG--KPNRSWRKLL  392
            V YYP AGRL   P+  RKL VDC   G +F EA  D+T  EF +      P R + +LL
Sbjct  72   VYYYPFAGRLREGPN--RKLVVDCTGEGVLFIEADADVTVLEFEEKDALKPPFRCFEELL  129

Query  393  YKVEAPT-FLHIPPLVVQVS  449
            + VE  +  L+ P +++QV+
Sbjct  130  FGVEGSSEVLNSPLMLMQVT  149



>gb|ACR36326.1| unknown [Zea mays]
 tpg|DAA41373.1| TPA: taxadien-5-alpha-ol O-acetyltransferase [Zea mays]
Length=435

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 78/141 (55%), Gaps = 14/141 (10%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR--------LKCSLARA  215
            P L+ P + TP  +  LS++DDQ  LR  + +L+L+R  V V          ++ +L  A
Sbjct  15   PALVGPAAPTPRETKRLSDIDDQETLRGQMPFLFLYRGGVHVRADDDDPACVIRRALGEA  74

Query  216  LVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSG--KPNRSWRKL  389
            LV +YPLAGRL     + RKL VDC   G +F EA  D+  DE ++ +G   P     +L
Sbjct  75   LVPFYPLAGRLREV--EGRKLVVDCTGEGVLFVEADADVRLDE-LEATGLRPPFPCMDQL  131

Query  390  LYKVEAPT-FLHIPPLVVQVS  449
            L+ V+  +  LH P L++QV+
Sbjct  132  LFDVDGSSGVLHCPLLLIQVT  152



>ref|XP_006437408.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
 gb|ESR50648.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
Length=458

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 74/138 (54%), Gaps = 9/138 (7%)
 Frame = +3

Query  57   TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARAL  218
             P LI P   TP    PLS++DDQ  LRF I  +  ++ +  V+       ++ ++A+ L
Sbjct  13   APELIAPAKPTPRELKPLSDIDDQEGLRFHIPVIQFYKYNPFVNGKDPVKVIREAVAQTL  72

Query  219  VDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYK  398
            V YYP AGRL   P+  RKL VDC   G +F EA  D+T ++F      P     +LL+ 
Sbjct  73   VSYYPFAGRLREGPN--RKLMVDCTGEGVLFIEADADVTLEQFGDALQPPFPGLEELLFD  130

Query  399  V-EAPTFLHIPPLVVQVS  449
            V  +   L+ P L++QV+
Sbjct  131  VPGSAGVLNCPLLLIQVT  148



>ref|NP_001058545.2| Os06g0710700 [Oryza sativa Japonica Group]
 dbj|BAD53644.1| putative benzoyl coenzyme A, benzyl alcohol benzoyl transferase 
[Oryza sativa Japonica Group]
 dbj|BAF20459.2| Os06g0710700 [Oryza sativa Japonica Group]
Length=450

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 10/132 (8%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARALV  221
            P L+ P + TP     LS++DD   +RF    ++L+R + A         ++ +LARALV
Sbjct  16   PVLVTPAAPTPREVKALSDIDDGEGMRFYSSGIHLYRNNPAKKGQDPAMVIREALARALV  75

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL    +  RKL V+C   G +FAEA  DLTAD+F  +   P   + + +  +
Sbjct  76   PYYPLAGRLRE--EAGRKLVVECAGQGVMFAEADADLTADDFGDVQSPPFPCFERFI--L  131

Query  402  EAPTFLHIPPLV  437
            E+ T   + P+V
Sbjct  132  ESTTVAGVEPVV  143



>ref|XP_003536235.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=454

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 75/138 (54%), Gaps = 10/138 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT--SVA----VDRLKCSLARALV  221
            P LI P   TP     LS++DDQ+ LRF I  + ++R   S+A    V+ ++ +LAR LV
Sbjct  14   PELIAPAKPTPREVKLLSDIDDQDGLRFQIPVIQIYRHDPSMAGKDPVEVIRKALARTLV  73

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAA-GAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYK  398
             YYP AGRL    D  RKL VDC    G +F EA  D+T   F      P   W +LLY 
Sbjct  74   FYYPFAGRLREGRD--RKLMVDCTGELGVLFIEADADVTLKHFGDALQPPFPCWEELLYD  131

Query  399  V-EAPTFLHIPPLVVQVS  449
            V  +   L+ P L++QV+
Sbjct  132  VPGSQGVLNTPLLLIQVT  149



>gb|EAZ02323.1| hypothetical protein OsI_24425 [Oryza sativa Indica Group]
Length=450

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 10/132 (8%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARALV  221
            P L+ P + TP     LS++DD   +RF    ++L+R + A         ++ +LARALV
Sbjct  16   PVLVTPAAPTPREVKALSDIDDGEGMRFYSSGIHLYRNNPAKKGQDPAMVIREALARALV  75

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYPLAGRL    +  RKL V+C   G +FAEA  DLTAD+F  +   P   + + +  +
Sbjct  76   PYYPLAGRLRE--EAGRKLVVECAGQGVMFAEADADLTADDFGDVQSPPFPCFERFI--L  131

Query  402  EAPTFLHIPPLV  437
            E+ T   + P+V
Sbjct  132  ESTTVAGVEPVV  143



>ref|XP_011073100.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase isoform 
X1 [Sesamum indicum]
Length=490

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 76/136 (56%), Gaps = 10/136 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLARALVD  224
            PTL+PP  +T      LSNLD QN +   ++ +Y F++       AV+ +K +L++ LV 
Sbjct  76   PTLVPPAEETMKGFYFLSNLD-QN-IAVIVRTIYCFKSEERGNEDAVEVIKNALSKVLVH  133

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV-  401
            YYPLAGRLT  P+   KL VDC   GAVF EA  +    +   ++     +  KL+Y + 
Sbjct  134  YYPLAGRLTISPE--MKLIVDCTGEGAVFVEAEAECELQKLGDITKPDPVTLGKLVYDIP  191

Query  402  EAPTFLHIPPLVVQVS  449
             A   L IPPLV QV+
Sbjct  192  GAENVLQIPPLVAQVT  207



>ref|XP_010489657.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=454

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 73/138 (53%), Gaps = 10/138 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR-----LKCSLARALVD  224
            P LI P   TP    PLS++DDQ  LRF I  ++ +R ++  D      +K +LA ALV 
Sbjct  24   PELITPAKPTPRELKPLSDIDDQQGLRFQIPVIFFYRPNLTTDLDPVQVIKKALAEALVY  83

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSG--KPNRSWRKLLYK  398
            YYPLAGRL      +RKL VDC   G +F EA  ++   E  +      P     +LL+ 
Sbjct  84   YYPLAGRLREL--SNRKLAVDCTGEGVLFIEAEANVALAELEEADALLPPFPCLEELLFD  141

Query  399  VEAPT-FLHIPPLVVQVS  449
            VE  T  ++ P L+ QV+
Sbjct  142  VEGSTDVINTPLLLFQVT  159



>ref|XP_010926850.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Elaeis guineensis]
Length=490

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 77/137 (56%), Gaps = 12/137 (9%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFR-----TSVAVDRLKCSLARALVD  224
            PTL+PP  +T      LSNLD QN +   ++ +Y FR        A   +K +L++ LV 
Sbjct  76   PTLVPPAKETEKGLYFLSNLD-QN-IAVIVQTIYCFRAEDRGNEGAAVAIKEALSKVLVH  133

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSW-RKLLYKV  401
            Y+PLAGRLT C +   KL VDC   GAVF EA  D   ++   ++ KP+ S   KL+Y +
Sbjct  134  YHPLAGRLTICSEG--KLIVDCTGEGAVFVEAEADCRLEDIGDIA-KPDPSMLGKLVYNI  190

Query  402  -EAPTFLHIPPLVVQVS  449
              A   L IPPLV QV+
Sbjct  191  PGAKNILEIPPLVAQVT  207



>gb|EMT25787.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Aegilops tauschii]
Length=337

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 70/135 (52%), Gaps = 8/135 (6%)
 Frame = +3

Query  63   TLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR-----LKCSLARALVDY  227
             L+PP + TP     LS++DDQ  LRF +  ++ FR     D      ++ ++A ALV Y
Sbjct  17   VLVPPAAPTPRELKRLSDIDDQEGLRFQLPLIHFFRRHDGQDDDPALVIRGAIAAALVHY  76

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKVEA  407
            YP AGRL     + RKL VDC   G +F EA  D+  D+F    G P     +LL+ V  
Sbjct  77   YPFAGRLREL--EGRKLAVDCTGEGVLFVEADSDVRLDQFDAALGPPFPCLDELLFDVPG  134

Query  408  PT-FLHIPPLVVQVS  449
             +  L  P L+ QV+
Sbjct  135  SSGILDSPLLLFQVT  149



>emb|CDY50708.1| BnaC05g47750D [Brassica napus]
Length=467

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 75/138 (54%), Gaps = 10/138 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA-----VDRLKCSLARALVD  224
            P L+ P   TP    PLS++DDQ  LRF I +++ +R ++      V  ++ +L + LV 
Sbjct  25   PELVTPAKPTPLELKPLSDIDDQQGLRFQIPFIFFYRPNLTCTLDPVQVIRRALGQTLVY  84

Query  225  YYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSG--KPNRSWRKLLYK  398
            YYP AGRL   P+  +KL VDC   G +F EA  D+T  E  +      P     +LL+ 
Sbjct  85   YYPFAGRLWEGPN--QKLAVDCTGEGVLFIEADADVTFAELEEADALLPPFPCLEELLFD  142

Query  399  VEAPT-FLHIPPLVVQVS  449
            VE  +  L+ P L+VQV+
Sbjct  143  VEGSSELLNTPLLLVQVT  160



>ref|XP_008373467.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 63/103 (61%), Gaps = 9/103 (9%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR-------LKCSLARAL  218
            P LI P   TP  +  LS++DDQ  LRF +  +  ++ + ++++       ++ +L+RAL
Sbjct  14   PELITPAKPTPHETKFLSDMDDQEGLRFQVPIIMCYKDNPSLNKHHNPVKVIREALSRAL  73

Query  219  VDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEF  347
            V YYPLAGRL   P+  RKL VDCN  G +F EAF D+T ++ 
Sbjct  74   VYYYPLAGRLREGPN--RKLMVDCNGEGILFIEAFADVTLEQL  114



>ref|NP_001148135.1| taxadien-5-alpha-ol O-acetyltransferase [Zea mays]
 gb|ACG29843.1| taxadien-5-alpha-ol O-acetyltransferase [Zea mays]
Length=436

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 78/142 (55%), Gaps = 15/142 (11%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR---------LKCSLAR  212
            P L+ P + TP  +  LS++DDQ  LR  + +L+L+R  V V           ++ +L  
Sbjct  15   PALVGPAAPTPRETKRLSDIDDQETLRGQMPFLFLYRGGVHVRADNDDDPACVIRRALGE  74

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSG--KPNRSWRK  386
            ALV +YPLAGRL     + RKL VDC   G +F EA  D+  DE ++ +G   P     +
Sbjct  75   ALVPFYPLAGRLREV--EGRKLVVDCTGEGVLFVEADADVRLDE-LEATGLRPPFPCMDQ  131

Query  387  LLYKVEAPT-FLHIPPLVVQVS  449
            LL+ V+  +  LH P L++QV+
Sbjct  132  LLFDVDGSSAVLHCPLLLIQVT  153



>ref|XP_006878641.1| hypothetical protein AMTR_s00011p00264530 [Amborella trichopoda]
 gb|ERM94786.1| hypothetical protein AMTR_s00011p00264530 [Amborella trichopoda]
Length=160

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 70/137 (51%), Gaps = 9/137 (7%)
 Frame = +3

Query  54   TTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARA  215
            + P L+ P+  TP    PLS++DDQ   RF I  +  +R    +D       +  +L+ A
Sbjct  13   SKPMLVSPSRPTPYEIKPLSDIDDQEGFRFQIPVIQFYRKDPKMDGRDPARVVTDALSEA  72

Query  216  LVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLY  395
            LV YYP AGRL     +++KL V+C+  G +F E   D++ +EF      P   W KLL 
Sbjct  73   LVYYYPFAGRLI--EGENKKLSVECSGEGVLFVEGDADVSLEEFGDALKPPFPCWEKLLM  130

Query  396  KV-EAPTFLHIPPLVVQ  443
             V  +   +  P L++Q
Sbjct  131  HVPGSDGVIGCPLLLIQ  147



>ref|XP_010527080.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Tarenaya 
hassleriana]
Length=459

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 74/143 (52%), Gaps = 16/143 (11%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRT------------SVAVDRLKCS  203
            P LI P   TP     LS +D Q+F+R  ++ ++ FR             S  V+ ++ +
Sbjct  22   PELICPAKPTPCELKILSGIDHQDFIRCHLRMIFFFRHNPLTKGNGNNNHSDPVEVIRKA  81

Query  204  LARALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWR  383
            LA  LV Y+P AGRL   PD    L VDCN  GA+F EA  ++  DEF  L   P     
Sbjct  82   LAETLVYYHPFAGRLREGPDG--SLSVDCNGRGALFVEADAEMALDEFGDLC-PPFPCLE  138

Query  384  KLLYKVEAP-TFLHIPPLVVQVS  449
            +LL+  E P  FLH P L++QV+
Sbjct  139  ELLFHDEGPRGFLHSPLLLLQVT  161



>ref|XP_007029787.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
 gb|EOY10289.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
Length=485

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 75/137 (55%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARALV  221
            P L+ P   TP     LS++DDQ+  RF I+ L+ +R   ++        +K +L +ALV
Sbjct  31   PELVVPAKPTPRECKLLSDIDDQDGHRFQIRGLHFYRFKPSMQGKDPACIIKEALTKALV  90

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYP AGRL   P+  RKL VDC   G +F +A  D+T D+F      P   +++LLY+V
Sbjct  91   FYYPYAGRLREGPN--RKLVVDCTGEGVLFIQADADVTLDQFGDSLHPPFPCYKELLYEV  148

Query  402  EAPT-FLHIPPLVVQVS  449
                  L+ P L +QV+
Sbjct  149  PGSNELLNCPLLQIQVT  165



>ref|XP_002875921.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52180.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=431

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 78/140 (56%), Gaps = 13/140 (9%)
 Frame = +3

Query  57   TPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR-----LKCSLARALV  221
             P LIPP S+TP+    LSNLD QN +   +K LY +++    +      +K SL+  LV
Sbjct  13   NPELIPPVSETPNGHYYLSNLD-QN-IAIIVKTLYYYKSESRTNEESYNVIKKSLSEVLV  70

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNR--SWRKLLY  395
             YYP+AGRLT  P+   K+ V+C   G V  EA  +    E I+ +   NR  +  KL+Y
Sbjct  71   HYYPVAGRLTISPEG--KIAVNCTGEGVVVVEAEAN-CGIETIKEAISENRMETLEKLVY  127

Query  396  KV-EAPTFLHIPPLVVQVSS  452
             V  A   L IPP+VVQV++
Sbjct  128  DVPGARNILEIPPVVVQVTN  147



>ref|XP_010441266.1| PREDICTED: omega-hydroxypalmitate O-feruloyl transferase-like 
[Camelina sativa]
Length=484

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 75/140 (54%), Gaps = 10/140 (7%)
 Frame = +3

Query  48   YPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLAR  212
            +   P L+ P S+T      LSNLD QN +   ++ +Y F++       AV  +K +L++
Sbjct  61   HQKEPALVKPESETRKGLYFLSNLD-QN-IAVIVRTIYCFKSEERGNEEAVQVIKKALSQ  118

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV YYPLAGRLT  P+   KL VDC   G VF EA  +   DE   ++     +  KL+
Sbjct  119  VLVHYYPLAGRLTISPEG--KLTVDCTGEGVVFVEAEANCKMDEIGDITKPDPETLGKLV  176

Query  393  YK-VEAPTFLHIPPLVVQVS  449
            Y  V+A   L IPP+  QV+
Sbjct  177  YDVVDAKNILEIPPVTAQVT  196



>ref|XP_006289628.1| hypothetical protein CARUB_v10003180mg [Capsella rubella]
 gb|EOA22526.1| hypothetical protein CARUB_v10003180mg [Capsella rubella]
Length=451

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 74/137 (54%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA----VDRLKCSLARALVDY  227
            P LI P   TP     LS++D+Q  LRF I  ++ +R S      V  ++ +LA  LV Y
Sbjct  14   PELISPAKPTPREIKLLSDIDEQEGLRFHIPTIFFYRHSTKASDPVAGIRRALAETLVYY  73

Query  228  YPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSG--KPNRSWRKLLYKV  401
            YP AGRL   P+  RKL VDC   G +F EA  ++T  EF +      P   + +LL+ V
Sbjct  74   YPFAGRLREGPN--RKLSVDCTGEGVLFIEAVANVTLVEFEEKDALKPPFPCFEELLFDV  131

Query  402  EAPT-FLHIPPLVVQVS  449
            E  T  L+ P +++QV+
Sbjct  132  EGSTEVLNTPLMLMQVT  148



>ref|XP_006405403.1| hypothetical protein EUTSA_v10027756mg [Eutrema salsugineum]
 gb|ESQ46856.1| hypothetical protein EUTSA_v10027756mg [Eutrema salsugineum]
Length=456

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 75/140 (54%), Gaps = 10/140 (7%)
 Frame = +3

Query  48   YPTTPTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSV-----AVDRLKCSLAR  212
            +   P L+ P S+T      LSNLD QN +   ++ +Y F++       AV  +K +L++
Sbjct  33   FQKEPALVKPESETRKGLYFLSNLD-QN-IAVIVRTIYCFKSEERGNEEAVQVIKKALSQ  90

Query  213  ALVDYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLL  392
             LV YYPLAGRLT  P+   KL VDC   G VF EA  +   DE   ++     +  KL+
Sbjct  91   VLVHYYPLAGRLTISPEG--KLTVDCTEEGVVFVEAEANCKMDEIGDITKPDPETLGKLV  148

Query  393  YK-VEAPTFLHIPPLVVQVS  449
            Y  V+A   L IPP+  QV+
Sbjct  149  YDVVDAKNILEIPPVTAQVT  168



>gb|KHF99421.1| Benzyl alcohol O-benzoyltransferase [Gossypium arboreum]
Length=454

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 74/137 (54%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVA------VDRLKCSLARALV  221
            P LI P   TP     LS++DDQ  LRF I  +  ++ + +      V  ++ +LA+ALV
Sbjct  17   PELIAPAKPTPHEYKLLSDIDDQEGLRFQIPVIQFYKYNPSMQGKDPVRVIREALAQALV  76

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYP AGRL   P   RKL VDC   G +F EA  D+T ++F  +   P     +LLY V
Sbjct  77   FYYPFAGRLREGP--QRKLMVDCTGEGLMFIEADADVTLEQFGDVLQPPFPCLEELLYDV  134

Query  402  EAPT-FLHIPPLVVQVS  449
               T  L+ P +++QV+
Sbjct  135  PGSTGVLNCPVILIQVT  151



>ref|XP_007029786.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
 gb|EOY10288.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
Length=525

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 75/137 (55%), Gaps = 9/137 (7%)
 Frame = +3

Query  60   PTLIPPTSKTPSHSLPLSNLDDQNFLRFSIKYLYLFRTSVAVDR------LKCSLARALV  221
            P L+ P   TP     LS++DDQ+  RF I+ L+ +R   ++        +K +L +ALV
Sbjct  39   PELVVPAKPTPRECKLLSDIDDQDGHRFQIRGLHFYRFKPSMQGKDPACIIKEALTKALV  98

Query  222  DYYPLAGRLTPCPDDHRKLQVDCNAAGAVFAEAFMDLTADEFIQLSGKPNRSWRKLLYKV  401
             YYP AGRL   P+  RKL VDC   G +F +A  D+T D+F      P   +++LLY+V
Sbjct  99   FYYPYAGRLREGPN--RKLVVDCTGEGVLFIQADADVTLDQFGDSLHPPFPCYKELLYEV  156

Query  402  EAPT-FLHIPPLVVQVS  449
                  L+ P L +QV+
Sbjct  157  PGSNELLNCPLLQIQVT  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897646128048