BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19337_g1_i1 len=1780 path=[3899:0-7 216:8-31 240:32-1779]

Length=1780
                                                                      Score     E

ref|XP_009801176.1|  PREDICTED: cytochrome P450 CYP82D47-like           463   2e-153   
ref|XP_006339196.1|  PREDICTED: cytochrome P450 82C4-like               462   8e-153   
gb|ABC69375.1|  CYP82M1v4                                               457   5e-151   Nicotiana tabacum [American tobacco]
ref|XP_009616319.1|  PREDICTED: cytochrome P450 CYP82D47-like           456   1e-150   
gb|ABC69374.1|  CYP82M1v3                                               455   4e-150   Nicotiana tabacum [American tobacco]
gb|ABC69373.1|  CYP82M1v2                                               454   1e-149   Nicotiana tabacum [American tobacco]
gb|ABC69376.1|  CYP82M1v5                                               454   1e-149   Nicotiana tabacum [American tobacco]
gb|ABC69372.1|  CYP82M1v1                                               454   1e-149   Nicotiana tabacum [American tobacco]
ref|XP_004249377.1|  PREDICTED: cytochrome P450 82C4-like               453   3e-149   
ref|XP_006352674.1|  PREDICTED: cytochrome P450 82C4-like               448   1e-147   
ref|XP_007136644.1|  hypothetical protein PHAVU_009G061600g             447   5e-147   
ref|XP_006375022.1|  hypothetical protein POPTR_0014s03660g             443   2e-145   
ref|XP_011030904.1|  PREDICTED: cytochrome P450 82C4-like               443   2e-145   
dbj|BAM36727.1|  nicotine N-demethylase                                 441   6e-145   
ref|XP_007227272.1|  hypothetical protein PRUPE_ppa017703mg             440   2e-144   
dbj|BAM36726.1|  nicotine N-demethylase                                 440   2e-144   
dbj|BAM36725.1|  nicotine N-demethylase                                 440   2e-144   
dbj|BAM36724.1|  nicotine N-demethylase                                 439   5e-144   
gb|AJD25203.1|  cytochrome P450 CYP82V2                                 439   5e-144   
ref|XP_008378409.1|  PREDICTED: cytochrome P450 82C4-like               439   7e-144   
ref|XP_009758062.1|  PREDICTED: cytochrome P450 82C4-like               437   1e-143   
ref|XP_009364162.1|  PREDICTED: cytochrome P450 82C4-like               438   2e-143   
ref|XP_006349946.1|  PREDICTED: cytochrome P450 82C2-like               438   2e-143   
gb|ABR57311.1|  cytochrome P450 monooxygenase                           437   3e-143   Nicotiana sylvestris
dbj|BAM36723.1|  nicotine N-demethylase                                 437   3e-143   
ref|XP_009609537.1|  PREDICTED: cytochrome P450 82C4-like               436   7e-143   
ref|XP_006473405.1|  PREDICTED: cytochrome P450 82C4-like               435   3e-142   
gb|ABD39477.1|  CYP82E4v6                                               433   1e-141   Nicotiana tabacum [American tobacco]
ref|XP_003523888.1|  PREDICTED: cytochrome P450 82C4-like               433   1e-141   
ref|XP_006434890.1|  hypothetical protein CICLE_v10003803mg             433   2e-141   
gb|KDO84376.1|  hypothetical protein CISIN_1g036812mg                   432   2e-141   
ref|XP_011089652.1|  PREDICTED: cytochrome P450 82C2                    432   2e-141   
gb|ADP65809.1|  nicotine N-demethylase                                  432   3e-141   
ref|XP_009599169.1|  PREDICTED: cytochrome P450 82C4-like               432   3e-141   
ref|XP_009757628.1|  PREDICTED: cytochrome P450 CYP82D47-like           432   3e-141   
ref|XP_009619218.1|  PREDICTED: cytochrome P450 CYP82D47-like           431   5e-141   
gb|ABA07806.2|  cytochrome P450 monooxygenase CYP82E2                   431   7e-141   Nicotiana tabacum [American tobacco]
ref|XP_009778755.1|  PREDICTED: cytochrome P450 82C4-like               430   1e-140   
gb|ABD39479.1|  CYP82E4v8                                               430   2e-140   Nicotiana tabacum [American tobacco]
ref|XP_004248527.2|  PREDICTED: cytochrome P450 CYP82D47-like           430   3e-140   
gb|ABX56037.1|  CYP82E5v2                                               429   4e-140   Nicotiana tabacum [American tobacco]
gb|ABA07804.1|  cytochrome P450 monooxygenase CYP82E4v2                 429   4e-140   Nicotiana tabacum [American tobacco]
ref|XP_009609539.1|  PREDICTED: cytochrome P450 82C4-like               429   5e-140   
gb|ABA07805.1|  cytochrome P450 monooxygenase CYP82E4v1                 429   6e-140   Nicotiana tabacum [American tobacco]
gb|ABD39483.1|  CYP82E2v2                                               429   6e-140   Nicotiana tabacum [American tobacco]
ref|XP_009627979.1|  PREDICTED: cytochrome P450 82C4-like               429   6e-140   
gb|ABA07807.1|  cytochrome P450 monooxygenase CYP82E3                   429   6e-140   Nicotiana tabacum [American tobacco]
gb|ABD39476.1|  CYP82E4v5                                               428   7e-140   Nicotiana tabacum [American tobacco]
gb|ABD39478.1|  CYP82E4v7                                               428   9e-140   Nicotiana tabacum [American tobacco]
gb|ABD39485.1|  CYP82E2v4                                               428   1e-139   Nicotiana tabacum [American tobacco]
ref|XP_002323130.1|  hypothetical protein POPTR_0016s00980g             427   1e-139   Populus trichocarpa [western balsam poplar]
gb|ABC69371.1|  CYP82E5                                                 428   1e-139   Nicotiana tabacum [American tobacco]
ref|XP_009348373.1|  PREDICTED: cytochrome P450 CYP82D47-like           428   2e-139   
gb|ABD39480.1|  CYP82E4v10                                              427   2e-139   Nicotiana tabacum [American tobacco]
gb|ABD39475.1|  CYP82E4v4                                               427   2e-139   Nicotiana tabacum [American tobacco]
ref|XP_010106089.1|  Cytochrome P450 82C4                               427   3e-139   
gb|ABD39474.1|  CYP82E4v3                                               427   4e-139   Nicotiana tabacum [American tobacco]
gb|ABD39484.1|  CYP82E2v3                                               426   8e-139   Nicotiana tabacum [American tobacco]
gb|ABD39481.1|  CYP82E4v11                                              426   9e-139   Nicotiana tabacum [American tobacco]
emb|CDY53704.1|  BnaC03g67210D                                          426   1e-138   
ref|XP_010437977.1|  PREDICTED: cytochrome P450 82C4-like               425   2e-138   
ref|XP_011040244.1|  PREDICTED: cytochrome P450 82C4-like               426   2e-138   
emb|CDY23316.1|  BnaA08g12300D                                          424   3e-138   
gb|AGD93125.1|  CYP450 nicotine N-demethylase                           424   3e-138   
ref|XP_010069626.1|  PREDICTED: cytochrome P450 CYP82D47-like           425   4e-138   
ref|XP_009606611.1|  PREDICTED: cytochrome P450 82C4-like               425   4e-138   
ref|XP_009109920.1|  PREDICTED: cytochrome P450 82C4                    424   5e-138   
gb|ABD39482.1|  CYP82E4v12                                              423   1e-137   Nicotiana tabacum [American tobacco]
ref|XP_007017403.1|  Cytochrome P450, family 82, subfamily C, pol...    422   2e-137   
ref|XP_008372514.1|  PREDICTED: cytochrome P450 CYP82D47-like           421   5e-137   
ref|XP_002284031.1|  PREDICTED: cytochrome P450 82C4                    421   9e-137   Vitis vinifera
ref|XP_011101555.1|  PREDICTED: cytochrome P450 CYP82D47-like           421   9e-137   
ref|XP_009761500.1|  PREDICTED: cytochrome P450 82C2-like               421   2e-136   
ref|XP_008372515.1|  PREDICTED: cytochrome P450 82C4-like               419   5e-136   
gb|KFK29809.1|  hypothetical protein AALP_AA7G181800                    418   7e-136   
ref|XP_010447469.1|  PREDICTED: cytochrome P450 82C4-like               418   1e-135   
ref|XP_009348374.1|  PREDICTED: cytochrome P450 CYP82D47-like           417   1e-135   
ref|XP_010069627.1|  PREDICTED: cytochrome P450 CYP82D47-like           417   3e-135   
gb|KCW58034.1|  hypothetical protein EUGRSUZ_H00762                     416   7e-135   
emb|CDP15065.1|  unnamed protein product                                416   7e-135   
ref|XP_002869304.1|  CYP82C4                                            416   1e-134   
ref|XP_010069621.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    415   3e-134   
ref|XP_008235431.1|  PREDICTED: cytochrome P450 82C4-like               414   3e-134   
ref|XP_004241385.1|  PREDICTED: cytochrome P450 82C2-like               414   5e-134   
ref|XP_002300088.2|  hypothetical protein POPTR_0001s34230g             412   2e-133   Populus trichocarpa [western balsam poplar]
ref|XP_010436299.1|  PREDICTED: cytochrome P450 82C4-like               412   2e-133   
ref|XP_004236938.1|  PREDICTED: cytochrome P450 82C4-like               412   3e-133   
ref|XP_007049687.1|  Cytochrome P450 82A3, putative                     410   9e-133   
ref|XP_010451089.1|  PREDICTED: cytochrome P450 82C4                    409   3e-132   
ref|XP_010526010.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    409   3e-132   
ref|XP_006283535.1|  hypothetical protein CARUB_v10004585mg             409   4e-132   
ref|XP_010445016.1|  PREDICTED: cytochrome P450 82C4-like               409   5e-132   
ref|XP_002510298.1|  cytochrome P450, putative                          408   6e-132   Ricinus communis
ref|XP_010918630.1|  PREDICTED: cytochrome P450 82C4-like               407   8e-132   
gb|KDP26345.1|  hypothetical protein JCGZ_17503                         408   9e-132   
ref|XP_002869302.1|  CYP82C4                                            407   1e-131   
ref|XP_011045174.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    408   1e-131   
ref|NP_194922.1|  cytochrome P450, family 82, subfamily C, polype...    407   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006342717.1|  PREDICTED: cytochrome P450 82C4-like               407   3e-131   
ref|XP_010432796.1|  PREDICTED: cytochrome P450 82C4-like               407   3e-131   
ref|XP_010104162.1|  Cytochrome P450 82C4                               405   3e-131   
ref|XP_010526011.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    406   3e-131   
ref|XP_003635525.2|  PREDICTED: cytochrome P450 CYP82D47-like           406   4e-131   
ref|XP_010547839.1|  PREDICTED: cytochrome P450 82C4-like               405   6e-131   
ref|XP_002531094.1|  cytochrome P450, putative                          405   7e-131   Ricinus communis
emb|CAN77159.1|  hypothetical protein VITISV_019026                     408   7e-131   Vitis vinifera
ref|XP_002264473.1|  PREDICTED: cytochrome P450 82C4-like               404   2e-130   Vitis vinifera
ref|XP_004252778.1|  PREDICTED: cytochrome P450 82C4-like               404   2e-130   
ref|XP_010069622.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    402   2e-130   
ref|XP_007200049.1|  hypothetical protein PRUPE_ppa023510mg             404   3e-130   
ref|XP_002274740.1|  PREDICTED: cytochrome P450 CYP82D47                404   3e-130   Vitis vinifera
ref|XP_007222622.1|  hypothetical protein PRUPE_ppa004175mg             403   8e-130   
ref|XP_007201695.1|  hypothetical protein PRUPE_ppa004301mg             402   8e-130   
gb|KDP38423.1|  hypothetical protein JCGZ_04348                         403   2e-129   
ref|XP_011045172.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    402   2e-129   
emb|CDP00859.1|  unnamed protein product                                400   1e-128   
ref|XP_007049686.1|  Cytochrome P450, family 82, subfamily C, pol...    402   2e-128   
ref|XP_010253830.1|  PREDICTED: cytochrome P450 CYP82D47-like           399   2e-128   
ref|XP_007049681.1|  Cytochrome P450                                    398   4e-128   
ref|NP_194925.1|  cytochrome P450, family 82, subfamily C, polype...    397   8e-128   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28662.1|  unknown                                                 397   1e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006443550.1|  hypothetical protein CICLE_v10019727mg             397   2e-127   
ref|XP_009364189.1|  PREDICTED: cytochrome P450 82A3-like               395   5e-127   
ref|XP_009801068.1|  PREDICTED: cytochrome P450 82C4-like               394   6e-127   
ref|XP_002264520.2|  PREDICTED: cytochrome P450 82C4                    397   8e-127   Vitis vinifera
ref|XP_006473406.1|  PREDICTED: cytochrome P450 82A3-like               395   8e-127   
emb|CAN81014.1|  hypothetical protein VITISV_025152                     394   1e-126   Vitis vinifera
ref|XP_010934114.1|  PREDICTED: cytochrome P450 82C4-like               395   1e-126   
ref|XP_002264464.1|  PREDICTED: cytochrome P450 CYP82D47                394   1e-126   Vitis vinifera
ref|XP_007134140.1|  hypothetical protein PHAVU_010G022700g             395   1e-126   
ref|XP_006434891.1|  hypothetical protein CICLE_v10000852mg             394   2e-126   
emb|CAN66846.1|  hypothetical protein VITISV_002367                     393   6e-126   Vitis vinifera
ref|XP_010264712.1|  PREDICTED: cytochrome P450 CYP82D47-like           393   6e-126   
ref|XP_007017404.1|  Cytochrome P450 82A3, putative                     393   6e-126   
ref|XP_006355071.1|  PREDICTED: cytochrome P450 82C4-like               392   8e-126   
emb|CDP15728.1|  unnamed protein product                                392   9e-126   
gb|KDO84377.1|  hypothetical protein CISIN_1g009899mg                   392   9e-126   
ref|XP_002264790.1|  PREDICTED: cytochrome P450 CYP82D47                392   2e-125   Vitis vinifera
ref|XP_002274509.1|  PREDICTED: cytochrome P450 CYP82D47-like           392   2e-125   Vitis vinifera
ref|XP_011039260.1|  PREDICTED: cytochrome P450 CYP82D47-like           392   2e-125   
emb|CAN61061.1|  hypothetical protein VITISV_018742                     391   6e-125   Vitis vinifera
ref|XP_002531093.1|  cytochrome P450, putative                          390   7e-125   Ricinus communis
ref|XP_006443549.1|  hypothetical protein CICLE_v10019706mg             390   1e-124   
ref|XP_007017409.1|  Cytochrome P450, family 82, subfamily C, pol...    389   2e-124   
ref|XP_011030924.1|  PREDICTED: cytochrome P450 CYP82D47-like           389   3e-124   
gb|KDP26346.1|  hypothetical protein JCGZ_17504                         388   3e-124   
ref|XP_002283952.2|  PREDICTED: cytochrome P450 CYP82D47-like           389   3e-124   Vitis vinifera
ref|XP_007134137.1|  hypothetical protein PHAVU_010G022400g             388   4e-124   
emb|CAN74205.1|  hypothetical protein VITISV_031127                     388   6e-124   Vitis vinifera
ref|XP_002282111.2|  PREDICTED: cytochrome P450 82A3-like               387   7e-124   Vitis vinifera
ref|XP_003548649.2|  PREDICTED: cytochrome P450 82C2-like               388   7e-124   
ref|XP_010106088.1|  Cytochrome P450 82A4                               387   1e-123   
ref|XP_003547786.2|  PREDICTED: cytochrome P450 82C2-like               387   2e-123   
gb|AJD25202.1|  cytochrome P450 CYP82U4                                 386   2e-123   
emb|CDP03915.1|  unnamed protein product                                384   4e-123   
ref|XP_009364774.1|  PREDICTED: cytochrome P450 82A3-like               385   6e-123   
gb|KEH25406.1|  cytochrome P450 family protein                          384   7e-123   
ref|XP_008235430.1|  PREDICTED: cytochrome P450 CYP82D47-like           384   8e-123   
gb|KHG07864.1|  Cytochrome P450 protein                                 384   9e-123   
ref|XP_002282035.1|  PREDICTED: cytochrome P450 CYP82D47-like           384   1e-122   Vitis vinifera
ref|XP_009336429.1|  PREDICTED: cytochrome P450 82A3-like               384   1e-122   
ref|XP_008796321.1|  PREDICTED: cytochrome P450 CYP82D47-like           384   1e-122   
ref|XP_009336967.1|  PREDICTED: cytochrome P450 82A4-like               384   1e-122   
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                    390   2e-122   Vitis vinifera
emb|CBI36491.3|  unnamed protein product                                385   2e-122   
ref|XP_006375029.1|  putative cytochrome P450 family protein            384   2e-122   
ref|XP_002510297.1|  cytochrome P450, putative                          383   3e-122   Ricinus communis
ref|XP_010664626.1|  PREDICTED: cytochrome P450 CYP82D47                384   3e-122   
ref|XP_004291927.1|  PREDICTED: cytochrome P450 82A3-like               383   4e-122   
emb|CBI40977.3|  unnamed protein product                                384   4e-122   
ref|XP_008220885.1|  PREDICTED: cytochrome P450 82A3-like               397   4e-122   
ref|XP_009595933.1|  PREDICTED: cytochrome P450 82A4-like               382   6e-122   
ref|XP_002282118.1|  PREDICTED: cytochrome P450 CYP82D47-like           382   6e-122   Vitis vinifera
ref|XP_007047111.1|  Cytochrome P450                                    382   1e-121   
emb|CDP15727.1|  unnamed protein product                                383   2e-121   
ref|XP_007134139.1|  hypothetical protein PHAVU_010G022600g             382   2e-121   
gb|KDP38422.1|  hypothetical protein JCGZ_04347                         381   2e-121   
ref|XP_003537400.1|  PREDICTED: cytochrome P450 82A3-like               381   3e-121   
ref|XP_009792748.1|  PREDICTED: cytochrome P450 CYP82D47-like           380   4e-121   
ref|XP_008464765.1|  PREDICTED: cytochrome P450 CYP82D47-like           380   4e-121   
ref|XP_008464764.1|  PREDICTED: cytochrome P450 CYP82D47-like           380   5e-121   
gb|KHG29694.1|  Cytochrome P450                                         380   5e-121   
ref|XP_009770601.1|  PREDICTED: cytochrome P450 CYP82D47-like           380   5e-121   
gb|ABC69420.1|  CYP82E8                                                 380   7e-121   Nicotiana tabacum [American tobacco]
ref|XP_009364178.1|  PREDICTED: cytochrome P450 CYP82D47-like           380   7e-121   
dbj|BAA35080.1|  putative cytochrome P450                               379   8e-121   Nicotiana tabacum [American tobacco]
gb|KHG29587.1|  Cytochrome P450 protein                                 379   9e-121   
gb|AII31758.1|  cytochrome P450 monooxygenase                           379   9e-121   
gb|KDP38424.1|  hypothetical protein JCGZ_04349                         379   1e-120   
ref|XP_004517185.1|  PREDICTED: cytochrome P450 82C4-like               379   1e-120   
ref|XP_009768110.1|  PREDICTED: cytochrome P450 82A4-like               379   1e-120   
ref|XP_002282133.1|  PREDICTED: cytochrome P450 CYP82D47                379   2e-120   Vitis vinifera
dbj|BAF98469.1|  cytochrome P450                                        378   2e-120   Coptis japonica var. dissecta
ref|XP_010547840.1|  PREDICTED: cytochrome P450 82C4-like               379   2e-120   
ref|XP_011008137.1|  PREDICTED: cytochrome P450 82G1-like               378   2e-120   
ref|XP_006376421.1|  cytochrome P450 family protein                     377   3e-120   
ref|XP_010919967.1|  PREDICTED: cytochrome P450 CYP82D47-like           378   3e-120   
ref|XP_002282085.3|  PREDICTED: cytochrome P450 82A1-like               392   4e-120   Vitis vinifera
ref|XP_003619137.1|  Cytochrome P450                                    377   4e-120   
ref|XP_011037409.1|  PREDICTED: cytochrome P450 82G1-like               377   7e-120   
ref|XP_004147802.1|  PREDICTED: cytochrome P450 82A4-like               377   9e-120   
gb|KHN42044.1|  Cytochrome P450 82A3                                    377   1e-119   
emb|CBI37514.3|  unnamed protein product                                392   2e-119   
ref|XP_004154826.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    376   3e-119   
gb|KHG01290.1|  Cytochrome P450                                         375   3e-119   
ref|XP_003619141.1|  Cytochrome P450                                    375   4e-119   
gb|AII31760.1|  cytochrome P450 monooxygenase                           375   5e-119   
ref|XP_002305292.2|  hypothetical protein POPTR_0004s10630g             374   7e-119   Populus trichocarpa [western balsam poplar]
gb|AAS90126.1|  cytochrome P450                                         375   8e-119   Ammi majus [ameo mayor]
ref|XP_006432714.1|  hypothetical protein CICLE_v10000845mg             374   1e-118   
ref|XP_006340061.1|  PREDICTED: cytochrome P450 82C4-like               374   1e-118   
ref|XP_006486179.1|  PREDICTED: cytochrome P450 82C4-like               374   1e-118   
gb|KGN59914.1|  hypothetical protein Csa_3G852630                       374   2e-118   
ref|XP_004147803.1|  PREDICTED: cytochrome P450 82C4-like               374   2e-118   
ref|XP_006432712.1|  hypothetical protein CICLE_v10000809mg             374   2e-118   
gb|AII31759.1|  cytochrome P450 monooxygenase                           373   2e-118   
ref|XP_007017415.1|  Cytochrome P450, putative                          373   3e-118   
ref|XP_004292356.1|  PREDICTED: cytochrome P450 82C4-like               372   3e-118   
ref|XP_003516592.1|  PREDICTED: cytochrome P450 82A3-like isoform X1    373   3e-118   
ref|XP_007222623.1|  hypothetical protein PRUPE_ppa004179mg             373   4e-118   
gb|KHN36187.1|  Cytochrome P450 82A3                                    373   5e-118   
ref|XP_007017406.1|  Cytochrome P450 82A3, putative                     386   7e-118   
ref|XP_010248151.1|  PREDICTED: cytochrome P450 82C4-like               370   8e-118   
emb|CAN76287.1|  hypothetical protein VITISV_027433                     372   1e-117   Vitis vinifera
gb|KDO40894.1|  hypothetical protein CISIN_1g009786mg                   371   1e-117   
gb|KHG29695.1|  Cytochrome P450                                         371   1e-117   
gb|KCW58033.1|  hypothetical protein EUGRSUZ_H00761                     372   2e-117   
ref|XP_006435903.1|  hypothetical protein CICLE_v10031215mg             371   2e-117   
ref|XP_007017417.1|  Cytochrome P450 82A3, putative isoform 2           371   2e-117   
gb|KDO40892.1|  hypothetical protein CISIN_1g009347mg                   371   2e-117   
ref|XP_003548652.1|  PREDICTED: cytochrome P450 82C4-like               370   2e-117   
ref|XP_008464766.1|  PREDICTED: cytochrome P450 CYP82D47-like           370   3e-117   
ref|XP_009336438.1|  PREDICTED: cytochrome P450 82A3-like               370   4e-117   
ref|XP_009364766.1|  PREDICTED: cytochrome P450 82A3-like               370   5e-117   
ref|XP_003519977.1|  PREDICTED: cytochrome P450 82A4-like               370   5e-117   
ref|XP_003523886.1|  PREDICTED: cytochrome P450 82A1-like               370   6e-117   
gb|KHN00733.1|  Cytochrome P450 82A4                                    369   7e-117   
ref|XP_008378426.1|  PREDICTED: cytochrome P450 CYP82D47-like           369   8e-117   
gb|KDP38427.1|  hypothetical protein JCGZ_04352                         369   8e-117   
ref|XP_003634362.2|  PREDICTED: cytochrome P450 CYP82D47-like           369   9e-117   
ref|XP_010092357.1|  Cytochrome P450 82A3                               369   1e-116   
ref|XP_009336448.1|  PREDICTED: cytochrome P450 82A3-like               369   2e-116   
ref|NP_001240972.1|  cytochrome P450 82A3                               369   2e-116   
ref|XP_010106082.1|  Cytochrome P450 82A3                               368   2e-116   
ref|XP_002510313.1|  cytochrome P450, putative                          368   3e-116   Ricinus communis
ref|XP_004247061.1|  PREDICTED: cytochrome P450 82C4-like               367   3e-116   
ref|XP_006486181.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    368   3e-116   
gb|KHN04536.1|  Cytochrome P450 82A1                                    366   4e-116   
ref|XP_010036785.1|  PREDICTED: cytochrome P450 82G1                    367   6e-116   
gb|KDO42182.1|  hypothetical protein CISIN_1g046041mg                   367   7e-116   
emb|CBI29738.3|  unnamed protein product                                373   8e-116   
ref|XP_003604789.1|  Cytochrome P450                                    367   8e-116   
gb|KCW45363.1|  hypothetical protein EUGRSUZ_L00956                     366   1e-115   
ref|XP_006471495.1|  PREDICTED: cytochrome P450 82C4-like               366   1e-115   
ref|XP_008388075.1|  PREDICTED: cytochrome P450 82A3-like               367   1e-115   
ref|XP_009780811.1|  PREDICTED: cytochrome P450 82C4-like               372   1e-115   
ref|XP_011005663.1|  PREDICTED: cytochrome P450 CYP82D47-like           366   1e-115   
ref|XP_010040234.1|  PREDICTED: cytochrome P450 CYP82D47-like           367   1e-115   
ref|XP_009365841.1|  PREDICTED: cytochrome P450 CYP82D47-like           366   2e-115   
ref|XP_009364154.1|  PREDICTED: cytochrome P450 CYP82D47-like           365   2e-115   
ref|XP_006346673.1|  PREDICTED: cytochrome P450 82C4-like               365   3e-115   
ref|XP_006432710.1|  hypothetical protein CICLE_v10000851mg             365   4e-115   
ref|XP_010664625.1|  PREDICTED: cytochrome P450 CYP82D47-like           365   4e-115   
ref|XP_009336944.1|  PREDICTED: cytochrome P450 82A3-like               365   4e-115   
gb|AJD25201.1|  cytochrome P450 CYP82D71                                364   5e-115   
gb|KHN13272.1|  Cytochrome P450 82A4                                    364   5e-115   
ref|XP_004510285.1|  PREDICTED: uncharacterized protein LOC101505071    379   5e-115   
ref|XP_007041355.1|  Cytochrome P450 82C4, putative isoform 1           367   5e-115   
ref|XP_003618361.1|  Cytochrome P450                                    365   6e-115   
ref|XP_006432704.1|  hypothetical protein CICLE_v10000846mg             364   7e-115   
ref|XP_003543523.2|  PREDICTED: cytochrome P450 82A4-like               365   8e-115   
gb|KDP38433.1|  hypothetical protein JCGZ_04358                         363   8e-115   
ref|XP_006573616.1|  PREDICTED: cytochrome P450 82A3-like isoform X3    364   8e-115   
gb|KDO65988.1|  hypothetical protein CISIN_1g011292mg                   362   1e-114   
ref|XP_006366435.1|  PREDICTED: cytochrome P450 82A3-like               363   1e-114   
ref|XP_007047112.1|  Cytochrome P450                                    369   1e-114   
gb|AGF30366.1|  CYP450 monooxygenase CYP82D62                           363   2e-114   
ref|XP_006471496.1|  PREDICTED: cytochrome P450 82C4-like               363   2e-114   
emb|CAN64371.1|  hypothetical protein VITISV_016844                     363   2e-114   Vitis vinifera
ref|XP_007017416.1|  Cytochrome P450 82A3, putative isoform 1           371   2e-114   
gb|KHN16362.1|  Cytochrome P450 82A3                                    363   3e-114   
ref|XP_007151141.1|  hypothetical protein PHAVU_004G021200g             362   4e-114   
emb|CDP07595.1|  unnamed protein product                                372   5e-114   
ref|XP_006471151.1|  PREDICTED: cytochrome P450 82C4-like               363   5e-114   
emb|CAN66023.1|  hypothetical protein VITISV_042713                     361   5e-114   
gb|AGF30364.1|  CYP450 monooxygenase CYP82D33                           362   5e-114   
ref|XP_010070486.1|  PREDICTED: cytochrome P450 CYP82D47-like           362   5e-114   
ref|XP_006464300.1|  PREDICTED: cytochrome P450 82C4-like               362   5e-114   
ref|XP_003618363.1|  Cytochrome P450                                    362   5e-114   
gb|KEH18124.1|  cytochrome P450 family 82 protein                       360   6e-114   
ref|XP_009795251.1|  PREDICTED: cytochrome P450 CYP82D47-like           362   6e-114   
ref|XP_008245476.1|  PREDICTED: cytochrome P450 CYP82D47-like           362   7e-114   
gb|KCW52083.1|  hypothetical protein EUGRSUZ_J01518                     362   9e-114   
ref|XP_009364169.1|  PREDICTED: cytochrome P450 CYP82D47-like           361   9e-114   
ref|XP_010028533.1|  PREDICTED: cytochrome P450 CYP82D47-like           361   1e-113   
ref|NP_001236179.1|  cytochrome P450 CYP82C1                            361   1e-113   
ref|XP_010060880.1|  PREDICTED: cytochrome P450 CYP82D47-like           361   2e-113   
ref|XP_003554074.1|  PREDICTED: cytochrome P450 82A3-like               360   2e-113   
gb|KCW68803.1|  hypothetical protein EUGRSUZ_F02402                     360   2e-113   
emb|CBI32510.3|  unnamed protein product                                363   2e-113   
ref|XP_010064743.1|  PREDICTED: cytochrome P450 CYP82D47-like           360   2e-113   
gb|KHG07801.1|  Cytochrome P450                                         360   2e-113   
ref|XP_006432705.1|  hypothetical protein CICLE_v10001118mg             358   2e-113   
ref|XP_002284810.3|  PREDICTED: cytochrome P450 CYP82D47                363   3e-113   
ref|XP_004489343.1|  PREDICTED: cytochrome P450 82A3-like               360   3e-113   
ref|XP_006464299.1|  PREDICTED: cytochrome P450 82C4-like               360   3e-113   
gb|KDP26347.1|  hypothetical protein JCGZ_17505                         360   4e-113   
ref|XP_004291926.1|  PREDICTED: cytochrome P450 82A3-like               360   4e-113   
gb|KDP38438.1|  hypothetical protein JCGZ_04363                         360   4e-113   
ref|XP_003618354.1|  Cytochrome P450                                    360   4e-113   
gb|KHG26594.1|  Cytochrome P450                                         360   4e-113   
gb|KCW67753.1|  hypothetical protein EUGRSUZ_F01486                     359   4e-113   
ref|XP_008372516.1|  PREDICTED: cytochrome P450 82G1-like               360   5e-113   
ref|XP_010091295.1|  Cytochrome P450 82G1                               360   5e-113   
ref|XP_008391540.1|  PREDICTED: cytochrome P450 82A4-like               359   6e-113   
emb|CAN75482.1|  hypothetical protein VITISV_020998                     358   6e-113   
ref|XP_010060877.1|  PREDICTED: cytochrome P450 CYP82D47-like           359   8e-113   
ref|XP_007224171.1|  hypothetical protein PRUPE_ppa016912mg             358   8e-113   
ref|XP_007222593.1|  hypothetical protein PRUPE_ppa004169mg             358   9e-113   
ref|XP_004147805.1|  PREDICTED: cytochrome P450 82A3-like               358   1e-112   
ref|XP_004154823.1|  PREDICTED: cytochrome P450 82A3-like               358   1e-112   
gb|KHG24650.1|  Cytochrome P450 protein                                 357   2e-112   
ref|XP_006464298.1|  PREDICTED: cytochrome P450 82C4-like               358   2e-112   
ref|XP_006465163.1|  PREDICTED: cytochrome P450 82C4-like               358   2e-112   
ref|NP_194923.1|  cytochrome P450, family 82, subfamily C, polype...    357   2e-112   
ref|XP_006573615.1|  PREDICTED: cytochrome P450 82A3-like isoform X2    358   2e-112   
gb|KDO39483.1|  hypothetical protein CISIN_1g009723mg                   357   3e-112   
gb|AES74584.2|  cytochrome P450 family protein                          357   3e-112   
gb|KGN59907.1|  hypothetical protein Csa_3G852560                       359   3e-112   
ref|XP_007201702.1|  hypothetical protein PRUPE_ppa004095mg             357   3e-112   
ref|XP_010028535.1|  PREDICTED: cytochrome P450 CYP82D47-like           357   3e-112   
ref|XP_006423130.1|  hypothetical protein CICLE_v10030016mg             357   4e-112   
ref|XP_007156852.1|  hypothetical protein PHAVU_002G022900g             357   4e-112   
ref|XP_008388170.1|  PREDICTED: cytochrome P450 82A3-like               357   4e-112   
ref|XP_007017413.1|  Cytochrome P450                                    357   4e-112   
ref|XP_006423133.1|  hypothetical protein CICLE_v10028201mg             357   5e-112   
ref|XP_008343753.1|  PREDICTED: cytochrome P450 CYP82D47-like           357   7e-112   
ref|XP_011073191.1|  PREDICTED: cytochrome P450 82C4-like               356   8e-112   
ref|XP_007151896.1|  hypothetical protein PHAVU_004G085000g             356   8e-112   
ref|XP_006427755.1|  hypothetical protein CICLE_v10025349mg             356   9e-112   
ref|XP_003618365.1|  Cytochrome P450                                    356   1e-111   
ref|XP_008235427.1|  PREDICTED: cytochrome P450 82G1-like               356   1e-111   
gb|KHN36186.1|  Cytochrome P450 82A3                                    356   1e-111   
ref|XP_010106083.1|  Cytochrome P450 82A3                               356   1e-111   
ref|XP_006432711.1|  hypothetical protein CICLE_v10003589mg             354   1e-111   
gb|KGN59915.1|  Cytochrome P450                                         355   1e-111   
gb|ABB20912.1|  P450 mono-oxygenase                                     355   2e-111   
ref|XP_010064744.1|  PREDICTED: cytochrome P450 CYP82D47-like           355   2e-111   
ref|XP_002284806.1|  PREDICTED: cytochrome P450 CYP82D47                355   2e-111   
gb|KHN42045.1|  Cytochrome P450 82C4                                    353   2e-111   
gb|KEH18125.1|  cytochrome P450 family protein                          354   2e-111   
ref|XP_006435895.1|  hypothetical protein CICLE_v10031217mg             355   2e-111   
gb|KDO42181.1|  hypothetical protein CISIN_1g009844mg                   355   3e-111   
ref|XP_007226598.1|  hypothetical protein PRUPE_ppa023495mg             355   3e-111   
ref|XP_010040235.1|  PREDICTED: cytochrome P450 CYP82D47-like           355   4e-111   
ref|XP_010070481.1|  PREDICTED: cytochrome P450 CYP82D47-like           354   5e-111   
ref|XP_007017414.1|  Cytochrome P450 82A3, putative                     361   5e-111   
ref|XP_007226343.1|  hypothetical protein PRUPE_ppa022174mg             354   5e-111   
ref|XP_002510312.1|  cytochrome P450, putative                          354   6e-111   
ref|XP_004238199.1|  PREDICTED: cytochrome P450 CYP82D47-like           354   6e-111   
ref|XP_006435899.1|  hypothetical protein CICLE_v10031216mg             354   6e-111   
ref|XP_008378401.1|  PREDICTED: cytochrome P450 CYP82D47-like           353   9e-111   
ref|XP_003554859.1|  PREDICTED: cytochrome P450 82A4-like               353   9e-111   
ref|XP_010070483.1|  PREDICTED: cytochrome P450 CYP82D47-like           353   1e-110   
ref|XP_010249368.1|  PREDICTED: cytochrome P450 CYP82D47-like           354   1e-110   
ref|XP_007201144.1|  hypothetical protein PRUPE_ppa016050mg             352   1e-110   
ref|XP_007151146.1|  hypothetical protein PHAVU_004G021700g             353   1e-110   
ref|XP_006366471.1|  PREDICTED: cytochrome P450 82A3-like               353   2e-110   
ref|XP_002510305.1|  cytochrome P450, putative                          353   2e-110   
emb|CDP15067.1|  unnamed protein product                                351   2e-110   
ref|XP_010070484.1|  PREDICTED: cytochrome P450 CYP82D47-like           353   2e-110   
ref|XP_004293232.1|  PREDICTED: cytochrome P450 82A3-like               351   2e-110   
gb|KCW68806.1|  hypothetical protein EUGRSUZ_F02405                     352   2e-110   
ref|XP_008382594.1|  PREDICTED: cytochrome P450 82G1-like               353   3e-110   
ref|XP_009348372.1|  PREDICTED: cytochrome P450 82G1-like               352   4e-110   
gb|AES74583.2|  cytochrome P450 family 82 protein                       352   4e-110   
ref|XP_003618345.1|  Cytochrome P450                                    352   4e-110   
emb|CBI19611.3|  unnamed protein product                                363   5e-110   
gb|AAG09208.1|AF175278_1  wound-inducible P450 hydroxylase              352   5e-110   
ref|XP_003554125.1|  PREDICTED: cytochrome P450 82A4-like               351   6e-110   
ref|XP_009372222.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    352   7e-110   
emb|CDP16080.1|  unnamed protein product                                351   7e-110   
emb|CDP07593.1|  unnamed protein product                                348   1e-109   
ref|XP_008235428.1|  PREDICTED: cytochrome P450 82G1-like               350   2e-109   
ref|XP_006375032.1|  hypothetical protein POPTR_0014s03770g             350   2e-109   
ref|XP_007017407.1|  Cytochrome P450                                    350   2e-109   
ref|XP_006432669.1|  hypothetical protein CICLE_v10000844mg             350   2e-109   
ref|XP_006375031.1|  hypothetical protein POPTR_0014s03760g             350   3e-109   
ref|XP_006471473.1|  PREDICTED: cytochrome P450 82A3-like               350   3e-109   
ref|XP_007224041.1|  hypothetical protein PRUPE_ppa015200mg             349   4e-109   
ref|XP_004291928.1|  PREDICTED: cytochrome P450 82A4-like               350   4e-109   
ref|XP_006379218.1|  hypothetical protein POPTR_0009s11180g             348   4e-109   
ref|XP_003554118.2|  PREDICTED: cytochrome P450 82A4-like               350   5e-109   
ref|XP_002510306.1|  cytochrome P450, putative                          349   6e-109   
ref|XP_003528211.2|  PREDICTED: cytochrome P450 82A1-like               349   6e-109   
ref|XP_007151148.1|  hypothetical protein PHAVU_004G021900g             349   1e-108   
ref|XP_008351399.1|  PREDICTED: cytochrome P450 82A4-like               348   1e-108   
ref|XP_008464770.1|  PREDICTED: cytochrome P450 CYP82D47-like           348   1e-108   
ref|XP_008466638.1|  PREDICTED: cytochrome P450 CYP82D47-like           348   1e-108   
gb|KHN34164.1|  Cytochrome P450 82A4                                    348   1e-108   
gb|AFK79026.1|  cytochrome P450 CYP82T1                                 348   2e-108   
ref|XP_010034443.1|  PREDICTED: cytochrome P450 CYP82D47-like           345   2e-108   
ref|XP_002522370.1|  cytochrome P450, putative                          347   2e-108   
gb|KDP38426.1|  hypothetical protein JCGZ_04351                         347   3e-108   
gb|KCW60845.1|  hypothetical protein EUGRSUZ_H03582                     347   3e-108   
ref|XP_010696237.1|  PREDICTED: cytochrome P450 82G1                    347   3e-108   
ref|XP_004488195.1|  PREDICTED: cytochrome P450 82A3-like               347   3e-108   
ref|XP_011030916.1|  PREDICTED: cytochrome P450 CYP82D47-like           347   3e-108   
emb|CAN65652.1|  hypothetical protein VITISV_016780                     345   5e-108   
ref|XP_006581227.1|  PREDICTED: cytochrome P450 82A1-like               346   7e-108   
ref|XP_004147820.1|  PREDICTED: cytochrome P450 82C4-like               346   7e-108   
gb|KEH33015.1|  cytochrome P450 family 82 protein                       346   7e-108   
ref|XP_009624056.1|  PREDICTED: cytochrome P450 82A3-like               345   8e-108   
gb|KHN16363.1|  Cytochrome P450 82A4                                    346   9e-108   
ref|XP_010064745.1|  PREDICTED: cytochrome P450 CYP82D47-like           346   1e-107   
gb|KCW68807.1|  hypothetical protein EUGRSUZ_F02406                     345   1e-107   
gb|KEH37856.1|  cytochrome P450 family protein                          345   1e-107   
ref|XP_008382597.1|  PREDICTED: cytochrome P450 82G1-like               346   1e-107   
ref|XP_004238201.1|  PREDICTED: cytochrome P450 CYP82D47-like           345   2e-107   
ref|XP_010527267.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    345   2e-107   
gb|KDP38432.1|  hypothetical protein JCGZ_04357                         345   2e-107   
ref|XP_007151149.1|  hypothetical protein PHAVU_004G022000g             345   2e-107   
ref|XP_010647827.1|  PREDICTED: cytochrome P450 CYP82D47                345   2e-107   
gb|ABK55756.1|  P450 monooxygenase-like protein                         345   2e-107   
ref|XP_011030958.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    345   2e-107   
ref|XP_010064547.1|  PREDICTED: cytochrome P450 CYP82D47-like           344   3e-107   
gb|KDP26344.1|  hypothetical protein JCGZ_17502                         344   3e-107   
ref|XP_010061806.1|  PREDICTED: cytochrome P450 CYP82D47-like           345   3e-107   
ref|XP_007133366.1|  hypothetical protein PHAVU_011G173200g             344   3e-107   
sp|Q43068.2|C82A1_PEA  RecName: Full=Cytochrome P450 82A1; AltNam...    345   4e-107   
ref|XP_002281361.1|  PREDICTED: cytochrome P450 82C4                    344   4e-107   
ref|XP_006375025.1|  hypothetical protein POPTR_0014s03700g             345   5e-107   
ref|XP_006375030.1|  hypothetical protein POPTR_0014s03750g             344   5e-107   
ref|XP_006464328.1|  PREDICTED: cytochrome P450 82C4-like               343   6e-107   
gb|KHN22284.1|  Cytochrome P450 82A3                                    341   7e-107   
ref|XP_008343493.1|  PREDICTED: cytochrome P450 82A3-like               343   7e-107   
ref|XP_010089020.1|  Cytochrome P450 82A3                               343   8e-107   
gb|AGN54072.1|  cytochrome P450 monooxygenase                           343   8e-107   
ref|XP_007151147.1|  hypothetical protein PHAVU_004G021800g             343   1e-106   
gb|KDP45301.1|  hypothetical protein JCGZ_15166                         343   1e-106   
ref|XP_003517019.1|  PREDICTED: cytochrome P450 82A4-like               343   1e-106   
gb|KCW68808.1|  hypothetical protein EUGRSUZ_F02407                     344   1e-106   
ref|XP_009341185.1|  PREDICTED: cytochrome P450 CYP82D47-like           343   1e-106   
ref|XP_002281431.2|  PREDICTED: cytochrome P450 82C4                    342   2e-106   
ref|XP_010527268.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    342   2e-106   
ref|XP_009372224.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    343   2e-106   
ref|XP_011030947.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    342   2e-106   
gb|EYU23763.1|  hypothetical protein MIMGU_mgv1a023100mg                342   2e-106   
ref|XP_007151144.1|  hypothetical protein PHAVU_004G021500g             342   2e-106   
ref|XP_010686309.1|  PREDICTED: cytochrome P450 CYP82D47-like           342   2e-106   
ref|XP_010686308.1|  PREDICTED: cytochrome P450 CYP82D47-like           342   2e-106   
ref|XP_009372223.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    343   2e-106   
gb|AAC39454.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   343   2e-106   
ref|XP_008228483.1|  PREDICTED: cytochrome P450 CYP82D47-like           342   2e-106   
gb|KHN22285.1|  Cytochrome P450 82A4                                    342   3e-106   
ref|XP_007017411.1|  Cytochrome P450, putative                          342   3e-106   
ref|XP_008388076.1|  PREDICTED: cytochrome P450 CYP82D47-like           341   3e-106   
ref|XP_010060879.1|  PREDICTED: cytochrome P450 CYP82D47-like           342   3e-106   
gb|KCW85809.1|  hypothetical protein EUGRSUZ_B02554                     340   3e-106   
ref|XP_009374201.1|  PREDICTED: cytochrome P450 CYP82D47-like           342   3e-106   
ref|XP_007151142.1|  hypothetical protein PHAVU_004G021300g             341   4e-106   
ref|XP_009372225.1|  PREDICTED: cytochrome P450 82G1-like isoform X4    342   4e-106   
ref|XP_007033359.1|  Cytochrome P450                                    341   4e-106   
gb|KHG01223.1|  Cytochrome P450 protein                                 341   4e-106   
ref|XP_009758036.1|  PREDICTED: cytochrome P450 82C4-like               338   5e-106   
ref|XP_006366469.1|  PREDICTED: cytochrome P450 82A3-like               339   5e-106   
ref|XP_011030967.1|  PREDICTED: cytochrome P450 CYP82D47-like           342   5e-106   
ref|XP_010061805.1|  PREDICTED: cytochrome P450 CYP82D47-like           342   5e-106   
ref|XP_007151145.1|  hypothetical protein PHAVU_004G021600g             341   6e-106   
ref|XP_010527265.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    341   6e-106   
gb|KDP29948.1|  hypothetical protein JCGZ_18517                         341   6e-106   
ref|XP_008464769.1|  PREDICTED: cytochrome P450 CYP82D47-like           340   7e-106   
ref|XP_010527266.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    341   8e-106   
ref|XP_010046449.1|  PREDICTED: cytochrome P450 CYP82D47-like           341   8e-106   
ref|XP_010106079.1|  Cytochrome P450 82A3                               340   1e-105   
ref|XP_008355533.1|  PREDICTED: cytochrome P450 CYP82D47-like           340   1e-105   
ref|XP_008355522.1|  PREDICTED: cytochrome P450 CYP82D47-like           340   2e-105   
ref|XP_011030954.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    339   3e-105   
ref|XP_007017410.1|  Cytochrome P450 82A3, putative                     342   4e-105   
ref|XP_009606708.1|  PREDICTED: cytochrome P450 CYP82D47-like           339   4e-105   
ref|XP_010070482.1|  PREDICTED: cytochrome P450 CYP82D47-like           338   6e-105   
ref|XP_008236910.1|  PREDICTED: cytochrome P450 CYP82D47-like           339   6e-105   
ref|XP_004238200.1|  PREDICTED: cytochrome P450 CYP82D47-like           338   8e-105   
gb|EYU23762.1|  hypothetical protein MIMGU_mgv1a004588mg                337   1e-104   
ref|XP_007207908.1|  hypothetical protein PRUPE_ppa019731mg             337   1e-104   
ref|XP_004306669.1|  PREDICTED: cytochrome P450 82A3-like               338   1e-104   
ref|XP_007226806.1|  hypothetical protein PRUPE_ppa017795mg             334   3e-104   
dbj|BAF98472.1|  cytochrome P450                                        337   4e-104   
ref|XP_003554857.2|  PREDICTED: cytochrome P450 82A4-like               345   5e-104   
ref|XP_004147804.1|  PREDICTED: cytochrome P450 82C4-like               336   5e-104   
ref|XP_006486180.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    335   7e-104   
ref|XP_006366470.1|  PREDICTED: cytochrome P450 82A3-like               335   1e-103   
ref|XP_010036784.1|  PREDICTED: cytochrome P450 82G1-like isoform X3    335   1e-103   
gb|EYU23761.1|  hypothetical protein MIMGU_mgv1a004606mg                335   1e-103   
ref|XP_003618351.1|  Cytochrome P450 82A1                               336   1e-103   
gb|KDP46184.1|  hypothetical protein JCGZ_10024                         334   1e-103   
ref|XP_010036783.1|  PREDICTED: cytochrome P450 82G1-like isoform X2    335   1e-103   
emb|CAN64501.1|  hypothetical protein VITISV_020341                     333   1e-103   
ref|XP_010036782.1|  PREDICTED: cytochrome P450 82G1-like isoform X1    335   1e-103   
ref|XP_006856219.1|  hypothetical protein AMTR_s00059p00204120          335   1e-103   



>ref|XP_009801176.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=517

 Score =   463 bits (1192),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 220/496 (44%), Positives = 317/496 (64%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILN--SQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             IIGH+  L+   +N    R LG +ADK+GP+F +R GM P  ++   EAAKDC TTH++D
Sbjct  41    IIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKD  100

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
             +A++P    GE +GY YA F++++   Y+  +RK  + ++LS+ KL+K+KHIR+SE+ETS
Sbjct  101   LAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQQVLSSTKLEKMKHIRVSEMETS  160

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IKELY         N    V + +W  QLTLN   + + G+RY           +  E +
Sbjct  161   IKELYSLALVK---NNIQKVNISKWFEQLTLNIIVKTICGKRY----------SNIEEDE  207

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EAQ     F+   Y+ G  VL DA P  LFK+FDFQGH++ MK+  K +D ILQ W+D H
Sbjct  208   EAQRFRKAFKGIMYVVGQIVLYDAIPFPLFKYFDFQGHIKLMKKIYKDLDYILQGWLDDH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             + ++ + N        D D +  ML        K + ++    IK T  S+I+DG+DTT 
Sbjct  268   MMKKDVNN-------EDQDAMDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTA  320

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H++W +SLL+    VMK+ +EEI+ +VG ERWVED+D+K L YLQA+VKE+LRLYP VP
Sbjct  321   VHLIWVMSLLLNNPHVMKQAQEEIDMKVGKERWVEDTDIKNLVYLQAIVKETLRLYPPVP  380

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
              L+P    +DCK+ GY +PKG + ++N WK+ RDP+ W EP++FMP+RFL  +A   D  
Sbjct  381   FLLPHEAVQDCKVAGYHIPKGTRLHINAWKVHRDPEIWSEPERFMPERFLTSKA-NVDAR  439

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE++PFG GRRSC G+ +A  ++HLT  RL+QGF+FSTP N  +DM EG GVTLP+ 
Sbjct  440   GQNFEFIPFGSGRRSCPGINFATLVTHLTFGRLLQGFDFSTPSNTPIDMTEGVGVTLPKV  499

Query  184   TPLQLVVTPRLPPNFY  137
               ++++++PRLP   Y
Sbjct  500   NQVEVLISPRLPSKLY  515



>ref|XP_006339196.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=524

 Score =   462 bits (1188),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 225/497 (45%), Positives = 326/497 (66%), Gaps = 19/497 (4%)
 Frame = -1

Query  1618  IIGHIPIL-NSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDV  1442
             IIGH+    + +N  L+RT G+++D++GP+F ++ GM    +I   EAAKDCFT +++++
Sbjct  46    IIGHLRGFGDGKNVPLARTFGKLSDQYGPIFTIKLGMYRYCVINNWEAAKDCFTINDKEL  105

Query  1441  ASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSI  1262
             A++P     EH GYNYA FSF++   Y+  +RK V+  +LS+ +L+KVKH+R SE+E SI
Sbjct  106   AARPISLAAEHYGYNYARFSFANYGPYYCQVRKLVLQNVLSSTRLEKVKHVRTSEVEISI  165

Query  1261  KELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             KELY         N    + + +W  +LTLN   +++AG+RY      ++  D+     E
Sbjct  166   KELYNLCGKGDNSN---TINISKWFEKLTLNIIVKMIAGKRYI-----SLEKDE-----E  212

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             AQ     F +  YL+G F+L DA P ++FK+ DFQGH++ MK+  K +D ILQ+W+++H+
Sbjct  213   AQCFRKAFAKIMYLAGEFILYDAIPFKIFKYVDFQGHIKTMKQIYKDLDDILQSWVNEHM  272

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             E++++         N+ D I  MLS    E  K + YT    IK T  SMI+DGSDTT  
Sbjct  273   EKKKIEGD----NNNEQDCIDSMLSVTKLEDFKAYGYTRDTVIKATVLSMILDGSDTTAV  328

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
             H+ W +SLL+    VM   ++EI+ +VG +RWVE+SD+K L YLQA+VKE+LRLYP  PL
Sbjct  329   HLTWLMSLLLNNPHVMSHVQKEIDNKVGKDRWVEESDIKDLVYLQAIVKEALRLYPPAPL  388

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L+P    +DC + GY++PKG +   N WKI RDP+ + EPDKFMP+RFLN E    D   
Sbjct  389   LVPHEAVEDCTVAGYNIPKGTRLFPNAWKIQRDPRVYSEPDKFMPERFLN-EHSNVDARG  447

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE++PFG GRRSC G+ +A Q++HLTI RLIQGFNF TP N+ +DM EG G+T+P+A 
Sbjct  448   QHFEFIPFGSGRRSCPGINFATQVAHLTIGRLIQGFNFGTPSNLPVDMTEGQGITMPKAK  507

Query  181   PLQLVVTPRLPPNFYGL  131
             P+++V+TPRL    Y L
Sbjct  508   PVEVVITPRLNSMLYEL  524



>gb|ABC69375.1| CYP82M1v4 [Nicotiana tabacum]
Length=521

 Score =   457 bits (1176),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 220/496 (44%), Positives = 311/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNS--QNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             IIGH+  L+   +N    R LG +ADK+GP+F +R GM P  ++   EAAKDC TTH++D
Sbjct  45    IIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKD  104

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
             +A++P    GE +GY YA F++++   Y+  +RK  +  +LS+ KL+K+KHIR+SELETS
Sbjct  105   LAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETS  164

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IKELY         N    V + +W  QLTLN   + + G+RY           +  E +
Sbjct  165   IKELYSLTLGK---NNMQKVNISKWFEQLTLNIIVKTICGKRY----------SNIEEDE  211

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EAQ     F+   ++ G  VL DA P  LFK+FDFQGH++ M +  K +D ILQ W+D H
Sbjct  212   EAQRFRKAFKGIMFVVGQIVLYDAIPFPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             +  + + N        D D I  ML        K + ++    IK T  S+I+DG+DTT 
Sbjct  272   MMNKDVNN-------KDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H++W +SLL+    VMK+ +EEI+ +VG ERW+ED+D+K L YLQA+VKE+LRLYP VP
Sbjct  325   VHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLYPPVP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
              L+P    +DCK+ GY +PKG +  +N WK+ RDP+ W EP+KFMP RFL  +A   D  
Sbjct  385   FLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPEIWSEPEKFMPNRFLTSKA-NIDAR  443

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE++PFG GRRSC G+ +A  ++HLT  RL+QGF+FS P N  +DM EG GVTLP+ 
Sbjct  444   GQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKV  503

Query  184   TPLQLVVTPRLPPNFY  137
               +++++TPRLP   Y
Sbjct  504   NQVEVLITPRLPSKLY  519



>ref|XP_009616319.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=521

 Score =   456 bits (1174),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 220/496 (44%), Positives = 310/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNS--QNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             IIGH+  L+   +N    R LG +ADK+GP+F +R GM P  ++   EAAKDC TTH++D
Sbjct  45    IIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKD  104

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              A++P    GE +GY YA F++++   Y+  +RK  +  +LS+ KL+K+KHIR+SELETS
Sbjct  105   FAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETS  164

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IKELY         N    V + +W  QLTLN   + + G+RY           +  E +
Sbjct  165   IKELYSLTLGK---NNMQKVNISKWFEQLTLNIIVKTICGKRY----------SNIEEDE  211

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EAQ     F+   ++ G  VL DA P  LFK+FDFQGH++ M +  K +D ILQ W+D H
Sbjct  212   EAQRFRKAFKGIMFVVGQIVLYDAIPFPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             +  + + N        D D I  ML        K + ++    IK T  S+I+DG+DTT 
Sbjct  272   MMNKDVNN-------KDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H++W +SLL+    VMK+ +EEI+ +VG ERW+ED+D+K L YLQA+VKE+LRLYP VP
Sbjct  325   VHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLYPPVP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
              L+P    +DCK+ GY +PKG +  +N WK+ RDP+ W EP+KFMP RFL  +A   D  
Sbjct  385   FLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPEIWSEPEKFMPDRFLTSKA-NIDAR  443

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE++PFG GRRSC G+ +A  ++HLT  RL+QGF+FS P N  +DM EG GVTLP+ 
Sbjct  444   GQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKV  503

Query  184   TPLQLVVTPRLPPNFY  137
               +++++TPRLP   Y
Sbjct  504   NQVEVLITPRLPSKLY  519



>gb|ABC69374.1| CYP82M1v3 [Nicotiana tabacum]
Length=521

 Score =   455 bits (1170),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 219/496 (44%), Positives = 310/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNS--QNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             IIGH+  L+   +N    R LG +ADK+GP+F +R GM P  ++   EAAKDC TTH++D
Sbjct  45    IIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKD  104

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              A++P    GE +GY YA F++++   Y+  +RK  +  +LS+ KL+K+KHIR+SELETS
Sbjct  105   FAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETS  164

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IKELY         N    V + +W  QLTLN   + + G+RY           +  E +
Sbjct  165   IKELYSLTLGK---NNMQKVNISKWFEQLTLNIIVKTICGKRY----------SNIEEDE  211

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EAQ     F+   ++ G  VL DA P  LFK+FDFQGH++ M +  K +D ILQ W+D H
Sbjct  212   EAQRFRKAFKGIMFVVGQIVLYDAIPFPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             +  + + N        D D I  ML        K + ++    IK T  S+I+DG+DTT 
Sbjct  272   MMNKDVNN-------KDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H++W +SLL+    VMK+ +EEI+ ++G ERW+ED+D+K L YLQA+VKE+LRLYP VP
Sbjct  325   VHLIWVMSLLLNNPHVMKQGQEEIDMKMGKERWIEDTDIKNLVYLQAIVKETLRLYPPVP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
              L+P    +DCK+ GY +PKG +  +N WK+ RDP+ W EP+KFMP RFL  +A   D  
Sbjct  385   FLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPEIWSEPEKFMPNRFLTSKA-NIDAR  443

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE++PFG GRRSC G+ +A  ++HLT  RL+QGF+FS P N  +DM EG GVTLP+ 
Sbjct  444   GQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKV  503

Query  184   TPLQLVVTPRLPPNFY  137
               +++++TPRLP   Y
Sbjct  504   NQVEVLITPRLPSKLY  519



>gb|ABC69373.1| CYP82M1v2 [Nicotiana tabacum]
Length=521

 Score =   454 bits (1167),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 219/496 (44%), Positives = 309/496 (62%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNS--QNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             IIGH+  L+   +N    R LG +ADK+GP+F +R GM P  ++   EAAKDC TTH++D
Sbjct  45    IIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKD  104

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              A++P    GE +GY YA F++++   Y+  +RK  +  +LS+ KL+K+KHIR+SELETS
Sbjct  105   FAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETS  164

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IKELY         N    V + +W  QLTLN   + + G+RY           +  E +
Sbjct  165   IKELYSLTLGK---NNMQKVNISKWFEQLTLNIIVKTICGKRY----------SNIEEDE  211

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EAQ     F+   ++ G  VL DA P  LFK+FDFQGH++ M +  K +D ILQ W+D H
Sbjct  212   EAQRFRKAFKGIMFVVGQIVLYDAIPFPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             +  + + N        D D I  ML        K + ++    IK T  S+I+DG+DTT 
Sbjct  272   MMNKDVNN-------KDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H++W +SLL+    VMK+ +EEI+ +VG ERW+ED+D+K L YLQA+VKE+LRL+P VP
Sbjct  325   VHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLFPPVP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
              L+P    +DCK+ GY +PKG +  +N WK+ RDP+ W EP+KFMP RFL  +A   D  
Sbjct  385   FLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPEIWSEPEKFMPNRFLTSKA-NIDAR  443

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE++PFG GRRSC G+ +A  ++HLT  RL+QGF+FS P N   DM EG GVTLP+ 
Sbjct  444   GQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGFDFSKPSNTPTDMTEGVGVTLPKV  503

Query  184   TPLQLVVTPRLPPNFY  137
               +++++TPRLP   Y
Sbjct  504   NQVEVLITPRLPSKLY  519



>gb|ABC69376.1| CYP82M1v5 [Nicotiana tabacum]
Length=521

 Score =   454 bits (1167),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 219/496 (44%), Positives = 309/496 (62%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNS--QNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             IIGH+  L+   +N    R LG +ADK+GP+F +R GM P  ++   EAAKDC TTH++D
Sbjct  45    IIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKD  104

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              A++P    GE +GY YA F++++   Y+  +RK  +  + S+ KL+K+KHIR+SELETS
Sbjct  105   FAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVPSSTKLEKMKHIRVSELETS  164

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IKELY         N    V + +W  QLTLN   + + G+RY           +  E +
Sbjct  165   IKELYSLTLGK---NNMQKVNISKWFEQLTLNIIVKTICGKRY----------SNIEEDE  211

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EAQ     F+   ++ G  VL DA P  LFK+FDFQGH++ M +  K +D ILQ W+D H
Sbjct  212   EAQRFRKAFKGIMFVVGQIVLYDAIPFPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             +  + + N        D D I  ML        K + ++    IK T  S+I+DG+DTT 
Sbjct  272   MMNKDVNN-------KDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H++W +SLL+    VMK+ +EEI+ +VG ERW+ED+D+K L YLQA+VKE+LRLYP VP
Sbjct  325   VHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLYPPVP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
              L+P    +DCK+ GY +PKG +  +N WK+ RDP+ W EP+KFMP RFL  +A   D  
Sbjct  385   FLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDPEIWSEPEKFMPNRFLTSKA-NIDAR  443

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE++PFG GRRSC G+ +A  ++HLT  RL+QGF+FS P N  +DM EG GVTLP+ 
Sbjct  444   GQNFEFIPFGSGRRSCPGIGFATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKV  503

Query  184   TPLQLVVTPRLPPNFY  137
               +++++TPRLP   Y
Sbjct  504   NQVEVLITPRLPSKLY  519



>gb|ABC69372.1| CYP82M1v1 [Nicotiana tabacum]
Length=521

 Score =   454 bits (1167),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 219/496 (44%), Positives = 309/496 (62%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNS--QNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             IIGH+  L+   +N    R LG +ADK+GP+F +R GM P  ++   EAAKDC TTH++D
Sbjct  45    IIGHLRQLSGTDKNIPFPRILGALADKYGPVFTLRIGMYPYLIVNNWEAAKDCLTTHDKD  104

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              A++P    GE +GY YA F++++   Y+  +RK  +  +LS+ KL+K+KHIR+SELETS
Sbjct  105   FAARPTSMAGESIGYKYARFTYANFGPYYNQVRKLALQHVLSSTKLEKMKHIRVSELETS  164

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IKELY         N    V + +W  QLTLN   + + G+RY           +  E +
Sbjct  165   IKELYSLTLGK---NNMQKVNISKWFEQLTLNIIVKTICGKRY----------SNIEEDE  211

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EAQ     F+   ++ G  VL DA P  LFK+FDFQGH++ M +  K +D ILQ W+D H
Sbjct  212   EAQRFRKAFKGIMFVVGQIVLYDAIPFPLFKYFDFQGHIQLMNKIYKDLDSILQGWLDDH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             +  + + N        D D I  ML        K + ++    IK T  S+I+DG+DTT 
Sbjct  272   MMNKDVNN-------KDQDAIDAMLKVTQLNEFKAYGFSQATVIKSTVLSLILDGNDTTA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H++W +SLL+    VMK+ +EEI+ +VG ERW+ED+D+K L YLQA+VKE+LRLYP VP
Sbjct  325   VHLIWVMSLLLNNPHVMKQGQEEIDMKVGKERWIEDTDIKNLVYLQAIVKETLRLYPPVP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
              L+P    +DCK+ GY +PKG +  +N WK+ RD + W EP+KFMP RFL  +A   D  
Sbjct  385   FLLPHEAVQDCKVTGYHIPKGTRLYINAWKVHRDSEIWSEPEKFMPNRFLTSKA-NIDAR  443

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE++PFG GRRSC G+ +A  ++HLT  RL+QGF+FS P N  +DM EG GVTLP+ 
Sbjct  444   GQNFEFIPFGSGRRSCPGLGFATLVTHLTFGRLLQGFDFSKPSNTPIDMTEGVGVTLPKV  503

Query  184   TPLQLVVTPRLPPNFY  137
               +++++TPRLP   Y
Sbjct  504   NQVEVLITPRLPSKLY  519



>ref|XP_004249377.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=524

 Score =   453 bits (1165),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 219/497 (44%), Positives = 327/497 (66%), Gaps = 19/497 (4%)
 Frame = -1

Query  1618  IIGHIPIL-NSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDV  1442
             IIGH+    + +N  L+RT G++++++GP+F ++ GM    +I   EAAKDCFT +++++
Sbjct  46    IIGHLRGFGDGENVPLARTFGKLSNQYGPIFTIKLGMYRYCVINNWEAAKDCFTINDKEL  105

Query  1441  ASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSI  1262
             A++P     EH GYNYA FSF++   Y+  +RK V+  +LS+ +L+KVK++R+SE+E SI
Sbjct  106   AARPISLAAEHYGYNYARFSFANYGPYYCQVRKLVLQNVLSSTRLEKVKNVRISEVEISI  165

Query  1261  KELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             KELY         N    + + +W  +LTLN   +++AG+RY      ++  D     +E
Sbjct  166   KELYNIWGKGENSN---TINISKWFEKLTLNIIVKMIAGKRYI-----SLEKD-----QE  212

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             AQ     F +  YL+G F+L DA P ++FK+ DFQGH++ MK+  K +D ILQ+W+++H+
Sbjct  213   AQCFRRAFAKIMYLAGEFILYDAIPFKIFKYVDFQGHIKTMKQIYKDLDDILQSWVNEHM  272

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             E++++         N+ D I  MLS    E  K + YT    IK    SMI+DGSDTT  
Sbjct  273   EKKKIEGD----NNNEQDCIDSMLSVTKLEDFKAYGYTRDTVIKAIVLSMILDGSDTTAV  328

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
             H+ W +SLL+    VM   ++EI+++VG +RW+E+SD+K L YLQA+VKE+LRLYP  PL
Sbjct  329   HLTWLMSLLLNNPRVMNNAQKEIDSKVGKDRWIEESDIKDLVYLQAIVKEALRLYPPAPL  388

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L+P    +DC + GY++PKG +   N WKI RDP+ + EPDKF+P+RFLN E    D   
Sbjct  389   LVPHEAVEDCTVAGYNIPKGTRLFANAWKIQRDPRVYSEPDKFIPERFLN-EHSNVDARG  447

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE++PFG GRRSC G+ +A Q++HLTI RLIQGF+F TP N+ +DM EG G+T+P+A 
Sbjct  448   QHFEFIPFGSGRRSCPGINFATQVAHLTIGRLIQGFSFGTPSNLPVDMTEGQGITMPKAK  507

Query  181   PLQLVVTPRLPPNFYGL  131
             P+++V+TPRL    Y L
Sbjct  508   PVEVVITPRLNSMLYEL  524



>ref|XP_006352674.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=520

 Score =   448 bits (1153),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 218/495 (44%), Positives = 325/495 (66%), Gaps = 26/495 (5%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             IGH+ +  S+   L+  L  +ADK+G +F +R G+    ++   E  K+CFTT+++ +A 
Sbjct  48    IGHLYLFISKTP-LALILANLADKYGHIFSIRLGIHRAIIVSNWEIVKECFTTNDKVLAG  106

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  + G +LGYN A F F+    YWR +RK V+ E+LS+ +LD+ KHIR++E+ET+IKE
Sbjct  107   RPASSAGIYLGYNNAAFGFADYGPYWRNIRKLVLLEVLSSKRLDQFKHIRVTEVETNIKE  166

Query  1255  LY--LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             LY  +  + S  P+K   V M +W  QLTLN   +++ G+RYK            TE ++
Sbjct  167   LYSSILKSGSTNPSK---VNMSKWFEQLTLNVIMKMITGKRYK------------TEDEK  211

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              +      +E+ Y S  FVL D  PL   KWFDFQG +++MK+ ++++DKI+ +WID+H+
Sbjct  212   GRHFTRTTKEYMYESVQFVLSDVIPLPFLKWFDFQGRIKSMKKLSQEMDKIVTSWIDEHL  271

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
              +R+L         +D D I +MLS ID++F+ G  YT +  IK T  ++I+ GSDTT  
Sbjct  272   MKRELA-----IKDDDQDFIDVMLSKIDEQFMYG--YTRETIIKATILNIILAGSDTTSI  324

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
             H+ W LSLLV    VM + +EEI+ ++G ERWVE+ D+K L YLQA+VKE+LRLYP  PL
Sbjct  325   HLTWLLSLLVNNKHVMDQAQEEIDMKIGKERWVEECDIKNLVYLQAIVKETLRLYPPGPL  384

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
              +P    +DC +GGY +PKG +  VN+WK+ RDP+ W +P+KFMP+RF+ +     D   
Sbjct  385   AIPHAAMEDCTVGGYKVPKGTRLMVNVWKLHRDPQIWSDPEKFMPERFM-KSHSEIDISG  443

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE++PFG GRRSC G+ +A+Q++HLT+ARL+QGFNFST G++ +D+  G  +TLP+A 
Sbjct  444   QNFEFIPFGSGRRSCPGITFAMQVTHLTLARLLQGFNFSTLGDLPVDLTVGNSITLPKAN  503

Query  181   PLQLVVTPRLPPNFY  137
             PL++ V PRL P  Y
Sbjct  504   PLEVFVMPRLAPMLY  518



>ref|XP_007136644.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
 gb|ESW08638.1| hypothetical protein PHAVU_009G061600g [Phaseolus vulgaris]
Length=528

 Score =   447 bits (1150),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 222/496 (45%), Positives = 316/496 (64%), Gaps = 18/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L   +Q+L RTLG MAD++GP F +  G     ++   E AK+CFTT+++ +A
Sbjct  49    LIGHLHLLGGDDQLLYRTLGTMADQYGPAFNIWLGTRRAFVVSSWEVAKECFTTNDKALA  108

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GYNYA+F F+  + +WR MRK    ELLSN +L+ +KH+R+SEL T IK
Sbjct  109   SRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEMLKHVRVSELNTGIK  168

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             ELY  +V    +P    VV ++ W+  LTLN   R+VAG+RY     GA    D  E + 
Sbjct  169   ELYNSWVQNRSQP---VVVELNRWLEDLTLNMVVRMVAGKRYF----GASATCDDDEARR  221

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ IN   +F +L G+FV+ DA P    +WFD QGH RAMK+  K++D IL+ W+ +H 
Sbjct  222   CQKAIN---QFFHLIGIFVVSDALPF--LRWFDLQGHERAMKKTAKELDSILEGWLQEHR  276

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
              +R  G         + D I +ML       +  F Y    +IK T  ++I+ GSDT+  
Sbjct  277   MQRVDGEVKVEG---EQDFIDVMLDLQKTGHLSNFQYDSDTSIKSTCLAIILGGSDTSAG  333

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WA+SLL+     +K+ +EE++  VG ER VE+SD++ L YLQA++KE+LRLYP  PL
Sbjct  334   TLTWAISLLLNNRQALKKAQEELDLNVGMERQVEESDIRNLAYLQAIIKETLRLYPAGPL  393

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L PR   +DC +GGYD+P G +  VNLWKI RDP+ W EP  F P+RFL  +A   D   
Sbjct  394   LGPREAQEDCNVGGYDVPAGTRLVVNLWKIHRDPRVWEEPSAFRPERFLTSDA--VDVRG  451

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRRSC GM++ALQ+ HLT+ARL+  F F+TP +  +DM E  G+T+P+AT
Sbjct  452   QNFELIPFGSGRRSCPGMSFALQVLHLTLARLLHAFEFATPSDEPVDMTESPGLTIPKAT  511

Query  181   PLQLVVTPRLPPNFYG  134
             PL++++TPRLPP  Y 
Sbjct  512   PLEVLLTPRLPPQLYA  527



>ref|XP_006375022.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
 gb|ERP52819.1| hypothetical protein POPTR_0014s03660g [Populus trichocarpa]
Length=519

 Score =   443 bits (1139),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 223/496 (45%), Positives = 315/496 (64%), Gaps = 17/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+L RTLG MADKHG  F +R G     ++   E  K+CFT + + +A
Sbjct  39    IIGHLHLLGGGDQLLYRTLGAMADKHGSAFTIRLGSRRAFVVSSWEVVKECFTINAKALA  98

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GYNYA+F F+  +++WR MRK    ELLSN +L+ +KH+R SE++  I+
Sbjct  99    SRPTTVAAKHMGYNYAVFGFAPYSSFWREMRKIATLELLSNRRLEMLKHVRASEVDIGIR  158

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             ELY  +   S  P    VV + +W+  LTLN   R+VAG+RY    G A   DD  E + 
Sbjct  159   ELYNSWANNSSSP---VVVELKQWLEDLTLNVVVRMVAGKRY---FGSAAASDDG-EARR  211

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ IN   +F  L G+FV+ DA P     W D QGH RAMK   K++D IL+ W+D+H 
Sbjct  212   CQKAIN---QFFRLIGIFVVSDALPF--LGWLDLQGHERAMKNTAKELDAILEGWLDEHR  266

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +RR   +A     G   D I +MLS  ++  +  F Y    +IK T  ++I+ GSDTT  
Sbjct  267   QRRV--SAGIKDEGEQ-DFIDVMLSLKEEGQLSNFQYDANTSIKSTCLALILGGSDTTAG  323

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WA+SLL+    ++K+ +EE++  VG ER VEDSDVK L YLQA++KE+LRLYP  PL
Sbjct  324   TLTWAISLLLNNRHMLKKAQEELDLHVGKERQVEDSDVKNLVYLQAIIKETLRLYPAGPL  383

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L PR   +DCK+ GY +P G +  VN+WKI RDP+ W  P  F+P+RFL    G  D   
Sbjct  384   LGPREAMEDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSH-GDVDVRG  442

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             ++FE +PFG GRRSC G+++ALQ+ HLT+ARL+  F  +TP +  +D+ E  G+T+P+AT
Sbjct  443   QQFELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFELATPMDQPVDLTESSGLTIPKAT  502

Query  181   PLQLVVTPRLPPNFYG  134
             PL++++TPRLPP  YG
Sbjct  503   PLEVILTPRLPPKLYG  518



>ref|XP_011030904.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=526

 Score =   443 bits (1139),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 221/496 (45%), Positives = 316/496 (64%), Gaps = 17/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+L RTLG MADKHG  F +R G     ++   E  K+CFT +++ +A
Sbjct  46    IIGHLHLLGGGDQLLYRTLGAMADKHGSAFTIRLGSRRAFVVSSWEVVKECFTINDKALA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GYNYA+F F+  +A+WR MRK    ELLSN +L+ +KH+R SE++  I+
Sbjct  106   SRPTTVAAKHMGYNYAVFGFAPYSAFWREMRKIATIELLSNRRLEMLKHVRASEVDIGIR  165

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             ELY  +   S  P    VV + +W+  LTLN   R+VAG+RY    G A   DD  E + 
Sbjct  166   ELYNSWANNSSSP---VVVELKQWLEDLTLNVVVRMVAGKRY---FGSAAASDDG-EARR  218

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ IN   +F  L G+F++ DA P     W D QGH RAMK   K++D IL+ W+D+H 
Sbjct  219   CQKAIN---QFFRLIGIFLVSDALPF--LGWLDLQGHERAMKNTAKELDAILEGWLDEHR  273

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +RR    +      ++ D I +MLS  ++  +  F Y    +IK T  ++I+ GSDTT  
Sbjct  274   QRRV---SAGIKDEDEQDFIDVMLSLKEEGQLSNFQYDANTSIKSTCLALILGGSDTTAG  330

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WA+SLL+    ++K+ +EE++  VG ER VEDSDVK L YLQA++KE+LRLYP  PL
Sbjct  331   TLTWAISLLLNNRHMLKKAQEELDLLVGKERQVEDSDVKNLVYLQAIIKETLRLYPAGPL  390

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L PR   +DCK+ GY +P G +  VN+WKI RDP+ W  P  F+P+RFL    G  D   
Sbjct  391   LGPREAMEDCKVAGYHVPAGTRLIVNVWKIQRDPRVWTNPSAFLPERFLTSH-GDVDVRG  449

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             ++FE +PFG GRRSC G+++ALQ+ HLT+ARL+  F  +TP +  +D+ E  G+T+P+AT
Sbjct  450   QQFELIPFGSGRRSCPGVSFALQVLHLTLARLLHSFQLATPMDQPVDLTESSGLTIPKAT  509

Query  181   PLQLVVTPRLPPNFYG  134
             PL++++TPRLPP  YG
Sbjct  510   PLEVILTPRLPPKLYG  525



>dbj|BAM36727.1| nicotine N-demethylase [Nicotiana langsdorffii]
Length=516

 Score =   441 bits (1135),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 207/497 (42%), Positives = 322/497 (65%), Gaps = 26/497 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   ++   ++ L+R LG++ADK+GP++  R G+  + ++   EA KDCF+T++  
Sbjct  44    VIGHLFYFDNDGDDRPLARKLGDLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAI  103

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN AM   ++   YWR  RK ++ E+LS  +L+K KH+R+++++T 
Sbjct  104   FSNRPAFLYGEYLGYNNAMLFLANYGPYWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTG  163

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK+LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  164   IKDLYSRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  214

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
                   N F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  215   ------NAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  268

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I++R++      A GN+ D I ++LS +  E++    Y+    IK T  S+++D +DT  
Sbjct  269   IKKREVN-----AEGNEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVA  322

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + +K+ +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  323   LHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  382

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK WP PD F P+RF+   A   D  
Sbjct  383   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWPNPDNFDPERFV---AADIDFR  439

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +EY+PFG GRRSC GM YALQ+ HLT+ARLIQGFN+ TP N  LDM+EG G+T+ + 
Sbjct  440   GQHYEYIPFGSGRRSCPGMTYALQVEHLTMARLIQGFNYRTPTNEPLDMKEGAGITIRKV  499

Query  184   TPLQLVVTPRLPPNFYG  134
              P+++++TPRL P  Y 
Sbjct  500   NPVEVIITPRLAPELYN  516



>ref|XP_007227272.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
 gb|EMJ28471.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
Length=518

 Score =   440 bits (1132),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 221/495 (45%), Positives = 317/495 (64%), Gaps = 13/495 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+L RTLG MADK+G  F +R G     ++   E AK+CFT +++ +A
Sbjct  35    IIGHLHLLGGGDQLLYRTLGAMADKYGSAFNIRLGSRRAFVVSSWEVAKECFTFNDKALA  94

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GYNYA+F F+  + +WR MRK    ELLSN +L+ +KH+R SEL+T IK
Sbjct  95    SRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATIELLSNRRLEMLKHVRTSELDTGIK  154

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             EL  L+V      ++  VV ++ W+ +LTLN   R+VAG+RY    G +   DD  E + 
Sbjct  155   ELQNLWVQNGS--SRPVVVELNRWLEELTLNVVVRMVAGKRY---FGASAKCDDGDEARR  209

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ I    +F +L G+FV+ DA P     W D QGH +AMK+  K +D IL  W+D+H 
Sbjct  210   CQKAIG---QFFHLIGIFVVSDALPF--LWWLDLQGHEKAMKKTAKDLDAILGGWLDEHR  264

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +RR L +       ++ D I +MLS  ++  +  F ++   +IK T  ++I+ GSDTT  
Sbjct  265   QRRVLSHEKGKTEADE-DFIDVMLSLQEEGQLSNFQHSSDTSIKSTCLAIILGGSDTTAG  323

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WA+SLL+    VMK+ +EE+E QVGTER V++SD+K L YLQA++KE+LRLYP  PL
Sbjct  324   TLTWAISLLLNNPHVMKKAQEELELQVGTERQVDESDIKNLVYLQAIIKETLRLYPAGPL  383

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L PR   +DC + GY +P G +  VN+WKI RDP  W  P  F P+RFL    G  D   
Sbjct  384   LGPREALEDCTVAGYHVPAGTRLVVNVWKIQRDPSVWENPSAFEPERFLTSH-GHVDVRG  442

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             ++FE +PFG GRRSC G+++A+Q+ HLT+ARL+  F F TP    +DM E  G+T+P+AT
Sbjct  443   QQFELMPFGSGRRSCPGVSFAMQVLHLTLARLLHAFEFETPLGQRIDMTESPGLTIPKAT  502

Query  181   PLQLVVTPRLPPNFY  137
             PL++++TPRLP N Y
Sbjct  503   PLEVLLTPRLPGNLY  517



>dbj|BAM36726.1| nicotine N-demethylase [Nicotiana alata]
Length=515

 Score =   440 bits (1132),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 208/496 (42%), Positives = 322/496 (65%), Gaps = 26/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   ++   ++ L+R LG++ADK+GP++  R G+  + ++   EA KDCF+T++  
Sbjct  44    VIGHLFYFDNDGDDRPLARKLGDLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAI  103

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN  M   ++   YWR  RK V+ E+LS  +L+K KH+R+++++T 
Sbjct  104   FSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRLAKIQTG  163

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK+LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  164   IKDLYSRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  214

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
                   N F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  215   ------NAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  268

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I++R++      A GN+ D I ++LS +  E++    Y+    IK T  S+++D +DT  
Sbjct  269   IKKREVN-----AEGNEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVA  322

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + +K+ +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  323   LHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  382

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK WP PDKF P+RF+   AG  D  
Sbjct  383   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWPNPDKFDPERFI---AGDIDFR  439

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +EY+PFG GRRSC GM YALQ+ HLT+ARLIQGFN+ TP N  LDM+EG G+T+ + 
Sbjct  440   GQHYEYIPFGSGRRSCPGMTYALQVEHLTMARLIQGFNYRTPTNEPLDMKEGAGITIRKV  499

Query  184   TPLQLVVTPRLPPNFY  137
              P+++++TPRL    Y
Sbjct  500   NPVEVIITPRLAHELY  515



>dbj|BAM36725.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   440 bits (1131),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 207/496 (42%), Positives = 322/496 (65%), Gaps = 26/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   ++   ++ L+R LG++ADK+GP++  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFYFDNDGDDRPLARKLGDLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN AM   ++   YWR  RK ++ E+LS  +L+K KH+R+++++T 
Sbjct  103   FSNRPAFLYGEYLGYNNAMLFLANYGPYWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTG  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK+LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKDLYSRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
                   N F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   ------NAFKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I++R++      A GN+ D I ++LS +  E++    Y+    IK T  S+++D +DT  
Sbjct  268   IKKREVN-----AEGNEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVA  321

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + +K+ +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  322   LHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  381

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W  PDKF P+RF+   AG  D  
Sbjct  382   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFI---AGDIDFR  438

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +EY+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP N  LDM+EG G+T+ + 
Sbjct  439   GQHYEYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPTNEPLDMKEGAGITIRKV  498

Query  184   TPLQLVVTPRLPPNFY  137
              P+++++TPRL P  Y
Sbjct  499   NPVEVIITPRLAPELY  514



>dbj|BAM36724.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   439 bits (1129),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 206/496 (42%), Positives = 322/496 (65%), Gaps = 26/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   ++   ++ L+R LG++ADK+GP++  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFYFDNDGDDRPLARKLGDLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN AM   ++   YWR  RK ++ E+LS  +L+K KH+R+++++T 
Sbjct  103   FSNRPAFLYGEYLGYNNAMLFLANYGPYWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTG  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK+LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKDLYSRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I++R++      A GN+ D I ++LS +  E++    Y+    IK T  S+++D +DT  
Sbjct  268   IKKREVN-----AEGNEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVA  321

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + +K+ +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  322   LHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  381

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK WP PD F P+RF+   A   D  
Sbjct  382   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWPNPDNFDPERFV---AANIDFR  438

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +EY+PFG GRRSC GM YALQ+ HLT+ARLIQGFN+ TP    LDM+EG G+T+ + 
Sbjct  439   GQHYEYIPFGSGRRSCPGMTYALQVEHLTMARLIQGFNYRTPTKEPLDMKEGAGITIRKV  498

Query  184   TPLQLVVTPRLPPNFY  137
              P+++++TPRL P  Y
Sbjct  499   NPVEVIITPRLAPELY  514



>gb|AJD25203.1| cytochrome P450 CYP82V2 [Salvia miltiorrhiza]
Length=534

 Score =   439 bits (1130),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 217/494 (44%), Positives = 327/494 (66%), Gaps = 13/494 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  +  I SR LG MADK GP+F +R G+    ++   EA KDCFTT++R +A
Sbjct  52    IIGHLHLLGGKIPI-SRILGAMADKLGPVFTLRLGVHRTVVVSSREAVKDCFTTNDRVLA  110

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
              +P    G +LGYN+A F FS    YWR +RK V++E+L+  +LD ++ +R +EL  S+ 
Sbjct  111   KRPSSTAGIYLGYNHAGFGFSH-GPYWREVRKLVLAEVLTPRRLDSLRPVREAELAASLG  169

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             EL+  V  S + ++   VA+ EW+ +LTL+T   ++AG+R   + GG     D+   +EA
Sbjct  170   ELHELVRGSDD-DQEREVAISEWLERLTLDTIMMMLAGKRCAERDGG-----DAAAEEEA  223

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             + + ++ ++F Y+SG FV+ D+ P    +W D QGH+++MKR   ++ +I + WI +H+E
Sbjct  224   KSLRHIIKQFMYISGQFVVSDSIPFPPLRWLDLQGHIKSMKRIADELSEICEGWIGEHVE  283

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR++ +      G + D I +MLS ID +F++ F +T +  IK T  ++I+ GSDTT TH
Sbjct  284   RRRIDDG---GLGIERDFIDVMLSAIDDKFMR-FGHTRETIIKATLLNLILAGSDTTSTH  339

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             M W LSLL+     M++ + EI+ +VG +RWV++SD+K L YLQAVVKE+LRL+P  PL 
Sbjct  340   MTWILSLLLNNTRAMQQTQAEIDDKVGKDRWVQESDIKNLVYLQAVVKEALRLFPPGPLA  399

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P    +DC++ GY + +G +  VN+WK+ RDP+ W EPD+F+P+RFL R A   D    
Sbjct  400   VPHEAMEDCRVAGYHVARGTRILVNVWKLHRDPRVWEEPDEFVPERFLTRHA-DVDFTGH  458

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
               E++PFG GRRSC G+ +A Q++HLT+ARLIQGF F TP +  +DM EG G+TLP+AT 
Sbjct  459   HHEFIPFGSGRRSCPGITFATQVTHLTMARLIQGFEFRTPLDEPVDMTEGLGITLPKATL  518

Query  178   LQLVVTPRLPPNFY  137
             L+++V PRL P  Y
Sbjct  519   LRVLVAPRLAPFMY  532



>ref|XP_008378409.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=529

 Score =   439 bits (1129),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 218/495 (44%), Positives = 315/495 (64%), Gaps = 12/495 (2%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+L RTLG MADK+GP F +R G     ++   E AKDCFT ++R +A
Sbjct  45    IIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEVAKDCFTVNDRALA  104

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GYNYA+F F+  + +WR MRK    ELLSN +LD ++H+R SEL+  IK
Sbjct  105   SRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLDMLRHVRTSELDMGIK  164

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             ELY L+V       + AVV ++ W+ +LTLN   R+VAG+RY    G +   +D  E + 
Sbjct  165   ELYSLWVQNGGL--RPAVVELNHWLEELTLNVVVRMVAGKRY---FGASAKCEDGDEARR  219

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ I    +F +L G+FV+ DA P     W D QGH +AMK+  K++D IL  W+++H 
Sbjct  220   CQKAIG---QFFHLIGIFVVADALPF--LWWLDLQGHEKAMKKTAKELDGILGGWLEEHR  274

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +RR   +  A   G D D I +MLS  ++  +  F Y+   +IK T  ++I+ GSDTT  
Sbjct  275   QRRGASHGEAEDEGGDEDFIDVMLSLEEEGQLSNFQYSSDTSIKSTCLALILGGSDTTAG  334

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WA+SLL+   D MK  +EE++  VGTER VE+SD+  L YLQA++KE+LRLYP  PL
Sbjct  335   TLTWAISLLLNNPDAMKMAQEELDLHVGTERQVEESDITNLVYLQAIIKETLRLYPAGPL  394

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L PR   +DC + GY +P G +  VN+WKI RDP+ W  P  F+P+RFL   +   D   
Sbjct  395   LGPREALEDCTVAGYRVPAGTRLVVNVWKIQRDPRVWENPSAFVPERFLESHS-HVDVRG  453

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             ++F  +PFG GRRSC G+++A+Q+ HLT+ARL+ GF   T     +D+ E  G+T+P+AT
Sbjct  454   QQFNLMPFGFGRRSCPGVSFAMQVLHLTLARLLHGFKIETASGQSVDLTESPGLTIPKAT  513

Query  181   PLQLVVTPRLPPNFY  137
             PL+++++PRLP   Y
Sbjct  514   PLEVLLSPRLPSELY  528



>ref|XP_009758062.1| PREDICTED: cytochrome P450 82C4-like, partial [Nicotiana sylvestris]
Length=485

 Score =   437 bits (1123),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 208/496 (42%), Positives = 315/496 (64%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N+   ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  11    VIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAI  70

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN  M   ++   YWR  RK V+ E+LS  +L+K K +R + ++TS
Sbjct  71    FSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTS  130

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  131   IKNLYTRINGN-----SSTINLSDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  181

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
                   N F++F  LS  FVL DAFP+ LFKW DFQGH++AMKR  K +D + Q W+++H
Sbjct  182   ------NAFKDFMVLSMEFVLWDAFPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEH  235

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS + KE++    Y+    IK T  S+++D +DT  
Sbjct  236   INKRE--KMEVGAEGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVLDAADTVA  292

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  293   LHINWGMTLLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  352

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    KDC + GY +PKG +   N+ K+ RDPK W  PDKF P+RF+   AG  D  
Sbjct  353   LLVPHENVKDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFI---AGDIDFR  409

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
                +E++PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  410   GHHYEFIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKV  469

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++TPRL P  Y
Sbjct  470   NPVELIITPRLAPELY  485



>ref|XP_009364162.1| PREDICTED: cytochrome P450 82C4-like [Pyrus x bretschneideri]
Length=529

 Score =   438 bits (1127),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 216/494 (44%), Positives = 312/494 (63%), Gaps = 10/494 (2%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+L RTLG MADK+GP F +R G     ++   E AKDCFT ++R +A
Sbjct  45    IIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEVAKDCFTVNDRALA  104

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GYNYA+F F+  + +WR MRK    ELLSN +LD +KH+R SEL+  IK
Sbjct  105   SRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLDMLKHVRTSELDMGIK  164

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY  +       + AVV ++ W+ +LTLN   R+VAG+RY    G +   +D  E +  
Sbjct  165   ELY-NLGVQNGGLRPAVVELNHWLEELTLNVVVRMVAGKRY---FGASAKCEDGDEARRC  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q+ I    +F +L G+FV+ DA P     W D QGH +AMK+  K++D IL  W+++H +
Sbjct  221   QKAIG---QFFHLIGIFVVADALPF--LWWLDLQGHEKAMKKTAKELDGILGGWLEEHRQ  275

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR   +  A   G D D I +MLS  ++  +  F Y+   +IK T  ++I+ GSDTT   
Sbjct  276   RRGASHGKAEDEGGDEDFIDVMLSLEEEGQLSNFQYSSDTSIKSTCLALILGGSDTTAGT  335

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WA+SLL+     MK+ +EE++  VGTER VE+SD+  L YLQA++KE+LRLYP  PLL
Sbjct  336   LTWAISLLINNPHAMKKAQEELDLHVGTERQVEESDITNLVYLQAIIKETLRLYPAGPLL  395

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR   +DC + GY +P G +  VN+WKI RDP+ W  P  F+P+RFL   +   D   +
Sbjct  396   GPREALEDCTVAGYRVPAGTRLVVNVWKIQRDPRVWESPSAFVPERFLESHS-HVDVRGQ  454

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
             +F  +PFG GRRSC G+++A+Q+ HLT+ARL+ GF   T     +D+ E  G+T+P+ATP
Sbjct  455   QFNLMPFGFGRRSCPGVSFAMQVLHLTLARLLHGFKIETASGQAIDLTESPGLTIPKATP  514

Query  178   LQLVVTPRLPPNFY  137
             L+ +++PRLP   Y
Sbjct  515   LEALLSPRLPSELY  528



>ref|XP_006349946.1| PREDICTED: cytochrome P450 82C2-like [Solanum tuberosum]
Length=531

 Score =   438 bits (1126),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 214/498 (43%), Positives = 329/498 (66%), Gaps = 18/498 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQI-LSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDV  1442
             +IGH+   +  + I LSR L  +ADK+GP+F  R G+  I ++   +A KDC  T+++  
Sbjct  46    VIGHLLQFSGADDIPLSRKLATLADKYGPVFTFRLGLPCILVVSSYDAVKDCLCTNDKAF  105

Query  1441  ASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSI  1262
             A++P    GE++GYN AM   ++   YWR +RK V+ E+LS+ +L+K+K +R+SE++TSI
Sbjct  106   AARPASLAGEYIGYNNAMLFLANYGPYWRKIRKIVLQEVLSSSRLEKLKFVRVSEIQTSI  165

Query  1261  KELYLFVTASPEPNKAAV-VAMDEWIAQLTLNTSCRIVAGRRY-KFKVGGAIGDDDSTEY  1088
              ELY  ++ + E     V V +  WI +LTL+   +++AG+ Y + + GG   ++++  +
Sbjct  166   NELYSLISVAGENVDFPVKVNVTNWIEKLTLSLIVKMIAGKSYGRVEKGG--NEEEAERF  223

Query  1087  KEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             K+A       ++F Y+S  FVL DAFP+ LFKW DFQGHV+ MKR  K +D +LQ W+D+
Sbjct  224   KKA------LKDFMYISMEFVLWDAFPIALFKWIDFQGHVKFMKRTFKDIDCVLQNWLDE  277

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKE-FVKGFPYTHQMAIKGTTQSMIIDGSDT  731
             H+++++  +      GN+ D I +MLS +  E F  G  ++ +  IK T  SM++D SDT
Sbjct  278   HLKKKERVDV---VDGNEQDFIDVMLSMMSNEDFADG--HSRETTIKATALSMVLDASDT  332

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
             T  H+ W ++ L+ + DVMK+ +EE++ +VG  RWVE+SD+K L Y QAVVKE+LRLYP 
Sbjct  333   TAIHLNWVMATLLNHRDVMKKVQEELDTKVGRNRWVEESDIKNLVYFQAVVKETLRLYPP  392

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PLL+P  + +DC + GY +PKG +  VN  K+ RDPK W  P+ F P+RFL  +A G D
Sbjct  393   APLLVPHESIEDCIVQGYHIPKGTRLWVNTMKLQRDPKIWSNPNTFDPERFLTSQA-GCD  451

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                +++E++PFG  RRSC G+ YA+Q++HL IA L+QGF+FSTP N  LDM+EG G+T+ 
Sbjct  452   VRGQQYEFIPFGSRRRSCPGITYAIQVTHLAIAHLLQGFDFSTPSNEPLDMKEGLGMTMR  511

Query  190   RATPLQLVVTPRLPPNFY  137
             +  P+++++TPR P   Y
Sbjct  512   KVNPIEVMITPRFPSVLY  529



>gb|ABR57311.1| cytochrome P450 monooxygenase [Nicotiana sylvestris]
Length=517

 Score =   437 bits (1124),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 208/496 (42%), Positives = 315/496 (64%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N+   ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN  M   ++   YWR  RK V+ E+LS  +L+K K +R + ++TS
Sbjct  103   FSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRINGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
                   N F++F  LS  FVL DAFP+ LFKW DFQGH++AMKR  K +D + Q W+++H
Sbjct  214   ------NAFKDFMVLSMEFVLWDAFPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS + KE++    Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVGAEGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMTLLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    KDC + GY +PKG +   N+ K+ RDPK W  PDKF P+RF+   AG  D  
Sbjct  385   LLVPHENVKDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFI---AGDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
                +E++PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GHHYEFIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++TPRL P  Y
Sbjct  502   NPVELIITPRLAPELY  517



>dbj|BAM36723.1| nicotine N-demethylase [Nicotiana alata]
Length=514

 Score =   437 bits (1124),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 322/496 (65%), Gaps = 26/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   ++   ++ L+R LG++ADK+GP++  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFYFDNDGDDRPLARKLGDLADKYGPVYTFRLGLPLVLVVSSYEAIKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN AM   ++   +WR  RK ++ E+LS  +L+K KH+R+++++T 
Sbjct  103   FSNRPAFLYGEYLGYNNAMLFLANYGPFWRKNRKLIIQEVLSASRLEKFKHVRLAKIQTG  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK+LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKDLYSRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I++R++      A GN+ D I ++LS +  E++    Y+    IK T  S+++D +DT  
Sbjct  268   IKKREVN-----AEGNEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVA  321

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + +K+ +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  322   LHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  381

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK WP PD F P+RF+   A   D  
Sbjct  382   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWPNPDNFDPERFV---AANIDFR  438

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +EY+PFG GRRSC GM YALQ+ HLT+ARLIQGFN+ TP    LDM+EG G+T+ + 
Sbjct  439   GQHYEYIPFGSGRRSCPGMTYALQVEHLTMARLIQGFNYRTPTKEPLDMKEGAGITICKV  498

Query  184   TPLQLVVTPRLPPNFY  137
              P+++++TPRL P  Y
Sbjct  499   NPVEVIITPRLAPELY  514



>ref|XP_009609537.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
 gb|ABM46919.1| cytochrome P450 monooxygenase CYP82E3 [Nicotiana tomentosiformis]
Length=518

 Score =   436 bits (1122),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 207/496 (42%), Positives = 320/496 (65%), Gaps = 22/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   +    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN AM   ++  +YWR  RK ++ E+LS  +L+K KH+R + ++TS
Sbjct  103   FSNRPAFLYGEYLGYNNAMLFLANYGSYWRKNRKLIIQEVLSASRLEKFKHVRFARIQTS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I++R+         GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   IKKRE-KIMEVGTEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  325

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + +K+ +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  326   LHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  385

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W  PDKF P+RF+ R+    D  
Sbjct  386   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFNPERFIARD---IDFH  442

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +EY+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  443   GQHYEYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPTDEPLDMKEGAGITIRKV  502

Query  184   TPLQLVVTPRLPPNFY  137
              P+++++TPRL P  Y
Sbjct  503   NPVKVIITPRLAPELY  518



>ref|XP_006473405.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   435 bits (1118),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 212/497 (43%), Positives = 323/497 (65%), Gaps = 17/497 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+L RTLG MADK GP F +R G     ++   E  K+CFT +++ +A
Sbjct  48    IIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECFTINDKALA  107

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+ A  +H+GY+YA+F F+    +WR MRK    ELLSN +L+ +KH+R+SE+E  ++
Sbjct  108   SRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHVRISEVEMGLR  167

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             EL+ L+   +  P    +V + +W+  +TLN   R+VAG+RY     GA    D +E ++
Sbjct  168   ELHGLWAKNNSRP---VLVELKKWLEDMTLNMVVRMVAGKRY----FGASATCDDSEARQ  220

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ IN   +F +L G+F + DA P   F W D+QGH  AMK+  K++D IL+ W+++H 
Sbjct  221   CQKAIN---QFFHLIGIFTVSDALPF--FWWLDWQGHEMAMKKTAKELDAILEGWLEEHR  275

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +RR  G   + +   + D I +MLS  ++  +  F ++  ++IK T  ++I+ GSDTT  
Sbjct  276   QRRVSGGIESES---EQDFIDVMLSLQEEGHLSQFQHSADISIKSTCLALILGGSDTTSG  332

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WA+SLL+   +++K+ +EE++ Q+G +R V+DSD+K L YLQA++KE+LRLYP  PL
Sbjct  333   TLTWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPL  392

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L PR   +DC + GY +P G +  VN+WKI RDP+ W  P  F P+RFL       D   
Sbjct  393   LGPREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHT-DVDFRG  451

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             ++FE +PFG GRRSC G ++ALQ+ HLT+ARL+  F  +TP +  +DM E  G+T+P+AT
Sbjct  452   QQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKAT  511

Query  181   PLQLVVTPRLPPNFYGL  131
             PL++V++PRLPPN YG 
Sbjct  512   PLEVVLSPRLPPNPYGF  528



>gb|ABD39477.1| CYP82E4v6 [Nicotiana tabacum]
Length=517

 Score =   433 bits (1114),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 206/496 (42%), Positives = 316/496 (64%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  G++LGYN AM   ++   YWR  RK V+ E+LS  +L+K KH+R + ++ S
Sbjct  103   FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQAS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+     + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K++RDPK WP+PD F P+RF+   A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLLRDPKLWPDPDTFDPERFI---ATDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + ++Y+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++ PRL P  Y
Sbjct  502   NPVELIIAPRLAPELY  517



>ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
 gb|KHN04535.1| Cytochrome P450 82C4 [Glycine soja]
Length=526

 Score =   433 bits (1114),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/496 (43%), Positives = 314/496 (63%), Gaps = 17/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L   +Q+L RTLG MAD++GP F +  G     ++   E AK+CFT++++ +A
Sbjct  46    LIGHLHLLGGDDQLLYRTLGTMADQYGPAFNIWLGTRRAFVVSSWEVAKECFTSNDKALA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GYNYA+F F+  + +WR MRK    ELLSN +L+ +KH+ +SEL   ++
Sbjct  106   SRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEMLKHVMVSELNMVMR  165

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             +LY  +V     P    +V ++ W+  LTLN   R+VAG+RY    G +   D+  E + 
Sbjct  166   DLYNSWVQNRSRP---VLVELNRWLEDLTLNMVVRMVAGKRY---FGASASCDNDDEARR  219

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ IN   +F +L G+FV+ DA P    +WFD QGH RAMK+  K++D IL+ W+ +H 
Sbjct  220   CQKAIN---QFFHLIGIFVVSDALPF--LRWFDVQGHERAMKKTAKELDAILEGWLKEHR  274

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             E+R  G   A     + D I +MLS      +  F Y    +IK T  ++I+ GSDTT  
Sbjct  275   EQRVDGEIKAEG---EQDFIDIMLSLQKGGHLSNFQYDSDTSIKSTCLALILGGSDTTAG  331

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WA+SLL+     +K+ +EE++  VG ER VE+SD++ L Y+QA++KE+LRLYP  PL
Sbjct  332   TVTWAISLLLNNRQALKKAQEELDLNVGMERQVEESDIRNLAYVQAIIKETLRLYPAGPL  391

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L PR   +DC + GY +P G +  VNLWKI RDP+ W EP  F P+RFL  +A   D   
Sbjct  392   LGPREAQEDCNVAGYHVPAGTRLVVNLWKIHRDPRVWQEPSAFRPERFLTSDA--VDVRG  449

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRRSC GM++ALQ+ HLT+ARL+  F F+TP +  +DM E  G+T+P+AT
Sbjct  450   QNFELIPFGSGRRSCPGMSFALQVLHLTLARLLHAFEFATPSDQPVDMTESPGLTIPKAT  509

Query  181   PLQLVVTPRLPPNFYG  134
             PL++++TPRLP   Y 
Sbjct  510   PLEVLLTPRLPAKLYA  525



>ref|XP_006434890.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
 gb|ESR48130.1| hypothetical protein CICLE_v10003803mg [Citrus clementina]
Length=521

 Score =   433 bits (1113),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 211/497 (42%), Positives = 322/497 (65%), Gaps = 17/497 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+L RTLG MADK GP F +R G     ++   E  K+CFT +++ +A
Sbjct  41    IIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECFTINDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+ A  +H+GY+YA+F F+    +WR MRK    ELLSN +L+ +KH+R+SE++  ++
Sbjct  101   SRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHVRISEVDMGLR  160

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             +LY L+      P    +V + +W+  +TLN   R+VAG+RY     GA    D +E ++
Sbjct  161   DLYGLWAKNDSRP---VLVELKKWLEDMTLNMVVRMVAGKRY----FGASATCDDSEARQ  213

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ IN   +F +L G+F + DA P   F W D+QGH  AMK+  K++D IL+ W+++H 
Sbjct  214   CQKAIN---QFFHLIGIFTVSDALPF--FWWLDWQGHEMAMKKTAKELDAILEGWLEEHR  268

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +RR  G   + +   + D I +MLS  ++  +  F ++  ++IK T  ++I+ GSDTT  
Sbjct  269   QRRVSGGIESES---EQDFIDVMLSLQEEGHLSQFQHSADISIKSTCLALILGGSDTTSG  325

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WA+SLL+   +++K+ +EE++ Q+G +R V+DSD+K L YLQA++KE+LRLYP  PL
Sbjct  326   TLTWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPL  385

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L PR   +DC + GY +P G +  VN+WKI RDP+ W  P  F P+RFL       D   
Sbjct  386   LGPREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHT-DVDFRG  444

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             ++FE +PFG GRRSC G ++ALQ+ HLT+ARL+  F  +TP +  +DM E  G+T+P+AT
Sbjct  445   QQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKAT  504

Query  181   PLQLVVTPRLPPNFYGL  131
             PL++V++PRLPPN YG 
Sbjct  505   PLEVVLSPRLPPNPYGF  521



>gb|KDO84376.1| hypothetical protein CISIN_1g036812mg [Citrus sinensis]
Length=499

 Score =   432 bits (1110),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/497 (42%), Positives = 323/497 (65%), Gaps = 17/497 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+L RTLG MADK GP F +R G     ++   E  K+CFT +++ +A
Sbjct  19    IIGHLHLLGGGDQLLYRTLGAMADKWGPAFNIRLGSRSAFVVSSWEVVKECFTINDKALA  78

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+ A  +H+GY+YA+F F+    +WR MRK    ELLSN +L+ +KH+R+SE++  ++
Sbjct  79    SRPKTAAAKHMGYDYAVFGFAPYTPFWREMRKIATLELLSNRRLEALKHVRISEVDMGLR  138

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             +L+ L+   +  P    +V + +W+  +TLN   R+VAG+RY     GA    D +E ++
Sbjct  139   DLHGLWAKNNSRP---VLVELKKWLEDMTLNMVVRMVAGKRYF----GASATCDDSEARQ  191

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ IN   +F +L G+F + DA P   F W D+QGH  AMK+  K++D IL+ W+++H 
Sbjct  192   CQKAIN---QFFHLIGIFTVSDALPF--FWWLDWQGHEMAMKKTAKELDAILEGWLEEHR  246

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +RR  G   + +   + D I +MLS  ++  +  F ++  ++IK T  ++I+ GSDTT  
Sbjct  247   QRRVSGGIESES---EQDFIDVMLSLQEEGHLSQFQHSADISIKSTCLALILGGSDTTSG  303

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WA+SLL+   +++K+ +EE++ Q+G +R V+DSD+K L YLQA++KE+LRLYP  PL
Sbjct  304   TLTWAISLLLNNPNMLKKAQEELDQQIGMDRQVDDSDIKNLVYLQAIIKETLRLYPAGPL  363

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L PR   +DC + GY +P G +  VN+WKI RDP+ W  P  F P+RFL       D   
Sbjct  364   LGPREAMEDCTVAGYHIPAGTRLIVNVWKIQRDPRVWKNPSAFQPERFLTSHT-DVDFRG  422

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             ++FE +PFG GRRSC G ++ALQ+ HLT+ARL+  F  +TP +  +DM E  G+T+P+AT
Sbjct  423   QQFELIPFGSGRRSCPGASFALQVLHLTLARLLHAFELATPSDQPVDMTESPGLTIPKAT  482

Query  181   PLQLVVTPRLPPNFYGL  131
             PL++V++PRLPPN YG 
Sbjct  483   PLEVVLSPRLPPNPYGF  499



>ref|XP_011089652.1| PREDICTED: cytochrome P450 82C2 [Sesamum indicum]
Length=528

 Score =   432 bits (1112),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 220/494 (45%), Positives = 323/494 (65%), Gaps = 23/494 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L  +  +  RTLG +AD++GP+F VR G+    ++   EA KDCFTT+++ + 
Sbjct  54    VIGHLHLLGGRVPVY-RTLGGLADRYGPVFTVRLGVHTALVVSSWEAVKDCFTTNDKILN  112

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
              +P  + G++LGY+YA F FS    YWR MRK V+ E+LS  +L+ +K++  SE+ TSI 
Sbjct  113   KRPASSAGKYLGYDYAAFGFS-HGTYWRQMRKLVLLEVLSARRLESLKNVWESEIHTSIN  171

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY       + +   VV + EWI +LTLNT   ++AG+RY     G    D++ E +  
Sbjct  172   ELY-------KKHSGKVVVISEWIERLTLNTIVMMIAGKRYTDSTQG----DETVEARSF  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +E+I   +EF Y+SG FV  DA P    +W DFQGH+++MKR +K++  + + WI +H+ 
Sbjct  221   RELI---KEFMYISGQFVASDAIPFPPLRWMDFQGHIKSMKRISKELSTVFERWITEHVR  277

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
                  +      GN+ D I +MLSTID++F   F +T +  IK T  ++I+ GSDTT  H
Sbjct  278   -----SDCKSRLGNEQDFIDVMLSTIDEKFT-SFGHTRETIIKATALNLILAGSDTTSIH  331

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + W LSLL+    VM++ +EEI+ +VG ERWV++SD+K L YLQAVVKE+LRL+P  PL 
Sbjct  332   LTWLLSLLLNNRQVMQQAQEEIDMKVGKERWVQESDIKNLVYLQAVVKETLRLFPPGPLS  391

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P    +DC + GY +PKG +  VN+WK+ RDP+ W EPD F+P+RFL       D   +
Sbjct  392   VPHEAMEDCCVAGYHVPKGTRLLVNVWKLHRDPRIWAEPDNFVPERFLTSHV-AVDFTGQ  450

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
               E+VPFG GRRSC G+ +A+Q++HLT+ARL+QGF+ +TP N  +DM EG  +TLP+ATP
Sbjct  451   NHEFVPFGSGRRSCPGITFAMQVTHLTLARLLQGFDLATPSNGPVDMTEGLSITLPKATP  510

Query  178   LQLVVTPRLPPNFY  137
             L++V+TPRL    Y
Sbjct  511   LEVVITPRLSDGLY  524



>gb|ADP65809.1| nicotine N-demethylase [Nicotiana tabacum]
Length=517

 Score =   432 bits (1111),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 206/496 (42%), Positives = 315/496 (64%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILN--SQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   +  S ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFYFDDDSDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN AM   +    YWR  RK V+ E+L   +L+K+KH+R  E++TS
Sbjct  103   FSNRPAFLYGEYLGYNNAMLFLTKYGPYWRKNRKLVIQEVLCASRLEKLKHVRFGEIQTS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    ++
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFR  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFIILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             +++++       A GN+ D I ++LS +  E++    Y+    IK T  S+++D +DT  
Sbjct  268   VKKKE--KMEVNAEGNEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              HM W ++LL+     +K+ +EEI+ +VG +RWVE+SD+K L YLQ +VKE LRLYP  P
Sbjct  325   LHMNWGMALLINNQHALKKAQEEIDKKVGKDRWVEESDIKDLVYLQTIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W  PDKF P+RF    A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFF---AADIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +E++PFG GRRSC GM YA+Q+ HLTIA LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQHYEFIPFGSGRRSCPGMTYAMQVEHLTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P+++V+TPRL P  Y
Sbjct  502   NPIEVVITPRLTPELY  517



>ref|XP_009599169.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=523

 Score =   432 bits (1111),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 216/500 (43%), Positives = 316/500 (63%), Gaps = 22/500 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L    Q+L RTLG MAD +GP F +R G     ++   E AK+CFT +++ +A
Sbjct  40    IIGHLHLLGGAEQLLYRTLGAMADNYGPAFSIRLGSRRAFVVSSWEMAKECFTLNDKALA  99

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GY YA+F F+  + +WR MRK  + ELLSN +LD +KH+++SE+E  I+
Sbjct  100   SRPTTVAAKHMGYGYAVFGFAPYSTFWREMRKIAMYELLSNRRLDTLKHVQVSEVEMGIQ  159

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY     +    +  +V +  W   LTLN   R+VAG+RY F  G +  DD   E +  
Sbjct  160   ELYKLWVNNNSGYRPILVELKHWFEDLTLNVIVRMVAGKRY-FGAGASCDDD---EARRC  215

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q+ IN   +F +L G+FV  DAFP+    WFD QGH +AMKR  K++D IL++W+ +H E
Sbjct  216   QKAIN---QFFHLIGIFVPSDAFPI--LGWFDIQGHEKAMKRTAKELDSILESWLQEHRE  270

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +R+L       A    D I +MLS  ++  +  F Y    +IK T  ++I+ GSDTT   
Sbjct  271   KRRLSEGKNEGAQ---DFIDVMLSLQEEGRLSNFQYDADTSIKSTCLALILGGSDTTAGT  327

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WA+SLL+   +++++ +EEI+  VG +R V++SD++ L Y+QA++KE+LRLYP  PLL
Sbjct  328   LTWAISLLLNNPEILRKAQEEIDVHVGKDRQVDESDIQNLAYIQAIIKETLRLYPAGPLL  387

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFL----NREAGGAD  371
              PR    +C++GGY +  G +  VN+WKI RDP+ W +PD F P RFL    N +  G D
Sbjct  388   GPREAMDECEVGGYKITPGTRLIVNVWKIQRDPRIWEDPDSFKPDRFLMSNSNVDVKGQD  447

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTP-GNVELDMEEGFGVTL  194
                  FE +PFG GRRSC G++ ALQ+ HLT+AR +Q F FS P G+  +D+ E  G+T+
Sbjct  448   -----FELIPFGSGRRSCPGVSLALQVLHLTLARFLQAFEFSKPVGDQLIDLTESPGLTI  502

Query  193   PRATPLQLVVTPRLPPNFYG  134
             P+ATPL +++TPRL  N YG
Sbjct  503   PKATPLDVLITPRLNANLYG  522



>ref|XP_009757628.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
 gb|ADP65810.1| nicotine N-demethylase [Nicotiana sylvestris]
Length=517

 Score =   432 bits (1110),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 206/496 (42%), Positives = 315/496 (64%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILN--SQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   +  S ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFYFDDDSDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN AM   +    YWR  RK V+ E+L   +L+K+KH+R  E++TS
Sbjct  103   FSNRPAFLYGEYLGYNNAMLFLTKYGPYWRKNRKLVIQEVLCASRLEKLKHVRFGEIQTS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    ++
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFR  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFIILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             +++++       A GN+ D I ++LS +  E++    Y+    IK T  S+++D +DT  
Sbjct  268   VKKKE--KMEVNAEGNEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              HM W ++LL+     +K+ +EEI+ +VG +RWVE+SD+K L YLQ +VKE LRLYP  P
Sbjct  325   LHMNWGMALLINNQHALKKAQEEIDKKVGKDRWVEESDIKDLVYLQTIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W  PDKF P+RF    A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFF---AADIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +E++PFG GRRSC GM YA+Q+ HLTIA LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQHYEFIPFGSGRRSCPGMTYAMQVEHLTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P+++V+TPRL P  Y
Sbjct  502   NPIEVVITPRLTPELY  517



>ref|XP_009619218.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=517

 Score =   431 bits (1109),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 207/496 (42%), Positives = 314/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   +    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN AM   +    YWR  RK V+ E+LS  +L+K+KH+R  +++TS
Sbjct  103   FSNRPAFLYGEYLGYNNAMLFLTKYGPYWRKNRKLVIQEVLSASRLEKLKHVRFGKIQTS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    ++
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFR  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFIILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             +++R+       A GN+ D I ++LS +  E++    Y+    IK T  S+++D +DT  
Sbjct  268   VKKRE--KMEVNAQGNEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              HM W ++LL+     +K+ +EEI+ +VG ERWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHMNWGMALLINNQHALKKAQEEIDKKVGKERWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W  PDKF P+RF    A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFF---ADDIDYR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +E++PFG GRRSC GM YALQ+ HLTIA LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQHYEFIPFGSGRRSCPGMTYALQVEHLTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P+++ +T RL P  Y
Sbjct  502   NPVEVTITARLAPELY  517



>gb|ABA07806.2| cytochrome P450 monooxygenase CYP82E2 [Nicotiana tabacum]
Length=517

 Score =   431 bits (1108),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 206/496 (42%), Positives = 314/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N+   ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN  M   ++   YWR  RK V+ E+LS  +L+K K +R + ++TS
Sbjct  103   FSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRINGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
                   N F++F  LS  FVL DAFP+ LFKW DFQGH++AMKR  K +D + Q W+++H
Sbjct  214   ------NAFKDFMVLSMEFVLWDAFPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS + KE++    Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVGAEGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + + + +EEI+ +VG +RWVE+SD+K L YLQA+VK+ LRLYP  P
Sbjct  325   LHINWGMTLLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    KDC + GY +PKG +   N+ K+ RDPK    PDKF P+RF+   AG  D  
Sbjct  385   LLVPHENVKDCVVSGYHIPKGTRLFANVMKLQRDPKLLSNPDKFDPERFI---AGDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
                +E++PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GHHYEFIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++TPRL P  Y
Sbjct  502   NPVELIITPRLAPELY  517



>ref|XP_009778755.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=515

 Score =   430 bits (1106),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 313/496 (63%), Gaps = 26/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N+   ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  44    VIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAI  103

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN  M   ++   YWR  RK V+ E+LS  +L+K K +R + ++TS
Sbjct  104   FSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTS  163

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  164   IKNLYTRINGN-----SSTINLSDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  214

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
                   N F++F  LS  FVL DAFP+ LFKW DFQGH++AMKR  K +D + Q W+++H
Sbjct  215   ------NAFKDFMVLSMEFVLWDAFPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEH  268

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS + KE++    Y+    IK T  S+++D +DT  
Sbjct  269   INKRE--KMEVGAEGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVLDAADTVA  325

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + +K+ +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  326   LHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  385

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK WP PD F P+RF+    G     
Sbjct  386   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWPNPDNFDPERFVIDFRG-----  440

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +EY+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP N  LDM+EG G+T+ + 
Sbjct  441   -QHYEYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPTNEPLDMKEGAGITIRKV  499

Query  184   TPLQLVVTPRLPPNFY  137
               +++++ PRL P  Y
Sbjct  500   NSVEVLIKPRLAPELY  515



>gb|ABD39479.1| CYP82E4v8 [Nicotiana tabacum]
Length=517

 Score =   430 bits (1105),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/496 (42%), Positives = 315/496 (64%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  G++LGYN AM   ++   YWR  RK V+ E+LS  +L+K KH+R + ++ S
Sbjct  103   FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQAS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRAFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+     + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +  VN+ K+ RDPK W +PD F P+RF+   A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFVNVMKLQRDPKLWSDPDTFDPERFI---ATDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + ++Y+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++ PRL P  Y
Sbjct  502   NPVELIIAPRLAPELY  517



>ref|XP_004248527.2| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=521

 Score =   430 bits (1105),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 218/496 (44%), Positives = 315/496 (64%), Gaps = 21/496 (4%)
 Frame = -1

Query  1618  IIGHIPILN--SQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             IIGH+  L+   +N   + TL  +ADK+GP+F +R GM P  +I   E AKDC TTH++D
Sbjct  43    IIGHLHQLSGIDKNVPFAHTLAALADKYGPIFTLRMGMYPYLIINNWEGAKDCLTTHDKD  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              A++P    G+ +GY YA F++S+   Y+  +RK  ++++LS+ KL+K++HIR+ ELE S
Sbjct  103   FAARPTSMAGQSIGYKYARFTYSNFGLYYNHVRKLALTQVLSSTKLEKMRHIRVVELENS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK+LY     + + N+  V+ + +W  QLTLNT  + + G+RY          ++  + +
Sbjct  163   IKDLYSLTQVANKNNE--VINITQWFHQLTLNTIVKTICGKRY----------NNIEKDE  210

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EA+     F+   Y+ G  VL D  P  LFK+ DFQGH++ M    K +D ILQ W++ H
Sbjct  211   EAKRFRKAFKGIMYVVGQIVLYDVVPFPLFKYVDFQGHIKLMNNIYKDLDSILQGWLEDH  270

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             ++++ L N       +D D I  ML     +  K + Y+    IK T  S+I+DGSDTT 
Sbjct  271   MKKKDLNN------DDDEDAIDAMLKATYVDEFKAYGYSQATVIKSTILSLILDGSDTTA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              HM+W +SLL+     MK+ +EEI+ +VG  RWV +SDVK L YLQA+VKE+ RLYP VP
Sbjct  325   VHMIWIMSLLLNNPHAMKQAQEEIDTKVGKSRWVGESDVKNLVYLQAIVKETSRLYPPVP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DCK+ GYD+PKG +  +N WKI RDPK W E +KFMP+RFL  ++   D  
Sbjct  385   LLLPHEAVQDCKVAGYDIPKGTRTYINAWKIHRDPKIWSESEKFMPERFLTSKS-SVDAR  443

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE++PFG GRRSC G+ +A  ++HLT ARL+QGF FST  N  +DM EG G+TLP+ 
Sbjct  444   GQHFEFIPFGSGRRSCPGINFATLVTHLTFARLLQGFAFSTSSNTPIDMTEGVGITLPKV  503

Query  184   TPLQLVVTPRLPPNFY  137
               ++++VTPRL  NFY
Sbjct  504   NQVEILVTPRLSSNFY  519



>gb|ABX56037.1| CYP82E5v2 [Nicotiana tabacum]
Length=517

 Score =   429 bits (1103),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 206/496 (42%), Positives = 314/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   +    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGY+ AM   +    YWR  RK V+ E+LS  +L+K+KH+R  +++TS
Sbjct  103   FSNRPAFLYGEYLGYSNAMLFLTKYGPYWRKNRKLVIQEVLSASRLEKLKHVRFGKIQTS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    ++
Sbjct  163   IKSLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFR  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFIILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             +++R+       A GN+ D I ++LS +  E++    Y+    IK T  S+++D +DT  
Sbjct  268   VKKRE--KMEVNAQGNEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              HM W ++LL+     +K+ +EEI+ +VG ERWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHMNWGMALLINNQHALKKAQEEIDKKVGKERWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W  PDKF P+RF    A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFF---ADDIDYR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +E++PFG GRRSC GM YALQ+ HLTIA LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQHYEFIPFGSGRRSCPGMTYALQVEHLTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P+++ +T RL P  Y
Sbjct  502   NPVEVTITARLAPELY  517



>gb|ABA07804.1| cytochrome P450 monooxygenase CYP82E4v2 [Nicotiana tabacum]
 gb|ABB36475.1| nicotine demethylase [Nicotiana tabacum]
 gb|ABN42695.1| cytochrome P450 CYP82E4v2 nicotine demethylase [Nicotiana tabacum]
Length=517

 Score =   429 bits (1103),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 314/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  G++LGYN AM   ++   YWR  RK V+ E+LS  +L+K KH+R + ++ S
Sbjct  103   FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQAS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+     + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W +PD F P+RF+   A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI---ATDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + ++Y+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++ PRL P  Y
Sbjct  502   NPVELIIAPRLAPELY  517



>ref|XP_009609539.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
 gb|ABM46920.1| cytochrome P450 monooxygenase CYP82E4 [Nicotiana tomentosiformis]
Length=517

 Score =   429 bits (1103),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 314/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  G++LGYN AM   ++   YWR  RK V+ E+LS  +L+K KH+R + ++ S
Sbjct  103   FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQAS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+     + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W +PD F P+RF+   A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI---ATDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + ++Y+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++ PRL P  Y
Sbjct  502   NPVELIIAPRLAPELY  517



>gb|ABA07805.1| cytochrome P450 monooxygenase CYP82E4v1 [Nicotiana tabacum]
Length=517

 Score =   429 bits (1102),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 314/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  G++LGYN AM   ++   YWR  RK V+ E+LS  +L+K KH+R + ++ S
Sbjct  103   FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQAS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+     + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W +PD F P+RF+   A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI---ATDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + ++Y+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++ PRL P  Y
Sbjct  502   NPVELIIAPRLAPELY  517



>gb|ABD39483.1| CYP82E2v2 [Nicotiana tabacum]
Length=517

 Score =   429 bits (1102),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 313/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N+   ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P    GE+LGYN  M   ++   YWR  RK V+ E+LS  +L+K K +R + ++TS
Sbjct  103   FSNRPALLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRINGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
                   N F++F  LS  FVL DAFP+ LFKW DFQGH++AMKR  K +D + Q W+++H
Sbjct  214   ------NAFKDFMVLSMEFVLWDAFPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS + KE++    Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KIEVGAEGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + + + +EEI+ +VG +RWVE+SD+K L YLQA+VK+ LRLYP  P
Sbjct  325   LHINWGMTLLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    KDC + GY +PKG +   N+ K+ RDPK    PDKF P+RF+   AG  D  
Sbjct  385   LLVPHENVKDCVVSGYHIPKGTRLFANVMKLQRDPKLLSNPDKFDPERFI---AGDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
                +E++PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GHHYEFIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++TPRL P  Y
Sbjct  502   NPVELIITPRLAPELY  517



>ref|XP_009627979.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=517

 Score =   429 bits (1102),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 206/496 (42%), Positives = 315/496 (64%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNS--QNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L+R LG++ADK+G +F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNDDGNDRPLARKLGDLADKYGLVFTFRLGLPLVLVVSSYEAIKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE++GYN AM   ++   YWR  RK V+ E+LS  +L K KH+R + ++TS
Sbjct  103   FSNRPAFLYGEYIGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLKKFKHVRFARIQTS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDRN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  +S  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMIISMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + +K+ +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY + KG +   N+ K+ RDPK WP PD F P+RF+   A G D  
Sbjct  385   LLVPHENIEDCVVSGYYISKGTRLFANVMKLQRDPKLWPNPDNFDPERFV---AAGIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +EY+PFG GRRSC GM YALQ+ HLT+A LIQGFN+STP +  LDM+EG G+T+ + 
Sbjct  442   GQHYEYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYSTPNDEPLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P+++++  RL P  Y
Sbjct  502   NPVEVIIMSRLAPELY  517



>gb|ABA07807.1| cytochrome P450 monooxygenase CYP82E3 [Nicotiana tabacum]
Length=518

 Score =   429 bits (1102),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 318/496 (64%), Gaps = 22/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   +    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGY  AM   ++  +YWR  RK ++ E+LS  +L+K KH+R + ++TS
Sbjct  103   FSNRPAFLYGEYLGYKNAMLFLANYGSYWRKNRKLIIQEVLSASRLEKFKHVRFARIQTS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I++R+         GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   IKKRE-KIMEVGTEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  325

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+   ++LL+   + +K+ +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  326   LHINCGMALLINNQNALKKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  385

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W  PDKF P+RF+ R+    D  
Sbjct  386   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFNPERFIARD---IDFH  442

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +EY+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  443   GQHYEYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPTDEPLDMKEGAGITIRKV  502

Query  184   TPLQLVVTPRLPPNFY  137
              P+++++TPRL P  Y
Sbjct  503   NPVKVIITPRLAPELY  518



>gb|ABD39476.1| CYP82E4v5 [Nicotiana tabacum]
Length=517

 Score =   428 bits (1101),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 314/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  G++LGYN AM   ++   YWR  RK V+ E+LS  +L+K KH+R + ++ S
Sbjct  103   FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQAS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+     + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W +PD F P+RF+   A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVVKLQRDPKLWSDPDTFDPERFI---ATDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + ++Y+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++ PRL P  Y
Sbjct  502   NPVELIIAPRLAPELY  517



>gb|ABD39478.1| CYP82E4v7 [Nicotiana tabacum]
Length=517

 Score =   428 bits (1101),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 313/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  G++LGYN AM   ++   YWR  RK V+ E+LS  +L+K KH+R + ++ S
Sbjct  103   FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQAS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLVVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F +F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FEDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+     + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W +PD F P+RF+   A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI---ATDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + ++Y+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++ PRL P  Y
Sbjct  502   NPVELIIAPRLAPELY  517



>gb|ABD39485.1| CYP82E2v4 [Nicotiana tabacum]
Length=517

 Score =   428 bits (1100),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/496 (42%), Positives = 313/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N+   ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAIKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN  M   ++   YWR  RK V+ E+LS  +L+K K +R + ++TS
Sbjct  103   FSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRINGN-----SSTINLTDWLEELDFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
                   N F++F  LS  FVL DAFP+ LFKW DFQGH++AMKR  K +D + Q W+++H
Sbjct  214   ------NAFKDFMVLSMEFVLWDAFPIPLFKWVDFQGHIKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS + KE++    Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVGAEGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + + + +EEI+ +VG  RWVE+SD+K L YLQA+VK+ LRLYP  P
Sbjct  325   LHINWGMTLLINNQNALMKAQEEIDTKVGKYRWVEESDIKDLVYLQAIVKKVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    KDC + GY +PKG +   N+ K+ RDPK    PDKF P+RF+   AG  D  
Sbjct  385   LLVPHEYVKDCVVSGYHIPKGTRLFANVMKLQRDPKLLSNPDKFDPERFI---AGDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
                +E++PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GHHYEFIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEALDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++TPRL P  Y
Sbjct  502   NPVELIITPRLAPELY  517



>ref|XP_002323130.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
 gb|EEF04891.1| hypothetical protein POPTR_0016s00980g [Populus trichocarpa]
Length=499

 Score =   427 bits (1099),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 215/494 (44%), Positives = 314/494 (64%), Gaps = 24/494 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ ILNSQ     R LG++A KHGP+F +R GM    +I   E+ K+CF T++R   
Sbjct  28    LIGHLRILNSQIPFF-RILGDLAVKHGPVFSIRLGMRRTLVISSWESVKECFKTNDRKFL  86

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P FA  +++GY+ A F F     YW  MRK    ELLSN +L+ +KH+R+SE+ET IK
Sbjct  87    NRPSFAASKYMGYDDAFFGFHPYGEYWLEMRKIATQELLSNRRLELLKHVRVSEIETCIK  146

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             EL+   T S   N + +V M +W + +  N   R++AG+RY   +G           K++
Sbjct  147   ELH--TTCS---NGSVLVDMSQWFSCVVANVMFRLIAGKRYCSGIG-----------KDS  190

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                  + REF YL G+ V+ D  P    +W D QGHV++MKR  K++D ++  W+ +H++
Sbjct  191   GAFGRLVREFFYLGGVLVISDLIPFT--EWMDLQGHVKSMKRVAKELDHVVSGWLVEHLQ  248

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR+ G         + D + +ML ++       F Y  +  +K T  ++I+ G+DTT   
Sbjct  249   RREEGRV----RKEEKDFMDVMLESLAVGDDPIFGYKRETIVKATALNLILAGTDTTSVT  304

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+ + +V+KR ++EI+  VGT RWVE+SD+K L YLQA+VKE+LRLYP  PLL
Sbjct  305   LTWALSLLLNHTEVLKRAQKEIDVHVGTTRWVEESDIKNLVYLQAIVKETLRLYPPGPLL  364

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +PR + +DC + GY +P+G Q  VN WK+ RD + W  P +F P+RFL    G  D   +
Sbjct  365   VPRESLEDCYVDGYLVPRGTQLLVNAWKLHRDARIWENPYEFHPERFLTSH-GSTDVRGQ  423

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
             +FEYVPFG GRR C G++ +LQ+ HLT++RL+QGFNFSTP N ++DM EG G+TLP+ATP
Sbjct  424   QFEYVPFGSGRRLCPGISSSLQMLHLTLSRLLQGFNFSTPMNAQVDMSEGLGLTLPKATP  483

Query  178   LQLVVTPRLPPNFY  137
             L++V+TPRL    Y
Sbjct  484   LEVVLTPRLENEIY  497



>gb|ABC69371.1| CYP82E5 [Nicotiana tabacum]
Length=517

 Score =   428 bits (1100),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 314/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   +    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFYFDDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLIVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN AM   +    YWR  RK V+ E+LS  +L+K+KH+R  +++TS
Sbjct  103   FSNRPAFLYGEYLGYNNAMLFLTKYGPYWRKNRKLVIQEVLSASRLEKLKHVRFGKIQTS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    ++
Sbjct  163   IKSLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFR  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      +++F  LS  FVL DAFP+ LFKW DFQG+V+AMKR  K +D + Q W+++H
Sbjct  214   KA------YKDFIILSMEFVLWDAFPIPLFKWVDFQGYVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             +++R+       A GN+ D I ++LS +  E++    Y+    IK T  S+++D +DT  
Sbjct  268   VKKRE--KMEVNAQGNEQDFIDVVLSKMSNEYLDE-GYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              HM W ++LL+     +K+ +EEI+ +VG ERWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHMNWGMALLINNQHALKKAQEEIDKKVGKERWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W  PDKF P+RF    A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSNPDKFDPERFF---ADDIDYR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +E++PFG GRRSC GM YALQ+ HLTIA LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQHYEFIPFGSGRRSCPGMTYALQVEHLTIAHLIQGFNYKTPNDEPLDMKEGAGLTIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P+++ +T RL P  Y
Sbjct  502   NPVEVTITARLAPELY  517



>ref|XP_009348373.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=538

 Score =   428 bits (1101),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 223/496 (45%), Positives = 315/496 (64%), Gaps = 19/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+  L  +   L RTL  MADK+GP+F +R G  P  +I   +A K+CFT ++    
Sbjct  58    IIGHLHKLGGKKP-LCRTLASMADKYGPIFTIRLGKDPALVISNYDAVKECFTKNDIVFG  116

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P+ A G +LGYNYA F FS    YWR MRK V++ELLS+ +L  +KH+++SE+++ IK
Sbjct  117   ARPKSAHGRYLGYNYAGFGFSPYGTYWRNMRKVVIAELLSSRRLQTLKHVQISEVDSFIK  176

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY       E  +  VV + EWI  LTLN   +++AG+RY F   G +G+D   E  E 
Sbjct  177   GLYEICKTKGENGQGKVV-ISEWIEHLTLNVITQMIAGKRY-FD-WGKVGNDSDNE-GEN  232

Query  1078  QEMINVFREFQYLSGMFVLQD--AFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             + +  + +EF  +SGM V+ D   +P     W DF G V+ MKR  K++D +  +WI++H
Sbjct  233   KRIREIVKEFMLVSGMPVISDMIGYP----DWIDFLGEVKNMKRIGKELDSLTASWIEEH  288

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
                R+        + + LD I +MLS I+   V G  YT +  IK T+Q++II GSDTT 
Sbjct  289   NNARK-----EIDSRDKLDFIDVMLSVIEDNTVLG--YTRETIIKATSQNLIIAGSDTTA  341

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
               + W +SLL+    V+K  +EEI   VGTERWVED+D++ L YLQA+VKE+LRLYP  P
Sbjct  342   ISLKWVISLLLNNRHVLKHAQEEINLIVGTERWVEDTDIENLTYLQAIVKETLRLYPPGP  401

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             L +P    +DC++ G+ +PKG +  VNLWK+ RDP  W +P+ F P RFL  +A   D  
Sbjct  402   LSVPHEAMEDCQVCGFHIPKGTRLFVNLWKLHRDPTVWSDPEMFYPDRFLTTQA-SIDVS  460

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
                FE++PFG GRRSC G+ +A+Q+ HLT+ RLIQGF  +TP ++ +DM EG GVTLP+A
Sbjct  461   GNHFEFIPFGSGRRSCPGLTFAMQVIHLTLGRLIQGFELATPLDMPVDMTEGLGVTLPKA  520

Query  184   TPLQLVVTPRLPPNFY  137
             T L++V+TPRLP  FY
Sbjct  521   TSLEVVLTPRLPIEFY  536



>gb|ABD39480.1| CYP82E4v10 [Nicotiana tabacum]
Length=517

 Score =   427 bits (1098),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 203/496 (41%), Positives = 314/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  G++LGYN AM   ++   YWR  RK V+ E+LS  +L+K KH+R + ++ S
Sbjct  103   FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQAS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL D+FP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDSFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+     + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLMNNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W +PD F P+RF+  + G     
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIATDIGFRG--  442

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + ++Y+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  443   -QYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++ PRL P  Y
Sbjct  502   NPVELIIAPRLAPELY  517



>gb|ABD39475.1| CYP82E4v4 [Nicotiana tabacum]
Length=517

 Score =   427 bits (1098),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/496 (41%), Positives = 313/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L+R LG++ADK+GP+   R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNDDGDDRPLARKLGDLADKYGPVLTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  G++LGYN AM   ++   YWR  RK V+ E+LS  +L+K KH+R + ++ S
Sbjct  103   FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQAS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+     + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W +PD F P+RF+   A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI---ATDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + ++Y+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++ PRL P  Y
Sbjct  502   NPVELIIAPRLAPELY  517



>ref|XP_010106089.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXC07359.1| Cytochrome P450 82C4 [Morus notabilis]
Length=528

 Score =   427 bits (1099),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 216/497 (43%), Positives = 309/497 (62%), Gaps = 19/497 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+L RTLG MAD +GP F +R G     ++   + AKDCFT +++ +A
Sbjct  50    IIGHLHLLGGGDQLLYRTLGAMADNYGPAFNIRLGSRRAFVVNSWDVAKDCFTANDKALA  109

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GYNYA+F F+  + +WR MRK    ELLSN +L+ +KH+R+SE++T I+
Sbjct  110   SRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEMLKHVRISEIDTGIQ  169

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LY  V     P    VV +  W+ +LTLN   R+VAG+RY   +    GD       EA
Sbjct  170   DLYDRVQNGAHP---VVVELSRWLDELTLNMVVRMVAGKRYFGALAECNGD-------EA  219

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q       EF +L G+FV+ DA P     W D  GH RAMKR  K++D IL  W+++H  
Sbjct  220   QRCQKAICEFFHLIGIFVVSDALPF--LWWLDLHGHERAMKRTAKELDAILGGWLEEHRR  277

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR      +  A +D D I +MLS  +   +  F Y   ++IK T  ++I+ GSDTT   
Sbjct  278   RRA-----SKMADSDQDFIDVMLSLQEGGELSNFQYDADISIKSTCLALILGGSDTTAGT  332

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WA+SLL+     +K+ ++E++ +VGT R V+DSD+K L YLQA++KE+LRLYP  PLL
Sbjct  333   LTWAISLLLNNSHALKKAQQELDIEVGTNRLVDDSDIKNLVYLQAIIKETLRLYPAGPLL  392

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR   +DC + GY +P G +  VN+WKI RDP  W  P+ F P+RFL   A   D   +
Sbjct  393   GPREALEDCTVSGYHVPAGTRLVVNVWKIQRDPTVWSNPEAFEPERFLTTHA-HVDVRGQ  451

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTP-GNVELDMEEGFGVTLPRAT  182
             +FE +PFG GRRSC G ++ALQ+ HLT+ARL+Q F FS P     +DM E  G+T+P+A 
Sbjct  452   QFELIPFGSGRRSCPGASFALQVLHLTLARLLQAFEFSNPLDGRPVDMTENPGLTIPKAH  511

Query  181   PLQLVVTPRLPPNFYGL  131
             PL+++++PRLP   YG+
Sbjct  512   PLEVLLSPRLPRELYGV  528



>gb|ABD39474.1| CYP82E4v3 [Nicotiana tabacum]
Length=517

 Score =   427 bits (1097),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 204/496 (41%), Positives = 313/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  G++LGYN AM   ++   YWR  RK V+ E+LS  +L+K KH+R + ++ S
Sbjct  103   FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQAS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+     + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W +PD F P+RF+   A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI---ATDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + ++Y+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +   DM+EG G+T+ + 
Sbjct  442   GQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPSDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++ PRL P  Y
Sbjct  502   NPVELIIAPRLAPELY  517



>gb|ABD39484.1| CYP82E2v3 [Nicotiana tabacum]
Length=517

 Score =   426 bits (1094),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 204/496 (41%), Positives = 312/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N+   ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNNDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEATKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  GE+LGYN  M   ++   YWR  RK V+ E+LS  +L+K K +R + ++TS
Sbjct  103   FSNRPAFLYGEYLGYNNTMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKQVRFTRIQTS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRINGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
                   N F++F  LS  FVL DAFP+ LFKW DFQGH++ MKR  K +D + Q W+++H
Sbjct  214   ------NAFKDFMVLSMEFVLWDAFPIPLFKWVDFQGHIKTMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS + KE++    Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVGAEGNEQDFIDVVLSKLSKEYLDE-GYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+   + + + +EEI+ +VG +RWVE+SD+K L YLQA+VK+ LRLYP  P
Sbjct  325   LHINWGMTLLINNQNALMKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKKVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    KDC + GY +PKG +   N+ K+ RDPK    PDKF P+RF+   AG  D  
Sbjct  385   LLVPHENVKDCVVSGYHIPKGTRLFANVMKLQRDPKLLSNPDKFDPERFI---AGDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
                +E++P G GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GHHYEFIPSGSGRRSCPGMTYALQVEHLTMAHLIQGFNYKTPNDEVLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++TPRL P  Y
Sbjct  502   NPVELIITPRLAPELY  517



>gb|ABD39481.1| CYP82E4v11 [Nicotiana tabacum]
Length=517

 Score =   426 bits (1094),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 204/496 (41%), Positives = 312/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L++ LG++ADK+GP+F  R G+  + ++   EA KDCF+T +  
Sbjct  43    VIGHLFHFNDDGDDRPLAQKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTDDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  G++LGYN AM   ++   YWR  RK V+ E+LS  +L+K KH+R + ++ S
Sbjct  103   FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQAS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    IK T   +++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFGLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+     + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W +PD F P+RF+   A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI---ATDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + ++Y+PFG GRRSC GM YALQ+ HLTIA LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQYYKYIPFGSGRRSCPGMTYALQVEHLTIAHLIQGFNYRTPNDEPLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++ PRL P  Y
Sbjct  502   NPVELIIAPRLAPELY  517



>emb|CDY53704.1| BnaC03g67210D [Brassica napus]
Length=523

 Score =   426 bits (1094),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/498 (43%), Positives = 323/498 (65%), Gaps = 18/498 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  + Q+L RTLGEMA+++GP   +R G +   ++   E AK+CFT +++ +A
Sbjct  41    IIGHLHLLGGKEQLLYRTLGEMANRYGPAMSLRLGSSEAFVVSSFEVAKECFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYNYA+F F+  +++WR MRK    ELLSN +L  +KH+R+SE+   +K
Sbjct  101   SRPMTAAAKHMGYNYAVFGFAPYSSFWREMRKIATIELLSNRRLQMLKHVRVSEISMGVK  160

Query  1258  ELY-LFVT-ASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W+  +TLN   R+VAG+RY F  GG+   +D+ E +
Sbjct  161   DLYSLWVKKGGSEP---VMVNLKRWLEDMTLNMIVRMVAGKRY-FG-GGSTTPEDTEEAR  215

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             + Q+ I    +F +L G+F + DAFP     WFD QGH + MK+   ++D IL+ WI+ H
Sbjct  216   QCQKAIT---KFFHLIGIFTMSDAFPT--LGWFDLQGHEKEMKKTGSELDVILERWIENH  270

Query  904   IERRQL-GNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
              ++R++ GN       ND D I +MLS  ++  +    Y    +IK T  ++I+ GSDTT
Sbjct  271   RQQRKVSGNKE-----NDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTT  325

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
              + + WA++LL+   D++K+ ++EI+ QVGT+R VEDSD++ L YLQA++KE+LRLYP  
Sbjct  326   ASTLTWAIALLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAG  385

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PLL PR   +DC I GY +  G +  VN+WKI RDPK W EP++F P+RFL  EA   D 
Sbjct  386   PLLGPREAMEDCTIAGYHVSCGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDV  445

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + FE +PFG GRRSC G + A+Q+ HL +AR +  F+  T  +V +DM E  G+T+P+
Sbjct  446   RGQNFELIPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPK  505

Query  187   ATPLQLVVTPRLPPNFYG  134
             ATPL+++++PRL  + + 
Sbjct  506   ATPLEVMISPRLEKHLFA  523



>ref|XP_010437977.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=525

 Score =   425 bits (1093),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 209/496 (42%), Positives = 321/496 (65%), Gaps = 14/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  + Q+L RTLG MAD++GP+  +R G +   ++   E AKDCFT +++ +A
Sbjct  41    IIGHLHLLVGKEQLLYRTLGRMADRYGPVMSLRLGSSEAFVVSSFEVAKDCFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYNYA+F F+  NA+WR MRK    ELLSN +L  +KH+ +SE+   +K
Sbjct  101   SRPMTAAAKHMGYNYAVFGFAPYNAFWREMRKIATIELLSNRRLQMLKHVSVSEISMGVK  160

Query  1258  ELY-LFV-TASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W+  +TLN   R+VAG+RY    GG +G + S + +
Sbjct  161   DLYSLWVKNGGSEP---VMVDLKRWLDNMTLNMIVRMVAGKRY---FGGVVGSESSEDTE  214

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EA++      +F +L G+F + DAFP RL +WFDFQGH + MK+   ++D IL+ WID H
Sbjct  215   EARQCKMAISKFFHLIGIFTVSDAFP-RL-RWFDFQGHEKEMKQTGSELDVILERWIDNH  272

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              + R++         ND D I +MLS  ++  +    Y   ++IK T  ++I+ GS+TT 
Sbjct  273   RQERKVSGTKE----NDSDFIDVMLSLAEQGKLSHLQYDANISIKSTCLALILGGSETTS  328

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             + + WA++LL+   +++K+ ++EI+  VG +R VEDSD+  L YLQA++KE+LRLYP  P
Sbjct  329   STLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRLYPAGP  388

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL PR   +DC + GY++  G +  VN+WKI RDPK + EP++F P+RF+  EA   D  
Sbjct  389   LLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYKEPNEFRPERFITGEAKEFDVR  448

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRRSC G + A+Q+ HL +AR +  F   T  ++ +DM E  G+T+P+A
Sbjct  449   GQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPGLTIPKA  508

Query  184   TPLQLVVTPRLPPNFY  137
             TPL+++++PRL  +F+
Sbjct  509   TPLEVLISPRLNEHFF  524



>ref|XP_011040244.1| PREDICTED: cytochrome P450 82C4-like [Populus euphratica]
Length=544

 Score =   426 bits (1094),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 216/498 (43%), Positives = 318/498 (64%), Gaps = 28/498 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ ILNSQ  +  RTLG++ADKHGP+F +R GM    +I   E+ K+CF T++R   
Sbjct  69    LIGHLRILNSQIPLF-RTLGDLADKHGPVFSIRLGMRRTLVISSWESVKECFKTNDRKFL  127

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P  A  +++GY+ A F F     YW  MRK    ELLSN +L+ +KH+R+SE+ET IK
Sbjct  128   NRPSVAASKYMGYDDAFFGFHPYGEYWLEMRKIATQELLSNSRLELLKHVRVSEIETCIK  187

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             EL+   T S   N + ++ M +W + +  N   R++AG+RY     G  G D     +  
Sbjct  188   ELH--TTCS---NGSVLLDMSQWFSCIVANVMFRLIAGKRY----CGGTGKDSGACGR--  236

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQA-WIDQHI  902
                  + +EF YLSG+ V  D  P    +W DFQGH+++MKR  K++D ++   W+ +H+
Sbjct  237   -----LIKEFFYLSGVLVTSDLIPFT--EWMDFQGHLKSMKRVAKELDDVVSGQWLVEHL  289

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFP---YTHQMAIKGTTQSMIIDGSDT  731
             +RR+ G         + D + +ML ++D   +   P   Y  +  +K T  ++++ G DT
Sbjct  290   QRREEG----LVRKEEKDFMDVMLESLDSLAIGEEPIFVYKRETIVKATALNLLLAGIDT  345

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
             T   + WALSLL+ + +V+KR ++EI+  VGT RWVE+SD+K L YLQA+VKE+LRLYP 
Sbjct  346   TSITLTWALSLLLNHTEVLKRAQKEIDIHVGTTRWVEESDIKNLVYLQAIVKETLRLYPP  405

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PLL+PR + +DC + GY +P+G Q  VN WK+ RD + W  P +F P+RFL    G  D
Sbjct  406   GPLLVPRESLEDCYVDGYLVPRGTQLLVNAWKLHRDARIWENPYEFHPERFLTSH-GSTD  464

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                ++FEYVPFG GRRSC G++ +LQ+ HLT++RL+QGFNFSTP N ++DM EG G+T+P
Sbjct  465   VRGQQFEYVPFGSGRRSCPGISSSLQMLHLTLSRLLQGFNFSTPMNAQVDMSEGLGLTMP  524

Query  190   RATPLQLVVTPRLPPNFY  137
             +ATPL++V+TPRL    Y
Sbjct  525   KATPLEVVLTPRLENEIY  542



>emb|CDY23316.1| BnaA08g12300D [Brassica napus]
Length=523

 Score =   424 bits (1091),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 212/498 (43%), Positives = 323/498 (65%), Gaps = 18/498 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  + Q+L RTLGEMA+++GP   +R G +   ++   E AK+CFT +++ +A
Sbjct  41    IIGHLHLLGGKEQLLYRTLGEMANRYGPAMSLRLGSSEAFVVSSFEVAKECFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYNYA+F F+  +++WR MRK    ELLSN +L  +KH+R+SE+   +K
Sbjct  101   SRPMTAAAKHMGYNYAVFGFAPYSSFWREMRKIATIELLSNRRLQMLKHVRVSEISMGVK  160

Query  1258  ELY-LFVT-ASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W+  +TLN   R+VAG+RY F  GG+   +D+ E +
Sbjct  161   DLYSLWVKKGGSEP---VMVNLKRWLEDMTLNMIVRMVAGKRY-FG-GGSTTPEDTEEAR  215

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             + Q+ I    +F +L G+F + DAFP     WFD QGH + MK+   ++D IL+ WI+ H
Sbjct  216   QCQKAIT---KFFHLIGIFTMSDAFPT--LGWFDLQGHEKEMKKTGSELDVILERWIENH  270

Query  904   IERRQL-GNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
              ++R++ GN       ND D I +MLS  ++  +    Y    +IK T  ++I+ GSDTT
Sbjct  271   RQQRKVSGNKE-----NDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTT  325

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
              + + WA++LL+   D++K+ ++EI+ QVGT+R VEDSD++ L YLQA++KE+LRLYP  
Sbjct  326   ASTLTWAIALLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAG  385

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PLL PR   +DC + GY +  G +  VN+WKI RDPK W EP++F P+RFL  EA   D 
Sbjct  386   PLLGPREAMEDCTVAGYHVACGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDV  445

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + FE +PFG GRRSC G + A+Q+ HL +AR +  F+  T  +V +DM E  G+T+P+
Sbjct  446   RGQNFELIPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPK  505

Query  187   ATPLQLVVTPRLPPNFYG  134
             ATPL+++++PRL  + + 
Sbjct  506   ATPLEVMISPRLEKHLFA  523



>gb|AGD93125.1| CYP450 nicotine N-demethylase [Nicotiana tabacum]
Length=517

 Score =   424 bits (1091),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 204/496 (41%), Positives = 313/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  G++LGYN AM   ++   YWR  RK V+ E+LS  +L+K KH+R + ++ S
Sbjct  103   FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQAS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    IK T  S+++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIKATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+     + + +EEI+ +VG +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+  DPK W +PD F P+RF+   A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQCDPKLWSDPDTFDPERFI---AIDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + ++Y+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++ PRL P  Y
Sbjct  502   NPVELIIAPRLAPELY  517



>ref|XP_010069626.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=542

 Score =   425 bits (1092),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 212/498 (43%), Positives = 318/498 (64%), Gaps = 10/498 (2%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGHI +L  +   L+RTL  MADK GP+F +R G+ P  +I   EA ++CFTTH++D+A
Sbjct  45    IIGHIHLLGGETP-LARTLAAMADKQGPMFRIRLGVHPATIISSREAVRECFTTHDKDLA  103

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+   G HLGY YA F F     +WR MRK  + ELLS  +LD +KH++ SE++T +K
Sbjct  104   SRPKSKAGIHLGYGYAGFGFVEYGDFWREMRKITMLELLSTRRLDNLKHVQASEIDTFVK  163

Query  1258  ELYLFV---TASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEY  1088
             +L+      +   +   + VV + + +  LTLN   R++A +RY F +  A     + + 
Sbjct  164   DLHALCRTNSIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRY-FGLSSASTGSSADDD  222

Query  1087  KEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             +EA  +  V +EF Y+SG   + D  P     W D  G V+ MKR  +++D+I+  W+++
Sbjct  223   EEASHLRRVIKEFMYISGFPAVSDLVPFT--GWTDCVGTVKTMKRVARELDEIVGKWVEE  280

Query  907   HIERRQLGNAPAPAAGN-DLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDT  731
             H  +R+ G+      G+   D I +MLS I ++ +  F ++ +  IK T  ++I+ GSD+
Sbjct  281   HKLKRE-GDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETLIKATIVNIIVAGSDS  339

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
             T  ++ W LSLL+ +  V+KR +EEI+ +VG +RWV+DSD++ L YLQA+VKE+LRLYP 
Sbjct  340   TSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDRWVQDSDIENLLYLQAIVKETLRLYPP  399

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PLL+P     DC + GY +PKG +  VN WK+ RDP+ W EP+KF+P+RFL   + G D
Sbjct  400   GPLLVPHEARADCNVRGYLIPKGTRIFVNAWKLHRDPQVWSEPEKFLPERFLTNHS-GVD  458

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                + FE++PFG GRR C G A+AL+ +HLT+ARL+QGF+ +T  +  +DM EG GV LP
Sbjct  459   ASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLATSLDELVDMTEGLGVNLP  518

Query  190   RATPLQLVVTPRLPPNFY  137
             +ATPL++V+ PRLP   Y
Sbjct  519   KATPLRVVLNPRLPSVLY  536



>ref|XP_009606611.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana tomentosiformis]
Length=548

 Score =   425 bits (1093),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 215/508 (42%), Positives = 326/508 (64%), Gaps = 25/508 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQI-LSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDV  1442
             +IGH+      + I LSR L  +A+K+GP+F  R G+  I ++   EA +DC  T+++  
Sbjct  50    VIGHLLQFFGADDIPLSRKLATLAEKYGPVFTFRLGLPRILVVSSYEAVRDCLNTNDKAF  109

Query  1441  ASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSI  1262
             A++P    GE++GYN AM   +S   YWR +RK V+ E+LS+ +L+K+K +R+SE++TSI
Sbjct  110   AARPASLAGEYIGYNNAMLFLASYGPYWRKIRKIVLQEVLSSSRLEKLKIVRVSEVQTSI  169

Query  1261  KELY-LF--------VTASPEPNKAAVVA----MDEWIAQLTLNTSCRIVAGRRYKFKVG  1121
             KEL+ LF        +T    P     V     +  WI +LTL+   +++AG+ Y     
Sbjct  170   KELFSLFPVTGDHSSITGDNFPVTGDYVPVKLNLTNWIEKLTLSLIVKMIAGKSYGRLNE  229

Query  1120  GAIGDDDSTEYKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKK  941
                 ++++  +K+A       ++F Y+S  FVL DAFP+ LFKW DFQGHV+ MKR  K 
Sbjct  230   KGEDEEEAERFKKA------LKDFMYISMEFVLWDAFPIPLFKWIDFQGHVKFMKRTFKD  283

Query  940   VDKILQAWIDQHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTT  761
             +D +LQ W+D+H+++R+  +     AGN+ D I +MLS +  E      YT +  IK T 
Sbjct  284   IDCVLQNWLDEHMKKREEVDV---VAGNEQDFIDVMLSMMSNEDFAD-SYTRETTIKATA  339

Query  760   QSMIIDGSDTTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAV  581
              SM++D SDTT  H+ W ++ L+ + DVMK+ +EE++ +VG  RWVE+SD+K L Y QAV
Sbjct  340   LSMVLDASDTTAIHLNWVMATLLNHRDVMKKVQEELDTKVGRNRWVEESDIKNLVYFQAV  399

Query  580   VKESLRLYPTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKR  401
             +KE+LRLYP  PLL+P  + +DC + GY +PKG +  VN  K+ RDP+ W +PD F P+R
Sbjct  400   IKETLRLYPPAPLLVPHESVEDCIVHGYHIPKGTRLWVNTMKLQRDPEIWSDPDTFDPER  459

Query  400   FLNREAGGADNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELD  221
             FL  +A G D   +++E++PFG GRRSC G+ YA Q++HL IA L+QGF+F+TP N  L+
Sbjct  460   FLTCQA-GFDVRGQQYEFIPFGSGRRSCPGITYASQVTHLAIAHLLQGFDFTTPFNEPLE  518

Query  220   MEEGFGVTLPRATPLQLVVTPRLPPNFY  137
             M+EG G+T+ +  P+++++TPRLP   Y
Sbjct  519   MKEGLGMTMRKVNPIEVLITPRLPSVLY  546



>ref|XP_009109920.1| PREDICTED: cytochrome P450 82C4 [Brassica rapa]
Length=525

 Score =   424 bits (1090),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 212/497 (43%), Positives = 322/497 (65%), Gaps = 18/497 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  + Q+L RTLGEMA+++GP   +R G     ++   E AK+CFT +++ +A
Sbjct  41    IIGHLHLLGGKEQLLYRTLGEMANRYGPAMSLRLGSNEAFVVSSFEVAKECFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYNYA+F F+  +++WR MRK    ELLSN +L  +KH+R+SE+   +K
Sbjct  101   SRPMTAAAKHMGYNYAVFGFAPYSSFWREMRKIATVELLSNRRLQMLKHVRVSEISMGVK  160

Query  1258  ELY-LFVT-ASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W+  +TLN   R+VAG+RY F  GG+   +D+ E +
Sbjct  161   DLYSLWVKKGGSEP---IIVDLKRWLEDMTLNMIVRMVAGKRY-FG-GGSTTPEDTEEAR  215

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             + Q+ I    +F +L G+F + DAFP     WFD QGH + MK+   ++D IL+ WI+ H
Sbjct  216   QCQKAIT---KFFHLIGIFTMSDAFPT--LGWFDLQGHEKEMKKTGSELDVILERWIENH  270

Query  904   IERRQL-GNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
              ++R++ GN       ND D I +MLS  ++  +    Y    +IK T  ++I+ GSDTT
Sbjct  271   RQQRKVSGNKE-----NDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTT  325

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
              + + WA++LL+   D++K+ ++EI+ QVGT+R VEDSD++ L YLQA++KE+LRLYP  
Sbjct  326   ASTLTWAIALLLNNKDMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAG  385

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PLL PR   +DC + GY +  G +  VN+WKI RDPK W EP++F P+RFL  EA   D 
Sbjct  386   PLLGPREAMEDCTVAGYHVACGTRLIVNVWKIQRDPKVWVEPNEFRPERFLTGEAKEFDV  445

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + FE +PFG GRRSC G + A+Q+ HL +AR +  F+  T  +V +DM E  G+T+P+
Sbjct  446   RGQNFELIPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTDLDVAVDMSESPGLTIPK  505

Query  187   ATPLQLVVTPRLPPNFY  137
             ATPL+++++PRL  + +
Sbjct  506   ATPLEVMISPRLEKHLH  522



>gb|ABD39482.1| CYP82E4v12 [Nicotiana tabacum]
Length=517

 Score =   423 bits (1087),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/496 (41%), Positives = 313/496 (63%), Gaps = 23/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   N    ++ L+R LG++ADK+GP+F  R G+  + ++   EA KDCF+T++  
Sbjct  43    VIGHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI  102

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +++P F  G++LGYN AM   ++   YWR  RK V+ E+LS  +L+K KH+R + ++ S
Sbjct  103   FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQAS  162

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK LY  +  +     ++ + + +W+ +L      +++AG+ Y+       GD+    +K
Sbjct  163   IKNLYTRIDGN-----SSTINLTDWLEELNFGLIVKMIAGKNYE----SGKGDEQVERFK  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A      F++F  LS  FVL DAFP+ LFKW DFQGHV+AMKR  K +D + Q W+++H
Sbjct  214   KA------FKDFMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEH  267

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I +R+       A GN+ D I ++LS +  E++ G  Y+    I+ T  S+++D +DT  
Sbjct  268   INKRE--KMEVNAEGNEQDFIDVVLSKMSNEYL-GEGYSRDTVIEATVFSLVLDAADTVA  324

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+     + + +EEI+ +V  +RWVE+SD+K L YLQA+VKE LRLYP  P
Sbjct  325   LHINWGMALLINNQKALTKAQEEIDTKVCKDRWVEESDIKDLVYLQAIVKEVLRLYPPGP  384

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P    +DC + GY +PKG +   N+ K+ RDPK W +PD F P+RF+   A   D  
Sbjct  385   LLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFI---ATDIDFR  441

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + ++Y+PFG GRRSC GM YALQ+ HLT+A LIQGFN+ TP +  LDM+EG G+T+ + 
Sbjct  442   GQYYKYIPFGPGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKV  501

Query  184   TPLQLVVTPRLPPNFY  137
              P++L++ PRL P  Y
Sbjct  502   NPVELIIAPRLAPELY  517



>ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
 gb|EOY14628.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
Length=527

 Score =   422 bits (1086),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 208/496 (42%), Positives = 312/496 (63%), Gaps = 15/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I+GH+ +L   +Q+L RTLG MAD++GP F +R G     ++   E AK+CFT +++ +A
Sbjct  47    ILGHLHLLGGSDQLLYRTLGAMADEYGPAFTIRLGSRCAFVVSSWELAKECFTINDKALA  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GYNYA+F F+  + +WR MRK    ELLSN +L+ +KH+R+SE++  I+
Sbjct  107   SRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEMLKHVRISEVDMGIR  166

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY         +   +V + +W+  LTLN   R+VAG+RY F       D ++   ++A
Sbjct  167   ELYSL--RHDNGSIPVLVELKQWLEDLTLNVVVRMVAGKRY-FGASAVCVDGEARRCQKA  223

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                    +EF  L GMFV+ DA PL    W D  GH +AMK   K++D +L+AW+ +H +
Sbjct  224   ------IKEFFRLIGMFVVSDALPL--LWWLDVHGHEKAMKMTAKELDDLLEAWLKEHRQ  275

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR  G   A     + D I +MLS  ++  +  F Y   ++IK T  ++I+ G+DTT   
Sbjct  276   RRISGGIKAEG---EQDFIDVMLSLQEEGHLANFQYDADISIKSTCLALILGGTDTTAGT  332

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WA+SLL+   +++K+ +EE++ QVG ER V++SD++ L YLQA++KE+LRLYP  PLL
Sbjct  333   LTWAISLLLNNPELLKKAQEELDLQVGRERLVDESDIQNLVYLQAIIKETLRLYPAGPLL  392

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR    DC + GY +P G +  VN+WKI RDP+ W  P  F+P+RFL   A   D   +
Sbjct  393   GPREAMNDCTVAGYHVPAGTRLIVNVWKIQRDPRVWSNPSAFVPERFLTSHA-NVDVRGQ  451

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
             +FE +PFG GRRSC G ++ALQ+ HLT+AR +  F  STP +  +DM E  G+T+P+ATP
Sbjct  452   QFELIPFGSGRRSCPGASFALQLLHLTLARFLHAFELSTPLDQPVDMTESPGLTIPKATP  511

Query  178   LQLVVTPRLPPNFYGL  131
             L++++ PR+P N Y L
Sbjct  512   LEVLLKPRVPANVYAL  527



>ref|XP_008372514.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=524

 Score =   421 bits (1083),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 217/497 (44%), Positives = 312/497 (63%), Gaps = 21/497 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+  L   N  L RTL  MADK+GP+F ++ G  P  +I   +A K+CFT ++   A
Sbjct  44    IIGHLHKLGGXNP-LCRTLASMADKYGPIFTIQLGKHPALVISNYDAVKECFTKNDIAFA  102

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++ + A G +LGYNYA   FS    YWR MRK  + ELLS+ +L  +KH+++SE+++ IK
Sbjct  103   TRSKSAQGRYLGYNYAALGFSQYGTYWRNMRKMAIVELLSSRRLQTLKHVQISEVDSFIK  162

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGD-DDSTEYKE  1082
              LY       E  ++ VV + EWI  LTLN   +++AG+RY F  G    D D+  E K 
Sbjct  163   GLYEICKTKGENGQSKVV-ISEWIEHLTLNVITQMIAGKRY-FDWGKVGNDSDNEGENKR  220

Query  1081  AQEMINVFREFQYLSGMFVLQD--AFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
              +EM+   +EF  ++G  V+ D   FP     W D  G V+ MKR  K  D ++ +WI++
Sbjct  221   IREMV---KEFMCVAGKPVVSDVIGFP----DWIDLMGQVKNMKRIGKDFDSLMASWIEE  273

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H   R+  ++      + LD I +MLS I+   V G  ++ +  IK T+Q++I+ GSDTT
Sbjct  274   HKNAREEIDSR-----DKLDFIDVMLSVIEDNTVLG--HSRETIIKATSQNLILAGSDTT  326

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
              T + W LSLL+    ++K  +E I  QVGTERWVED+D+K L YLQA+VKE+LRLYP  
Sbjct  327   ATSLTWILSLLLNNRHILKHAQEXINLQVGTERWVEDTDIKDLTYLQAIVKETLRLYPPA  386

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL +P    +DC++ G+ +PKG +   NLWK+ RDP  W +P+ F P RFL  +A   D 
Sbjct  387   PLSVPHEAXEDCQVCGFHIPKGTRLFANLWKLHRDPSVWSDPEVFCPDRFLTTQA-STDV  445

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + FE++PFG GRRSC G+ +A+Q+ HLT+ RLIQGF  +TP ++ +DM EG G+T+P+
Sbjct  446   SGQHFEFIPFGSGRRSCPGLTFAMQVIHLTLGRLIQGFELATPLDMPVDMAEGLGITMPK  505

Query  187   ATPLQLVVTPRLPPNFY  137
             AT L++V+TPRLP  FY
Sbjct  506   ATSLEVVLTPRLPSQFY  522



>ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
 emb|CBI19595.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   421 bits (1082),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 218/496 (44%), Positives = 316/496 (64%), Gaps = 17/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+L RTLG MADK+GP F +R G     ++   E AK+CFT +++ +A
Sbjct  47    IIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEVAKECFTINDKALA  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P     +H+GYNYA+F F+  + +WR MRK    ELLSN +L+ +KH+R SE++  I+
Sbjct  107   TRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEILKHVRTSEVDMGIR  166

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             ELY L+V  S  P    +V ++ W+  +TLN   R+VAG+RY     GA    DS+E + 
Sbjct  167   ELYGLWVKNSSRP---LLVELNRWLEDMTLNVIVRMVAGKRYF----GAAAASDSSEARR  219

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ I+   +F  L G+FV+ DA P     W D QGH RAMK   K++D IL+ W+++H 
Sbjct  220   CQKAIS---QFFRLIGIFVVSDALPF--LWWLDLQGHERAMKTTAKELDSILEGWLEEHR  274

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +RR    +    A  + D I +MLS  ++  + GF Y  + +IK T  ++I+ GSDTT  
Sbjct  275   QRRV---SSLIKAEGEQDFIDVMLSLQEEGRLSGFQYDSETSIKSTCLALILGGSDTTAG  331

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WA+SLL+     +K+ +EE++  VG ER VE+SDVK L YLQA++KE+LRLYP  PL
Sbjct  332   TLTWAISLLLNNRHALKKAQEELDLCVGMERQVEESDVKNLVYLQAIIKETLRLYPAGPL  391

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L PR    DC + GY++P G +  VN+WK+ RDP  W  P  F P+RFLN  A   D   
Sbjct  392   LGPREALDDCTVAGYNVPAGTRLIVNIWKLQRDPSVWTNPCAFQPERFLNAHA-DVDVKG  450

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             ++FE +PFG GRRSC G+++ALQ+ HLT+ARL+  F  STP +  +DM E  G+T+P+AT
Sbjct  451   QQFELMPFGSGRRSCPGVSFALQVLHLTLARLLHAFELSTPVDQPVDMTESSGLTIPKAT  510

Query  181   PLQLVVTPRLPPNFYG  134
             PL++++TPRL    Y 
Sbjct  511   PLEVLLTPRLNSKLYA  526



>ref|XP_011101555.1| PREDICTED: cytochrome P450 CYP82D47-like [Sesamum indicum]
Length=519

 Score =   421 bits (1081),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 212/499 (42%), Positives = 311/499 (62%), Gaps = 31/499 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L+ +  I + TL E+ADK+GP+F +  G     ++   EA  +CFT +++  A
Sbjct  46    IIGHLHLLDPELNI-AHTLAELADKYGPVFTLWFGAQRAVVVSSREAVFECFTRNDKSFA  104

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P  + GEHL Y++A F FS +  YWR MRK V SE+LS  +L+ ++++R++E+ TSI 
Sbjct  105   NRPITSAGEHLVYDHASFGFS-NGPYWREMRKLVSSEVLSARRLEAMRNLRVTEIATSIG  163

Query  1258  ELYLFVTA-----SPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDST  1094
             ELYL  T       P P+K   V M  W+ ++TLN   + +AG+RY    G A       
Sbjct  164   ELYLETTTKTRGQQPLPSK---VVMSSWVEKMTLNIIVKTIAGKRYG--KGAA-------  211

Query  1093  EYKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWI  914
                E +    + REF  LSG FV  D  P+   +W D +GH+++MKR +K++D I++ W+
Sbjct  212   ---EVESFRKLIREFTVLSGEFVPSDVIPIPFLRWIDPKGHIKSMKRVSKELDVIIEKWV  268

Query  913   DQHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSD  734
             ++H++RR  G         + D I  MLSTID +F           IK T  ++I+ G D
Sbjct  269   EEHMKRRGKGEG----CTEEQDFIDAMLSTIDDKFA----IPKLTIIKATVLNVILGGFD  320

Query  733   TTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYP  554
             TT  H+ W LSLLV     M   R+EI+ +VG +RWV++SD+  L YLQA++KESLRLYP
Sbjct  321   TTSVHLTWVLSLLVNNKHAMNLARQEIDDKVGNQRWVQESDINNLPYLQAIIKESLRLYP  380

Query  553   TVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGA  374
              +PL +P    +DC +  Y +PKG    VN+WK+  D +FWPEP++FMP+RFL       
Sbjct  381   PLPLSIPHQAVEDCHLSNYLIPKGTLLFVNIWKLHHDARFWPEPNRFMPERFLTGHT-QV  439

Query  373   DNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTL  194
             D   +++EY+PFG GRRSC G  +A+Q++ LT+ARLIQGF+F+T GN  +DM EG G+T+
Sbjct  440   DVMGQQYEYIPFGTGRRSCPGTTFAMQVTSLTVARLIQGFDFATEGNEAVDMAEGIGITM  499

Query  193   PRATPLQLVVTPRLPPNFY  137
             PR  PL+++VTPRLP   Y
Sbjct  500   PRKNPLEVLVTPRLPSQLY  518



>ref|XP_009761500.1| PREDICTED: cytochrome P450 82C2-like [Nicotiana sylvestris]
Length=555

 Score =   421 bits (1082),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 213/515 (41%), Positives = 325/515 (63%), Gaps = 32/515 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQI-LSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDV  1442
             +IGH+   +  + I LSR L  +A+K+GP+F  R G+  + ++   +A +DC   +++  
Sbjct  50    VIGHLLQFSGADDIPLSRKLATLAEKYGPVFTFRLGLPRVLVVSSYDAVRDCLNANDKAF  109

Query  1441  ASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSI  1262
             A++P    GE++GYN AM   SS   YWR +RK V+ E+LS+ +L+K+K++R+SEL+TSI
Sbjct  110   AARPASLAGEYIGYNNAMLFLSSYGPYWRKIRKIVLQEVLSSSRLEKLKNVRVSELQTSI  169

Query  1261  KELY-LF---------------VTASPEPNKAAVVA----MDEWIAQLTLNTSCRIVAGR  1142
             KEL+ LF               +T    P     V     +  WI +LTL+   +++AG+
Sbjct  170   KELFSLFPVTGDHSSVTGDHSSITGDNLPVTGDYVPVKLNLTNWIEKLTLSLIVKMIAGK  229

Query  1141  RYKFKVGGAIGDDDSTEYKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRA  962
              Y      A  ++++  +K+A       ++F Y+S  FVL DAFP+ LFKW DFQGHV+ 
Sbjct  230   SYGRLNEKAEDEEEAERFKKA------LKDFMYISMEFVLWDAFPIPLFKWIDFQGHVKF  283

Query  961   MKRNNKKVDKILQAWIDQHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQ  782
             MKR  K +D +LQ W+D+H+++R+  +     AGN+ D I +MLS +  E      YT +
Sbjct  284   MKRTFKDIDCVLQNWLDEHVKKREGVDV---VAGNEQDFIDVMLSMMSNEDFAD-SYTRE  339

Query  781   MAIKGTTQSMIIDGSDTTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKK  602
               IK T  SM++D SDTT  H+ W +++L+ + DVMK+ +EE++ ++   RWVE+SD+K 
Sbjct  340   TTIKATALSMVLDASDTTAIHLNWVMAILLNHRDVMKKVQEELDTKISRNRWVEESDIKN  399

Query  601   LEYLQAVVKESLRLYPTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEP  422
             L Y QAV+KE+LRLYP  PLL+P  + +DC + GY +PKG +  VN  K+ RDP+ W  P
Sbjct  400   LVYFQAVIKETLRLYPPAPLLVPHESVEDCIVHGYHIPKGTRLWVNTMKLQRDPEIWSNP  459

Query  421   DKFMPKRFLNREAGGADNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFST  242
             D F P+RFL  +A G D   +++E++PFG GRRSC G+ YA Q++HL IA L+QGF+FST
Sbjct  460   DTFDPERFLTSQA-GFDVRGQQYEFIPFGSGRRSCPGITYATQVTHLAIAHLLQGFDFST  518

Query  241   PGNVELDMEEGFGVTLPRATPLQLVVTPRLPPNFY  137
               N  LDM+EG G+T+ +  P+++++ PRLP   Y
Sbjct  519   LLNEPLDMKEGLGMTMRKVNPIEVLIMPRLPSVLY  553



>ref|XP_008372515.1| PREDICTED: cytochrome P450 82C4-like [Malus domestica]
Length=524

 Score =   419 bits (1076),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 219/496 (44%), Positives = 315/496 (64%), Gaps = 19/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+  L  +N  L RTL  MADK+GP+F +R G  P  +I   +A K+CFT ++   A
Sbjct  44    IIGHLHKLGGKNP-LCRTLASMADKYGPIFTIRLGKHPALVISNHDAVKECFTKNDIVFA  102

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P+ A G +LGYNYA F FS    YWR MRK V++ELLS+ +L  +KH+++SE+++ IK
Sbjct  103   ARPKSAHGRYLGYNYAGFGFSPYGTYWRNMRKMVIAELLSSRRLQTLKHVQISEVDSFIK  162

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY  +  +   N  + V + EWI  LTL    +++AG+RY F   G +G+D   E  E 
Sbjct  163   GLY-EICKTKGXNGQSKVVISEWIEHLTLXVITQMIAGKRY-FD-WGKVGNDSDNE-GEN  218

Query  1078  QEMINVFREFQYLSGMFVLQD--AFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             + +  + +EF  +SGM V+ D   +P     W DF G V+ MKR  K++D +  +WI++H
Sbjct  219   KRIREIVKEFMLVSGMPVISDMIGYP----DWIDFLGQVKNMKRIGKELDALTASWIEEH  274

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
                R+        + + LD I +MLS I+   V G  +T +  IK T+Q++II GSDTT 
Sbjct  275   NNARK-----EIDSRDKLDFIDVMLSVIEDNTVLG--HTRETIIKATSQNLIIAGSDTTA  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
               + W +SLL+    V+K  +EEI  +VGTERWVED+D++ L  LQA+VKE+LRLYP  P
Sbjct  328   ISLKWIISLLLNNRHVLKHAQEEINLKVGTERWVEDTDIENLTXLQAIVKETLRLYPPGP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             L +P    +DC++ G+ + KG +  VNLWK+ RDP  W +P+ F P RFL  +A   D  
Sbjct  388   LSVPHEAMEDCQVCGFHIXKGTRLFVNLWKLHRDPTMWSDPEMFYPDRFLTTQA-SIDAS  446

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
                FE++PFG GRRSC G+ +A+Q+ HLT+ RLIQGF  +TP ++ +DM EG GVTLP+A
Sbjct  447   GNHFEFIPFGSGRRSCPGLTFAMQVIHLTLGRLIQGFELATPLDMPVDMTEGLGVTLPKA  506

Query  184   TPLQLVVTPRLPPNFY  137
             T L++V+TPRLP   Y
Sbjct  507   TSLEVVLTPRLPIELY  522



>gb|KFK29809.1| hypothetical protein AALP_AA7G181800 [Arabis alpina]
Length=524

 Score =   418 bits (1075),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 207/496 (42%), Positives = 320/496 (65%), Gaps = 15/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  ++Q+L RTLGEMAD +GP   +R G +   ++   E AKDCFTT+++ +A
Sbjct  41    IIGHLHLLGGKDQLLYRTLGEMADHYGPAMSLRLGSSEAFVVSSFEVAKDCFTTNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYN+A+F F+  +++WR MRK    ELLSN +L  +KH+R+SE+   ++
Sbjct  101   SRPMTAAAKHMGYNFAVFGFAPYSSFWREMRKIATVELLSNRRLQMLKHVRVSEIAMGVQ  160

Query  1258  ELY-LFVT-ASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W+  +TLN   R+VAG+RY F  G ++  +D+ E +
Sbjct  161   DLYSLWVKKGGSEP---VMVDLKTWLEDMTLNMIVRMVAGKRY-FGCG-SVSSEDTDEAR  215

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             + ++ I    +F +L G+F + DAFP     WFD QGH + MKR   ++D IL+ WI+ H
Sbjct  216   QCKKAIA---KFFHLIGIFTVSDAFPT--LTWFDLQGHEKKMKRTGSELDVILERWIENH  270

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              ++R   N       ND D I +MLS  ++  +    Y    +IK T  ++I+ GSDTT 
Sbjct  271   KQQR---NDSGTKENNDSDFIDVMLSLAEQGKLSHLQYDADTSIKSTCLALILGGSDTTA  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             + + WA++LL+   +++K+ ++EI+ QVGT+R VEDSD++ L YLQA++KE+LRLYP  P
Sbjct  328   STLTWAIALLLNNKEMLKKAQDEIDLQVGTDRNVEDSDIENLVYLQAIIKETLRLYPAGP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL PR   ++C + GY++ +G +  VN+WKI RDPK + EP++F P+RF+  EA   D  
Sbjct  388   LLGPREALENCTVAGYNVSRGKRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKEFDVR  447

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              K FE +PFG GRRSC G + ALQ+ HL +AR +  F   T  ++ +DM E  G+T+P+A
Sbjct  448   GKNFELIPFGSGRRSCPGSSLALQVLHLGLARFLHSFEVKTILDLPVDMSESPGLTIPKA  507

Query  184   TPLQLVVTPRLPPNFY  137
             TP +++++PRL    +
Sbjct  508   TPFEVLISPRLEKQLF  523



>ref|XP_010447469.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=527

 Score =   418 bits (1074),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 205/496 (41%), Positives = 316/496 (64%), Gaps = 14/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  + Q+L RTLG +AD++GP   +R G +   ++   E AKDCFT +++ +A
Sbjct  43    IIGHLHLLVGKEQLLYRTLGRLADRYGPTMSLRLGSSEAFVVSSFEVAKDCFTVNDKALA  102

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYNYA+F F+  NA+WR MRK    ELLSN +L  +KH+ +SE+   +K
Sbjct  103   SRPMTAAAKHMGYNYAVFGFAPYNAFWREMRKIATIELLSNRRLQMLKHVSVSEISMGVK  162

Query  1258  ELY-LFV-TASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W+  +TLN   R+VAG+RY    GG +G + S + +
Sbjct  163   DLYSLWVKNGGSEP---VMVDLRRWLDNMTLNMIVRMVAGKRY---FGGVVGSESSEDTE  216

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             E ++      +F +L G+F + DAFP    +WFDFQGH + MK+   ++D IL+ WID H
Sbjct  217   EGRQCKTAISKFFHLIGIFTVSDAFPS--LRWFDFQGHEKEMKQTGSELDVILEKWIDNH  274

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              + R++          D D IH+MLS  ++  +    Y   ++IK T  ++I+ GS+TT 
Sbjct  275   RQERKVSGTEEI----DSDFIHVMLSLAEQGKLSHLQYDANISIKSTCLALILGGSETTS  330

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             + + WA++LL+   +++K+ ++EI+  VG +R VE SD+  L YLQAVVKE+LRLYP  P
Sbjct  331   STLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEVSDINNLVYLQAVVKETLRLYPAGP  390

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL PR   +DC + GY++ +G +  VN+WKI RDPK + EP++F P+RF+  EA   D  
Sbjct  391   LLGPREAMEDCTVAGYNVTRGTRLIVNVWKIQRDPKVYKEPNEFRPERFITGEAKEFDVR  450

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRRSC G + A+Q+ HL +AR +  F   T  ++ +DM E  G+T+P+A
Sbjct  451   GQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPGLTIPKA  510

Query  184   TPLQLVVTPRLPPNFY  137
             TPL+++++PRL  + +
Sbjct  511   TPLEVLISPRLNEHLF  526



>ref|XP_009348374.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   417 bits (1073),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 218/496 (44%), Positives = 310/496 (63%), Gaps = 19/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+  L  +   L RTL  MADK+GP+F +R G  P  +I   +A K+CFT ++   A
Sbjct  44    IIGHLHKLGGKKP-LCRTLASMADKYGPIFTIRLGKHPALVINNYDAVKECFTKNDIAFA  102

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+ + A G +LGYNYA F F+    YWR MRK V  ELLS+ +L  +KH+++ E+++ IK
Sbjct  103   SRSKSAQGRYLGYNYAGFGFAPYGTYWRNMRKMVTVELLSSRRLQTLKHVQICEVDSFIK  162

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY       E  ++ VV + EWI  LTLN   +++AG+RY F +G  +G+D   E  E 
Sbjct  163   GLYEICKTKGENGQSKVV-ISEWIEHLTLNVITQMIAGKRY-FDLG-TVGNDSDNE-GEN  218

Query  1078  QEMINVFREFQYLSGMFVLQD--AFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             + +  + +EF  ++G   + D   FP     W D  G V+ MKR  K  D ++  WI++H
Sbjct  219   KRIRGMVKEFMCVAGKPAVSDVIGFP----HWIDLMGQVKNMKRIGKDFDSLMAGWIEEH  274

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
                R+  ++      + LD I +MLS I+   V G  +T +  IK T+Q++I+ GSDTT 
Sbjct  275   KNARKEIDSR-----DKLDFIDVMLSVIEDNTVLG--HTRETIIKATSQTLILAGSDTTA  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             T + W LSLL+    V+K  +EEI  QVGTERWVED+D+K L YLQA+VKE+LRLYP  P
Sbjct  328   TSLTWILSLLLNNRHVLKHAQEEINLQVGTERWVEDTDIKDLTYLQAIVKETLRLYPPAP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             L       +DC++ G+ +PKG +   NLWK+ RDP  W +P+ F P RFL  +A   D  
Sbjct  388   LSTSHEAMEDCQVCGFYIPKGTRLFTNLWKLHRDPSVWSDPEVFCPDRFLTTQA-SIDVS  446

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE++PFG GRRSC G+ +A+Q+ HLT+ RLIQGF  +TP ++ +DM EG GVT+P+A
Sbjct  447   GQHFEFIPFGSGRRSCPGLTFAMQVIHLTLGRLIQGFELATPLDMPVDMAEGLGVTMPKA  506

Query  184   TPLQLVVTPRLPPNFY  137
             T L++V+TPRLP  FY
Sbjct  507   TSLEVVLTPRLPCQFY  522



>ref|XP_010069627.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW58035.1| hypothetical protein EUGRSUZ_H00764 [Eucalyptus grandis]
Length=539

 Score =   417 bits (1073),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 205/497 (41%), Positives = 314/497 (63%), Gaps = 11/497 (2%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  +   L+RTL  MADK GP+F +  G+ P  +I   EA ++CFTTH++++A
Sbjct  45    IIGHLHLLRGETP-LARTLAAMADKQGPMFRIWLGVHPTTVISSREAVRECFTTHDKELA  103

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+   G HLGY + +F F+     WR MRK  + ELL   +LD +KH++ SE+++ +K
Sbjct  104   SRPKSMAGVHLGYGHTVFVFAEYGDLWREMRKITMLELLCTRRLDNLKHVQESEIDSFVK  163

Query  1258  ELYLFV---TASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEY  1088
             +L       T   +   +  V + E +  LTLN   R++A +RY  ++  + G   ST+Y
Sbjct  164   DLRTLCMTNTDDAQNGSSKGVVISELLELLTLNIMTRMLASKRYFGQLSASTGS--STDY  221

Query  1087  KEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
              EA  +  + ++F YL G+ V+ D  P    +W D  G V+ MKR  +++D+I+  W+++
Sbjct  222   DEASHLRELIKDFMYLFGLPVVSDFLPFP--EWTDCTGTVKTMKRVARELDEIVGKWVEE  279

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H  +R   +    A     D I +MLS I ++    F +  +  IK T  + I+ GSDTT
Sbjct  280   HKLKR--CDHRGEAIDVREDFIDVMLSMIGEDSFAKFGHPPERLIKATVVNNIVAGSDTT  337

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                + W LSLL+ +  ++KR +EE++  VG ++W++DSD++ L YLQA+VKE+LRLYPT 
Sbjct  338   YLTLTWVLSLLLNHKHILKRAQEEMDLMVGKDKWIQDSDIENLPYLQAIVKETLRLYPTA  397

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL+ P     DC + GY +PKG +  VN+WK+ RDP+ W  P+KF+P+RFL   + G D 
Sbjct  398   PLVAPHEARADCTVSGYRIPKGTRIIVNVWKLHRDPQVWSNPEKFLPERFLTNHS-GMDA  456

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + FE++PFG GRRSC G   AL+++HLT+ARL+QGF+ +TP N  +DM EG GVTLP+
Sbjct  457   LGQHFEFIPFGSGRRSCPGAMLALRVTHLTLARLLQGFDLATPSNKPVDMTEGLGVTLPK  516

Query  187   ATPLQLVVTPRLPPNFY  137
             A+PL++++TPRLPP  Y
Sbjct  517   ASPLRVILTPRLPPTLY  533



>gb|KCW58034.1| hypothetical protein EUGRSUZ_H00762, partial [Eucalyptus grandis]
Length=529

 Score =   416 bits (1069),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 208/491 (42%), Positives = 314/491 (64%), Gaps = 10/491 (2%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGHI +L  +   L+RTL  MADK GP+F +R G+ P  +I   EA ++CFTTH++D+A
Sbjct  45    IIGHIHLLGGETP-LARTLAAMADKQGPMFRIRLGVHPATIISSREAVRECFTTHDKDLA  103

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+   G HLGY YA F F     +WR MRK  + ELLS  +LD +KH++ SE++T +K
Sbjct  104   SRPKSKAGIHLGYGYAGFGFVEYGDFWREMRKITMLELLSTRRLDNLKHVQASEIDTFVK  163

Query  1258  ELYLFV---TASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEY  1088
             +L+      +   +   + VV + + +  LTLN   R++A +RY F +  A     + + 
Sbjct  164   DLHALCRTNSIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRY-FGLSSASTGSSADDD  222

Query  1087  KEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             +EA  +  V +EF Y+SG   + D  P     W D  G V+ MKR  +++D+I+  W+++
Sbjct  223   EEASHLRRVIKEFMYISGFPAVSDLVPFT--GWTDCVGTVKTMKRVARELDEIVGKWVEE  280

Query  907   HIERRQLGNAPAPAAGN-DLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDT  731
             H  +R+ G+      G+   D I +MLS I ++ +  F ++ +  IK T  ++I+ GSD+
Sbjct  281   HKLKRE-GDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETLIKATIVNIIVAGSDS  339

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
             T  ++ W LSLL+ +  V+KR +EEI+ +VG +RWV+DSD++ L YLQA+VKE+LRLYP 
Sbjct  340   TSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDRWVQDSDIENLLYLQAIVKETLRLYPP  399

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PLL+P     DC + GY +PKG +  VN WK+ RDP+ W EP+KF+P+RFL   + G D
Sbjct  400   GPLLVPHEARADCNVRGYLIPKGTRIFVNAWKLHRDPQVWSEPEKFLPERFLTNHS-GVD  458

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                + FE++PFG GRR C G A+AL+ +HLT+ARL+QGF+ +T  +  +DM EG GV LP
Sbjct  459   ASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLATSLDELVDMTEGLGVNLP  518

Query  190   RATPLQLVVTP  158
             +ATPL++V+ P
Sbjct  519   KATPLRVVLNP  529



>emb|CDP15065.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   416 bits (1069),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 207/496 (42%), Positives = 312/496 (63%), Gaps = 20/496 (4%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             IGH+  L S N  ++R LG MADK+GP+F +R GM    ++   EA K+CFTT+++  + 
Sbjct  48    IGHLLQL-SPNVPIARNLGAMADKYGPVFSLRLGMRQTLVVSSWEAVKECFTTNDKAFSY  106

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  +  E++GYNYA   F+    YWR +RK V+ ELLSN +L+++KH+R+SE+E +IK 
Sbjct  107   RPPSSFNEYVGYNYAAIGFAPYGPYWREIRKIVMLELLSNRRLERLKHVRISEIENNIKV  166

Query  1255  LYL-FVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             L+  + ++S +P   A V M +W   L LN   R ++G RY       +G   + +++  
Sbjct  167   LFDGWKSSSNDP--PAKVNMGKWFEDLFLNIMVRKISGTRY---TDSEVGSKRNAQFRR-  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                  V +EF +  G FV+ D  P  L KW D QGH++++KR +K++D I+Q WID+H E
Sbjct  221   -----VVKEFVHFLGQFVVSDVIPFPLLKWIDMQGHLKSIKRVSKELDSIIQIWIDEHNE  275

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR      +       D I  +LS    E++  F ++ +  IK T  S++I   +TT  H
Sbjct  276   RRM---KISEQGDEQQDFIDALLSVTKDEYL--FGHSRETVIKATLMSLVIAAFETTSIH  330

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + W LSLL+    VM++ +EEI++ VG ERW E+SD+  L YLQA+VKES+RLYP  PL 
Sbjct  331   LTWTLSLLLNNKHVMRQAQEEIDSNVGKERWAEESDINNLVYLQAIVKESIRLYPPAPLS  390

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +PR   +DC + GY +  G Q  VN+WK+ RDP+ W EPD+F+P+RFLN E   +    +
Sbjct  391   LPRQAMEDCNVSGYRISMGTQLFVNVWKLQRDPRIWSEPDQFLPERFLNGEVDFSGKNFE  450

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              F + PFG GRRSC G+  A Q++HLT+ARL+QGF+ +TP ++ +DM E   +++ +ATP
Sbjct  451   -FSFTPFGSGRRSCPGIPLATQVTHLTLARLLQGFDLTTPSDLPVDMTEDTSISMGKATP  509

Query  178   LQLVVTPRLPP-NFYG  134
             L++V+ PRLP  + YG
Sbjct  510   LEVVILPRLPNHDLYG  525



>ref|XP_002869304.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45563.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   416 bits (1068),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 207/496 (42%), Positives = 320/496 (65%), Gaps = 15/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  +  +L RTLG+MAD +GP   +R G +   ++   E AKDCFT +++ +A
Sbjct  41    IIGHLHLLGGKEHLLYRTLGKMADHYGPAMSLRLGSSEAFVVSSFEVAKDCFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYN+A+F F+  +A+WR MRK    ELLSN +L  +KH+R+SE+   +K
Sbjct  101   SRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEISMGVK  160

Query  1258  ELY-LFVT-ASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W+  +TLN   R+VAG+RY F  GG+   +D+ E  
Sbjct  161   DLYSLWVKKGGTEP---VMVDLKSWLEDMTLNMIVRMVAGKRY-FGGGGSQSSEDTEEAM  216

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             + ++ I    +F +L G+F + DAFP RL  WFD QGH + MK+   ++D IL+ WI+ H
Sbjct  217   QCKKAIA---KFFHLIGIFTVSDAFP-RL-GWFDLQGHEKEMKQTGSELDVILERWIENH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              ++RQ+         ND D I +MLS  ++  +    Y    +IK T  ++I+ GSDT+ 
Sbjct  272   RQQRQVSGTKE----NDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTSA  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             + + WA+SLL+   +++K+ ++EI+  VGT++ VEDSD++ L YLQA++KE+LRLYP  P
Sbjct  328   STLTWAISLLLNNKEMLKKAQDEIDLHVGTDKNVEDSDIENLVYLQAIIKETLRLYPAGP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL PR   +DC++ GY++P G +  VN+WKI RDPK + EP++F P+RF+  EA   D  
Sbjct  388   LLGPREAMEDCRVAGYNVPCGTRLIVNVWKIQRDPKVYTEPNEFRPERFITGEAKEFDVR  447

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRRSC G + A+Q+ HL +AR +  F   T  ++ +DM E  G+T+P+A
Sbjct  448   GQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEAKTVLDLPVDMSESPGLTIPKA  507

Query  184   TPLQLVVTPRLPPNFY  137
             TPL+++++PRL    +
Sbjct  508   TPLEVLISPRLNEELF  523



>ref|XP_010069621.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Eucalyptus 
grandis]
Length=542

 Score =   415 bits (1066),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 208/501 (42%), Positives = 316/501 (63%), Gaps = 16/501 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  +   L+RTL  MADK GP+F +R G+ P  +I   EA + CFTTH++D+A
Sbjct  45    IIGHLHLLGGETP-LARTLAAMADKQGPMFRIRLGVHPATIISSQEAVRKCFTTHDKDLA  103

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+  VG H GY YA F F+     WR MRK  + ELLS  +LD +KH++ SE++T +K
Sbjct  104   SRPKSKVGIHFGYGYAGFGFAEYGDLWREMRKITMLELLSTRRLDNLKHVQASEIDTFVK  163

Query  1258  ELYLFVTASP---EPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIG---DDDS  1097
             +L+     +    +   + VV + + +  LTLN   R++A +RY   +  + G   DDD 
Sbjct  164   DLHALCRTNAIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRYFGLLSASTGSSTDDD-  222

Query  1096  TEYKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAW  917
                +EA  +  V +EF Y+SG   + +  P     W D  G V+ MKR  +++D+I+  W
Sbjct  223   ---EEASHLRKVIKEFMYISGFPTVSELVPFT--GWTDCVGTVKTMKRVAREMDEIVGKW  277

Query  916   IDQHIERRQLGNAPAPAAGN-DLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDG  740
             +++H  +R+ G+      G+   D I +MLS I ++ +  F ++ +  IK T  ++I+ G
Sbjct  278   VEEHKLKRE-GDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETLIKATVVNIIVAG  336

Query  739   SDTTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRL  560
             SDTT  ++ W LSLL+ +  V+KR +EEI+ +VG ++WV+DSD+  L YLQA+VKE+LRL
Sbjct  337   SDTTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDKWVQDSDIGSLHYLQAIVKETLRL  396

Query  559   YPTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAG  380
             YP  PL +P     DC + GY +PKG +  VN+WK+ RDP+ W +P+KF+P+RFL   + 
Sbjct  397   YPPGPLSIPHEARADCNVRGYLIPKGTRIFVNVWKLHRDPQVWSDPEKFLPERFLTNHS-  455

Query  379   GADNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGV  200
             G D   + FE++PFG GRR C G A+AL+ +HLT+ARL+QGF+ +   +  +DM EG G+
Sbjct  456   GVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLAISSDELVDMTEGIGL  515

Query  199   TLPRATPLQLVVTPRLPPNFY  137
              LP+ATPL++V+ PRLP   Y
Sbjct  516   NLPKATPLRVVLNPRLPSMLY  536



>ref|XP_008235431.1| PREDICTED: cytochrome P450 82C4-like [Prunus mume]
Length=517

 Score =   414 bits (1063),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 208/500 (42%), Positives = 314/500 (63%), Gaps = 35/500 (7%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+  L      + +TL  MADK+GP+F +  G  P+ +I   +A K CFT ++   A
Sbjct  44    IIGHLHKLRGP---IFKTLAAMADKYGPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P  + G++LGYNYA F FS    YWR MRK V+ ELLS+ +L  +KH+++SE++  IK
Sbjct  101   TRPRSSHGKYLGYNYAGFGFSPYGPYWRDMRKMVMVELLSSRRLQNLKHVQISEVDAFIK  160

Query  1258  ELYLFVTASPE----PNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTE  1091
              L+L           P K   V + +WI  LTLN   R++AG+RY           DS+ 
Sbjct  161   GLFLLCKTEEHNGLNPTK---VVISDWIEHLTLNVITRMIAGKRYF----------DSSY  207

Query  1090  YKEAQEMINVFREFQYLSGMFVLQD--AFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAW  917
               + Q    + +EF Y+SG  V  D   FP     W DF+G ++AMKR  K++D ++ +W
Sbjct  208   EGDEQRFGKIVKEFMYVSGNPVASDVIGFP----SWIDFKGQIKAMKRIMKELDSVMGSW  263

Query  916   IDQHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGS  737
             +++H  ++Q  +       +D D I +M+S I+     G  YT +  IK T+ ++I+ GS
Sbjct  264   VEEHYAKKQTDSR------DDHDFIDVMISVIEDNSTLG--YTRETIIKATSLNLILAGS  315

Query  736   DTTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLY  557
             +TT  +++W LSLL+    V+K  +EE++ +VG +RW+ED+D++ L YLQA+VKE+LRLY
Sbjct  316   ETTAINLIWILSLLLNNRHVLKLAQEELDLKVGRDRWIEDTDIENLPYLQAMVKETLRLY  375

Query  556   PTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGG  377
             P  PL +P    +DC++ G+D+PKG +  VNLWK+ RDP  WP+P+ F P+RFL     G
Sbjct  376   PPGPLSVPHEAMQDCQVCGFDIPKGTRLFVNLWKLHRDPSLWPDPEVFCPERFLTTHV-G  434

Query  376   ADNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVT  197
              D   K FE++PFG GRRSC G  +ALQ++HLT+ RL+QGF  +TP ++ +D+ EG G+T
Sbjct  435   IDASGKHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFELATPLDMPVDLTEGLGIT  494

Query  196   LPRATPLQLVVTPRLPPNFY  137
             +P+AT L++++TPRLP  FY
Sbjct  495   MPKATSLEVILTPRLPFEFY  514



>ref|XP_004241385.1| PREDICTED: cytochrome P450 82C2-like [Solanum lycopersicum]
Length=543

 Score =   414 bits (1065),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 203/507 (40%), Positives = 320/507 (63%), Gaps = 26/507 (5%)
 Frame = -1

Query  1618  IIGHIP-----ILNSQNQI-------LSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAA  1475
             IIGH+P      L+ +N+I       L+ TLG +ADK+GP+F VR GM PIA++   EA 
Sbjct  50    IIGHLPQILSNTLDGRNRINKDGEIPLAHTLGALADKYGPVFTVRQGMFPIAVVSSYEAI  109

Query  1474  KDCFTTHERDVASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVK  1295
             K+CFTT ++++A++      ++LGY++A  +F++   YWR++RK VV+ LLS+  L+++K
Sbjct  110   KECFTTQDKNLANRVATCSCKYLGYDHANLTFANYGPYWRMVRKLVVNNLLSSKSLERLK  169

Query  1294  HIRMSELETSIKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGA  1115
             H+R+SE+E+SIKELY    A+   N    V +  W   + LN + +++ G+RY       
Sbjct  170   HVRISEVESSIKELYTLFVANEAKNVPTKVDIGHWFDDMMLNITVKMIGGKRYSQVNNKE  229

Query  1114  IGDDDSTEYKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVD  935
                +++  +++A      F E  Y   +  ++DAFP  L +W D QG+++ MKR   ++D
Sbjct  230   EEKEEAERFRKA------FNETMYYIAIVGIEDAFPFPLLQWLDLQGNIKVMKRIADEMD  283

Query  934   KILQAWIDQHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQS  755
              ILQ W+D H  +R+        + +D DLI +ML+ +DK+  + + Y+ +  IK T  +
Sbjct  284   VILQRWLDDHTNKRKNNE-----SNDDQDLIDIMLTELDKDDFQ-YGYSRETIIKATMLT  337

Query  754   MIIDGSDTTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVK  575
             ++ D + TT  H++W ++ L+    V+++  EEI+ +VG +RWVEDSD+K L Y QA +K
Sbjct  338   IVSDATHTTAVHLIWIIACLLNNKHVLEKVHEEIDTKVGKDRWVEDSDIKNLMYFQATIK  397

Query  574   ESLRLYPTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFL  395
             E LRLYP  P+L+    + DC++ GY + KG +  VN+WK+ +D KFWPEP+KF+P+RFL
Sbjct  398   EVLRLYPPSPMLVHEALA-DCQVLGYHISKGTRLFVNVWKLQKDSKFWPEPEKFLPERFL  456

Query  394   NREAGGADNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDME  215
               +A   D   K  E++PFG GRRSC G+  A+Q+++L+IARL+Q F+F  P N  LDM 
Sbjct  457   TTKA-KVDVYGKDLEFIPFGSGRRSCPGITMAMQVTYLSIARLLQAFDFDLPNNDPLDMT  515

Query  214   EGFGVTLPRATPLQLVVTPRLPPNFYG  134
             EG G T  +  PL++VV PR+ P +YG
Sbjct  516   EGPGFTAVKKVPLEVVVKPRMLPMYYG  542



>ref|XP_002300088.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
 gb|EEE84893.2| hypothetical protein POPTR_0001s34230g [Populus trichocarpa]
Length=527

 Score =   412 bits (1060),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 206/495 (42%), Positives = 309/495 (62%), Gaps = 18/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L +Q + L+RTL  MADK+GP+F +R G  P  ++  LEA K+CFTTH+R ++
Sbjct  47    LIGHLHLLGAQ-KTLARTLAAMADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTHDRILS  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  + GEHL YNYA F F++   +WR MRK V  +LLS+ +L  ++H+++SE+ T I 
Sbjct  106   SRPRSSHGEHLSYNYAAFGFNNSGPFWREMRKIVTIQLLSSHRLKSLRHVQVSEVNTLIN  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LYL   ++ +   +  + + E   ++T+N   R++AG+RY F    A  +D      E 
Sbjct  166   DLYLLSKSNKQ--GSTKIDISECFERMTINMITRMIAGKRY-FSSTEAEKED------EG  216

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFD-FQGHVRAMKRNNKKVDKILQAWIDQHI  902
             + +  + +EF Y+SG+FV  D  P     W + F G V+ MKR ++++D ++++WI +H 
Sbjct  217   KRIGKLMKEFMYISGVFVPSDVIPF--LGWMNNFLGSVKTMKRLSRELDSLMESWIQEHK  274

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
              +R L +        D D I +MLS +D      F Y+ +  IK T  ++II G+DTT  
Sbjct  275   LKR-LESTENTNKMEDDDFIDVMLSLLDDSM---FGYSRETIIKATAMTLIIAGADTTSI  330

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + W LS L+     ++  +EE++ +VG ERW EDSD+  L Y+QA++KE+LRLYP  PL
Sbjct  331   TLTWILSNLLNNRRSLQLAQEELDLKVGRERWAEDSDIGNLVYIQAIIKETLRLYPPGPL  390

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
              +P   +KD  + GY +PKG +   NLWK+ RDP  W  PD++MP+RFL   A   D   
Sbjct  391   SVPHEATKDFCVAGYHIPKGTRLFANLWKLHRDPNLWSNPDEYMPERFLTDHA-NVDVLG  449

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
               FE +PFG GRRSC G+ +ALQ+ HLT ARL+QGF+  TP    +DM EG  +TLP+AT
Sbjct  450   HHFELIPFGSGRRSCPGITFALQVLHLTFARLLQGFDMKTPTGESVDMTEGVAITLPKAT  509

Query  181   PLQLVVTPRLPPNFY  137
             PL++ +TPRL P  Y
Sbjct  510   PLEIQITPRLSPELY  524



>ref|XP_010436299.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   412 bits (1058),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 204/496 (41%), Positives = 313/496 (63%), Gaps = 15/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  + Q+L RTLG+MAD +G    ++ G +   ++   E AK+CFT +++ +A
Sbjct  41    IIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYN+A+F F+  +A+WR MRK    ELLSN +L  +KH+R+SE+   +K
Sbjct  101   SRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEISMGVK  160

Query  1258  ELY-LFV-TASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W+  +TLN   R+VAG+RY    GGA G + S + +
Sbjct  161   DLYSLWVKNGGSEP---VIVDLKSWLEDMTLNMIVRMVAGKRY---FGGA-GSESSEDTE  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EA +      +F +L G+F + DAFP    +WFD QGH + MK+   ++D IL+ WI+ H
Sbjct  214   EASQCKRAISKFFHLIGIFTVSDAFPA--LRWFDLQGHEKEMKQTGSELDVILERWIENH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              + R++         ND D I +MLS   +  +    Y    +IK T  ++I+ GSDTT 
Sbjct  272   RQERKVSGTKE----NDSDFIDVMLSLAKQGKLSHLQYDATTSIKSTCLALILGGSDTTA  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             + + WA++LL+   +++K  ++EI+  VG +R VEDSD+K L YLQA++KE+LRLYP  P
Sbjct  328   STLTWAIALLLNNKEMLKNAQDEIDLHVGRDRNVEDSDIKNLVYLQAIIKETLRLYPAGP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL PR   +DC + GY++  G +  VN+WKI RDPK + EP++F P+RF+  EA   D  
Sbjct  388   LLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYVEPNEFRPERFITGEAKEFDVR  447

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRRSC G + A+Q+ HL +AR +  F   T  ++ +DM E  G+T+P+A
Sbjct  448   GQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESPGLTIPKA  507

Query  184   TPLQLVVTPRLPPNFY  137
             TPL+++++PRL   F+
Sbjct  508   TPLEVLISPRLNEQFF  523



>ref|XP_004236938.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=530

 Score =   412 bits (1058),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 198/498 (40%), Positives = 315/498 (63%), Gaps = 26/498 (5%)
 Frame = -1

Query  1618  IIGHIPILNS-QNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDV  1442
             +IGH+   N   N+ L+R L ++ADK+GP+F  R G+  + +I   +A K+C+T ++   
Sbjct  51    VIGHLFYFNDGDNRPLARKLSDLADKYGPVFTFRLGLHRMLVISSYDAVKECYTKNDAVF  110

Query  1441  ASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSI  1262
             A++P    GE++GYN A+   ++  +YWR +RK ++ E+LSN +L+K+KH+++ ++   I
Sbjct  111   ANRPACLYGEYIGYNNAILFLANYGSYWRNIRKLIIQEVLSNSRLEKLKHVKIEKIRNEI  170

Query  1261  KELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             K L   +  S      +V+ + +W+ ++      +++AG+ Y+    G  GD++   ++E
Sbjct  171   KNLNSRIQNS---EVKSVINLTDWLEKMNFGLIVKMIAGKNYE---SGGDGDEEVERFRE  224

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
                    F++F  LS  FVL DAFP+RLFKW DFQGHV+ MK   K +D I Q W+D+H+
Sbjct  225   T------FKKFLVLSMEFVLWDAFPIRLFKWIDFQGHVKLMKETFKDIDSISQRWLDEHV  278

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTI-DKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             +R    N        + D I +MLS + D+   +G  ++   AIK T  SM++D +DT  
Sbjct  279   KRNTEVNEDEKY---ERDFIDVMLSKMSDERLHQG--HSRDNAIKATIFSMVMDAADTVP  333

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+    V+K+ +EEI+ +VG  RW++D+D+K L YLQA+VKE+LRLYP  P
Sbjct  334   HHINWGMTLLINNQHVLKKAQEEIDTKVGKARWIDDNDIKNLVYLQAIVKETLRLYPPSP  393

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAG--GAD  371
             LL+P   +++C + GY +PKG +   N+ K+  DPK WP P++F P RFL+ +    G D
Sbjct  394   LLVPHENTEECVVSGYRIPKGTRLYANVMKLQLDPKVWPNPEQFNPDRFLSTDINFRGQD  453

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                  +E++PFG GRRSC G++YALQ+ HLTI  LIQGFN+ TP N  LD++EG G+T+P
Sbjct  454   -----YEFIPFGSGRRSCPGISYALQMEHLTIGHLIQGFNYQTPSNEPLDLQEGIGMTMP  508

Query  190   RATPLQLVVTPRLPPNFY  137
             +  P+++++TPRL    Y
Sbjct  509   KVNPVEVIITPRLATELY  526



>ref|XP_007049687.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOX93844.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=527

 Score =   410 bits (1055),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 215/497 (43%), Positives = 311/497 (63%), Gaps = 22/497 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGHI +L  + + L++TLG MADK+GP+F +R G  P  +I   EA K+CFTT++R +A
Sbjct  47    IIGHIHLLGGK-RTLAQTLGAMADKYGPIFSIRFGAFPALIISNHEAVKECFTTNDRVLA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+   G +LGY++A F F+    YWR  RK  V ELLS+ +L+  KH+   E+   IK
Sbjct  106   SRPKSNAGTYLGYDHAGFGFAPYGEYWRETRKLAVVELLSSHRLETSKHVLDFEVNAFIK  165

Query  1258  ELYLFVTAS-PEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
              LYLF   + P+ N  AV++       LTLNT  R++AG+RY       I D D  +  E
Sbjct  166   NLYLFCKKNGPDANPKAVISHK--FEALTLNTITRMIAGKRY-------ISDGDEEDDVE  216

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFD--FQGHVRAMKRNNKKVDKILQAWIDQ  908
             A+ +I V ++F Y+SG+    +A P     W +  F G V++MKR  K++D I+  W+D+
Sbjct  217   ARHVIKVIKDFMYVSGLIAPSEAMPF--LGWMESIFGGPVKSMKRVAKEIDSIIGRWVDE  274

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H  +R +  A      N+ D I L+LS I ++ +  F YT +  IK T  ++ + G+DTT
Sbjct  275   HKLKRLMSEADH----NNQDFIDLLLSAIGEDSM--FGYTRETIIKATVMNLFLAGADTT  328

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                + W LS L+     +K  +EE++  VG ++WV+DSD++KL YLQAV+KE+LRLYP  
Sbjct  329   SIALTWILSNLMNNRHTLKTAQEELDLTVGRDKWVQDSDIEKLVYLQAVIKETLRLYPPG  388

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             P+ +P    +DC I GY + KG +  VNL ++ RDP+ W  PD+F P+RFL   A   D 
Sbjct  389   PISVPHEAREDCSISGYHVQKGTRVIVNLRRLHRDPRIWSNPDEFQPERFLTSHA-NVDV  447

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + FE +PFG GRRSC GM  ALQI+HLTIAR +QGF+ +TP N  +DM EG G+T+P+
Sbjct  448   LGQHFELIPFGSGRRSCPGMPLALQITHLTIARTLQGFDLTTPFNESVDMTEGLGITMPK  507

Query  187   ATPLQLVVTPRLPPNFY  137
             ATPL ++++PRLP   Y
Sbjct  508   ATPLDVLLSPRLPAALY  524



>ref|XP_010451089.1| PREDICTED: cytochrome P450 82C4 [Camelina sativa]
Length=524

 Score =   409 bits (1051),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 201/496 (41%), Positives = 314/496 (63%), Gaps = 15/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  + Q+L RTLG+MAD +G    ++ G +   ++   E AK+CFT +++ +A
Sbjct  41    IIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYN+A+F F+  +A+WR MRK    ELLSN +L  +KH+R+SE+   +K
Sbjct  101   SRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEISMGVK  160

Query  1258  ELY-LFV-TASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W+  +TLN   R+VAG+RY     G  G + S + +
Sbjct  161   DLYSLWVKNGGSEP---VIVDLKSWLEDMTLNMIVRMVAGKRY----FGGTGSETSEDTE  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EA++      +F +L G+F + DAFP    +WFD QGH + MK+   ++D IL+ WI+ H
Sbjct  214   EARQCKIAISKFFHLIGIFTVSDAFPA--LRWFDLQGHEKEMKQTGSELDVILEKWIENH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              ++R++         ND D I +MLS  ++  +    Y    +IK T  ++I+ GSDTT 
Sbjct  272   RQQRKVSGTKE----NDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTTA  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             + + WA++LL+   +++K+ ++EI+  VG +R VEDSD+K L YLQA++KE+LRLYP  P
Sbjct  328   STLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDIKNLVYLQAIIKETLRLYPAGP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL PR   +DC + GY++  G +  VN+WKI RDPK + EP++F P+RF+  EA   D  
Sbjct  388   LLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYMEPNEFRPERFVTGEAKEFDVR  447

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRRSC G + A+Q+ HL +AR +  F   T  ++ +DM E  G+T+P+A
Sbjct  448   GQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESPGLTIPKA  507

Query  184   TPLQLVVTPRLPPNFY  137
             TPL+++++PRL    +
Sbjct  508   TPLEVLMSPRLNEQLF  523



>ref|XP_010526010.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Tarenaya hassleriana]
Length=524

 Score =   409 bits (1051),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 200/494 (40%), Positives = 305/494 (62%), Gaps = 14/494 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I+GH+ +L  +N +L RTLG +AD++GP F ++ G     ++   + AK+C T ++R  A
Sbjct  43    ILGHLHLLGGKNNLLYRTLGALADEYGPAFGLQLGSQKALVVSSWDVAKECLTVNDRTFA  102

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    +H+GYNYA+F F+  ++Y+R MRK V  ELLSN ++ K+ H+R+SE+E  IK
Sbjct  103   SRPKTVGAKHMGYNYALFGFAPYDSYFRDMRKIVTFELLSNQRIQKLSHVRISEIEMGIK  162

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ++Y  + +    +   +V + +W+  L LN   ++VAG+RY F      GD  + E  EA
Sbjct  163   DIY-NLWSKKGGSGPVLVDVKQWLEDLNLNMIVKLVAGKRYAF------GDATADEADEA  215

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +        F  L G+FVL DA P      FD QGH + MK+N  ++D IL+ W+ +H  
Sbjct  216   RRCPKATARFFQLMGLFVLSDALPF--LGRFDLQGHEKEMKKNAAEIDGILEGWLQEHER  273

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR LG         D D I +MLS  ++  +    +  + AIK T  +MI+ GSDT    
Sbjct  274   RRALGETDG-----DSDFIDVMLSQKEQGKLSNLKHDERTAIKATCLAMILGGSDTLVGT  328

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             +VWA +LL    +++K+ REEI+  VG +R VEDSD++KL YLQA+ KE+LRLYP  PLL
Sbjct  329   LVWAFALLANNREILKKAREEIDFHVGKDRKVEDSDIEKLVYLQAITKETLRLYPAAPLL  388

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR  ++DC + GY +  G +  VN+WK+ RDPK WP PD+F+P+RFL  +A       +
Sbjct  389   GPREATEDCTVAGYHVTAGTRLMVNVWKVHRDPKIWPNPDEFIPERFLEGKASEYSVRGQ  448

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              +E +PFG GRRSC G++ A+Q+ HL +AR +  F+ ST   +++DM E  G+T+P+  P
Sbjct  449   SYELLPFGSGRRSCPGISLAVQVLHLLLARFLHSFDMSTVSGMDVDMGESPGLTIPKTKP  508

Query  178   LQLVVTPRLPPNFY  137
             L+++++PRL    Y
Sbjct  509   LEVLLSPRLKKELY  522



>ref|XP_006283535.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
 gb|EOA16433.1| hypothetical protein CARUB_v10004585mg [Capsella rubella]
Length=524

 Score =   409 bits (1050),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 199/496 (40%), Positives = 321/496 (65%), Gaps = 15/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +++ + Q+L RTLG+MAD +G    ++ G +   ++   E AKDCFT +++ +A
Sbjct  41    IIGHLHLISGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKDCFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYN+A+F F+  +A+WR MRK    ELLSN +L  +KH+R+SE+   + 
Sbjct  101   SRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEISMGVN  160

Query  1258  ELY-LFVT-ASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
              LY L+V     EP    +V +  W+  +TLN   R+VAG+RY    GGA G + S + +
Sbjct  161   YLYSLWVKKGGSEP---VMVDLKSWLDDMTLNMVVRMVAGKRY---FGGA-GSESSKDTE  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EA++      +F +L G+F + DAFP     WFD QGH + MK+   ++D IL+ W++ H
Sbjct  214   EARQCKKAIAKFFHLIGIFTVSDAFPT--LGWFDLQGHEKEMKQTGIELDVILERWVENH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              ++R++         ND D I +MLS  ++  +    Y   ++IK T  ++I+ GS+TT 
Sbjct  272   RQQRKVSGPKE----NDSDFIDVMLSLAEQGKLSHLQYDANISIKSTCLALILGGSETTS  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             + + WA++LL+   +++K+ ++EI+  VGTER VEDSD++ L Y+QA++KE+LRLYP  P
Sbjct  328   STLTWAIALLLNNKEMLKKAQDEIDLHVGTERNVEDSDIENLVYVQAIIKETLRLYPAGP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL PR   +DC + G+++ +G +  VN+WKI RDP+ + EP++F P+RF+  EA   D  
Sbjct  388   LLGPREAMEDCTVAGHNVSRGTRLIVNVWKIQRDPRVYMEPNEFRPERFVTGEAKKFDVR  447

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRRSC G + A+Q+ HL +AR++Q F+  T  ++ +DM E  G+T+P+A
Sbjct  448   GQNFELMPFGSGRRSCPGSSLAMQVLHLGLARILQSFDVKTVSDMAVDMSESPGLTIPKA  507

Query  184   TPLQLVVTPRLPPNFY  137
             TPL+++++PRL  + +
Sbjct  508   TPLEVLISPRLKEHLF  523



>ref|XP_010445016.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   409 bits (1050),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 202/496 (41%), Positives = 312/496 (63%), Gaps = 15/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  + Q+L RTLG+MAD +G    ++ G +   ++   E AK+CFT +++ +A
Sbjct  41    IIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYN+A+F F+  +A+WR MRK    ELLSN +L  +KH+R+SE+   +K
Sbjct  101   SRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEISMGVK  160

Query  1258  ELY-LFV-TASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W+  +TLN   R+VAG+RY    GGA G + S + +
Sbjct  161   DLYSLWVKNGGSEP---VIVDLKSWLEDMTLNMIVRMVAGKRY---FGGA-GSESSEDTE  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EA +      +F +L G+F + DAFP    +WFD QGH + MK+   ++D IL+ WI+ H
Sbjct  214   EASQCKRAISKFFHLIGIFTVSDAFPS--LRWFDLQGHEKEMKQTGSELDVILERWIENH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              + R++         ND D I +MLS  ++  +    Y    +IK T  ++I+ GSDTT 
Sbjct  272   RQERKVSGTKE----NDSDFIDVMLSLAEQGKLSHLQYDATTSIKSTCLALILGGSDTTA  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             + + WA++LL+   +++K  ++EI+  VG +R VEDSD+  L YLQA++KE+LRLYP  P
Sbjct  328   STLTWAIALLLNNKEMLKNAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRLYPAGP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL PR   +DC + GY++  G +  VN+WKI RDPK + EP++F P+RF+  EA   D  
Sbjct  388   LLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYEEPNEFRPERFITGEAKEFDVR  447

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRRSC G + A+Q+ HL +AR +  F   T  ++ +DM E  G+T+P+A
Sbjct  448   GQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMSESPGLTIPKA  507

Query  184   TPLQLVVTPRLPPNFY  137
             TPL+++++PRL    +
Sbjct  508   TPLEVLISPRLNEQLF  523



>ref|XP_002510298.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52485.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   408 bits (1049),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 207/496 (42%), Positives = 310/496 (63%), Gaps = 21/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +++L RTLG +ADK+GP F +R G     ++   E AK+CFT +++ +A
Sbjct  47    IIGHLHLLGGADKLLHRTLGSLADKYGPAFNIRIGSHRALVVASKELAKECFTINDKTLA  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+   A  +H+ Y++A+F F+  +++WR MRK V+ ELLSN +L+ VKH++ SE++  I+
Sbjct  107   SRSTTAATKHMCYDHAVFGFAPYSSHWREMRKIVMLELLSNRRLEMVKHVQASEVDLGIR  166

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             +LY L+      P    +V + ++   LTL+   R+VAG+RY     G+  DD++ +Y++
Sbjct  167   KLYNLWAQNRCLP---VIVELKQFFEDLTLDVIVRVVAGKRYT----GSSDDDEARQYQK  219

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             A        +F +L G+FV+ DA P    +W D +GH +AMK+  K +D +L  W+D+H 
Sbjct  220   A------ISQFFHLMGIFVVSDALP--FLRWLDLEGHEKAMKKTAKDLDAVLAGWLDEHR  271

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
              RR  G   +     D D I +MLS  +K  + GF Y    +IK T  ++I   SDTT T
Sbjct  272   RRRVSGEVKSEG---DQDFIDVMLSLEEKGHLSGFQYDADTSIKSTCLALIAGASDTTTT  328

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              +VWA+SLL+     +K  +EE+E  +GTER V++SD+K L YLQAV+KE+LRLYP  PL
Sbjct  329   TLVWAISLLLNNQLALKNAKEELEKHIGTERQVDESDLKNLVYLQAVIKETLRLYPVAPL  388

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             + PR   +DC++GGY +P G +  VN+WKI RDP  W +   F P+RFL   A   D   
Sbjct  389   I-PREFVEDCRVGGYHVPAGTRLLVNVWKIQRDPMLWTKASAFQPERFLTSHA-DIDVRG  446

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
               FE +PFG GRRSC G ++AL   HLT+AR +  F+ +TP +  +DM E  G TLP+AT
Sbjct  447   HHFELLPFGSGRRSCPGASFALHALHLTLARFLHAFDVATPMDQPVDMTERSGTTLPKAT  506

Query  181   PLQLVVTPRLPPNFYG  134
             PL+++++PRLP   Y 
Sbjct  507   PLEVLLSPRLPAKLYS  522



>ref|XP_010918630.1| PREDICTED: cytochrome P450 82C4-like [Elaeis guineensis]
Length=493

 Score =   407 bits (1045),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 212/495 (43%), Positives = 306/495 (62%), Gaps = 22/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L SQ   L+   GEMADK+GP+F++  GM    ++   EAAK+C  T+++  A
Sbjct  19    IIGHLHLLRSQKP-LAHLFGEMADKYGPVFMLHLGMRRTLVVNSWEAAKECLATNDKVFA  77

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P  A G+HLGYNYAM  F+   +YWR +RK ++ ELLSN +L+ +KH+R  E++T I+
Sbjct  78    TRPGNAAGKHLGYNYAMVGFAPYGSYWRSVRKIIMVELLSNARLETLKHVRSMEMDTCIR  137

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             ELY L++  +  P K   V M  W+  L  N   R+VAG+RY    G   G D++  +++
Sbjct  138   ELYELWLRNNRRPVK---VEMKRWLGGLAYNIVVRVVAGKRY---FGSGTGSDEAWRFRK  191

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             A     + R F  L   FV  D FP    KW D++GH  AMK   ++VD I+   +++H 
Sbjct  192   A-----ISRLFGLLDA-FVASDMFPC--LKWMDWRGHESAMKNTAQEVDSIMAGLLEEHR  243

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +RR  G A     G   D + +MLS ++     G        IK T+ ++I+ G+DTT T
Sbjct  244   QRRLSGKA----TGGPQDFMDVMLSIVEDAEFSGMDV--DAVIKATSLALIMGGTDTTTT  297

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + W L+LLVK   V+K+ ++EI+A VG +R VE+SDVK L YLQA+VKE LRLYP   L
Sbjct  298   SLAWTLALLVKNPQVLKKAQDEIDAVVGKDRHVEESDVKNLLYLQAIVKEVLRLYPAAKL  357

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L+      DC+IGGYD+  G + +VN+WK+ RDP  W EP++F P+RFL+    G D   
Sbjct  358   LVQHEAMADCRIGGYDVAAGTRLHVNVWKLQRDPLVWSEPNEFRPERFLSAPHAGVDVRG  417

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRRSC G+++ALQ+ HLT+ARLIQGF   TPG    +M +  G+  P  T
Sbjct  418   QHFELIPFGSGRRSCPGISFALQVMHLTLARLIQGFELETPGGGPSEMADDLGLPYPNTT  477

Query  181   PLQLVVTPRLPPNFY  137
             PL+++++PRL    Y
Sbjct  478   PLEVLLSPRLADMLY  492



>gb|KDP26345.1| hypothetical protein JCGZ_17503 [Jatropha curcas]
Length=532

 Score =   408 bits (1049),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 213/499 (43%), Positives = 310/499 (62%), Gaps = 22/499 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I+GH+ +L ++ + L+RTL  +ADK+GP+F +  G+     +   EA K+CFT +++ +A
Sbjct  49    ILGHLHLLGAE-KTLARTLALLADKYGPIFTIWLGVHRTVEVSSHEAIKECFTANDKVLA  107

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+ + G++L YNYA F F+S   YWR MRK VV +LLS+ +L  +KH+++SE+ T IK
Sbjct  108   SRPKSSHGKYLSYNYAAFGFASYGPYWRDMRKLVVIQLLSSHRLKSLKHVQVSEVNTLIK  167

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LYL     P  NK   + + E+   LTLN   R++AG+RY    GG   +D+     E 
Sbjct  168   DLYLLSLNQPSSNK---IVISEFFEHLTLNMITRMIAGKRYCNCNGG---NDE-----EG  216

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI-  902
               +  + +EF Y+SG+FV  D  P     W +F G V+AMKR +K++D +LQ WID+H  
Sbjct  217   IRIGKLMKEFMYVSGVFVPSDVIPF--LWWMNFLGPVKAMKRLSKELDSLLQTWIDEHKL  274

Query  901   ----ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSD  734
                 +RR  G         + D I +MLS ++  F   F ++    IKGT  ++II G+D
Sbjct  275   KGINKRRDGGGGGGDFKNIEEDFIDVMLSILEDNF---FGHSRDDIIKGTVMTLIIAGAD  331

Query  733   TTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYP  554
             TT   + W LS L+     ++  ++E++ +VG ER V+DSD++ L YLQAVVKE+LRLYP
Sbjct  332   TTSITLTWILSNLLNNRHALELAQQELDLKVGKERCVQDSDIENLVYLQAVVKETLRLYP  391

Query  553   TVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGA  374
               PL +P     DC I GY +PKG +   NLWK+ RDP  W  PDKF+P+RFL       
Sbjct  392   PGPLAVPHEAINDCYISGYYIPKGTRVLANLWKLHRDPNIWSNPDKFLPERFLANRDNNV  451

Query  373   DNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTL  194
             D   + FEY+PFG GRRSC G+ +A+Q  HLT+ARL+Q F+ +T  N  +DM EG G+TL
Sbjct  452   DFSGQNFEYLPFGSGRRSCPGLNFAIQAIHLTLARLLQAFSLTTLFNQPVDMTEGLGITL  511

Query  193   PRATPLQLVVTPRLPPNFY  137
             P+ATPL++ +TPRL    Y
Sbjct  512   PKATPLEIQITPRLSSELY  530



>ref|XP_002869302.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45561.1| CYP82C4 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   407 bits (1047),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 201/496 (41%), Positives = 316/496 (64%), Gaps = 15/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L+ + Q+L RTLG+MAD +GP   +R G +   ++   E AK+CFT +++ +A
Sbjct  41    IIGHLHLLSGKEQLLYRTLGKMADHYGPAMSLRLGSSETFVVSSFEVAKECFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYN+A+F F+   A+WR MRK    ELLSN +L  +KH+R+SE+   +K
Sbjct  101   SRPMSAAAKHMGYNFAVFGFAPYGAFWREMRKIATIELLSNRRLQMLKHVRVSEIAMGVK  160

Query  1258  ELY-LFVT-ASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W+  ++LN   R+VAG+RY F  GG++  +D+ E +
Sbjct  161   DLYSLWVKKGGAEP---VMVDLQSWLEDISLNMMVRMVAGKRY-FGGGGSLSSEDTEEAR  216

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             + ++ +     F +L G+F + DAFP     WFD QGH + MK+  +++D IL+ WI+ H
Sbjct  217   QCRKGVA---NFFHLVGIFTVSDAFPK--LGWFDLQGHEKEMKQTGRELDVILERWIENH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              ++R++         ND D I +MLS  ++  +    Y    +IK T  +MI+ G++T+ 
Sbjct  272   RQQRKVSGTKH----NDSDFIDVMLSLAEQGKLSHLQYDANTSIKSTCLAMILGGTETSP  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
               + WA+SLL+   +++K+ +EEI+  VG +R VEDSD++ L YLQA++KE+LRLYP  P
Sbjct  328   ATLTWAISLLLNNKEMLKKAQEEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRLYPAGP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL  R   +DC + GY++P G +  VN+WKI RDPK + EPD+F P+RF+  EA   D  
Sbjct  388   LLGHREAMEDCTVAGYNVPCGTRMLVNVWKIQRDPKVYMEPDEFRPERFITGEAKEFDVR  447

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRRSC G + A+Q+ HL +AR +  F   T  ++ +DM E  G+T+P+ 
Sbjct  448   GQNFELMPFGSGRRSCPGASLAMQVLHLGLARFLHSFEVKTVMDMPVDMSESPGLTIPKG  507

Query  184   TPLQLVVTPRLPPNFY  137
             TPL+++++PRL    +
Sbjct  508   TPLEVLISPRLKEELF  523



>ref|XP_011045174.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Populus 
euphratica]
Length=531

 Score =   408 bits (1048),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 202/495 (41%), Positives = 309/495 (62%), Gaps = 19/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L +Q + L+RTL  +ADK+GP+F +R G  P  ++  LEA K+CFTTH+R ++
Sbjct  51    LIGHLHLLGAQ-KTLARTLAAIADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTHDRILS  109

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  + GE+L YNYA F F++   +WR MRK V  +LLS+ +L  ++H+++SE+ T I 
Sbjct  110   SRPRSSHGEYLSYNYAAFGFTNSGPFWREMRKIVTIQLLSSHRLKSLRHVQVSEVNTLIN  169

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LYL   ++ + +   V++  E   ++T+N   R++AG+RY              E +E 
Sbjct  170   DLYLLSKSNKQGSTKIVIS--ECFERMTINMITRMIAGKRY--------FSSTEAEKEEG  219

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFD-FQGHVRAMKRNNKKVDKILQAWIDQHI  902
             + +  + +EF Y+SG+FV  D  P     W + F G V+ MKR ++++D ++++WI +H 
Sbjct  220   KRIGKLMKEFMYISGVFVPSDLIPF--LGWINNFLGSVKTMKRLSRELDSLMESWIQEHK  277

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
              +R L +       +D D I +MLS +D        Y+ +  IK T  ++II G+DTT  
Sbjct  278   LKR-LESTENTNKMDDDDFIDVMLSLLDDSMSG---YSRETIIKATAMTLIIAGADTTSI  333

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + W LS L+     ++  +EE++ +VG ERW EDSD+  L Y+QA++KE+LRLYP  PL
Sbjct  334   TLTWILSNLLNNRRSLQLAQEELDLKVGRERWAEDSDIGNLVYIQAIIKETLRLYPPGPL  393

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
              +P   ++D  + GY +PKG +   NLWK+ RDP  W  PD++MP+RFLN  A   D   
Sbjct  394   SVPHEATEDFCVAGYHMPKGTRLFTNLWKLHRDPNLWSNPDEYMPERFLNDHA-NLDVLG  452

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
               FE +PFG GRRSC G+ +ALQ+ HLT ARL+QGF+  TP    +DM EG  +TLP+AT
Sbjct  453   HHFELIPFGSGRRSCPGITFALQVLHLTFARLLQGFDMKTPRGESVDMTEGVAITLPKAT  512

Query  181   PLQLVVTPRLPPNFY  137
             PL++ +TPRL P  Y
Sbjct  513   PLEIHITPRLSPELY  527



>ref|NP_194922.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
 sp|Q9SZ46.1|C82C4_ARATH RecName: Full=Cytochrome P450 82C4 [Arabidopsis thaliana]
 emb|CAA16595.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79912.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE85981.1| cytochrome P450, family 82, subfamily C, polypeptide 4 [Arabidopsis 
thaliana]
Length=524

 Score =   407 bits (1046),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 200/496 (40%), Positives = 314/496 (63%), Gaps = 15/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  + Q+L RTLG+MAD +GP   ++ G     ++   E AKDCFT +++ +A
Sbjct  41    IIGHLHLLGGKEQLLYRTLGKMADHYGPAMSLQLGSNEAFVVSSFEVAKDCFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYN+A+F F+  +A+WR MRK    ELLSN +L  +KH+R+SE+   +K
Sbjct  101   SRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEITMGVK  160

Query  1258  ELY--LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY   F     +P    +V +  W+  +TLN   R+VAG+RY F  GG++  +D+ E  
Sbjct  161   DLYSLWFKNGGTKP---VMVDLKSWLEDMTLNMIVRMVAGKRY-FGGGGSVSSEDTEEAM  216

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             + ++ I    +F +L G+F + DAFP   F  FD QGH + MK+   ++D IL+ WI+ H
Sbjct  217   QCKKAIA---KFFHLIGIFTVSDAFPTLSF--FDLQGHEKEMKQTGSELDVILERWIENH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              ++R+          ND D I +M+S  ++  +    Y    +IK T  ++I+ GSDT+ 
Sbjct  272   RQQRKFSGTKE----NDSDFIDVMMSLAEQGKLSHLQYDANTSIKSTCLALILGGSDTSA  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             + + WA+SLL+   +++K+ ++EI+  VG +R VEDSD++ L YLQA++KE+LRLYP  P
Sbjct  328   STLTWAISLLLNNKEMLKKAQDEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRLYPAGP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL PR   +DC + GY +P G +  VN+WKI RDPK + EP++F P+RF+  EA   D  
Sbjct  388   LLGPREAMEDCTVAGYYVPCGTRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKEFDVR  447

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRRSC G + A+Q+ HL +AR +  F+  T  ++ +DM E  G+T+P+A
Sbjct  448   GQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTVMDMPVDMSENPGLTIPKA  507

Query  184   TPLQLVVTPRLPPNFY  137
             TPL+++++PR+    +
Sbjct  508   TPLEVLISPRIKEELF  523



>ref|XP_006342717.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=527

 Score =   407 bits (1045),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 208/501 (42%), Positives = 313/501 (62%), Gaps = 21/501 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L    Q+L RTLG MAD +GP F +R G     ++   E AK+CFT +++ +A
Sbjct  41    IIGHLHLLGGTEQLLYRTLGAMADNYGPAFNLRLGTRRAFVVSSWEMAKECFTLNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GY YA+F F+  + +WR MRK  + ELLSN +LD +K++++SE++  I+
Sbjct  101   SRPTTVAAKHMGYGYAVFGFAPYSPFWREMRKIAMFELLSNRRLDALKYVQVSEVDIGIQ  160

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             ELY L+V  + +  +  +V +  W   LTLN   R+VAG+RY F  G    +DD  E + 
Sbjct  161   ELYKLWVDNNSD--RPILVELKRWFEDLTLNVIVRMVAGKRY-FGAGATCDNDD--EARR  215

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ IN   +F +L G+FV  DAFP+    WFD  GH +AMK+  K++D IL+ W+ +H 
Sbjct  216   CQKAIN---QFFHLIGIFVPSDAFPI--LGWFDINGHEKAMKKTAKELDFILEGWLKEHR  270

Query  901   ERRQLGNAPAPAAGNDL--DLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             E+R+  +    +  +    D I +MLS  ++  +  FPY    +IK T  ++I+ GSDTT
Sbjct  271   EKRKCTSIEVKSTTDSAVQDFIDVMLSLEEEGRLSNFPYDADTSIKSTCLALILGGSDTT  330

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                + WA+SLL+    ++ + +EEI+  VG  R +++SD+  L Y+QA++KE+LRLYP  
Sbjct  331   AGTLTWAISLLLNNPKILTKAQEEIDLHVGKNRQIDESDINNLIYIQAIIKETLRLYPAG  390

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFL--NREAGGA  374
             PLL PR    +C+I GY +  G +  VN+WKI RDP+ W +PD F P RFL  N +  G 
Sbjct  391   PLLGPREAMDNCEISGYKITPGTRLIVNVWKIQRDPRIWEDPDCFNPDRFLMSNVDVKGK  450

Query  373   DNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVE-LDMEEGFGVT  197
             D     FE +PFG GRRSC G + ALQ+ HLT+AR++  F F+ P + + +D+ E  G+T
Sbjct  451   D-----FELIPFGSGRRSCPGASLALQVLHLTLARILHAFEFTKPIDGQPIDLTESPGLT  505

Query  196   LPRATPLQLVVTPRLPPNFYG  134
             +P+ATPL +++ PRL  N YG
Sbjct  506   IPKATPLDVLIAPRLSANLYG  526



>ref|XP_010432796.1| PREDICTED: cytochrome P450 82C4-like [Camelina sativa]
Length=524

 Score =   407 bits (1045),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 201/496 (41%), Positives = 313/496 (63%), Gaps = 15/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  + Q+L RTLG+MAD +G    ++ G +   ++   E AK+CFT +++ +A
Sbjct  41    IIGHLHLLGGKEQLLYRTLGKMADHYGAAMSLQLGSSEAFVVSSFEVAKNCFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GYN+A+F F+  +A+WR MRK    ELLSN +L  +KH+R+SE+   +K
Sbjct  101   SRPMTAAAKHMGYNFAVFGFAPYSAFWREMRKIATIELLSNRRLQMLKHVRVSEISMGVK  160

Query  1258  ELY-LFV-TASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W   +T N   R+VAG+RY   +GGA+  + S +  
Sbjct  161   DLYSLWVKNGGSEP---VIVDLKRWSEDMTQNVIVRMVAGKRY---LGGAV-SESSEDAA  213

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EA++      +F +L G+F + DAFP    +WFDFQGH + MK+   ++D IL+ W + H
Sbjct  214   EARQCKRAISKFFHLIGIFTVSDAFPA--LRWFDFQGHEKEMKQTGSELDVILERWTENH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              + R++         ND D I +MLS  ++  +    Y    +IK T  S+I+ GSDTT 
Sbjct  272   RQERKVSGTKE----NDSDFIDVMLSLEEQGKLSHLQYDANTSIKSTCLSLILGGSDTTS  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             + + WA++LL+   +++K+ ++EI+  VG +R VEDSD+  L YLQA++KE+LRLYP  P
Sbjct  328   STLTWAIALLLNNKEMLKKAQDEIDLHVGRDRNVEDSDINNLVYLQAIIKETLRLYPAGP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL PR   +DC + GY++  G +  VN+WKI RDPK + EP++F P+RF+  EA   D  
Sbjct  388   LLGPREAMEDCTVAGYNVSSGTRLIVNVWKIQRDPKVYKEPNEFRPERFITGEAKEFDVR  447

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRRSC G + A+Q+ HL +AR +  F   T  ++ +DM E  G+T+P+A
Sbjct  448   GQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLHSFEVKTVLDMPVDMTESPGLTIPKA  507

Query  184   TPLQLVVTPRLPPNFY  137
             TPL+++++PRL  + +
Sbjct  508   TPLEVLISPRLKEHLF  523



>ref|XP_010104162.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXB99094.1| Cytochrome P450 82C4 [Morus notabilis]
Length=482

 Score =   405 bits (1041),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 208/503 (41%), Positives = 301/503 (60%), Gaps = 50/503 (10%)
 Frame = -1

Query  1564  LGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVASKPEFAV-----------  1418
             + ++ADK+GP+F+ R GM P+ +I   EA K+CFTT++   AS+P F             
Sbjct  1     MADIADKYGPIFLFRLGMNPVLVISNYEAVKECFTTNDITFASRPSFCAKPSTIRAGAPC  60

Query  1417  ----------------GEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIR  1286
                             G HLGY++A F F+    YWR MRK V+ ELLSN +L+ ++H++
Sbjct  61    GPVQPTPAFMRSWSTHGTHLGYDFAAFGFAPYGPYWRTMRKLVMIELLSNRRLETLRHVQ  120

Query  1285  MSELETSIKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGD  1106
             +SE+ET +  LY              V + EWI   TLN    ++AG+RY    G  +G 
Sbjct  121   VSEVETLVNGLY--GQCKKNGFGPTEVVISEWIEHFTLNIITEMIAGKRYFDSSGKVVGG  178

Query  1105  DDSTEYKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKIL  926
                    EA+ +  V +E+  +SG F++ D  P+   KW DF G+++AMKR  +++D ++
Sbjct  179   -------EAERIGKVIKEYMCISGAFIVSDLIPVP--KWVDFNGNLKAMKRIGREIDVLI  229

Query  925   QAWIDQHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMII  746
             Q+W+++H +R +        A +  D I +MLS I++    G  Y     IKGT  ++II
Sbjct  230   QSWVEEH-KRSE--------ASDKQDFIDIMLSLIEENHELG--YARDTIIKGTVSTLII  278

Query  745   DGSDTTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESL  566
              GSDTT  ++ W L+LL+     + R +EE++  VG ERWVE SD+K L YLQA+VKE+L
Sbjct  279   AGSDTTAINLTWILALLLNNRRALNRAQEELDLIVGKERWVEGSDIKNLVYLQAIVKETL  338

Query  565   RLYPTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNRE  386
             RLYP  PL +P    +DC + G+ + KG +  VNLWK+ RDP  WP+P+ F P+RFL   
Sbjct  339   RLYPPGPLAVPHQAREDCTVCGFHVRKGTRLFVNLWKLHRDPNTWPDPEAFSPERFLTSH  398

Query  385   AGGADNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGF  206
             A G D   + FE +PFG GRRSC GMA+ALQ++HL +ARL+QGF F+T  +  +DM EG 
Sbjct  399   A-GIDVLGQHFELIPFGSGRRSCPGMAFALQVTHLALARLLQGFVFATKLDEPVDMSEGL  457

Query  205   GVTLPRATPLQLVVTPRLPPNFY  137
             G+TLPRATP++ V+TPRLP   Y
Sbjct  458   GITLPRATPVEAVLTPRLPAELY  480



>ref|XP_010526011.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Tarenaya hassleriana]
Length=524

 Score =   406 bits (1044),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 199/494 (40%), Positives = 304/494 (62%), Gaps = 14/494 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I+GH+ +L  +N +L RTLG +AD++GP F ++ G     ++   + AK+C T ++R  A
Sbjct  43    ILGHLHLLGGKNNLLYRTLGALADEYGPAFGLQLGSQKALVVSSWDVAKECLTVNDRTFA  102

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    +H+GYNYA+F F+  ++Y+R MRK V  ELLSN ++ K+ H+R+SE+E  IK
Sbjct  103   SRPKTVGAKHMGYNYALFGFAPYDSYFRDMRKIVTFELLSNQRIQKLSHVRISEIEMGIK  162

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ++Y  + +    +   +V + +W+  L LN   ++VAG+RY F      GD  + E  EA
Sbjct  163   DIY-NLWSKKGGSGPVLVDVKQWLEDLNLNMIVKLVAGKRYAF------GDATADEADEA  215

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +        F  L G+FVL DA P      FD QGH + MK+N  ++D IL+ W+ +H  
Sbjct  216   RRCPKATARFFQLMGLFVLSDALPF--LGRFDLQGHEKEMKKNAAEIDGILEGWLQEHER  273

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR LG         D D I +MLS  ++  +    +  + AIK T  +MI+ GSDT    
Sbjct  274   RRALGKTDG-----DSDFIDVMLSQKEQGKLSNLKHDERTAIKATCLAMILGGSDTLVGT  328

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             +VWA +LL    +++K+ REEI+  VG +R VEDSD++KL YLQA+ KE+LRLYP  PLL
Sbjct  329   LVWAFALLANNREILKKAREEIDFHVGKDRKVEDSDIEKLVYLQAITKETLRLYPAAPLL  388

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR  ++DC + GY +  G +  VN+WK+ RDPK W  PD+F+P+RFL  +A       +
Sbjct  389   GPREATEDCTVAGYQVTAGTRLMVNVWKVHRDPKIWSNPDEFIPERFLEGKASEYSVRGQ  448

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              +E +PFG GRRSC G++ A+Q+ HL +AR +  F+ ST   +++DM E  G+T+P+  P
Sbjct  449   SYELLPFGSGRRSCPGISLAVQVLHLLLARFLHSFDMSTVSGMDVDMGESPGLTIPKTKP  508

Query  178   LQLVVTPRLPPNFY  137
             L+++++PRL    Y
Sbjct  509   LEVLLSPRLKKELY  522



>ref|XP_003635525.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=518

 Score =   406 bits (1043),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 209/497 (42%), Positives = 310/497 (62%), Gaps = 29/497 (6%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             +GH+ +L+    I  RTL  MADKHGP+F++R GM    ++   EA K+C TT+++  AS
Sbjct  47    VGHLHLLSGPTPIF-RTLAAMADKHGPVFMIRLGMHRALVVSSHEAVKECLTTNDKAFAS  105

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  + G+ LGYNYA F F+     WR MRK  V+ELLSN  L+++KH+ +SEL+  I++
Sbjct  106   RPSSSAGKLLGYNYAGFGFAPYGPLWREMRKLSVTELLSNRPLNELKHVLVSELDVCIRD  165

Query  1255  LYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQ  1076
             LY     +   N   V AM EW+ QLT N   R+VAG+RY    G  +  ++     EA+
Sbjct  166   LYSLGKETNWVNPIKV-AMSEWLEQLTFNVVLRMVAGKRY---FGNGVHGNE-----EAR  216

Query  1075  EMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIER  896
               I V ++F +L+G+FV  DA P    +W D QGH+ +MKR  +++D  ++ W+++H+ +
Sbjct  217   HAIAVIKKFIFLTGVFVASDAIPF--VEWMDLQGHLGSMKRVAEQLDPFVEGWVEEHVTK  274

Query  895   RQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTHM  716
               L + P+    +  D I +MLS +    +  F +  +  IK T  ++I+ GS+TT    
Sbjct  275   --LKSDPS----SRQDFIDVMLSVLKDNSM--FGHRRETVIKATVMTLIVGGSETTSIAS  326

Query  715   VWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLLM  536
             +W LS L+     +KR +EE++ +VG  RWVE+SD++ L YLQA VKE+LRLYP  PLL+
Sbjct  327   IWILSALLNNRHTLKRAQEELDLKVGRGRWVEESDIQNLIYLQAAVKETLRLYPPGPLLV  386

Query  535   PRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLKR  356
             P    +DC + GY +PKG +  VN+WK+ RDP  W +P++F P+RFL   A      L  
Sbjct  387   PHEAIQDCSVCGYHIPKGTRLLVNVWKLHRDPDAWSDPEEFQPERFLTTHAN-----LNV  441

Query  355   F----EYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
             F    E +PF  GRRSC G+A ALQI HLT+ARL+QG++ +TP N  +DM EG G+ +P+
Sbjct  442   FGQHSELIPFSSGRRSCPGIALALQILHLTVARLLQGYDMTTPLNAPVDMTEGIGLAMPK  501

Query  187   ATPLQLVVTPRLPPNFY  137
              TPL++++TPRLP   Y
Sbjct  502   ETPLEVMLTPRLPSLLY  518



>ref|XP_010547839.1| PREDICTED: cytochrome P450 82C4-like [Tarenaya hassleriana]
Length=501

 Score =   405 bits (1040),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 202/496 (41%), Positives = 305/496 (61%), Gaps = 14/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L  + Q+L RTLG MAD HGP    R G     ++   E AK+CFT +++ +A
Sbjct  20    VIGHLHLLGGKEQLLYRTLGAMADDHGPASPRRVGSRRAFVVSSWEVAKECFTVNDKALA  79

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GYNYA+F F+  +++WR MRK    ELLSN +L  +KH+R+SE+ T IK
Sbjct  80    SRPMTVASKHMGYNYAVFGFAPYSSFWRKMRKIATVELLSNRRLQMLKHVRISEISTGIK  139

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +L+  + +    +   +V +  W+  + LN   ++VAG+RY    G +   +D+ E ++ 
Sbjct  140   DLH-GLWSKKGGSSPVLVDLKRWLEDMNLNMIVKMVAGKRY---FGSSAKMEDAEEARQC  195

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q  I     F +L G+FV+ DA P     WFD QGH + M++   ++D IL+ WID+H  
Sbjct  196   QRAIA---RFFHLIGIFVVSDALPF--LGWFDLQGHEKEMRKTASELDGILERWIDEHQR  250

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR  G +       D D I +MLS   +  +    Y  + +IK T  ++I+ GSDTT   
Sbjct  251   RRVSGQSEG-----DSDFIDVMLSLEGEGKLSDLQYDPRTSIKSTCLALILGGSDTTAGT  305

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WA++LL+   +++K+ +EEI+  VG  R VEDSD++ L YLQA++KE+LRLYP  PLL
Sbjct  306   LTWAIALLLNNREMLKKAQEEIDIHVGKNRQVEDSDIENLVYLQAIIKETLRLYPAGPLL  365

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR   +DC + GY +  G +  VN+WKI RDPK W  P++F P+RFL  +    D   +
Sbjct  366   GPREAMEDCTVAGYQVAAGTRLIVNVWKIQRDPKVWRNPEEFRPERFLTGKETEYDVRGQ  425

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRRSC G + ALQ+ HL++AR++  F+  T  + E+DM E  G+T+P+ATP
Sbjct  426   NFELMPFGSGRRSCPGASLALQVLHLSLARVLHSFDLLTVSDSEVDMRESPGLTIPKATP  485

Query  178   LQLVVTPRLPPNFYGL  131
             L++++TPRL    Y L
Sbjct  486   LEVLLTPRLEQELYEL  501



>ref|XP_002531094.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31308.1| cytochrome P450, putative [Ricinus communis]
Length=525

 Score =   405 bits (1042),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 202/496 (41%), Positives = 310/496 (63%), Gaps = 24/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  +N  L+RTLG +AD +GP+F +  G+    ++   EA K+CF++++R +A
Sbjct  52    IIGHLHLLGKENT-LARTLGRLADNYGPIFTIWLGVHRTVVVSSYEAIKECFSSNDRILA  110

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  + G++L YNYA F F+S   YW  MRK V  +LLS+ ++  +KH+++SE+ T IK
Sbjct  111   SRPRSSHGQYLSYNYAAFGFASYGPYWSHMRKLVAIQLLSSHRIKLLKHVQISEVNTLIK  170

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY       + +   ++ + E    LTLN   R++AG+RY           DS   +E 
Sbjct  171   ELY-----EKQGSNKKIINISECFEHLTLNMITRMIAGKRY-------FSSADSDSEQEG  218

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             + +  + +EF Y+SG+FV  D  P     W +F G V+ MKR ++++D + + WID+H  
Sbjct  219   KRIGKIMKEFMYISGVFVPSDLIPF--LGWMNFAGPVKTMKRLSRELDSLTETWIDEH--  274

Query  898   RRQLGNAPAPAAGN-DLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
               +L    +  + N + D I +MLS ++ +F   F ++ +  IKGT  ++II G+DTT  
Sbjct  275   --KLKRVKSEESKNMEEDFIDVMLSLLEDDF---FGHSKEDIIKGTVTNLIIAGADTTSI  329

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + W LS L+     ++  ++E++ +VG  R V+DSD+  L YL A+VKE+LRLYP  PL
Sbjct  330   TLTWILSNLLNNRRTLELAQQELDLKVGRNRCVQDSDIDNLVYLNAIVKETLRLYPPGPL  389

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
              +P   S+DC I GY +PKG +   NLWK+ RDP  W  P++F+P+RFL  +A   D   
Sbjct  390   AVPHEASEDCSIAGYHIPKGTRVFANLWKLHRDPNVWSSPNEFVPERFLTSQA-NMDVSG  448

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FEY+PFG GRRSC G+ +A+Q  HLT+A+L+Q F+F+TP NV +DM EG G+TLP+AT
Sbjct  449   QNFEYIPFGSGRRSCPGLNFAIQAIHLTLAKLLQAFSFTTPLNVPVDMTEGLGITLPKAT  508

Query  181   PLQLVVTPRLPPNFYG  134
             PL++ + PRL P  Y 
Sbjct  509   PLEIHIIPRLSPELYA  524



>emb|CAN77159.1| hypothetical protein VITISV_019026 [Vitis vinifera]
Length=604

 Score =   408 bits (1049),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 212/493 (43%), Positives = 308/493 (62%), Gaps = 21/493 (4%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             IGH+ +LNS   I  RTL  MAD HGP+F++R GM    ++   +A K+C TT+++  AS
Sbjct  133   IGHLHLLNSPMPIF-RTLTAMADXHGPVFMIRLGMXRALVVSSHKAVKECLTTNDKAFAS  191

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  + G+ LGYNYA F F+     WR MRK  V+ELLSN +LD++KH+ +SEL+  I++
Sbjct  192   RPISSAGKLLGYNYAGFGFAPYGPLWREMRKLSVTELLSNRRLDELKHVLVSELDVCIRD  251

Query  1255  LYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQ  1076
             LY     +   N   V AM EW+ Q T N   R+VAG+RY    G  +  ++     EA+
Sbjct  252   LYSLGKETNWVNPIKV-AMSEWLEQXTFNVVLRMVAGKRY---FGNGVHGNE-----EAR  302

Query  1075  EMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIER  896
               I V ++F  L+G FV  D  P    +W D QGH+ +MKR   ++D  ++ W+++H+ +
Sbjct  303   HAIAVIKKFLSLTGAFVASDVIPF--VEWMDLQGHLGSMKRVAGQLDPFVEGWVEEHVTK  360

Query  895   RQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTHM  716
               L + P+    +  D I +MLS +    +  F +T +  IK T  ++I+ GS+TT    
Sbjct  361   --LNSDPS----SRQDFIDVMLSVLKDNSI--FGHTRETVIKATVMTLIVGGSETTSIVS  412

Query  715   VWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLLM  536
              W LS L+     +KR +EEI+ +VG  RWVE+SD++ L YLQAVVKE+LRLYP  PL +
Sbjct  413   TWILSALLNNRHALKRAQEEIDLKVGRGRWVEESDIZNLIYLQAVVKETLRLYPPAPLSI  472

Query  535   PRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLKR  356
             P    +DC +  Y +PKG +  VN+WK+ RDP  W +P++F P+RFL   A   +   + 
Sbjct  473   PHEAVEDCNVCEYHIPKGTRLFVNVWKLHRDPGVWSDPEEFQPERFLTTNA-NLNVFGQH  531

Query  355   FEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATPL  176
             FE +PF  GRRSC G+A ALQI HLT+ARL+QG++ +TP N  +DM EG G+T+PRATPL
Sbjct  532   FELIPFSSGRRSCPGIALALQILHLTVARLLQGYDMTTPLNAPVDMTEGIGITMPRATPL  591

Query  175   QLVVTPRLPPNFY  137
             ++++TPRLP   Y
Sbjct  592   EVMLTPRLPSLLY  604



>ref|XP_002264473.1| PREDICTED: cytochrome P450 82C4-like [Vitis vinifera]
Length=519

 Score =   404 bits (1038),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 208/494 (42%), Positives = 312/494 (63%), Gaps = 21/494 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L+ Q  I  RTLG MADKHGP+F+++ GM P  ++   EA K+CFTT+++  A
Sbjct  47    IIGHLHLLSGQVPIF-RTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDKVFA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  +V + LGYNYAMF  +    +WR MRK  V E+LS  +L+++K +R+SEL+  IK
Sbjct  106   SRPRSSVSKLLGYNYAMFGSAPYGLFWREMRKLSVVEILSARRLNELKDVRISELDACIK  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LY     +   +   VV M EW   LT N + R++AG+RY         D+     +EA
Sbjct  166   DLYSLGKDNNWISPIKVV-MSEWFEHLTFNFALRMIAGKRYF--------DNAVHGNEEA  216

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +  I   +++  LSG FV  D FP    +  D QG++ +MK   +++D ++ +W+++H+ 
Sbjct  217   RGAIITIKKYLSLSGAFVPSDVFPF--LERLDLQGYLGSMKHVTEELDCLVGSWVEEHVM  274

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R  L + P    G   D I ++LST+    +  F +T +  IK T  ++I+ GSD+T   
Sbjct  275   R--LKSEP----GCRHDFIDVLLSTVQDTSM--FGHTRETVIKATIVNLIVGGSDSTSIT  326

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
               W LS L+   + MK  +EE++ +VG  RWVE+SD++KL+YL+A++KESLRLYP  PLL
Sbjct  327   STWILSALLNNREAMKHAQEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYPAAPLL  386

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P   ++DC + GY +PKG +  VN WK+ RDP+ W  P++F P+RFL   A   D    
Sbjct  387   VPHEATQDCHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHA-NLDVFGH  445

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
             +FE +PFG GRR+C G+  ALQ+ HLT ARL+QGF+ +TP N  +DM EG   T+P+ TP
Sbjct  446   QFELIPFGSGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTP  505

Query  178   LQLVVTPRLPPNFY  137
             L++++TPRLP + Y
Sbjct  506   LRVMLTPRLPSHLY  519



>ref|XP_004252778.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=527

 Score =   404 bits (1039),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 206/499 (41%), Positives = 311/499 (62%), Gaps = 17/499 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+L   +Q+L RTLG MAD +GP F +R G     ++   E AK+CFT +++ +A
Sbjct  41    IIGHLPLLGGTDQLLYRTLGAMADNYGPAFNLRLGTRRAFVVSSWEMAKECFTLNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GY YA+F F+  + +WR MRK  + ELLSN +LD +K++++SE++  I+
Sbjct  101   SRPTTVAAKHMGYGYAVFGFAPYSPFWREMRKIAMFELLSNRRLDTLKYVQVSEVDMGIQ  160

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
              LY L+V  + +  +  +V +  W   LTLN   R+VAG+RY F  G    +DD  E + 
Sbjct  161   ALYKLWVDNNSD--RPILVELKRWFEDLTLNVIVRMVAGKRY-FGAGATCDNDD--EARR  215

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ IN   +F +L G+FV  DAFP+  F   D  GH +AMK+  K++D IL+ W+ +H 
Sbjct  216   CQKAIN---QFFHLIGIFVPSDAFPILGF--LDINGHEKAMKKTAKELDFILEGWLKEHR  270

Query  901   ERRQLGNAPAPAAGNDL--DLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             E+R+  +  A +  +    D I +MLS  ++  +  FPY    +IK T  ++I+ GSDTT
Sbjct  271   EKRKCTSIEAKSTTDSAVQDFIDVMLSLEEEGRLSNFPYDADTSIKSTCLALILGGSDTT  330

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                + WA+SLL+    ++++ +EEI+  +G  R +++SD+  L Y+QA++KE+LRLYP  
Sbjct  331   AGTLTWAISLLLNNPKILRKAQEEIDNHIGKNRQIDESDINNLIYIQAIIKETLRLYPAG  390

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PLL PR    +C+I GY +  G +  VN+WKI RDP+ W  P+ F P RFL       D 
Sbjct  391   PLLGPREAMDNCEISGYKITPGTRLIVNVWKIQRDPRIWENPNCFNPDRFL---TSNVDV  447

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTP-GNVELDMEEGFGVTLP  191
               K FE +PFG GRRSC G + ALQ+ HLT+AR++  F F+ P  +  +D+ E  G+T+P
Sbjct  448   KGKDFELIPFGSGRRSCPGASLALQVLHLTLARILHAFEFTKPIDDQPIDLTESPGLTIP  507

Query  190   RATPLQLVVTPRLPPNFYG  134
             +ATPL ++V PRL  N YG
Sbjct  508   KATPLDVLVAPRLSANLYG  526



>ref|XP_010069622.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Eucalyptus 
grandis]
Length=478

 Score =   402 bits (1034),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 199/480 (41%), Positives = 303/480 (63%), Gaps = 15/480 (3%)
 Frame = -1

Query  1555  MADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVASKPEFAVGEHLGYNYAMFSFS  1376
             MADK GP+F +R G+ P  +I   EA + CFTTH++D+AS+P+  VG H GY YA F F+
Sbjct  1     MADKQGPMFRIRLGVHPATIISSQEAVRKCFTTHDKDLASRPKSKVGIHFGYGYAGFGFA  60

Query  1375  SDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKELYLFVTASP---EPNKAAVV  1205
                  WR MRK  + ELLS  +LD +KH++ SE++T +K+L+     +    +   + VV
Sbjct  61    EYGDLWREMRKITMLELLSTRRLDNLKHVQASEIDTFVKDLHALCRTNAIDAQNGSSKVV  120

Query  1204  AMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIG---DDDSTEYKEAQEMINVFREFQYLSG  1034
              + + +  LTLN   R++A +RY   +  + G   DDD    +EA  +  V +EF Y+SG
Sbjct  121   VISQLLELLTLNIIIRMIASKRYFGLLSASTGSSTDDD----EEASHLRKVIKEFMYISG  176

Query  1033  MFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIERRQLGNAPAPAAGN-  857
                + +  P     W D  G V+ MKR  +++D+I+  W+++H  +R+ G+      G+ 
Sbjct  177   FPTVSELVPFT--GWTDCVGTVKTMKRVAREMDEIVGKWVEEHKLKRE-GDQRGEVIGDV  233

Query  856   DLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTHMVWALSLLVKYGDV  677
               D I +MLS I ++ +  F ++ +  IK T  ++I+ GSDTT  ++ W LSLL+ +  V
Sbjct  234   KEDFIDVMLSVIGEDGLAQFGHSPETLIKATVVNIIVAGSDTTSLNLTWVLSLLLNHKHV  293

Query  676   MKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLLMPRMTSKDCKIGGY  497
             +KR +EEI+ +VG ++WV+DSD+  L YLQA+VKE+LRLYP  PL +P     DC + GY
Sbjct  294   LKRAQEEIDLKVGKDKWVQDSDIGSLHYLQAIVKETLRLYPPGPLSIPHEARADCNVRGY  353

Query  496   DLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLKRFEYVPFGCGRRSC  317
              +PKG +  VN+WK+ RDP+ W +P+KF+P+RFL   + G D   + FE++PFG GRR C
Sbjct  354   LIPKGTRIFVNVWKLHRDPQVWSDPEKFLPERFLTNHS-GVDASGQHFEFIPFGSGRRIC  412

Query  316   VGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATPLQLVVTPRLPPNFY  137
              G A+AL+ +HLT+ARL+QGF+ +   +  +DM EG G+ LP+ATPL++V+ PRLP   Y
Sbjct  413   PGAAFALRATHLTLARLLQGFDLAISSDELVDMTEGIGLNLPKATPLRVVLNPRLPSMLY  472



>ref|XP_007200049.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
 gb|EMJ01248.1| hypothetical protein PRUPE_ppa023510mg [Prunus persica]
Length=517

 Score =   404 bits (1037),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 201/498 (40%), Positives = 312/498 (63%), Gaps = 29/498 (6%)
 Frame = -1

Query  1612  GHIPILNSQNQI---LSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDV  1442
             G +PI+   +++   + +TL  MADK+GP+F +  G  P+ +I   +A K CFT ++   
Sbjct  40    GALPIIGHLHKLRVPVFKTLAAMADKYGPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVF  99

Query  1441  ASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSI  1262
             A++P  + G++LGYNYA F FS    YWR MRK V+ ELLS  +L  +KH+++SE++  I
Sbjct  100   ATRPRSSHGKYLGYNYAGFGFSPYGPYWRDMRKMVMVELLSIRRLQNLKHVQISEVDAFI  159

Query  1261  KELYLFV-TASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             K L+L   T          V + +WI  LTLN   R++AG+RY           DS++  
Sbjct  160   KGLFLLCKTEGLNGLNPTKVVISDWIEHLTLNVITRMIAGKRYF----------DSSDEG  209

Query  1084  EAQEMINVFREFQYLSGMFVLQD--AFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWID  911
             + Q    + +EF Y+SG  V  D   FP     W DF+G V+AMKR  K++D ++ +W++
Sbjct  210   DEQRFGKIVKEFMYVSGNPVAADVIGFP----SWIDFKGQVKAMKRIMKELDSVMGSWVE  265

Query  910   QHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDT  731
             +H  +++  +       ++ D I +M+S I+     G  YT +  IK T+ ++I+ GS+T
Sbjct  266   EHYAKKETNSR------DEHDFIDVMMSVIEDNSTLG--YTRETIIKATSMNLILAGSET  317

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
             T  +++W LSLL+     +K  +EE++ +VG +RW+ED+D++ L YLQA+VKE+LRLYP 
Sbjct  318   TAINLIWILSLLLNNRHALKLAQEELDLKVGRDRWIEDTDIENLPYLQAIVKETLRLYPP  377

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PL +P    +DC++ G+ +PKG +  VNLWK+ RDP  WP+P+ F P+RFL     G D
Sbjct  378   GPLSVPHEAMQDCQVCGFHIPKGTRLFVNLWKLHRDPCLWPDPEVFCPERFLTTHV-GID  436

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                K FE++PFG GRRSC G  +ALQ++HLT+ RL+QGF  +TP ++ +D+ EG G+T+P
Sbjct  437   ASGKHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFELATPMDMPVDLTEGLGITMP  496

Query  190   RATPLQLVVTPRLPPNFY  137
             +AT L++++TPRL   FY
Sbjct  497   KATSLEVILTPRLSFEFY  514



>ref|XP_002274740.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=518

 Score =   404 bits (1037),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 209/494 (42%), Positives = 301/494 (61%), Gaps = 23/494 (5%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             +GH+P+L  Q  I  RTLG MADKHGP+F++R G+    ++   EA K+CFTT+++  AS
Sbjct  47    LGHLPLLRGQTPIF-RTLGAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFAS  105

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  + G+ LGYNYA F F+   A WR MRK  + E+LS  +LD +KH+++SEL+ SIK+
Sbjct  106   RPSSSAGKLLGYNYAGFGFAPYGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKD  165

Query  1255  LYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQ  1076
             LY     S   +   VV M EW   L+ N   +++AG+RY    G  I        +EA+
Sbjct  166   LYSLGKGSDWVHPVKVV-MSEWFQHLSFNIVLKMIAGKRYFNTSGHGI--------EEAR  216

Query  1075  EMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIER  896
               I   +EF  LSG FVL DA P    +W D QG++ +MKR  K+VD ++  W+++H  R
Sbjct  217   RAIATIQEFLSLSGAFVLSDAIPG--VEWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIR  274

Query  895   RQLGNAPAPAAGNDL-DLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
                      + G+ + D I +MLS ++   +  F ++ +  IK T   +I+ G++T  T 
Sbjct  275   LN-------SEGSRMQDFIDVMLSVLEDTSM--FGHSRETVIKATIVILIVGGTETVATT  325

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
               W LS L+     +KR +EE++ +VG  RWVE+SD+  L YLQAV+KE+LRLY   PL 
Sbjct  326   STWLLSALLNNKHALKRAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLS  385

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P    +DC + GY +PKG +  VN WK+ RDP  W +P+ F P+RFL   A   D   +
Sbjct  386   VPHEAMEDCHVAGYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPERFLTSHA-DLDVLGQ  444

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRRSC G+  AL++  L I RL+QGF+ STP N  +DM EG  +TL + TP
Sbjct  445   HFELIPFGSGRRSCPGITMALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTP  504

Query  178   LQLVVTPRLPPNFY  137
             L++++TPRLP  FY
Sbjct  505   LEVILTPRLPSQFY  518



>ref|XP_007222622.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
 gb|EMJ23821.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
Length=525

 Score =   403 bits (1035),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 211/499 (42%), Positives = 303/499 (61%), Gaps = 22/499 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I GH+P+L        + L  MADK+GPLF +R G+ P  +I   E AK+CFTT++  + 
Sbjct  45    IFGHLPLLGGSTPPHIK-LAAMADKYGPLFTIRLGVYPSLVISSSEIAKECFTTNDLVLN  103

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+ AV +H+GYN AMF F+    +WR MRK    ELLSN +L+ ++HIR+SE+ T ++
Sbjct  104   SRPKLAVVDHIGYNCAMFGFAPSGPFWREMRKITTLELLSNRRLELLRHIRVSEVTTFLQ  163

Query  1258  ELY-LFVTASP-EPNKA--AVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTE  1091
             EL+  + TA   E N +   +V + +W   +TLN   R+VAG+RY      A  +D+ TE
Sbjct  164   ELFKTWSTAEKRESNNSDGVLVELKQWFGDMTLNVILRMVAGKRYSV----AADEDEKTE  219

Query  1090  YKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWID  911
              +  Q   +  +EF Y  G+FV+ DA P    +W D  GH +AMKR  K++D I+  W++
Sbjct  220   ARRVQ---SALKEFFYYVGLFVVGDAVPY--LRWLDLGGHEKAMKRIAKELDAIVGGWVE  274

Query  910   QHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDT  731
             +H  RR  G+A       + D I  MLS +D   + GF        K T+ +MI  GSDT
Sbjct  275   EHKRRRARGDAKG-----EPDFIDAMLSVLDGADLGGF--DADTVNKATSLNMIAGGSDT  327

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
             T   ++WA+SLL+    V+K  + E++ ++G +R V +SD+ KL Y+QA+VKE+LRLYP 
Sbjct  328   TMVTLIWAISLLLNNPHVLKSAQNELDTEIGRQRVVSESDISKLVYIQAIVKETLRLYPA  387

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PL  PR  +KDC IGGY + KG +   NLWKI  DP+ WP+P +F P+RFL       D
Sbjct  388   APLSGPREFTKDCTIGGYHVSKGTRLITNLWKIQTDPRIWPDPLEFKPERFLTSHR-DVD  446

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                  FE +PFG GRR+C G+A+ALQ+   T+A  +  F+ S P N  +DM E FG+T  
Sbjct  447   VKGLHFELIPFGSGRRACPGLAFALQMVQFTLASFVHAFDISNPSNSPIDMTESFGLTNI  506

Query  190   RATPLQLVVTPRLPPNFYG  134
             +ATPLQ+++ PRLP   YG
Sbjct  507   KATPLQVLIKPRLPSQLYG  525



>ref|XP_007201695.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
 gb|EMJ02894.1| hypothetical protein PRUPE_ppa004301mg [Prunus persica]
Length=517

 Score =   402 bits (1034),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 201/497 (40%), Positives = 310/497 (62%), Gaps = 29/497 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+  L      + +TL  MADK+GP+F +  G  P+ +I   +A K CFT ++   A
Sbjct  44    IIGHLHKLRGP---IFKTLAAMADKYGPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++    VG++LGYNYA F FS    YWR MRK V+ ELLS+ +L+ +K +++SE++  IK
Sbjct  101   TRSRSTVGKYLGYNYAGFGFSPYGTYWRDMRKMVMVELLSSRRLETLKRVQISEVDAFIK  160

Query  1258  ELYLFV-TASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
              L+L   T          V + +WI  LTLN   R++AG+RY           DS++  +
Sbjct  161   GLFLLCKTEGHNGLNPTKVVISDWIEHLTLNVITRMIAGKRYF----------DSSDEGD  210

Query  1081  AQEMINVFREFQYLSGMFVLQD--AFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
              Q    + +EF Y+SG  V  D   FP     W DF+G V+AMKR  K++D ++ +W+++
Sbjct  211   EQRFGKILKEFMYVSGNPVAADVIGFP----SWIDFKGQVKAMKRIMKELDSVMGSWVEE  266

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H  +++  +       ++ D I +M+S I+     G  YT +  IK T+ ++I+ GS+TT
Sbjct  267   HYAKKETNSR------DEHDFIDVMISVIEDNSTLG--YTRETIIKATSLNLILAGSETT  318

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
               +++W LSLL+    V+K  +EE++ +VG +RW+ED+D++ L YLQA+VKE+LRLYP  
Sbjct  319   AINLIWILSLLLNNRHVLKLAQEELDLKVGRDRWIEDTDIENLPYLQAIVKETLRLYPPA  378

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL +P    +DC++ G+ + KG    VNLWK+ RDP  WP+P+ F P+RFL     G D 
Sbjct  379   PLSVPHEAMQDCQVCGFHIQKGTLLFVNLWKLHRDPSLWPDPEVFCPERFLTTHV-GIDA  437

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + FE++PFG GRRSC G  +ALQ++HLT+ RL+QGF  +TP ++ +D+ EG G+T+P+
Sbjct  438   SGQHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFELATPMDMPVDLTEGVGITMPK  497

Query  187   ATPLQLVVTPRLPPNFY  137
             +T L++++TPRLP  FY
Sbjct  498   STSLEVILTPRLPLVFY  514



>gb|KDP38423.1| hypothetical protein JCGZ_04348 [Jatropha curcas]
Length=561

 Score =   403 bits (1036),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 211/495 (43%), Positives = 304/495 (61%), Gaps = 19/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +++L +TLG MADK+GP F +R G     ++   E AK+CFT +++DVA
Sbjct  83    IIGHLHLLGGADKLLHQTLGLMADKYGPAFNIRIGSHCAFVVASSELAKECFTINDKDVA  142

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+ YN+A+F F+  +++WR MRK V+ ELLSN +L+ VKH++ SE+   IK
Sbjct  143   SRPTTAATKHMCYNHAVFGFAPHSSHWREMRKIVMLELLSNRRLEMVKHVQNSEVNLGIK  202

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             +LY L+   +  P    +V + +W   LTLN   R+VAG+RY         DDD      
Sbjct  203   KLYHLWAENNCLP---VLVELKQWFEDLTLNVIVRVVAGKRYT-----GSSDDDG-----  249

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             A+   N   +F +L G+FV+ DA P    +W D +GH RAMK+  K +D +L+ W+ +H 
Sbjct  250   ARRCQNAISKFFHLMGIFVVSDALP--FLQWLDLEGHQRAMKKTAKDLDAVLEGWLTEHR  307

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             ++R      A   G   D I +MLS  +K  + GF Y    +IK T  ++I   SDTT T
Sbjct  308   QKRVSVLGEAKTEGEQ-DFIDVMLSLEEKGHLSGFIYDADTSIKSTCLALIAGASDTTTT  366

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WA+SLL+     +K+ REE++  VG ER V++SD+K L Y+QA++KE+LRLYP  PL
Sbjct  367   TLTWAISLLLNNKSALKKAREELDLHVGPERQVDESDLKSLVYIQAIIKETLRLYPVAPL  426

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             + PR  +KDC I GY +P G +  VN WKI RDP++W  P  F P+RFL   A   D   
Sbjct  427   I-PREFTKDCTIAGYHVPAGTRLLVNAWKIQRDPRYWTNPSAFQPERFLTSHA-NVDVRG  484

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             +  E +PFG GRRSC G A+AL   HLT+AR +  F+ +T  +  +DM E  G TLP+AT
Sbjct  485   QHHELIPFGSGRRSCPGAAFALHALHLTLARFLHAFDLATTMDKPVDMTETPGTTLPKAT  544

Query  181   PLQLVVTPRLPPNFY  137
             PL ++++PRLP   Y
Sbjct  545   PLDVLLSPRLPAELY  559



>ref|XP_011045172.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
 ref|XP_011045173.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
Length=541

 Score =   402 bits (1034),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 203/505 (40%), Positives = 310/505 (61%), Gaps = 29/505 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L +Q + L+RTL  +ADK+GP+F +R G  P  ++  LEA K+CFTTH+R ++
Sbjct  51    LIGHLHLLGAQ-KTLARTLAAIADKYGPIFTIRLGKHPTVVVSNLEAIKECFTTHDRILS  109

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  + GE+L YNYA F F++   +WR MRK V  +LLS+ +L  ++H+++SE+ T I 
Sbjct  110   SRPRSSHGEYLSYNYAAFGFTNSGPFWREMRKIVTIQLLSSHRLKSLRHVQVSEVNTLIN  169

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LYL   ++ + +   V++  E   ++T+N   R++AG+RY              E +E 
Sbjct  170   DLYLLSKSNKQGSTKIVIS--ECFERMTINMITRMIAGKRY--------FSSTEAEKEEG  219

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFD-FQGHVRAMKRNNKKVDKILQAWIDQHI  902
             + +  + +EF Y+SG+FV  D  P     W + F G V+ MKR ++++D ++++WI +H 
Sbjct  220   KRIGKLMKEFMYISGVFVPSDLIPF--LGWINNFLGSVKTMKRLSRELDSLMESWIQEHK  277

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTT----------QSM  752
              +R L +       +D D I +MLS +D        Y+ +  IK T           Q++
Sbjct  278   LKR-LESTENTNKMDDDDFIDVMLSLLDDSMSG---YSRETIIKATAMDQDVLFLHEQTL  333

Query  751   IIDGSDTTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKE  572
             II G+DTT   + W LS L+     ++  +EE++ +VG ERW EDSD+  L Y+QA++KE
Sbjct  334   IIAGADTTSITLTWILSNLLNNRRSLQLAQEELDLKVGRERWAEDSDIGNLVYIQAIIKE  393

Query  571   SLRLYPTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLN  392
             +LRLYP  PL +P   ++D  + GY +PKG +   NLWK+ RDP  W  PD++MP+RFLN
Sbjct  394   TLRLYPPGPLSVPHEATEDFCVAGYHMPKGTRLFTNLWKLHRDPNLWSNPDEYMPERFLN  453

Query  391   REAGGADNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEE  212
               A   D     FE +PFG GRRSC G+ +ALQ+ HLT ARL+QGF+  TP    +DM E
Sbjct  454   DHA-NLDVLGHHFELIPFGSGRRSCPGITFALQVLHLTFARLLQGFDMKTPRGESVDMTE  512

Query  211   GFGVTLPRATPLQLVVTPRLPPNFY  137
             G  +TLP+ATPL++ +TPRL P  Y
Sbjct  513   GVAITLPKATPLEIHITPRLSPELY  537



>emb|CDP00859.1| unnamed protein product [Coffea canephora]
Length=528

 Score =   400 bits (1028),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 206/502 (41%), Positives = 316/502 (63%), Gaps = 26/502 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+  +N +  + + TL  MADK+GP+F +R GM P+ ++   E+ K+CFTT+++  A
Sbjct  46    VIGHLLQMNPKIHV-AETLAAMADKNGPVFSIRLGMLPVLVVNNWESVKECFTTNDKTFA  104

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  +  ++L Y+YA F  +    YWR +RK V+ ELLS  +L+K+K +R+SE++TSIK
Sbjct  105   SRPPSSFAKYLCYDYAAFGIAPYGPYWRDVRKMVLRELLSTQRLEKLKQVRISEVQTSIK  164

Query  1258  ELYLFVTA----SPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTE  1091
             E++L ++       E    A V + +   +LTLN   R +AG RY         D D  +
Sbjct  165   EIFLNISEVNKHGNEIKAPARVDLGDVFEKLTLNIVLRKIAGGRYT--------DSDVGK  216

Query  1090  YKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWID  911
              ++A E   V +EF+  + + V+ D  P R  KW D QG++++MKR  K++DK +Q W+D
Sbjct  217   ERDA-EFRRVLKEFEAFARILVVSDIIPFRFLKWLDPQGNIKSMKRLAKELDKYMQIWVD  275

Query  910   QHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDT  731
             +H E R   +       ++LD I ++LSTI  E + GF  + ++ IK T   +I+ G+ T
Sbjct  276   EHKEGRMKNSG---DGDDELDFIDVLLSTIKDESICGF--SKEVVIKSTILVLIVAGTST  330

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
             T   + W +SLL+ +  V+++ +EEI++ VG ERWVE+SD+K L YLQA+VKE++RL+P 
Sbjct  331   TSRALSWVISLLLNHRHVLQKAQEEIDSFVGKERWVEESDIKNLVYLQAIVKETMRLHPP  390

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGA-  374
              P+ MPR   +DC + GY +PKG Q  VN+WKI RDP+ WPEP+KF P+RFL+ +  GA 
Sbjct  391   APVPMPRQADEDCNVAGYFIPKGTQLYVNVWKIQRDPRIWPEPEKFFPERFLSGDHAGAQ  450

Query  373   -DNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVT  197
              D   + FE  PFG GRR C GM++ALQ+ HLT+ARL+Q F+ S   ++ +D     G  
Sbjct  451   LDFSSQNFELNPFGNGRRICPGMSFALQVMHLTLARLLQAFDISRVSDLPVDTAGYEG--  508

Query  196   LPRATPLQLVVTPRLPP-NFYG  134
               +A PL+ ++ PRLP  + YG
Sbjct  509   --KAPPLEALMMPRLPNLDLYG  528



>ref|XP_007049686.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
 gb|EOX93843.1| Cytochrome P450, family 82, subfamily C, polypeptide 2, putative 
[Theobroma cacao]
Length=590

 Score =   402 bits (1032),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 208/493 (42%), Positives = 307/493 (62%), Gaps = 23/493 (5%)
 Frame = -1

Query  1600  ILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVASKPEFA  1421
             IL +    L+RTL  MADK+GP+F +R G+    ++   EA K+CFTT+++ +A++P   
Sbjct  118   ILYNLTVTLARTLAAMADKYGPVFTIRIGIYRTLIVSNHEAVKECFTTNDKILANRPRSN  177

Query  1420  VGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKELYLFV  1241
              G +L Y++A F F+    YWR MRK  V ELLS  +L  + H+R+SE++  IK L  F 
Sbjct  178   AGTYLAYDHAGFGFAPYGTYWRQMRKLAVLELLSVHRLATLTHVRVSEVDAFIKNLCFFC  237

Query  1240  TASPE-PNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQEMIN  1064
               S + PN+   +++ + +  L LN   R +AG RY         D D    KEAQ  + 
Sbjct  238   KKSEQSPNQK--ISISQRLEVLNLNMMLRTIAGTRY-------FSDADGENDKEAQRAMK  288

Query  1063  VFREFQYLSGMFVLQDAFPLRLFKWFDFQGH-VRAMKRNNKKVDKILQAWIDQHIERR-Q  890
             + +EF YL G+  L +  P    KW DF GH V++MKR +K++D ++++W+D+H  RR +
Sbjct  289   LIKEFSYLLGVTALSEVVPF--LKWIDFWGHQVKSMKRISKEMDSLIESWVDEHKLRRFK  346

Query  889   LGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTHMVW  710
             +G      A N+ D I ++LS I+ + +  F +T +  IK T   +I  GSD+T   + W
Sbjct  347   IG------AKNNQDFIDVLLSAIEDDSM--FGHTRETIIKATVTVLISAGSDSTSRTLTW  398

Query  709   ALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLLMPR  530
              LS L+   + MKR +EE++ ++G +RWVED D++KL YLQA++KE+ RLYP  PL +P 
Sbjct  399   ILSNLMNNRNAMKRAQEELDLKIGRDRWVEDCDIEKLVYLQAIIKETFRLYPAAPLSVPH  458

Query  529   MTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLKRFE  350
                + C+I GY +PKG +  VN+WK+ RDP+ W  P++F P+RFL       D   + FE
Sbjct  459   QAMEYCRISGYHIPKGTRLFVNVWKLQRDPRIWSNPEEFEPERFLT-SYQNVDILGQHFE  517

Query  349   YVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATPLQL  170
              +PFG GRRSC GM++ALQ+  LTIARL+QGF+ +TP N  +DM E  G T+ +ATPLQL
Sbjct  518   LIPFGSGRRSCPGMSWALQVIRLTIARLLQGFDLATPLNAPVDMTEEPGGTMSKATPLQL  577

Query  169   VVTPRLPPNFYGL  131
             V+TPRLP + Y L
Sbjct  578   VLTPRLPDHLYQL  590



>ref|XP_010253830.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   399 bits (1026),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/496 (41%), Positives = 304/496 (61%), Gaps = 14/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +  + +++L   LG MADK+GP F++R GM    ++   +AAK CFTT+++  +
Sbjct  46    IIGHLHLFRA-SELLHPKLGAMADKYGPAFMLRLGMRRALVVSSWDAAKQCFTTNDKVFS  104

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P     +H+GYNYA+  F+    YWR MRK    ELLS+ +LD  KHIR SE++ S+K
Sbjct  105   TRPRTVAIKHMGYNYALPGFAPYGPYWREMRKISTVELLSHRRLDMFKHIRTSEIDLSMK  164

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LY     +       +V M +W + LT+N   R++AG+RY    G A   D S E  E 
Sbjct  165   DLYTRWVKNGH-GSPVLVEMKQWFSDLTMNIVTRMIAGKRY---FGAANYTDFSEE--EV  218

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q+      EF +L G+FV+ DA P     W D QGH RAMKR  K++D +L++W+ +H  
Sbjct  219   QKCKKAITEFMHLVGIFVVSDALPF--LGWLDLQGHERAMKRTAKQLDHMLESWLKEHRC  276

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +++     A A  ++ D + ++LS +D     G  Y     +K T   +I+ GSDTT   
Sbjct  277   KKRASEGIATA--DERDFMDVLLSILDDHQCIG--YGTDTVVKATCLGLILGGSDTTSVT  332

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+     +K+ ++E++ +VG +  VE+SD++ L YLQA+VKE+LRLYP   + 
Sbjct  333   LTWALSLLLNNRQALKKAQDELDTKVGRDGLVEESDIRNLVYLQAIVKETLRLYPAAAVS  392

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR   +DC + G+ +P G Q  VN+WK+ RDP  WP P +F P+RFL   A   D   +
Sbjct  393   APREAMEDCTVAGFHIPAGTQLLVNIWKLQRDPSIWPHPCEFSPERFLTSHAADIDVRGQ  452

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTP-GNVELDMEEGFGVTLPRAT  182
              FE +PFG GRR+C G+++A+Q+ HLT+ARLIQGF+  TP  +  +DM +G G+T  + T
Sbjct  453   HFELLPFGSGRRACPGISFAIQVLHLTLARLIQGFDLGTPCCDAMVDMTQGIGLTNHKKT  512

Query  181   PLQLVVTPRLPPNFYG  134
             PL +++TPRL P  YG
Sbjct  513   PLDVLLTPRLHPLLYG  528



>ref|XP_007049681.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX93838.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   398 bits (1023),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 200/498 (40%), Positives = 302/498 (61%), Gaps = 27/498 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L  + + L + LG MADK+GPL+ ++ G   + ++   E AKDC T ++R +A
Sbjct  45    LIGHLHLLGGK-ETLCKKLGAMADKYGPLYSLKLGHRRVLVVSSWEIAKDCLTNNDRALA  103

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P  A G H+GYN A+F+ +    YWR +RK V  ELLS+ +L+K+KHIR SE++  IK
Sbjct  104   TRPSIAAGRHIGYNNAIFALAPYGEYWRNIRKIVTIELLSSYRLEKLKHIRFSEMDLFIK  163

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             EL+     + +    A V M E + +LT N + R++ G+R+            S+ Y +A
Sbjct  164   ELFRLCVENAD--NCAQVTMSEVLERLTFNINLRMLVGKRFA-----------SSSYAQA  210

Query  1078  QEMI----NVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWID  911
                        ++  YLSG+FVL DA P    +W D QGHVR+MK+  K++D I+  W++
Sbjct  211   HSQPWRYEKAIKQTLYLSGIFVLADALPF--LEWMDIQGHVRSMKQTAKELDSIISVWLE  268

Query  910   QHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDT  731
              H+ R++       +     D + +ML+ + ++ V    +T    +K TT  + + G ++
Sbjct  269   NHLRRKRESQGSCES-----DFMDVMLANLPQDAVIS-GHTRDTIVKATTLILTMTGGES  322

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
             T   M W LSLL+ +  V+K  ++E++  VG +RWVE+SD+K L+YLQA+VKE+LRLYP 
Sbjct  323   TSVTMTWVLSLLLNHPSVLKAAQQELDLHVGIDRWVEESDIKSLKYLQAIVKETLRLYPP  382

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PL   R   +DC I GY +PKG +  VNLWK+ RDP+ W  P +F P+RFL   A   D
Sbjct  383   GPLTGIREAMEDCCIAGYHVPKGTRLIVNLWKLQRDPRVWENPGEFQPERFLTTHA-DFD  441

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                + FEY+PF  GRRSC  + + LQ+ HLT+A+L+QGF+  TP    +DM EG G+ LP
Sbjct  442   VRGQNFEYIPFSSGRRSCPAITFGLQVVHLTLAKLLQGFDIRTPDGKPVDMGEGLGLALP  501

Query  190   RATPLQLVVTPRLPPNFY  137
             + TPL +V+TPRL   FY
Sbjct  502   KRTPLDVVLTPRLAHEFY  519



>ref|NP_194925.1| cytochrome P450, family 82, subfamily C, polypeptide 2 [Arabidopsis 
thaliana]
 sp|O49394.2|C82C2_ARATH RecName: Full=Cytochrome P450 82C2 [Arabidopsis thaliana]
 emb|CAA16592.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79915.1| Cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AEE85984.1| cytochrome P450, family 82, subfamily C, polypeptide 2 [Arabidopsis 
thaliana]
Length=523

 Score =   397 bits (1021),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 198/496 (40%), Positives = 321/496 (65%), Gaps = 16/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L+ + Q+L RTLG+MAD++GP   +R G +   ++   E AKDCFT +++ +A
Sbjct  41    IIGHLHLLSGKEQLLYRTLGKMADQYGPAMSLRLGSSETFVVSSFEVAKDCFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GY+ A+F F+  +A+WR MRK    ELLSN +L  +KH+R+SE+   ++
Sbjct  101   SRPITAAAKHMGYDCAVFGFAPYSAFWREMRKIATLELLSNRRLQMLKHVRVSEISMVMQ  160

Query  1258  ELY-LFVT-ASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W+  ++LN   R+VAG+RY F  GG++  +D+ E +
Sbjct  161   DLYSLWVKKGGSEP---VMVDLKSWLEDMSLNMMVRMVAGKRY-FG-GGSLSPEDAEEAR  215

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             + ++ +     F +L G+F + DAFP     WFDFQGH + MK+  +++D IL+ WI+ H
Sbjct  216   QCRKGVA---NFFHLVGIFTVSDAFPK--LGWFDFQGHEKEMKQTGRELDVILERWIENH  270

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              ++R++         ND D + +MLS  ++       +    +IK T  ++I+ GS+T+ 
Sbjct  271   RQQRKVSGTKH----NDSDFVDVMLSLAEQGKFSHLQHDAITSIKSTCLALILGGSETSP  326

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             + + WA+SLL+   D++K+ ++EI+  VG +R VEDSD++ L Y+QA++KE+LRLYP  P
Sbjct  327   STLTWAISLLLNNKDMLKKAQDEIDIHVGRDRNVEDSDIENLVYIQAIIKETLRLYPAGP  386

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL  R   +DC + GY++ +G +  VN+WKI RDP+ + EP++F P+RF+  EA   D  
Sbjct  387   LLGHREAIEDCTVAGYNVRRGTRMLVNVWKIQRDPRVYMEPNEFRPERFITGEAKEFDVR  446

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRRSC G + A+Q+ HL +AR +Q F+  T  ++ +DM E  G+T+P+A
Sbjct  447   GQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLQSFDVKTVMDMPVDMTESPGLTIPKA  506

Query  184   TPLQLVVTPRLPPNFY  137
             TPL+++++PRL    Y
Sbjct  507   TPLEILISPRLKEGLY  522



>gb|ABK28662.1| unknown [Arabidopsis thaliana]
Length=524

 Score =   397 bits (1021),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 198/496 (40%), Positives = 321/496 (65%), Gaps = 16/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L+ + Q+L RTLG+MAD++GP   +R G +   ++   E AKDCFT +++ +A
Sbjct  41    IIGHLHLLSGKEQLLYRTLGKMADQYGPAMSLRLGSSETFVVSSFEVAKDCFTVNDKALA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+GY+ A+F F+  +A+WR MRK    ELLSN +L  +KH+R+SE+   ++
Sbjct  101   SRPITAAAKHMGYDCAVFGFAPYSAFWREMRKIATLELLSNRRLQMLKHVRVSEISMVMQ  160

Query  1258  ELY-LFVT-ASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +LY L+V     EP    +V +  W+  ++LN   R+VAG+RY F  GG++  +D+ E +
Sbjct  161   DLYSLWVKKGGSEP---VMVDLKSWLEDMSLNMMVRMVAGKRY-FG-GGSLSPEDAEEAR  215

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             + ++ +     F +L G+F + DAFP     WFDFQGH + MK+  +++D IL+ WI+ H
Sbjct  216   QCRKGVA---NFFHLVGIFTVSDAFPK--LGWFDFQGHEKEMKQTGRELDVILERWIENH  270

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              ++R++         ND D + +MLS  ++       +    +IK T  ++I+ GS+T+ 
Sbjct  271   RQQRKVSGTKH----NDSDFVDVMLSLAEQGKFSHLQHDAITSIKSTCLALILGGSETSP  326

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             + + WA+SLL+   D++K+ ++EI+  VG +R VEDSD++ L Y+QA++KE+LRLYP  P
Sbjct  327   STLTWAISLLLNNKDMLKKAQDEIDIHVGRDRNVEDSDIENLVYIQAIIKETLRLYPAGP  386

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL  R   +DC + GY++ +G +  VN+WKI RDP+ + EP++F P+RF+  EA   D  
Sbjct  387   LLGHREAIEDCTVAGYNVRRGTRMLVNVWKIQRDPRVYMEPNEFRPERFITGEAKEFDVR  446

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRRSC G + A+Q+ HL +AR +Q F+  T  ++ +DM E  G+T+P+A
Sbjct  447   GQNFELMPFGSGRRSCPGSSLAMQVLHLGLARFLQSFDVKTVMDMPVDMTESPGLTIPKA  506

Query  184   TPLQLVVTPRLPPNFY  137
             TPL+++++PRL    Y
Sbjct  507   TPLEILISPRLKEGLY  522



>ref|XP_006443550.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
 ref|XP_006479221.1| PREDICTED: cytochrome P450 82G1-like isoform X1 [Citrus sinensis]
 ref|XP_006479222.1| PREDICTED: cytochrome P450 82G1-like isoform X2 [Citrus sinensis]
 gb|ESR56790.1| hypothetical protein CICLE_v10019727mg [Citrus clementina]
Length=520

 Score =   397 bits (1019),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 196/494 (40%), Positives = 307/494 (62%), Gaps = 23/494 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+P+L ++  +  + LG +ADK+GP++ +R G  P  ++   E  KDCFTT++R +A
Sbjct  47    LIGHLPLLIAEEPV-CKILGAIADKYGPIYSLRLGKHPTLIVSSWEIVKDCFTTNDRVLA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P  A G++LGY+ A+F+ +    YWR +RK   ++LLS+ +L+ +KH+R SE++T IK
Sbjct  106   TRPSIAAGKYLGYDNAVFALAPYGRYWRDIRKIATTDLLSSHRLELLKHVRYSEVDTFIK  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LY     S      A V + + I QLT N S R++AG+R+  +  G  G        E 
Sbjct  166   DLY--SRCSENAFNPAKVVISKLIEQLTFNISLRLIAGKRFSAREFGEQG-------SEG  216

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
               +    +E  YL+G+FVL DA P    +W DFQGH+ +M+R  KK+D ++  W+++H +
Sbjct  217   WRINRAIKEATYLTGVFVLGDAIPW--LEWIDFQGHIGSMRRTAKKIDDVIGNWLEEHAQ  274

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R+  G           D + ++LS I+   V    +T    IK T   +I  GS++T   
Sbjct  275   RKLQGEG---------DFMDVLLSKIEDNTVMS-GHTRDTVIKATALILIFTGSESTYLG  324

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             ++W LSLL+ +   +K+ +EE++  VG +RWV +SD+K L+YL+A+VKE+LR+YP  P+ 
Sbjct  325   IIWTLSLLLNHPKELKKAQEELDVHVGRDRWVNESDMKNLKYLRAIVKETLRIYPPGPVT  384

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
               R   +DC+IGGY +PKG +  VN+WK+ RDP+ W  P +F P+RFL   A   D   +
Sbjct  385   GIREAMEDCEIGGYHVPKGTRLIVNVWKLHRDPRMWENPCEFRPERFLTTHA-DVDVNTQ  443

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FEY+PF  GRRSC GM   LQI  LT+AR++QGF+ +T G + +DM+EG G+ LP+  P
Sbjct  444   HFEYIPFSFGRRSCPGMTSGLQIVQLTLARILQGFDLATVGGIPVDMKEGLGIALPKLNP  503

Query  178   LQLVVTPRLPPNFY  137
             +++V+ PRL  + Y
Sbjct  504   VEVVIKPRLSDDLY  517



>ref|XP_009364189.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   395 bits (1016),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 207/496 (42%), Positives = 293/496 (59%), Gaps = 20/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I+GH+P+L         TLG MADK+GPL+ +R G+ P  +I   E AK+CFTT++  V 
Sbjct  48    ILGHLPLLGGSTPP-HITLGAMADKYGPLYTIRLGVYPSLVISSSEIAKECFTTNDLSVN  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+ AV +H+GYNYAMF F+    YWR +RK    ELLSN +++ +KHIR+SE+ T +K
Sbjct  107   SRPKMAVVDHIGYNYAMFGFAPSGPYWREIRKITTLELLSNRRVELLKHIRVSEVTTFLK  166

Query  1258  ELY-LFVTASPE-PNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             EL+  + T   E  N   VV + +W   +TLN   R+VAG+RY           D  E K
Sbjct  167   ELHKTWSTRQKEGSNDGVVVELKQWFGDMTLNVIVRMVAGKRYSVAA-------DEDEKK  219

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EA  + N  REF    GMF++ DA P    +W D  GH +AMK+  K +D ++  W+++H
Sbjct  220   EALRVQNALREFFNFVGMFLVGDAVPY--LRWLDLGGHEKAMKKTAKDLDAMVGEWVEEH  277

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              +RR  G A       + D I  MLS +D   + GF        K T+ +MI  GSDTT 
Sbjct  278   KQRRAKGGAKG-----EQDFIDAMLSVLDGADLGGF--DADTINKATSLNMIAGGSDTTM  330

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
               + WA+SLLV    V+KR   E++ ++G +R V + D+  L Y+QA+VKE+LRLYP  P
Sbjct  331   VTLTWAISLLVNNPHVLKRALNELDTKIGRQRVVSEEDISNLVYIQAIVKETLRLYPAAP  390

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             L  PR  ++DC I G  + KG +  +NLWK+  DPK WP+P +F P+RFL       D  
Sbjct  391   LSGPREFTEDCTIAGCHIRKGTRLIMNLWKLQTDPKIWPDPLEFKPERFLTTHK-DVDVK  449

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
                FE +PFG GRR+C G+A+ALQ+   T+A  +  F  S P +  +DM E FG+T  + 
Sbjct  450   GHHFELIPFGSGRRACPGLAFALQMVQFTLASFLHAFEISNPSSAPIDMTESFGLTNMKV  509

Query  184   TPLQLVVTPRLPPNFY  137
             TPL++++ PRL   FY
Sbjct  510   TPLKVLIKPRLSFEFY  525



>ref|XP_009801068.1| PREDICTED: cytochrome P450 82C4-like [Nicotiana sylvestris]
Length=468

 Score =   394 bits (1011),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 201/477 (42%), Positives = 295/477 (62%), Gaps = 13/477 (3%)
 Frame = -1

Query  1555  MADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVASKPEFAVGEHLGYNYAMFSFS  1376
             MAD +GP F +R G     ++   E AK+CFT +++ +AS+P     +H+GY YA+F F+
Sbjct  1     MADNYGPAFNLRLGSRGAFVVSSWEMAKECFTLNDKALASRPTTVAAKHMGYGYAVFGFA  60

Query  1375  SDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKELY-LFVTA-SPEPNKAAVVA  1202
               + +WR MRK  + ELLSN +LD +KH+++SE+E  I+ELY L+V   S    +  +V 
Sbjct  61    PYSTFWREMRKIAMYELLSNRRLDTLKHVQVSEVEMGIQELYKLWVNNNSGHSCRPVLVE  120

Query  1201  MDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQEMINVFREFQYLSGMFVL  1022
             +  W   LTLN   R+VAG+RY F  G    DD   E +  Q+ IN   +F +L G+FV 
Sbjct  121   LKGWFEDLTLNVIVRMVAGKRY-FGAGATCDDD---EARRCQKAIN---QFFHLIGIFVP  173

Query  1021  QDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIERRQLGNAPAPAAGNDLDLI  842
              DAFP+    WFD QGH +AMKR  K++D IL+ W+ +H  R +   +         D I
Sbjct  174   SDAFPI--LGWFDIQGHEKAMKRTAKELDSILEGWLQEHRHREKTRFSHEAKNEGAQDFI  231

Query  841   HLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTHMVWALSLLVKYGDVMKRCR  662
              +MLS   +  +  F Y    +IK T  ++I+ GSDTT   + WA+SLL+    ++++ +
Sbjct  232   DVMLSLQQEGRLSNFQYDADTSIKSTCLALILGGSDTTAGTLTWAISLLLNNPQILRKAQ  291

Query  661   EEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLLMPRMTSKDCKIGGYDLPKG  482
             +EI+  VG +R V++SD++ L Y+QA++KE+LRLYP  PLL PR    +C++GGY +  G
Sbjct  292   KEIDLHVGKDRQVDESDIQNLAYIQAIIKETLRLYPAGPLLGPREAMDECEVGGYKIIPG  351

Query  481   AQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLKRFEYVPFGCGRRSCVGMAY  302
              +  VN+WKI RDP+ W +PD F P RF    +   D   + FE +PFG GRRSC G + 
Sbjct  352   TRLIVNVWKIQRDPRIWEDPDSFKPDRFFMSNS-NVDVKGQDFELIPFGSGRRSCPGASL  410

Query  301   ALQISHLTIARLIQGFNFSTPGNVEL-DMEEGFGVTLPRATPLQLVVTPRLPPNFYG  134
             ALQ+ HLT+AR +Q F FS P + +L D+ E  G+T+P+ATPL +++TPRL  N YG
Sbjct  411   ALQVLHLTLARFLQAFEFSKPVDDQLIDLTESPGLTIPKATPLDVLITPRLSANLYG  467



>ref|XP_002264520.2| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
Length=567

 Score =   397 bits (1019),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 205/494 (41%), Positives = 310/494 (63%), Gaps = 21/494 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L+ Q  I  RTLG MADKHGP+F+++ GM P  ++   EA K+CFTT+++  A
Sbjct  95    IIGHLHLLSGQVPIF-RTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDKVFA  153

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  +V + LGYNYA F F+    +WR MRK  V E+LS  +L+++K +R+SEL+  I+
Sbjct  154   SRPRSSVSKLLGYNYAGFGFAPYGPFWREMRKLSVVEILSARRLNELKDVRISELDACIQ  213

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LY     +   +   VV M EW   LT N   R++AG+RY         D+     +EA
Sbjct  214   DLYSLGKDNNWISPIEVV-MSEWFEHLTFNFVLRMIAGKRYF--------DNAVHGNEEA  264

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +  I   ++F  LSG FV  D FP    +  D +G++ +MK   +++D ++ +W+++H+ 
Sbjct  265   RGAIIAIKKFLSLSGAFVPSDVFPF--LERLDLKGYLGSMKHVAEELDCLVGSWVEEHVM  322

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R  L + P    G+  D I ++LS +    +  F ++ +  IK T  ++I+ GSD+T   
Sbjct  323   R--LKSEP----GSRHDFIDVLLSAVQDTSM--FGHSRETVIKATIGNLIVGGSDSTSIT  374

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
               W LS L+   + MKR +EE++ +VG  RWVE+SD++KL+YL+A++KESLRLY   PLL
Sbjct  375   STWILSALLNNREAMKRAQEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYSAAPLL  434

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P   ++DC + GY +PKG +  VN WK+ RDP+ W  P++F P+RFL   A   D    
Sbjct  435   VPHEATQDCHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHA-NLDVFGH  493

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
             +FE +PFG GRR+C G+  ALQ+ HLT ARL+QGF+ +TP N  +DM EG   T+P+ TP
Sbjct  494   QFELIPFGSGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTP  553

Query  178   LQLVVTPRLPPNFY  137
             L +++TPRLP + Y
Sbjct  554   LCVMLTPRLPSHLY  567



>ref|XP_006473406.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=523

 Score =   395 bits (1015),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 201/494 (41%), Positives = 307/494 (62%), Gaps = 17/494 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L +  Q+    LG +ADK+GPLF +R G+ P  ++   E AK+ FT H+ D++
Sbjct  46    MIGHLHLL-AGPQLPHLALGALADKYGPLFSIRIGVHPALVVSSWEMAKELFTKHDVDIS  104

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+  VG+ LG+NYA F FS  NAYWR MRK   SELLSN +L+ +KHIR +E+E  IK
Sbjct  105   SRPKLTVGKLLGHNYANFGFSPYNAYWREMRKITASELLSNRRLELLKHIRATEVEGEIK  164

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY   T     +   ++ M +W   L LN    ++AG+RY     GA  ++D TE +  
Sbjct  165   ELYKIWTKKKNESDQILLEMKKWFGDLNLNVILMMIAGKRY----FGARAENDETEVRRY  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +  I   R F  L G+F+++DA P     W D  G+ +AMK+  K++D +++ WI++H  
Sbjct  221   RAAI---RNFFLLGGVFLVRDALP--FLGWLDIGGYEKAMKKTAKELDSLIEEWIEEHRR  275

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +++ G      A  DLD I ++LS ++ E V    +     IK TT ++I+  +DTT  +
Sbjct  276   KKESG------ANLDLDFIDVLLSVLEGEGVDLSDFDVDTVIKATTMTIIVGATDTTTVN  329

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+     +++ ++E+++ VG ER + +SD++KL YLQAV+KE+LRLYP  PL 
Sbjct  330   LTWALSLLLNNRRELEKVKKELDSVVGKERLLCESDIEKLVYLQAVIKETLRLYPAGPLA  389

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
               R  ++DC +  Y +PKG +  +NLWK+  DP+ W +P +F P+RFL       D   +
Sbjct  390   GARQFTEDCTVAEYHVPKGTRLVLNLWKLQTDPRVWSDPLEFKPERFLTTHK-DVDVKGQ  448

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRR+C G+++ALQ+SHL +A  +  F+ STPG   +DM    G+T  RATP
Sbjct  449   HFELLPFGGGRRACPGISFALQMSHLALAAFLHAFDISTPGEAWVDMTGTAGLTNIRATP  508

Query  178   LQLVVTPRLPPNFY  137
             L++++ PRLP + Y
Sbjct  509   LEILLKPRLPSSLY  522



>emb|CAN81014.1| hypothetical protein VITISV_025152 [Vitis vinifera]
Length=519

 Score =   394 bits (1013),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 204/494 (41%), Positives = 309/494 (63%), Gaps = 21/494 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L+ Q  I  RTLG MADKHGP+F+++ GM P  ++   EA K+CFTT+++  A
Sbjct  47    IIGHLHLLSGQVPIF-RTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDKVFA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  +V + LGYNYA F F+    +WR MRK  V E+LS  +L+++K +R+SEL+  I+
Sbjct  106   SRPRSSVSKLLGYNYAGFGFAPYGPFWREMRKLSVVEILSARRLNELKDVRISELDACIQ  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LY     +   +   VV M EW   LT N   R++AG+RY         D+     +EA
Sbjct  166   DLYSLGKDNNWISPIEVV-MSEWFEHLTFNFVLRMIAGKRYF--------DNAVHGNEEA  216

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +  I   ++F  LSG FV  D FP    +  D +G++ +MK   +++D ++ +W+++H+ 
Sbjct  217   RGAIIAIKKFLSLSGAFVPSDVFPF--LERLDLKGYLGSMKHVAEELDCLVGSWVEEHVM  274

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R  L + P    G+  D I ++LS +    +  F ++ +  IK T  ++I+ GSD+T   
Sbjct  275   R--LKSEP----GSRHDFIDVLLSAVQDTSM--FGHSRETVIKATIGNLIVGGSDSTSIT  326

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
               W LS L+   + MK  +EE++ +VG  RWVE+SD++KL+YL+A++KESLRLY   PLL
Sbjct  327   STWILSALLNNREAMKXAQEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYXAAPLL  386

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P   ++DC + GY +PKG +  VN WK+ RDP+ W  P++F P+RFL   A   D    
Sbjct  387   VPHEATQDCHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHA-NLDVFGH  445

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
             +FE +PFG GRR+C G+  ALQ+ HLT ARL+QGF+ +TP N  +DM EG   T+P+ TP
Sbjct  446   QFELIPFGSGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTP  505

Query  178   LQLVVTPRLPPNFY  137
             L +++TPRLP + Y
Sbjct  506   LXVMLTPRLPSHLY  519



>ref|XP_010934114.1| PREDICTED: cytochrome P450 82C4-like [Elaeis guineensis]
Length=527

 Score =   395 bits (1014),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 204/494 (41%), Positives = 294/494 (60%), Gaps = 16/494 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             ++GH+P+L S N I  R L  +AD  GP+F +R G +P  ++   EAAK+CFT H++ +A
Sbjct  49    VLGHLPLLGSHNNI-GRALKALADASGPVFSLRLGASPALVVGTREAAKECFTVHDKALA  107

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
              +P     + + YN AM  FSS   YWR +RK +  ELLS+ +L  + H+R SE++   K
Sbjct  108   GRPRSTASKLMCYNNAMVGFSSYGPYWREVRKILTIELLSHARLGSLAHVRASEVDAFAK  167

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY       E    A V + +W  +LT N   ++VAG+R    V GA+ D  S+E   +
Sbjct  168   TLYGLCRRGDE--GPARVEISKWFQELTFNVVVKMVAGKRCF--VYGAVDDGGSSE---S  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +  I   +    L   FV+ D  P    KW DF G+ +AMKRN   +D I+  W+ +H E
Sbjct  221   RRFIGAIQRMMELLRAFVISDVVPF--LKWMDFGGYEKAMKRNAAVMDCIIGGWLREHRE  278

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR  G           D + +ML+ ++KE      +     IK  + ++II G+DTT   
Sbjct  279   RRMEGRG-----DGKQDFMDVMLAIMEKEGELLSDHDPDTVIKANSLALIIGGTDTTSVT  333

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             M WAL+L++ +  V+++ +EE+EA VG  R V +SDV+KL YLQA+VKE+LRLYP  P+L
Sbjct  334   MTWALALMLNHPHVLRKAQEELEAHVGRARNVNESDVEKLVYLQAIVKETLRLYPPGPIL  393

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P    +DC++ G+D+P G Q  VN W I RDP+ WPEP  F P+RFL    G      +
Sbjct  394   LPHQAMEDCQVAGFDVPAGTQVLVNAWAIQRDPQVWPEPSAFRPERFLTSH-GDVGVRGR  452

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
             + E +PFG GRR+C G ++ALQ+ HLT+AR+I GF+  TP    +DM EG G TLP+ATP
Sbjct  453   QLELLPFGSGRRACPGASFALQVVHLTLARIIHGFDLETPTGEPVDMTEGKGATLPKATP  512

Query  178   LQLVVTPRLPPNFY  137
             L+++VTPRL P  Y
Sbjct  513   LEVLVTPRLAPVLY  526



>ref|XP_002264464.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   394 bits (1013),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 204/495 (41%), Positives = 295/495 (60%), Gaps = 25/495 (5%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             +GH+ +L+ +  +  RTLG MADK GP+F++R GM    ++   EAAK+CFTT+++  AS
Sbjct  48    VGHLHLLHGKVPVF-RTLGAMADKVGPVFVIRLGMYRTLVVSNREAAKECFTTNDKIFAS  106

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  +  + LGYNYA F+F+    YWR MRK  + E+LS  +L  + H+++SEL   IK+
Sbjct  107   RPNSSAAKILGYNYAAFAFAPHGPYWREMRKLSMLEILSTRRLGDLMHVQVSELHAGIKD  166

Query  1255  LYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKV--GGAIGDDDSTEYKE  1082
             LY+    +   N   VV + EW   LT N   R+VAG+RY   V  GG          +E
Sbjct  167   LYILGKDNNWVNPKKVV-ISEWFEHLTFNVVLRMVAGKRYFNNVVHGG----------EE  215

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             A+  I   ++   L G  V  D  P    +W D QGH+ +MK   K++D ++++W+ +H 
Sbjct  216   ARSAIAAIKKVLLLVGASVASDVIPF--LEWVDLQGHLSSMKLVAKEMDSLIESWVKEHT  273

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
              R          A + LD I +ML+ +    +  F Y+ +  IK T  +MI+ GSDTT  
Sbjct  274   GRLN------SEASSSLDFIDIMLTKLKDASL--FGYSRETIIKATVLTMIVAGSDTTSL  325

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
                W LS L+    VMK  +EE++ +VG +RWVE SD++ L Y++A+VKE+LRLY T PL
Sbjct  326   TSTWLLSALLNNKHVMKHAQEELDLKVGRDRWVEQSDIQNLVYIKAIVKETLRLYTTFPL  385

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L+P    +DC +GGY + KG +  VN WK+ RDP  W  P++F P+RFL   A   D   
Sbjct  386   LVPHEAMEDCHVGGYHISKGTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHA-NVDVFG  444

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRRSC G+   LQ+ HLTIARL+QGF+ + P N  +DM EG  V L + T
Sbjct  445   QHFELIPFGSGRRSCPGLNMGLQMLHLTIARLLQGFDMTKPSNSPVDMTEGISVALSKLT  504

Query  181   PLQLVVTPRLPPNFY  137
             PL++++TPRLP   Y
Sbjct  505   PLEVMLTPRLPAELY  519



>ref|XP_007134140.1| hypothetical protein PHAVU_010G022700g [Phaseolus vulgaris]
 gb|ESW06134.1| hypothetical protein PHAVU_010G022700g [Phaseolus vulgaris]
Length=530

 Score =   395 bits (1014),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 201/494 (41%), Positives = 300/494 (61%), Gaps = 18/494 (4%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             IGH+ +LN++     RT   MA+K+GP+F V+ G  P  ++   E AK+C T ++R  AS
Sbjct  51    IGHLHLLNARIPYF-RTFSAMAEKYGPIFCVKLGCHPTIVVNSREIAKECLTKNDRVFAS  109

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  + G  LGYN+A+F  +    YWR +RK  V E+ S+ +L+K+KH+R SE  + +KE
Sbjct  110   RPNTSAGRILGYNHAVFGLAPYGNYWREIRKMAVLEIFSSYRLEKLKHVRDSETLSLVKE  169

Query  1255  LYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQ  1076
             LY  +++      +  VAM   +  +T N   R++AG+R+        GD  + E  EA 
Sbjct  170   LYSSISSIKNVKGSTEVAMSNLLEHMTFNIIVRMIAGKRFG-------GDTVNEEDNEAW  222

Query  1075  EMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIER  896
             ++    ++  YL G+FV+ DA P     WFDFQGH+  MKR  KK+D ILQ W+++H++ 
Sbjct  223   KLRKAIKDATYLCGIFVVADAIPS--LSWFDFQGHLSFMKRTAKKLDFILQKWLEEHVKT  280

Query  895   RQLGNAPAPAAGNDLDLIHLMLSTID-KEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R          G + D + +MLS+ + +E   G  Y  ++ IK T+  +++ GS +T   
Sbjct  281   R----GDNMNGGCERDFMDVMLSSFEGQEDFCG--YNREIVIKATSVLLVLTGSGSTAIT  334

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+ +  V+K  ++E++  VG ERWV++SD+K L YL A++KE+LRLYP  PL 
Sbjct  335   LTWALSLLLNHPRVLKAAQQELDNSVGKERWVQESDIKNLNYLHAIIKETLRLYPPAPLT  394

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
               R   +DC + GY +PKGA+  +NLW++ RDP+ W  P++F P+RFL       D   +
Sbjct  395   GIREAMEDCCVAGYHVPKGARLLINLWELQRDPEVWSNPNEFNPERFLTTHR-DIDFMSQ  453

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PF  GRRSC G+ + LQ+ HLT+ARLIQGF+ ST    E+DM EG GV LP+   
Sbjct  454   NFELIPFSFGRRSCPGVTFGLQVLHLTLARLIQGFDMSTKDGAEVDMTEGLGVALPKENE  513

Query  178   LQLVVTPRLPPNFY  137
             LQL + PRLP   Y
Sbjct  514   LQLTLAPRLPLMLY  527



>ref|XP_006434891.1| hypothetical protein CICLE_v10000852mg [Citrus clementina]
 gb|ESR48131.1| hypothetical protein CICLE_v10000852mg [Citrus clementina]
Length=523

 Score =   394 bits (1012),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 200/494 (40%), Positives = 304/494 (62%), Gaps = 17/494 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L +  Q+    LG +ADK+GPLF +R G+ P  ++   E AK+ FT H+ D++
Sbjct  46    MIGHLHLL-AGPQLPHLALGALADKYGPLFSIRIGVHPALVVSSWEMAKELFTKHDVDIS  104

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+  VG+ LG+NYA F FS  NAYWR MRK    ELLSN +L+ +KHIR +E+E  IK
Sbjct  105   SRPKLTVGKLLGHNYANFGFSPYNAYWREMRKITALELLSNRRLELLKHIRATEVEGEIK  164

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY   T     +   ++ M +W   L LN    ++AG+RY     GA  ++D TE +  
Sbjct  165   ELYKIWTKKKNESDQILLEMKKWFGDLNLNVILMMIAGKRY----FGARAENDETEVRRY  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +  I   R F  L G+F+++DA P     W D  G+ +AMK+  K++D +++ WI++H  
Sbjct  221   RAAI---RNFFRLGGVFLVRDALPF--LGWLDIGGYEKAMKKTAKELDSLIEEWIEEHRR  275

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +++ G         DLD I ++LS ++ E V    +     IK TT ++I+  +DTT  +
Sbjct  276   KKESGT------NLDLDFIDVLLSVLEGEGVDLSDFDVDTVIKATTMTIIVGATDTTTVN  329

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+     + + ++E+++ VG ER + +SD++KL YLQAV+KE+LRLYP  PL 
Sbjct  330   LTWALSLLLNNRRELDKVKKELDSVVGKERLLRESDIEKLGYLQAVIKETLRLYPAGPLA  389

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
               R  ++DC +  Y +PKG +  +NLWK+  DP+ W +P +F P+RFL       D   +
Sbjct  390   GARQFTEDCTVAEYQVPKGTRLVLNLWKLQTDPRVWSDPLEFKPERFLTTHK-DVDVKGQ  448

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRR+C G+++ALQ+SHL +A  +  F+ STPG   +DM    G+T  RATP
Sbjct  449   HFELLPFGGGRRACPGISFALQMSHLALAAFLHAFDISTPGEAWVDMTGTAGLTNIRATP  508

Query  178   LQLVVTPRLPPNFY  137
             L++++ PRLP N Y
Sbjct  509   LEILLKPRLPSNLY  522



>emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera]
Length=528

 Score =   393 bits (1009),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 200/495 (40%), Positives = 298/495 (60%), Gaps = 18/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +  +Q Q+  +TLG MADK+GP+F +R G+  I ++   E A++CFTTH+R  +
Sbjct  49    IIGHLHLFGAQ-QLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFTTHDRVFS  107

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P     + LGY++AMF F+   +YWR MRK V  ELLSN +LD +KHIR SE+ TSI+
Sbjct  108   TRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRASEVGTSIR  167

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY    +    +    V M  W   LTLN + R+V G+RY     GA  D    E +  
Sbjct  168   ELYEMWVSERGTDGRVFVDMKRWFGDLTLNLAVRLVGGKRY----FGAGADTKEGEGRTC  223

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q++I   R+F +L G+FVL DA P     W D +G+ +AMKR  K++D +   W+ +H E
Sbjct  224   QKVI---RDFAHLFGVFVLSDAIP--FLSWLDLKGYKKAMKRTAKELDSLFGGWLQEHKE  278

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +R LG        +D D + +ML+ ++     GF        K T  ++I+ GSDTT   
Sbjct  279   KRLLGG----EGKDDQDFMDVMLTVLEDVNFSGFDA--DTVNKATCLNLILAGSDTTKVT  332

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+ +  V+K+ + E++ QVG +R V++SDVK L YLQA++KE+LRLYP  P++
Sbjct  333   LTWALSLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPII  392

Query  538   MPRMTSKDCKI-GGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
                   +DC +  GY++  G Q  VN WKI RD + W  P +F P+RF+       D   
Sbjct  393   TLHAAMEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHK-DTDVRG  451

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRRSC G++ ALQ+ H  +A L+  +  + P + ++DM E  G+T  +AT
Sbjct  452   QHFELIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKAT  511

Query  181   PLQLVVTPRLPPNFY  137
             PL+++++PRL    Y
Sbjct  512   PLEVLLSPRLKAELY  526



>ref|XP_010264712.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   393 bits (1009),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 210/496 (42%), Positives = 299/496 (60%), Gaps = 19/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+P+L    ++   TLG MADK+GP F +R G+    ++   E AK+CFT ++R +A
Sbjct  49    VIGHLPLLGGP-ELPHITLGAMADKYGPAFTIRLGVRRALVVSDWEVAKECFTINDRALA  107

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P     +H+GYNYAMF+F+    YWR +RK    ELLSN +L+ +KH+R+SE+  S++
Sbjct  108   TRPSGVAMKHMGYNYAMFAFAPYGPYWREVRKIATLELLSNRRLEMLKHVRVSEVNMSVR  167

Query  1258  ELY-LFVTASPEPNKAAV-VAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             ELY L++         +V V M  W   LTLN   R+VAG+RY F    A G        
Sbjct  168   ELYGLWLKNKNATGADSVKVEMKRWFGDLTLNNVLRMVAGKRY-FGATAACGS------A  220

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EA     V R F  L G FV+ DA P     W D QGH +AMKR  K++D IL+ W+++H
Sbjct  221   EAVRCQTVMRSFFRLVGQFVIADAIPF--LGWLDMQGHEKAMKRTAKELDSILEGWMEEH  278

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              + R L N     A  + D + +MLS +    + G  Y      K T  ++I+ G+DT  
Sbjct  279   RKMR-LSN---DEANGEQDFMDVMLSILKDSKLSG--YDADTINKATCMNLILGGNDTIK  332

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
               + WALSLLV   +V+KR ++E++  VG +R VE+SD+KKLEYLQAVVKE+LRLYP  P
Sbjct  333   VCLTWALSLLVNNQEVLKRVQDELDRHVGKDRNVEESDMKKLEYLQAVVKEALRLYPPAP  392

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             L  P    ++C + GY +P G +  VNL KI RDP+ W +P +F P+RFL     G D  
Sbjct  393   LSGPHEAMEECTVAGYHVPVGTRILVNLSKIQRDPRVWSDPLEFRPERFLTSHV-GVDVL  451

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRR+C G +  L++ HL +ARL+  F+  TP    +DM E FG+T  +A
Sbjct  452   GQHFELIPFGSGRRACPGTSLGLKVVHLALARLLHAFHLHTPSGAPVDMTESFGLTNLKA  511

Query  184   TPLQLVVTPRLPPNFY  137
             TPL++++ PRLP + Y
Sbjct  512   TPLEVLLLPRLPSHLY  527



>ref|XP_007017404.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14629.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=527

 Score =   393 bits (1009),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 202/493 (41%), Positives = 312/493 (63%), Gaps = 16/493 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L + +Q+    LG++A+K+GP+F +R G+ P  ++   E AK+ FTT++  V+
Sbjct  49    LIGHLHVL-AGSQLPYLALGDLANKYGPIFTIRIGLHPAVVVSSSELAKEIFTTYDVAVS  107

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+  VG +LGYN A F FS   AYWR MRK   SELLSN +L+ +KHI+ SE+E+S+K
Sbjct  108   SRPKLTVGNYLGYNCANFGFSPYGAYWREMRKITASELLSNRRLELLKHIKASEVESSVK  167

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY   T + + +   +V M +W  +L LN   R++AG+R+    G  +  D++    EA
Sbjct  168   ELYKLWTKTKDESGHVLVEMKQWFGELNLNVILRMIAGKRF---FGAGVASDEN----EA  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +      REF  L+G+FV++DA P     W D  GH +AMK+N K++D I++ W+++H+ 
Sbjct  221   RRCRKAMREFFRLAGLFVVRDAVP--FLGWLDLGGHEKAMKKNAKELDSIMEEWLEEHLR  278

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             ++   +     A  + D I ++LS +D   ++G  Y      K T  ++++ G+DTT   
Sbjct  279   KK---DTVGEIAKGEQDFIDVLLSVLDGVDLEG--YDVNTVTKATAMTLLVGGTDTTTVT  333

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WAL+LL+ +   +++ +EE++ Q+G ER V ++D+ KL YLQA+VKESLRLYP  PL 
Sbjct  334   ITWALALLLNHRHALEKAQEELDIQIGRERLVNEADIDKLVYLQAIVKESLRLYPAGPLS  393

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
               R  ++DC IGGY +PKG +  VNLWKI  DP+FW +P +F P+RF+       D   +
Sbjct  394   GAREFTEDCTIGGYHVPKGTRLIVNLWKIQTDPQFWFDPLEFKPERFITSHL-DVDVKGQ  452

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRR C G+ + LQ++HL +ARL+  F+  TP N  +DM    G+T  +ATP
Sbjct  453   HFELIPFGAGRRLCPGINFGLQMTHLVLARLLHAFDIWTPSNEPVDMTGSPGLTNIKATP  512

Query  178   LQLVVTPRLPPNF  140
             L+++V PRL PN 
Sbjct  513   LEVLVKPRLSPNL  525



>ref|XP_006355071.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=525

 Score =   392 bits (1008),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 191/483 (40%), Positives = 301/483 (62%), Gaps = 20/483 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQ--NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             +IGH+   ++   ++ L+R L ++ADK+GP+F  R G+  + +I   +A KDC++ ++  
Sbjct  48    VIGHLFYFDNDGDDRPLARKLSDLADKYGPVFTFRLGLPRVLVISSSDAVKDCYSKNDAV  107

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              A++P    GE+LGYN AM   ++   YWR +RK V+ E+LSN +L+K+K I++ ++  +
Sbjct  108   FANRPACLYGEYLGYNNAMLFLANYGPYWRNIRKLVIQEVLSNTRLEKLKQIKLCKIRNN  167

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             IK L+  +  + E    +VV + +W+ +L      +++AG+ Y+     + GD +   +K
Sbjct  168   IKNLHSRIQNTEE---KSVVNLTDWLEELNFGLIVQMIAGKNYE-----SGGDGEMERFK  219

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EA      FR+F  LS  FVL DAFP+ LFKW DFQGHV+ MK+  K +D I Q W+D+H
Sbjct  220   EA------FRKFLVLSMEFVLWDAFPIPLFKWIDFQGHVKLMKKTFKDIDSIFQRWLDEH  273

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             ++ R+         GN+ D I +MLS +  E +    Y+    IK T  S+++D +DT  
Sbjct  274   VKTRETSLMEVNGGGNERDFIDVMLSKMSNEHLHE-GYSRDTVIKATVFSLVLDAADTVS  332

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              H+ W ++LL+    V+K+ +EEI+ ++G +RW++D+D+K L YLQA++KE LRLYP  P
Sbjct  333   LHINWGMTLLINNQHVLKKAQEEIDMKIGKDRWIDDNDIKDLVYLQAIIKEVLRLYPPGP  392

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL+P   ++DC + GY +PKG +   N+ K+ RD K W  PD+F P RF   +    D  
Sbjct  393   LLVPHENTEDCVVSGYHIPKGTRLYTNVMKLQRDLKIWSNPDQFNPDRFFTTD---IDFR  449

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +E++PFG GRRSC GM YALQ+ +LTI  LIQGF++ TP +  LDM+EG G+T+ + 
Sbjct  450   GQDYEFIPFGSGRRSCPGMTYALQVEYLTIGHLIQGFDYKTPSDEPLDMKEGPGMTMRKV  509

Query  184   TPL  176
               L
Sbjct  510   MVL  512



>emb|CDP15728.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   392 bits (1008),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 195/495 (39%), Positives = 308/495 (62%), Gaps = 17/495 (3%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             IGH+  L  Q   L+R LG MADKHGP+F +R G  P  ++   E  KDCFTT+++  AS
Sbjct  49    IGHLHHLGGQLP-LARILGSMADKHGPIFSLRLGSRPAIVVSSWEMVKDCFTTNDKTFAS  107

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  AV +++G N A+FS +    YWR +RK V  ELL+N +L+K+KH+R SE    I++
Sbjct  108   RPNMAVAKYMGNNNAIFSLAPYGPYWRDVRKMVTLELLTNQRLEKLKHVRASEFNKWIRD  167

Query  1255  LYLFVTAS--PEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             LY   + +  P+ +    V ++EW   LT N   R++ GR +     G    +D++E + 
Sbjct  168   LYSLCSKNDRPDVDVPTKVVLNEWFELLTFNLILRMLVGRPFSTSSQG----NDNSEDRR  223

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              +E I   ++  YLSG+FV  D  P    +W D  GH+++MK+  K++D++L  W+ +HI
Sbjct  224   LKEAI---KKALYLSGVFVFSDVIPW--IEWLDIGGHIKSMKKAGKELDEVLGQWLQEHI  278

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             ++ +  +  + A     D + +MLSTI  E  +   +     IK TT ++I+ GS++T  
Sbjct  279   QKAKQSHPESEAVH---DFMDVMLSTI-PEIGEISGHKRDAIIKSTTATLILTGSESTAE  334

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              ++WALSLL+ + +++K  + E++ QVG +RW+E++D+K L +LQA+VKE+ RLYP  PL
Sbjct  335   TLIWALSLLLNHPNILKIAQNELDVQVGKQRWIEEADIKNLSFLQAIVKETFRLYPPGPL  394

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
               PR  ++DC +G + +PKGA+  VNLWK+ RDP+ W +P +F P+RF+N     +    
Sbjct  395   SGPREATEDCYLGNFFVPKGARLIVNLWKLHRDPRIWSDPLEFKPERFMNSHENISLKG-  453

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FEY+PF  GRR C  + Y + +  LT+AR++Q F+ +TP  + +DM EG GV LP+  
Sbjct  454   QSFEYIPFSSGRRMCPAVNYGMNVVQLTLARMLQAFDITTPMGMPVDMGEGLGVALPKLK  513

Query  181   PLQLVVTPRLPPNFY  137
             PL++++TPRLP   Y
Sbjct  514   PLEVLLTPRLPVELY  528



>gb|KDO84377.1| hypothetical protein CISIN_1g009899mg [Citrus sinensis]
Length=523

 Score =   392 bits (1008),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 199/494 (40%), Positives = 307/494 (62%), Gaps = 17/494 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L +  Q+    LG +ADK+GPLF +R G+ P  ++   E AK+ FT H+ D++
Sbjct  46    MIGHLHLL-AGPQLPHLALGALADKYGPLFSIRIGVHPALVVSSWEMAKELFTKHDVDIS  104

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+  VG+ LG+NYA F FS  NAYWR MRK   SELLSN +L+ +KHIR +E++  IK
Sbjct  105   SRPKLTVGKLLGHNYANFGFSPYNAYWREMRKITASELLSNRRLELLKHIRATEVDGEIK  164

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             E+Y   T     +   ++ M +W   L LN    ++AG+RY     GA  ++D TE +  
Sbjct  165   EIYKIWTKKKNESDQILLEMKKWFGDLNLNVILMMIAGKRY----FGARAENDETEVRRY  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +  I   R F  L G+F+++DA P     W D  G+ +AMK+  K++D +++ WI++H  
Sbjct  221   RAAI---RNFFLLGGVFLVRDALP--FLGWLDIGGYEKAMKKTAKELDSLIEEWIEEHRR  275

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +++ G      A  DLD I ++LS ++ E V    +     IK TT ++I+  +DTT  +
Sbjct  276   KKESG------ANLDLDFIDVLLSVLEGEGVDLSDFDVDTVIKATTMTIIVGATDTTTVN  329

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+     +++ ++E+++ VG ER + +SD++KL YLQAV+KE+LRLYP  PL 
Sbjct  330   LTWALSLLLNNRRELEKVKKELDSVVGKERLLCESDIEKLVYLQAVIKETLRLYPAGPLA  389

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
               R  ++DC +  Y +PKG +  +NLWK+  DP+ W +P +F P+RFL       D   +
Sbjct  390   GARQFTEDCTVAEYHVPKGTRLVLNLWKLQTDPRVWSDPLEFKPERFLTAHK-DVDVKGQ  448

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRR+C G+++ALQ+SHL +A  +  F+ STPG   +DM    G+T  RATP
Sbjct  449   HFELLPFGGGRRACPGISFALQMSHLALAAFLHAFDISTPGEAWVDMTGTAGLTNIRATP  508

Query  178   LQLVVTPRLPPNFY  137
             L++++ PRLP + Y
Sbjct  509   LEILLKPRLPSSLY  522



>ref|XP_002264790.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=519

 Score =   392 bits (1006),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 202/495 (41%), Positives = 293/495 (59%), Gaps = 25/495 (5%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             +GH+ +L  +  +  RTLG MADK GP+F++R GM    ++   EAAK+CFTT+++  AS
Sbjct  48    VGHLHLLQGKVPVF-RTLGAMADKVGPVFVIRLGMYRALVVSNHEAAKECFTTNDKVFAS  106

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  +  + LGYNY  F  +     WR +RK  + E+LS  +L  + H+ +SEL   IK+
Sbjct  107   RPSSSASKILGYNYVAFGLAPYGPLWREIRKLCMLEILSTRRLSDLMHVHVSELHAGIKD  166

Query  1255  LYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKV--GGAIGDDDSTEYKE  1082
             LY+        N   VV + EW   L  N   R+VAG+RY   V  GG          +E
Sbjct  167   LYILGKDYNWVNPKKVV-ISEWFEHLNFNVVLRMVAGKRYFNNVVHGG----------EE  215

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             A     V ++   L+G FV  D  P    +W D QGH+ +MK+  K++D +L++W+++H 
Sbjct  216   AGSATAVIKKLVPLAGAFVASDVIPF--LEWVDLQGHLSSMKQVAKEMDSVLESWVEEHT  273

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
              R          A +  D I +ML+ +    +  F Y+ +  IK T   +I+ GSDTT  
Sbjct  274   GRLN------SEASSRQDFIDIMLTKLKDASL--FGYSRETIIKATVMMLIVAGSDTTSI  325

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
                W LS L+    VMK  +EE++ +VG +RWVE SD++ L YL+A+VKE+LRLYP VPL
Sbjct  326   TSTWLLSALLNNRHVMKHAQEELDLKVGRDRWVEQSDIQNLVYLKAIVKETLRLYPAVPL  385

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L+P    +DC +GGY +PKG +  VN WK+ RDP  W  P++F P+RFL   A   D   
Sbjct  386   LVPHEAMEDCHVGGYHIPKGTRLLVNAWKLHRDPAVWSNPEEFQPERFLTSHA-TVDVLG  444

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRRSC G+  ALQ+ HLTIA+L+QGF+ +TP N  +DM E   +T+P+ T
Sbjct  445   QNFELIPFGSGRRSCPGINMALQMLHLTIAQLLQGFDMATPSNSPVDMAEAISITMPKLT  504

Query  181   PLQLVVTPRLPPNFY  137
             PL++++TPRLP   Y
Sbjct  505   PLEVMLTPRLPAELY  519



>ref|XP_002274509.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=543

 Score =   392 bits (1007),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 207/494 (42%), Positives = 300/494 (61%), Gaps = 23/494 (5%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             +GH+PIL  Q  I  RTLG MADKHGP+F++R G+    ++   EA K+CFTT+++  AS
Sbjct  72    LGHLPILRGQTPIF-RTLGAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFAS  130

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  + G+ LGYN+A F F+   A WR MRK  + E+LS  +LD +KH+++SEL+ SIK+
Sbjct  131   RPSSSAGKILGYNHAGFGFAPYGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKD  190

Query  1255  LYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQ  1076
             LY     S   +   VV M EW   L+ N   +++AG+RY F   G  G++      EA+
Sbjct  191   LYSLGKGSDWFHPVKVV-MSEWFQHLSFNIVLKMIAGKRY-FNTSGH-GNE------EAR  241

Query  1075  EMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIER  896
               I   ++  +L+G FVL DA P    +W D QG++ +MK+  K+VD ++  W+++H  R
Sbjct  242   RAIATIQKLLFLTGAFVLSDAIPG--VEWMDSQGYLGSMKQVAKEVDSLVGGWVEEHEMR  299

Query  895   RQLGNAPAPAAGNDL-DLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
                      + GN   D I +MLS ++   +  F ++ +  IK T   +I+ G+DT  T 
Sbjct  300   LN-------SEGNKRQDFIDVMLSVLEDTSM--FGHSRETVIKATIMILIVGGTDTVSTT  350

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
               W LS L+     +K  +EE++ +VG  RWVE+SD+  L YLQAV+KE+LRLY   PL 
Sbjct  351   STWLLSALLNNKHALKCAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTATPLS  410

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              P    +DC + GY +PKG +  VN WK+ RDP  W +P+ F P+RFL   A   D   +
Sbjct  411   APHEAMEDCHVAGYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPERFLTTHA-DLDVLGQ  469

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRRSC G+  AL++  L I RL+QGF+ STP N  +DM EG  +TL + TP
Sbjct  470   HFELIPFGSGRRSCPGITMALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTP  529

Query  178   LQLVVTPRLPPNFY  137
             L++++TPRLP  FY
Sbjct  530   LEVMLTPRLPSQFY  543



>ref|XP_011039260.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=528

 Score =   392 bits (1006),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 199/496 (40%), Positives = 294/496 (59%), Gaps = 18/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +   + Q+  + LG MADK+GP+F ++ G   + ++   E A+DCFT H+R  +
Sbjct  50    IIGHMHLFGGK-QLTHKILGAMADKYGPVFTIKLGSHRVLVVNSWEMARDCFTVHDRAFS  108

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  + LGY+ AMF F+    YWR MRK    ELLS+ ++D ++HIR SE+ET+I+
Sbjct  109   SRPSIAASKLLGYDLAMFGFAPYGPYWREMRKITTIELLSSHRIDMLRHIRASEVETAIR  168

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +L+    +         V M +W  +LTLN   R+V G+RY        G     E  EA
Sbjct  169   DLHKMWVSKGSAESGVTVDMKQWFGELTLNIVLRMVGGKRY-------FGPSADGEEAEA  221

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +    V R+F  L G+FVL DA P     W DF G+ +AMKR  K++D +   W+++H +
Sbjct  222   RRNQKVMRDFVRLFGVFVLSDAIP--FLGWLDFNGYEKAMKRTAKELDILAGGWLEEHKQ  279

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR LG         + D + +ML+ ++K  + GF        K T  ++I+ GSDTT   
Sbjct  280   RRLLGGKEK----QEQDFMDVMLNILEKANIGGF--DADTINKATCLNVILAGSDTTMVT  333

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+    V+K+ ++E++  VG +R V++SD+  L YLQA++KE+LRLYP  PL+
Sbjct  334   LTWALSLLLNNPQVLKKAKDELDIHVGKDRLVDESDINNLVYLQAIIKETLRLYPPSPLI  393

Query  538   MPRMTSKDCKIG-GYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
               R   +DC +  GY +P G +   N WKI RD + WP PD+F P+RFL  +    D   
Sbjct  394   AHRSAKEDCTLSVGYHVPSGTRLMANAWKIQRDERVWPNPDEFHPERFLTSQK-EIDLKG  452

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRRSC G+A AL+I H T+ARL+  F  + P   ++DM E  G+T  +AT
Sbjct  453   QNFELIPFGSGRRSCPGIALALRIVHFTLARLLHSFEVTKPSREDVDMTESHGLTNLKAT  512

Query  181   PLQLVVTPRLPPNFYG  134
             PL++++ PRL P  YG
Sbjct  513   PLEILLIPRLNPRLYG  528



>emb|CAN61061.1| hypothetical protein VITISV_018742 [Vitis vinifera]
Length=542

 Score =   391 bits (1004),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 209/518 (40%), Positives = 302/518 (58%), Gaps = 47/518 (9%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             +GH+P+L  Q  I  RTLG MADKHGP+F++R G+    ++   EA K+CFTT+++  AS
Sbjct  47    LGHLPLLRGQTPIF-RTLGAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFAS  105

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  + G+ LGYNYA F F+   A WR MRK  + E+LS  +LD +KH+++SEL+ SIK+
Sbjct  106   RPSSSAGKLLGYNYAGFGFAPYGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKD  165

Query  1255  LYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQ  1076
             LY     S   +   VV M EW   L+ N   +++AG+RY    G  I        +EA+
Sbjct  166   LYSLGKGSDWVHPVKVV-MSEWFQHLSFNIVLKMIAGKRYFNTSGHGI--------EEAR  216

Query  1075  EMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIER  896
               I   +EF  LSG FVL DA P    +W D QG++ +MKR  K+VD ++  W+++H  R
Sbjct  217   RAIATIQEFLSLSGAFVLSDAIPG--VEWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIR  274

Query  895   RQLGNAPAPAAGNDL-DLIHLMLSTIDKEFVKGFPYTHQMAIKGTT--------------  761
                      + G+ + D I +MLS ++   +  F ++ +  IK T               
Sbjct  275   LN-------SEGSRMQDFIDVMLSVLEDTSM--FGHSRETVIKATIVVRSSPIHELLLLS  325

Query  760   ----------QSMIIDGSDTTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSD  611
                       + +I+ G++T  T   W LS L+     +KR +EE++ +VG  RWVE+SD
Sbjct  326   WKSVFLQPTLKILIVGGTETVATTSTWLLSALLNNKHALKRAQEELDLKVGRGRWVEESD  385

Query  610   VKKLEYLQAVVKESLRLYPTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFW  431
             +  L YLQAV+KE+LRLY   PL +P    +DC + GY +PKG +  VN WK+ RDP  W
Sbjct  386   IPNLLYLQAVIKETLRLYTAAPLSVPHEAMEDCHVAGYHIPKGTRLFVNAWKLHRDPSVW  445

Query  430   PEPDKFMPKRFLNREAGGADNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFN  251
              +P+ F P+RFL   A   D   + FE +PFG GRRSC G+  AL++  L I RL+QGF+
Sbjct  446   SDPEDFQPERFLTSHA-DFDVLGQHFELIPFGSGRRSCPGITMALKLLPLVIGRLLQGFD  504

Query  250   FSTPGNVELDMEEGFGVTLPRATPLQLVVTPRLPPNFY  137
              STP N  +DM EG  +TL + TPL++++TPRLP  FY
Sbjct  505   LSTPLNAPVDMREGLSITLAKLTPLEVILTPRLPSQFY  542



>ref|XP_002531093.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF31307.1| cytochrome P450, putative [Ricinus communis]
Length=523

 Score =   390 bits (1002),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 192/496 (39%), Positives = 311/496 (63%), Gaps = 21/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH  +L  Q +   R LG++ADK GPL+ +R G+  I +  G E  K+CFTT++R  A
Sbjct  44    LIGHFHLLARQ-EPACRILGDIADKTGPLYSLRLGINRIMVASGWEVVKECFTTNDRIFA  102

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++   A G+++GYN A+F+ +    YWR +RK    +LLS+ +L+K+KH+R+SE++T +K
Sbjct  103   TRASIAAGKYIGYNNAIFALAPYGQYWRDVRKLATLKLLSSNRLEKLKHVRLSEVDTFLK  162

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDST--EYK  1085
             +L+     S + N A V+ ++    +LT N S R++ G+++        G+++S    YK
Sbjct  163   DLHNLYVESADSNHAKVI-INTLFERLTFNISLRMIVGKQFS---SSTYGEENSEPWRYK  218

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             +A E      E  YLSG FV+ DA P    +W D QGH+ AMKR  K++D +++ W+++H
Sbjct  219   KAIE------EAVYLSGTFVMSDAIPW--LEWIDHQGHISAMKRTAKELDAVIETWLEEH  270

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I++R    +       + D + +MLS +D++ V    ++    IK T   + + GS +T 
Sbjct  271   IKKR----SSDECHKGENDFMDVMLSDLDEDAVMS-GHSRDTVIKATAMILTLTGSGSTA  325

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
               + WALSLL+    V+K  +EE++  VG E+WV++SD++ L+YLQA+VKE+LRLYP  P
Sbjct  326   VTLTWALSLLLNNPGVLKAAQEELDIHVGREKWVQESDIENLKYLQAIVKETLRLYPPGP  385

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             L   R  S+DC +GGY +PKG +  +N+W++ RDP+ W +P +F P+RFL   +   D  
Sbjct  386   LTGIREASEDCNLGGYFVPKGTRLIINIWQLQRDPRVWKDPGEFQPERFLTTHS-DVDFR  444

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE++PF  GRRSC  + + LQ+ HLT+AR++QGF+ +T G + +DM EG G+ LP+ 
Sbjct  445   GQNFEFIPFSSGRRSCPAITFGLQVVHLTLARVLQGFDLTTIGGLPVDMTEGLGIALPKV  504

Query  184   TPLQLVVTPRLPPNFY  137
              P+++++ PRL    Y
Sbjct  505   NPVEVIIKPRLGLELY  520



>ref|XP_006443549.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
 ref|XP_006479223.1| PREDICTED: cytochrome P450 82G1-like [Citrus sinensis]
 gb|ESR56789.1| hypothetical protein CICLE_v10019706mg [Citrus clementina]
Length=525

 Score =   390 bits (1001),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 194/494 (39%), Positives = 307/494 (62%), Gaps = 18/494 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+P+LN Q  I  + LG +ADK+GP++ +R G  PI ++   E  KDCFTT++R +A
Sbjct  47    LIGHLPLLNGQEPI-CKILGALADKYGPIYSLRLGKHPILIVSSWEIVKDCFTTNDRILA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++ +   G+ +GY+ A+F+ +    YWR +RK   +ELLS+ +L+ +KH+R SE++T IK
Sbjct  106   TRAKIVAGKLMGYDNAIFALAPYGPYWRDIRKIATTELLSSHRLELLKHVRYSEVDTFIK  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LY     S      A V + + I QLT N S +++AG+R+  K       D   +  EA
Sbjct  166   DLYSL--CSENAFNPAKVVISKLIEQLTFNISLKLIAGKRFSAK-------DYEEQGSEA  216

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
               +    +E  +L G+F+L DA P    +W DFQGHV +MK   K++D ++  W+ + ++
Sbjct  217   WRINRAIKEATHLFGVFILGDAIPW--LEWIDFQGHVGSMKSTAKEIDDVIGNWLKERLQ  274

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
              +  G           DLI ++LS + ++ V G  +T    +K T   +I+ GS++T   
Sbjct  275   NKLQGEGHNGKG----DLIDVLLSKLQEDAVMG-GHTRDTVVKATALILILTGSESTYLG  329

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             ++W +SLL+ +   +K+ +EE++  VG +RWV +SD+KKL+YL+A+VKE+LR+YP  P+ 
Sbjct  330   IIWTMSLLLNHPKELKKAQEELDVHVGRDRWVNESDMKKLKYLRAIVKETLRIYPPGPVT  389

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
               R   +DC+IGGY +PKG +  VN+WK+ RDP+ W  P +F P+RFL   A   D   +
Sbjct  390   GIREAMEDCEIGGYHVPKGTRLIVNIWKLHRDPRMWENPCEFRPERFLTTHA-DVDVNTQ  448

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FEYVPF  GRRSC GM   LQI  LT+AR++QGF+ +T G   +DM+ G G+ LP++ P
Sbjct  449   HFEYVPFSFGRRSCPGMTSGLQIVQLTLARILQGFDLATVGGTPVDMQIGLGLALPKSNP  508

Query  178   LQLVVTPRLPPNFY  137
             L++++ PRL  + +
Sbjct  509   LEVIIKPRLAEDLF  522



>ref|XP_007017409.1| Cytochrome P450, family 82, subfamily C, polypeptide 4, putative 
[Theobroma cacao]
 gb|EOY14634.1| Cytochrome P450, family 82, subfamily C, polypeptide 4, putative 
[Theobroma cacao]
Length=514

 Score =   389 bits (998),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 203/468 (43%), Positives = 293/468 (63%), Gaps = 21/468 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+L    Q    TLG MADKHGP+F++R G+   A++   + AK+ FT ++  V+
Sbjct  63    IIGHLPLLGGPEQP-HVTLGAMADKHGPVFMIRLGVHQAAVVSSSDIAKEIFTVNDMAVS  121

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+ + A  EHLGYNYAMF FS    +WR MRK  + ELLSN +++K++++ +SE+E S+K
Sbjct  122   SRSKMAAAEHLGYNYAMFGFSPYGQFWREMRKITMLELLSNHRIEKLRNVFVSEIEGSLK  181

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDS-TEYKE  1082
             +LY F       +    V M +    LTLN   R+VAG+RY    GGA  D+   T+Y++
Sbjct  182   DLYKFWLEEKNDSGHVFVEMKKQFGDLTLNVILRMVAGKRY---TGGAKEDEKVVTQYRK  238

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             A       R+F +L+GMFV+ DA P+   +W D  GHV+ MK+  K++D+I+  W+D H 
Sbjct  239   A------LRDFFHLTGMFVMGDAVPI--LRWLDLGGHVKHMKKTAKELDEIVGGWLDDH-  289

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
              RR   N        D D +H+M S +    + G  Y      K T+ +MI++GSDTT  
Sbjct  290   -RR---NGRWDETKTDKDFMHVMQSVLRGSDLAG--YDADTINKATSLNMILEGSDTTAV  343

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              ++WALSLL+    ++K+ +EE++  VG ER+V +SD+ KL Y+QA++KE+LR+YP  PL
Sbjct  344   TLIWALSLLLNNPHLLKKAQEELDTHVGKERFVHESDISKLVYIQAIIKETLRMYPPAPL  403

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
               PR  S+ C +GGYD+P G +  VNL KI RDPK WPEP +F P+RFL       D   
Sbjct  404   SAPRELSECCCVGGYDIPDGTRLIVNLHKIQRDPKIWPEPSEFRPERFLTTNK-DVDVRG  462

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDM  218
             + FE +PFG GRRSC G ++ALQ+ HLT++  +  FNFSTP N  +D+
Sbjct  463   QHFELMPFGSGRRSCPGTSFALQMLHLTLSNFLHAFNFSTPANGLIDL  510



>ref|XP_011030924.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=521

 Score =   389 bits (998),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 204/495 (41%), Positives = 298/495 (60%), Gaps = 18/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+L + +++    LG++ADK+GP+F +R GM P  ++   E AK+ FT ++  V+
Sbjct  43    IIGHLPLL-AGSELPHLRLGDLADKYGPIFTIRIGMYPALVVSSWELAKELFTINDAIVS  101

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+ +    + LGYN+A F FS    +WR +RK V SELLSN +L+ +KH+R SE+E S+K
Sbjct  102   SRSKLTASKILGYNFASFGFSPYGEFWRGIRKIVASELLSNRRLELLKHVRASEVEVSVK  161

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             ELY L+ +         +V M +WIA + LN   R++AG+RY +  G        TE  E
Sbjct  162   ELYKLWYSKDKNEESQILVNMKQWIADMNLNLMLRMIAGKRY-YDAGIV------TEENE  214

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             A+      REF +L+G+FVL+DA P     W D+ G+ +AMKRN +++D I   W+++H 
Sbjct  215   ARRCQRAMREFFHLTGLFVLRDAVPF--LGWLDWGGYEKAMKRNAEELDNIFAEWLEEHR  272

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
              +R  G +    A  + D + +ML  +D   + G  Y      K T+ S+II G+DT   
Sbjct  273   RKRDSGES----ANKEQDFMDVMLYALDGINLAG--YDADTVRKATSLSLIIGGTDTITV  326

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              ++WALSLL+     +K  +EE++  VG ER V +SD++KL YLQA VKE+LRLYP  PL
Sbjct  327   TIIWALSLLLNNTVALKNAQEELDVHVGKERLVNESDIEKLTYLQACVKEALRLYPAGPL  386

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
                R  + DC IGGY +P G +  +N+ KI RDP+ WP P +F P+R L       D   
Sbjct  387   GGFREFTADCTIGGYHVPAGTRLLLNIHKIQRDPRVWPNPTEFKPERLLGSHE-AVDVKG  445

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRR+C G    L++SHL +A ++Q F  S P N  +DM    G+T   AT
Sbjct  446   QHFELIPFGAGRRACPGATLGLRMSHLVLASILQAFEISPPSNAPIDMTGTAGLTCSPAT  505

Query  181   PLQLVVTPRLPPNFY  137
             PLQ++V PRLP + Y
Sbjct  506   PLQVLVKPRLPASVY  520



>gb|KDP26346.1| hypothetical protein JCGZ_17504 [Jatropha curcas]
Length=515

 Score =   388 bits (997),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 200/494 (40%), Positives = 304/494 (62%), Gaps = 28/494 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+  L  + + L+RT+G++ADK GP+F VR G     +I   EA K+ FTT++   +
Sbjct  46    IIGHLHRLGGE-KTLARTMGDLADKCGPIFTVRLGAHKAIIISNYEAMKETFTTNDILFS  104

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  +  +++GYNYA F F+    YWR MRK ++ ELLS  ++  ++H+++SE+   IK
Sbjct  105   SRPPSSQAKYIGYNYAAFGFAPYGTYWRNMRKLIMIELLSVQRIKLMRHVQVSEVNNMIK  164

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LY         +    + M E +  L LN   R+VAG+RY F  G + G D+       
Sbjct  165   DLY--------SDSKKKIDMSEMLEHLILNIITRMVAGKRY-FD-GNSEGRDE-----HG  209

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             + +  + REF ++ G  V  D  P     W+D QG  + MK+ +K++D I+  WI++H  
Sbjct  210   RPIGKIMREFMFVVGALVPGDLIPF--LGWWDIQGIKKTMKKVSKELDVIMSTWIEEHKT  267

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             ++           ++ D I +MLS I+ +    F +   + IK T  S+I+ GSDTT   
Sbjct  268   KKN-------KTDSNKDFIDVMLSVIEDDTT--FGHKCDVIIKSTAMSLIVAGSDTTSIT  318

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             M WALS L+     ++R +EE++ +VG +RWV+DSD++KL+Y  AV+KE+LRLYP  PL 
Sbjct  319   MTWALSSLLNNRKTLERLQEELDQKVGRDRWVDDSDIEKLDYFSAVIKETLRLYPPGPLG  378

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +PR  ++DC I GY +PKG +   NLWK+ RDP  W +P++F P+RFL   A   D   +
Sbjct  379   VPREATEDCTIAGYHIPKGTRLFTNLWKLHRDPNVWADPEEFKPERFLTDNA-NLDVSGQ  437

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FEY+PFG GRRSC G+ +A+Q+ ++T+ARL+Q ++F TPGN  +DM EG G+ LP+ TP
Sbjct  438   HFEYLPFGAGRRSCPGLNFAMQVMNITLARLLQAYDFRTPGNEPVDMTEGKGIALPKITP  497

Query  178   LQLVVTPRLPPNFY  137
             L++V+TPRL P  Y
Sbjct  498   LEVVLTPRLAPELY  511



>ref|XP_002283952.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   389 bits (998),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 204/489 (42%), Positives = 289/489 (59%), Gaps = 17/489 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L     +     G MADK+GP+F +R G+    ++   E AK+CFTTH+  +A
Sbjct  47    IIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVNSWEMAKECFTTHDLALA  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+PE    ++LGYNYAMF+FS   AYWR +RK    ELLSN +L+ +K++R+SE+ET +K
Sbjct  107   SRPEVEAAKYLGYNYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMK  166

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY             +V M EW   LTLN    +VAG+RY        G    ++ KEA
Sbjct  167   ELYKLWAEKKNEAGVVLVDMKEWFGHLTLNVILMMVAGKRY-------FGYTGESKEKEA  219

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q+     REF  L G+FV+ DA P   F W D  GH++AMK+  K++D I Q W+++H +
Sbjct  220   QQCRKAIREFFRLWGLFVVSDAIP--FFGWLDVGGHLKAMKKTAKELDGIAQEWLEEHRQ  277

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R+  G A     GN  D + + LS +    +    Y      K T   +I  G+DTT   
Sbjct  278   RKDSGEAD----GNQ-DFMDVTLSILGGRDIT--DYDADTINKATALILIGGGTDTTSAT  330

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + W +SLL+   DV+++ +EE++A VG ER V + D+ KL YLQA+VKE+LR+ PT PL 
Sbjct  331   LTWVISLLLNNPDVLRKAQEELDAHVGKERLVNEMDISKLVYLQAIVKETLRINPTAPLS  390

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR   +D  +GGY + KG +  +NL KI RDP+ W  P +F P RFL       D   K
Sbjct  391   GPRQFIQDSILGGYHISKGTRLILNLTKIQRDPRVWLNPMEFQPDRFLTTHK-DVDVRGK  449

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
             +FE  PFG GRR C G  +ALQ+ HLT+A  +  F  STP +  +DM E FG+T  ++TP
Sbjct  450   QFELTPFGGGRRICPGAVFALQVLHLTLANFLHRFQLSTPSDAPVDMSESFGLTNIKSTP  509

Query  178   LQLVVTPRL  152
             L+++++PRL
Sbjct  510   LEVLISPRL  518



>ref|XP_007134137.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
 gb|ESW06131.1| hypothetical protein PHAVU_010G022400g [Phaseolus vulgaris]
Length=526

 Score =   388 bits (997),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 204/495 (41%), Positives = 303/495 (61%), Gaps = 23/495 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L +Q   L+RT   +ADK+GP+F +R G  P  +IC  EA K+CFTT+++ +A
Sbjct  47    LIGHLHLLGAQTP-LARTFAALADKYGPMFQIRLGAYPALVICNQEAIKECFTTNDKVLA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+ + G HLGYN+A F F+    YW  +RK  + ELLS  +L  + H+  SE++T +K
Sbjct  106   SRPKSSHGVHLGYNFAGFGFAPYGTYWTKIRKLTMLELLSARRLQFLSHVYESEIDTLVK  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +L+L++           V + EW+ + T N   +++AG+RY F     + D       EA
Sbjct  166   DLWLYLGGKTH----VKVTISEWLERFTFNIIIKMIAGKRY-FSYLEDVDD------AEA  214

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHV-RAMKRNNKKVDKILQAWIDQHI  902
               ++ + +EF ++SG FV  D  P+    WF   G V ++MKR  K +D ++  W+++H 
Sbjct  215   HGVVKLIKEFMHISGEFVPSDLIPV--LGWFGVHGKVLKSMKRIAKDLDSLVGGWVEEHK  272

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
                 L N     +    D I +MLS I  + + G  +     IK    ++++ GSDTT T
Sbjct  273   NSDPLRNK----SLEKHDFIDVMLSVIQDDPLSG--HDRDTIIKANVTNLVLAGSDTTST  326

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              M W L++L+K  + +KR +EEIE +VG ER VE  D+K L YLQAVVKE+LRLYP  PL
Sbjct  327   TMTWILAMLMKNPEALKRAQEEIEDEVGRERKVEACDLKNLIYLQAVVKETLRLYPPGPL  386

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L+P    +DC I GY +PKG +   N+WK+ RDP+ W E +KF P+RFLN E G  D   
Sbjct  387   LVPHEAREDCCIQGYRVPKGTRVFANVWKLHRDPRVWSEAEKFSPERFLN-ENGEVDEG-  444

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             +RFEY+PFG GRR+C G  +A Q++ +T+ARL+Q F+   P +  +D+EEG G+TLP+  
Sbjct  445   QRFEYLPFGSGRRACPGSTFATQLTLITLARLLQAFHLDEPLDEPVDLEEGLGITLPKIN  504

Query  181   PLQLVVTPRLPPNFY  137
             PLQ++ T RLP  FY
Sbjct  505   PLQILFTSRLPNQFY  519



>emb|CAN74205.1| hypothetical protein VITISV_031127 [Vitis vinifera]
Length=525

 Score =   388 bits (996),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 204/495 (41%), Positives = 285/495 (58%), Gaps = 18/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L     +     G MADK+GP+F +R G     ++   E AK+CFTTH+  +A
Sbjct  47    IIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGXKRAVVVSSWEMAKECFTTHDLALA  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+PE    ++LGYNYAMF+FS   AYWR +RK    ELLSN +L+ +K++R+SE+ET +K
Sbjct  107   SRPEVVAAKYLGYNYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMK  166

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY             +V M +W   L+LN   ++V G+RY        G    ++ KEA
Sbjct  167   ELYKLWAEKKSEAGVVLVDMKQWFGHLSLNVILKMVVGKRY-------FGYAAESKEKEA  219

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q+     REF  L G+FV+ DA P     W D  GHV+AMK+  K++D I Q W+++H  
Sbjct  220   QQCQKAIREFFRLLGLFVVSDALP--FLGWLDVGGHVKAMKKTAKELDGIAQEWLEEHRR  277

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R+  G A       D D + +MLS +      G  Y      K T+  +I  G+DTT   
Sbjct  278   RKDSGEADG-----DQDFMDVMLSILGATDPNG--YDADXINKATSLILIAGGTDTTSXT  330

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WA+SLL+    V+++ +EE++  VG ER V + D+ KL YLQA+VKE+LRLYP  PL 
Sbjct  331   LTWAISLLLNNPHVLRKAQEELDTHVGKERLVNEMDISKLVYLQAIVKETLRLYPAAPLS  390

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
               R   +D  +GGY +PKG +  +NL KI RDP+ W  P  F P RFL       D   K
Sbjct  391   GQRQFIQDSVLGGYHIPKGTRLLLNLTKIQRDPRVWLNPTXFQPSRFLTTYK-DVDVKGK  449

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              F   PFG GRR C G A+ALQ+  LT+A  +  F  STP N  +DM E FG+T  ++TP
Sbjct  450   HFVLTPFGGGRRICPGAAFALQVLPLTLANFLHKFQLSTPSNSPIDMSESFGITNIKSTP  509

Query  178   LQLVVTPRLPP-NFY  137
             L+++++PRL   N Y
Sbjct  510   LEVLISPRLASYNLY  524



>ref|XP_002282111.2| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera]
Length=525

 Score =   387 bits (995),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 201/489 (41%), Positives = 285/489 (58%), Gaps = 17/489 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L     +     G MADK+GP+F +R G+    ++   E AK+CFTTH+  +A
Sbjct  47    IIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHDLALA  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+PE    ++LGYNYAMF  S   AYWR +RK    ELLSN +L+ +K++R+SE+ET +K
Sbjct  107   SRPELVAAKYLGYNYAMFGLSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMK  166

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY             +V M +W   L+LN   ++V G+RY        G    ++ KEA
Sbjct  167   ELYELWAKKKSEAGVVLVDMKQWFGHLSLNVILKMVVGKRY-------FGYAAESKEKEA  219

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q+     REF  L G+FV+ DA P     W D  GHV+AMK+  K++D I Q W+++H  
Sbjct  220   QQFQKAIREFFRLMGLFVVSDAIP--FLGWLDVGGHVKAMKKTAKELDGITQEWLEEHRR  277

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R+  G A       D D + +MLS +         Y      K T+  MI  G+DTT   
Sbjct  278   RKDSGEADG-----DQDFMDVMLSILGGRDTT--DYDADTINKATSLVMIGGGADTTSGT  330

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WA+SLL+    ++++ +EE++A VG ER V + D+ KL YLQA+VKE+LRL P  PL 
Sbjct  331   LTWAVSLLLNNPHILRKAQEELDAHVGKERLVNEMDISKLVYLQAIVKETLRLNPIAPLS  390

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR   +D  +GGY + KG +  +NL KI RDP+ W  P +F P RFL       D   K
Sbjct  391   GPRQFIQDSILGGYHISKGTRLILNLTKIQRDPRVWLNPMEFQPDRFLTTHK-DVDVRGK  449

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE  PFG GRR C G+ +ALQ+ HLT+A  +  F  STP +  +DM EGFG+T  ++TP
Sbjct  450   HFELTPFGGGRRICPGIVFALQVLHLTLANFLHRFQLSTPSDAPVDMSEGFGLTNIKSTP  509

Query  178   LQLVVTPRL  152
             L+++++PRL
Sbjct  510   LEVLISPRL  518



>ref|XP_003548649.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   388 bits (996),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 197/495 (40%), Positives = 299/495 (60%), Gaps = 19/495 (4%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             IGH+ +LN++     RT   +A+K+GP+FI++ G  P  ++   E AK+C TT+++  AS
Sbjct  61    IGHVHLLNARKPYF-RTFSAIAEKYGPIFILKLGCHPTLVVNSREIAKECLTTNDKVFAS  119

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  + G+ LGYN A+F FS    YWR +RK    E+LS+ KL+K+KH+R +E  + +K+
Sbjct  120   RPITSAGKILGYNNAVFGFSPYGKYWREIRKMATLEILSSYKLEKLKHVRDTETLSLVKD  179

Query  1255  LYLFVTASPEPNKAAV-VAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             LY  ++     N +   V +   +  ++ N   R++AG+R+        GD  + E  EA
Sbjct  180   LYSSISYPKNVNGSTTHVPISNLLEHMSFNIIVRMIAGKRFG-------GDTVNQEDNEA  232

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
               + N  R+  YL G+FV  DA P     W DFQG+V  MKR NK++D IL+ W+++H+ 
Sbjct  233   WRLRNAIRDATYLCGVFVAADAIPS--LSWIDFQGYVSFMKRTNKEIDLILEKWLEEHLR  290

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTI-DKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +R            + D + +M+S   ++E + G  Y  +M IK T+  +I+  S +T  
Sbjct  291   KR----GEEKDGKCESDFMDVMISAFQEEEEICG--YKREMVIKATSVLLILTASGSTAI  344

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WALSLL+ +  V+K  ++E++  +G ERWV++SD+K L YLQA++KE+LRLYP  PL
Sbjct  345   TLTWALSLLLNHPKVLKAAQKELDTHLGKERWVQESDIKNLTYLQAIIKETLRLYPPAPL  404

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
                R   +DC + GY +PKG +  +NLW + RDPK WP P+KF P+RFL       +   
Sbjct  405   TGIREVMEDCCVAGYHVPKGTRLLINLWNLQRDPKVWPNPNKFEPERFLTTHH-DINFMS  463

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PF  GRRSC GM + LQ+ HLT+ARL+QGF+  T    E+DM EG GV LP+  
Sbjct  464   QNFELIPFSIGRRSCPGMTFGLQVLHLTLARLLQGFDICTKDGAEVDMTEGLGVALPKEH  523

Query  181   PLQLVVTPRLPPNFY  137
              LQ+++ PRLP   Y
Sbjct  524   GLQVMLQPRLPLGLY  538



>ref|XP_010106088.1| Cytochrome P450 82A4 [Morus notabilis]
 gb|EXC07358.1| Cytochrome P450 82A4 [Morus notabilis]
Length=525

 Score =   387 bits (994),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 209/495 (42%), Positives = 301/495 (61%), Gaps = 21/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+   TL  +ADK+GP+F +  G+ P  +I   E+AK+CFTTH+  V+
Sbjct  50    IIGHLHLLGG-SQLPHITLANLADKYGPIFTIHIGVHPTLVISSWESAKECFTTHDLAVS  108

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P+    E LG+NYA F F+    YWR +RK   SELLSN +L+K++H+R SE+E+ +K
Sbjct  109   TRPKLISSEILGWNYASFGFAPYGPYWREIRKITTSELLSNKRLEKLRHVRESEVESFVK  168

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY   T     +   +V M + I  + LN + R+VA +RY         DDDS + KEA
Sbjct  169   NLYKLWTKRETGSDRVMVEMGKRIGDVNLNVALRVVARKRY--------FDDDSRDEKEA  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +      REF  L+G+F++ DA P    +W D  G+ +AMK+ + +++ I++ W+++H +
Sbjct  221   RRCKEAMREFFRLTGLFLVGDAIP--FLRWLDLGGYEKAMKKTHDELESIVEEWLEEHRQ  278

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR  GN      G + D + +MLS ++ E      Y   +  K T  ++I  G+DTT   
Sbjct  279   RRGSGN-----FGGEKDFMDVMLSKLE-ESTDLSGYDADIVNKATCMNIISGGTDTTAVT  332

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+    V+++ +EE++  VG ER V++SD+  L YLQAVVKE+LRLYP  PL 
Sbjct  333   LTWALSLLLNNKSVLQKVQEELDLHVGKERPVKESDISNLVYLQAVVKETLRLYPAGPLS  392

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWP-EPDKFMPKRFLNREAGGADNPL  362
               R  S+DC IGGY +PKG +   NLWKI  DPK W  +P +F P RFL       D   
Sbjct  393   GIREFSEDCTIGGYHVPKGTRLITNLWKIQTDPKTWSDDPLEFKPDRFLTTHK-DVDVKG  451

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             K FE +PFG GRRSC GM Y LQ++HL IA L+Q F+  T G V  DM   FG+T  +AT
Sbjct  452   KHFELIPFGAGRRSCPGMTYGLQMTHLVIACLLQAFDVFTDGPV--DMTAIFGLTNAKAT  509

Query  181   PLQLVVTPRLPPNFY  137
             PL+++V PRL  + Y
Sbjct  510   PLEVLVKPRLSISLY  524



>ref|XP_003547786.2| PREDICTED: cytochrome P450 82C2-like [Glycine max]
Length=541

 Score =   387 bits (994),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 195/495 (39%), Positives = 300/495 (61%), Gaps = 19/495 (4%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             IGH+ +LN++     RT   +A+K+GP+FI++ G  P  ++   E AK+C TT+++  AS
Sbjct  61    IGHLHLLNARKPYF-RTFSAIAEKYGPIFILKLGCHPTLVVNSREIAKECLTTNDKVFAS  119

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  + G+ LGYN A+F FS    YWR +RK  + E+LS+ KL+K+KH+R +E  + +K+
Sbjct  120   RPITSAGKILGYNNAVFGFSPYGKYWREIRKMAILEILSSYKLEKLKHVRDTETLSLVKD  179

Query  1255  LYLFVTASPEPNKAAV-VAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             LY  ++     N +   V +   +  ++ N   R++AG+R+        GD  + E  EA
Sbjct  180   LYSSISCPKNVNGSTTHVPISNLLEHMSFNIIVRMIAGKRFG-------GDTVNQEDNEA  232

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
               + N  ++  YL G+FV  DA P     W DFQG+V  MKR NK++D IL+ W+++H+ 
Sbjct  233   WRLRNAIKDATYLCGVFVAADAIPS--LSWIDFQGYVSFMKRTNKEIDLILEKWLEEHLR  290

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTI-DKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +R            + D + +M+S   ++E + G  Y  +M IK T+  +I+  S +T  
Sbjct  291   KR----GEEKDGKCESDFMDVMISAFQEEEEICG--YKREMVIKATSVLLILTASGSTAI  344

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WALSLL+ +  V+K  ++E++  +G ERWV++SD++ L YLQA++KE+LRLYP  PL
Sbjct  345   TLTWALSLLLNHPKVLKAAQKELDTHLGKERWVQESDIENLTYLQAIIKETLRLYPPAPL  404

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
                R   +DC + GY +PKG +  +NLW + RDPK WP P+KF P+RFL       +   
Sbjct  405   TGIREVMEDCCVAGYHVPKGTRLLINLWNLQRDPKVWPNPNKFEPERFLTTHH-DINFMS  463

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PF  GRRSC GM + LQ+ HLT+ARL+QGF+  T    E+DM EG GV LP+  
Sbjct  464   QNFELIPFSIGRRSCPGMTFGLQVLHLTLARLLQGFDICTKDGAEVDMTEGLGVALPKEH  523

Query  181   PLQLVVTPRLPPNFY  137
              LQ+++ PRLP   Y
Sbjct  524   GLQVMLQPRLPLGLY  538



>gb|AJD25202.1| cytochrome P450 CYP82U4 [Salvia miltiorrhiza]
Length=522

 Score =   386 bits (991),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/495 (40%), Positives = 298/495 (60%), Gaps = 21/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L+  + + +RTLG MAD+HGP+F +R G     ++   EA K+C T ++R  A
Sbjct  45    LIGHLHLLDGLSPV-ARTLGAMADRHGPVFSLRLGSHRGLVVSSWEAIKECLTANDRVFA  103

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P  AV ++LGY  A F  +    YWR +RK V  +LL+   LD   H+R +E++  +K
Sbjct  104   TRPSIAVAKYLGYGGASFGLAPYGPYWRDVRKMVTVDLLTARHLDDFSHVRTAEVDGFVK  163

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +L+             VVA+   I  LT N   R++ G+R+ F  G    DD +  ++EA
Sbjct  164   DLHSMCGGGNGGESKMVVALSGRIELLTFNIILRMLVGKRFSFSKGD---DDKNWRFQEA  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                    ++  YL G+FV  DA P    +W D  G++++MK+  K+VD +L+ W+ + I+
Sbjct  221   ------IKKVLYLGGVFVFSDAIPS--LEWLDIGGYIKSMKQTFKQVDNVLEDWVQERIQ  272

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDK-EFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
              R+  +A       D D + +MLSTIDK E + G  YT +  IK T   +I+ GS++T  
Sbjct  273   TRKQKDAQT-----DSDFMDVMLSTIDKNEMMAG--YTRETVIKATILMLIMTGSESTSE  325

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              ++WA+SLL+     MK  ++EI+  +G +R+V++SD+  L YLQA+ KE+LRLYP  PL
Sbjct  326   TIIWAISLLLNNPHTMKTAQDEIDNNIGRDRFVQESDINNLTYLQAIFKETLRLYPPGPL  385

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
               PR   +DC IGGY +P+G +  +NLWK+ RDP  W  PD+F P+RFLN E    +   
Sbjct  386   SGPREALEDCHIGGYHVPRGTRLVLNLWKLHRDPNIWFNPDEFRPERFLN-EKSQMNFKG  444

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE++PF  GRR C GM + LQ+ HLT+ARL+Q F+FS P    +DM EG G+ LP+  
Sbjct  445   QYFEFIPFSSGRRMCPGMTFGLQVIHLTLARLLQSFDFSMPNGETVDMGEGLGIALPKLK  504

Query  181   PLQLVVTPRLPPNFY  137
             PL +V+TPRLP   Y
Sbjct  505   PLDVVLTPRLPKKLY  519



>emb|CDP03915.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   384 bits (985),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 188/433 (43%), Positives = 279/433 (64%), Gaps = 18/433 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+  LNS +  L+RT G +ADK+GP+F +R GMT   ++   EA K+CFTT+++ +A
Sbjct  50    VIGHLLQLNSHD-TLARTFGALADKYGPVFSIRLGMTRALVVSNWEAVKECFTTNDKVLA  108

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+   G +LGYN A F F+    +WR MRK V+ ++LSN +L+ ++H+R+SE++TS +
Sbjct  109   SRPDSNAGVYLGYNNAAFGFAPYGHFWRQMRKLVLLQVLSNRRLETLRHVRVSEIQTSTR  168

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             EL+  +    E N  A V + EW+ QLTLN   R VAG+RY         D ++    +A
Sbjct  169   ELFSVINR--EENAPAKVVISEWVEQLTLNIIVRTVAGKRY--------SDSEAGNRIDA  218

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q    V +E+ Y++G   L D  P    +W D  GH+++MKR  K++D I+Q WID+H+E
Sbjct  219   QYFKKVVKEYMYVTGQLDLSDVIPFPPLRWLDPLGHIKSMKRLFKELDAIMQIWIDEHVE  278

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +R+  +     +G++   I ++LS I+ +F  G P   +  IK T  ++I+ GSDTT  H
Sbjct  279   KRRTKSI----SGDEQSFIDVLLSVIEDDFALGQP--RETLIKATINNLILAGSDTTSVH  332

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + W LSLLV    VM++ +EEI++ VG ERWV +SD+K L YLQA+VKE+LRLYP  PL 
Sbjct  333   LTWLLSLLVNNRQVMEQAQEEIDSSVGKERWVNESDIKNLVYLQAIVKEALRLYPPGPLS  392

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P +  +DC++ GY +PKG +  VN+WK+ RDP+ W EPDKF P+RF+   A   D   +
Sbjct  393   VPHLAREDCEVSGYHVPKGTRVFVNVWKLHRDPRIWSEPDKFCPERFMTSHA-EVDVSGQ  451

Query  358   RFEYVPFGCGRRS  320
              FE+ PFG GRRS
Sbjct  452   HFEFTPFGSGRRS  464



>ref|XP_009364774.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   385 bits (990),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 206/498 (41%), Positives = 298/498 (60%), Gaps = 22/498 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+          TLG MADK+GP+F +R G+ P  +I   E AK+C+TT +  + 
Sbjct  53    IIGHLPLFGGSTPP-HITLGAMADKYGPIFTIRLGVHPSLVISSSEIAKECYTTQDLSIL  111

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+  V +H+ Y+YAMF F     +WR +RK V  ELLS  K++ +KHIR+SE+ T +K
Sbjct  112   SRPKMVVLDHVSYDYAMFGFGPGGPFWREIRKLVTLELLSVRKVELLKHIRVSEVATFLK  171

Query  1258  ELY-LFVTASPEPNK-AAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             EL+ L+     E +K   +V + +W+  +TLN    +VAG+RY      A GD    E K
Sbjct  172   ELHELWSAKKRESSKDGVIVELKQWLGDMTLNVILTMVAGKRYSV---AAAGD----EKK  224

Query  1084  EAQEMINVFRE-FQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             EA+ +    RE F YL GMF+L DA P    +W D+ GH +AMK++  ++  I+  W+++
Sbjct  225   EARRVQTALRELFDYL-GMFLLGDAVPY--LRWLDWGGHEKAMKKSATEMHAIVAEWVEE  281

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H +RR  GNA       + D I  MLS +D   +  F       +K T+ ++I  G DTT
Sbjct  282   HKQRRAKGNAKG-----EQDFIDAMLSVLDGADLGSF--DADTIVKATSLNVIAGGGDTT  334

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                + WA+SLL+    VMK+   E++ ++G +R V + D+  L Y+QA+VKE+LRLYP  
Sbjct  335   MVTLTWAISLLLNNPHVMKKALNELDTKIGRQRVVSEEDLSNLVYIQAIVKETLRLYPVG  394

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL  PR+ ++DC I GY + KG +F  NLWKI  DPKFWPEP KF P+RFL       D 
Sbjct  395   PLSGPRVFNEDCIIAGYPIRKGTRFLPNLWKIQIDPKFWPEPLKFKPERFLTTHK-DVDL  453

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + F+++PFG GRRSC G+A+ LQ+   T+A  +  F  S P +  +DM E FG+T  +
Sbjct  454   KGQHFQFIPFGSGRRSCPGLAFGLQMVQFTLASFLHAFEISNPSSAPVDMTESFGMTNVK  513

Query  187   ATPLQLVVTPRLPPNFYG  134
             ATPL +++ PRL    YG
Sbjct  514   ATPLNVLIKPRLSSELYG  531



>gb|KEH25406.1| cytochrome P450 family protein [Medicago truncatula]
Length=516

 Score =   384 bits (987),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 199/496 (40%), Positives = 304/496 (61%), Gaps = 29/496 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L  Q   L+R     +DK+GP+F +R G  P  +I   EA K+CFTT+++ +A
Sbjct  47    LIGHLHLLGKQIP-LARIFASFSDKYGPVFQIRLGAYPALIISNKEAIKECFTTNDKILA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+ + G HLGYNYA FSF+    Y+  ++K  + ELLS+ +L+ ++H+  SE+ T IK
Sbjct  106   SRPKSSHGIHLGYNYAGFSFAPSGPYFSKLKKITMVELLSSRRLESLRHVYESEIHTWIK  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +L  +V      N    V + EW+ +L+ NT  +++ G+RY         ++ + E  EA
Sbjct  166   DLSFYVKG----NNNVKVVISEWLKRLSFNTITKMIGGKRY--------FENLNVEDVEA  213

Query  1078  Q-EMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHV-RAMKRNNKKVDKILQAWIDQH  905
                ++N+ REF  ++G FV +D  P+    WF F+G V ++MKR  K ++ ++ +WI++H
Sbjct  214   HGNIVNLIREFMLIAGDFVPKDLIPI--IGWFGFEGQVLKSMKRVGKDLETLVGSWIEEH  271

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             I            +    D I +MLS I+ + V G  +     IK     +++ GSD+T 
Sbjct  272   IVNN---------SNEKHDFIDVMLSVIEDDRVYG--HNRDTIIKANITDLMLAGSDSTS  320

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
             T + W ++LL+   +V+KR +EEI+  +G  R VE SD+K L YLQA++KE+LRLYP  P
Sbjct  321   TTLTWIVALLLNNRNVLKRAQEEIDHHIGKGRRVESSDIKNLVYLQAILKETLRLYPAAP  380

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL P   ++DC I GY +PKG +   N+WK+ RDP  W EP+KF+P+RF+N E G  D+ 
Sbjct  381   LLAPHEATEDCNIQGYYVPKGTRVFFNVWKLHRDPSIWSEPEKFLPERFIN-ENGEIDHE  439

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
                FEY+PFG GRR+C G  +A Q S +T+A L+ GF+   P +  +DM EG G+TLP+ 
Sbjct  440   SHHFEYLPFGLGRRACPGSLFATQNSLITLACLLHGFDLEVPMDEVVDMREGLGITLPKL  499

Query  184   TPLQLVVTPRLPPNFY  137
             TPLQ+V+TPRLP   Y
Sbjct  500   TPLQVVLTPRLPFELY  515



>ref|XP_008235430.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=517

 Score =   384 bits (987),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 200/497 (40%), Positives = 308/497 (62%), Gaps = 29/497 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+  L      + +TL  MADK+GP+F +  G  P+ +I   +A K CFT ++   A
Sbjct  44    IIGHLHKLRGP---IFKTLAAMADKYGPIFTIWLGKHPVLVISNYDAVKQCFTKNDTVFA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P    G++LGYNYA F FS    YWR MRK V+ ELLS+ +L+ +KH+++SE++  IK
Sbjct  101   TRPRSTTGKYLGYNYAGFGFSPYGTYWRDMRKMVMVELLSSRRLETLKHVQISEVDAFIK  160

Query  1258  ELYLFV-TASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
              L+L   T          V + +WI +LTLN   R++AG+RY           DS++  +
Sbjct  161   GLFLLCKTEGHNGLNPTKVVISDWIERLTLNVITRMIAGKRYF----------DSSDEGD  210

Query  1081  AQEMINVFREFQYLSGMFVLQD--AFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
              Q    + +EF Y+SG  V  D   FP     W DF+G ++AMKR  K++D  +   +++
Sbjct  211   EQRFGKILKEFMYVSGKPVASDVIGFP----SWIDFKGQIKAMKRIMKELDSFMGNLVEE  266

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H  +++  +       ++ D I +M+S I+     G  YT +  IK T+ ++I+ GS+TT
Sbjct  267   HYAKKETNSR------DEHDFIDVMISVIEDNSTLG--YTRETIIKATSLNLILAGSETT  318

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                ++W LSLL+    V+K  +EE++ +VG +RW+ED+D++ L YLQA+VKE+LRLYP  
Sbjct  319   AISLIWILSLLLNNRHVLKLAQEELDLKVGRDRWIEDTDIENLPYLQAIVKETLRLYPPA  378

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL +P    +DC++ G+ + KG    VNLWK+ RDP  WP+P+ F P+RFL     G D 
Sbjct  379   PLSVPHEAMQDCQVCGFHIQKGTLLFVNLWKLHRDPSLWPDPEVFCPERFLTTHV-GIDA  437

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + FE++PFG GRRSC G  +ALQ++HLT+ RL+QGF  +TP ++ +D+ EG G+T+P+
Sbjct  438   SGQHFEFIPFGSGRRSCPGATFALQVTHLTLGRLLQGFELATPMDMPVDLTEGLGITMPK  497

Query  187   ATPLQLVVTPRLPPNFY  137
             +T L++++TPRLP  FY
Sbjct  498   STSLEVILTPRLPFEFY  514



>gb|KHG07864.1| Cytochrome P450 protein [Gossypium arboreum]
Length=515

 Score =   384 bits (987),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 206/535 (39%), Positives = 320/535 (60%), Gaps = 23/535 (4%)
 Frame = -1

Query  1741  MDLFHLLSCLAGFIFFVllyirinnknrnlllppvaagalPIIGHIPILNSQNQILSRTL  1562
             MDL+  +  +A  + F+ ++ R   KN      P   G+LP+IGH+ +L  +  I  + L
Sbjct  1     MDLYTYIPSIASLLLFLYIFSRKAPKNSKKNCIPEPTGSLPLIGHLHLLGGKEPI-CKNL  59

Query  1561  GEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVASKPEFAVGEHLGYNYAMFS  1382
               MADKHGPL+ ++ G   I ++   E AKDCFT ++R +A++     G ++GY+ A+FS
Sbjct  60    ATMADKHGPLYSLKLGTHRILVVSSWEIAKDCFTNNDRTLATRANIVAGRYMGYDNAIFS  119

Query  1381  FSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKELYLFVTASPEPNKAAVVA  1202
              +    YWR +RK    ELLS+ +L+K+KHIR SE+++ IKELY              V 
Sbjct  120   LAPYGEYWRNIRKMATVELLSSHRLEKLKHIRFSEMDSFIKELYGL------SRNGDKVT  173

Query  1201  MDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQEMINVFREFQYLSGMFVL  1022
             + E + +LT N + R++ G+R+    G   G+ DS  ++     +   +   YL G+FVL
Sbjct  174   ISEALERLTFNINLRMLFGKRFS---GNDYGEVDSEPWR----FMKAIKRALYLFGIFVL  226

Query  1021  QDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIERRQLGNAPAPAAGNDLDLI  842
              DA  L+  + FD QGHVR+MK N K++D I+  W+++H+++++     + +   D+ L 
Sbjct  227   PDA--LQWLERFDIQGHVRSMKENAKELDSIINVWLEEHLKKKRENQGASESDFMDVMLT  284

Query  841   HLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTHMVWALSLLVKYGDVMKRCR  662
             HL   T+    + G  +T    +K TT  + + G ++T   + W LSLL+ + +V+   +
Sbjct  285   HLREDTV----ISG--HTRDTIVKATTLVLSLTGGESTSVTITWVLSLLLNHPNVLITAQ  338

Query  661   EEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLLMPRMTSKDCKIGGYDLPKG  482
             EEI+  VG +RWVE+SD+K L+YLQA+VKE+LRLYP  P+   R   +DC I GYD+PKG
Sbjct  339   EEIDHHVGKQRWVEESDIKNLKYLQAIVKETLRLYPPGPITGIREAMQDCCIAGYDVPKG  398

Query  481   AQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLKRFEYVPFGCGRRSCVGMAY  302
              +  VN+WK+ RDP+ W   ++F P+RF+       D   + FEY+PF  GRRSC GM +
Sbjct  399   TRLIVNIWKLHRDPRVWENANEFHPERFMTTHV-DFDVKGQNFEYMPFSSGRRSCPGMTF  457

Query  301   ALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATPLQLVVTPRLPPNFY  137
              LQ+ HLT+++LIQGF+        +DMEEG G+ LP+  PL++V++PRL   FY
Sbjct  458   GLQVVHLTVSKLIQGFDIRVAEGTAVDMEEGLGLALPKLNPLEVVLSPRLGTEFY  512



>ref|XP_002282035.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=528

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 207/496 (42%), Positives = 298/496 (60%), Gaps = 22/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+   TLG MADK+GP+F +R G+    ++   E AK+CFTT++  V+
Sbjct  52    IIGHLHLLGG-SQLPHVTLGTMADKYGPIFTIRLGVHRALVVSSREVAKECFTTNDSAVS  110

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
              +P+    EHLGYNYAMF+FS  +AYWR +RK V +ELLSN +L+ +K +R SE+ETSIK
Sbjct  111   GRPKLVAPEHLGYNYAMFAFSPYDAYWREVRKIVNTELLSNRRLELLKDVRASEVETSIK  170

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY             +V M +W   L++N   R+V G+RY     G        E +  
Sbjct  171   ELYKLWAEKKNELGHVLVEMKQWFGDLSMNVILRMVVGKRYFGVGAGGE----EEEARRC  226

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q+ I   REF  L G+FV++D  P     W D  GH +AMK+  K++D I Q W+++H  
Sbjct  227   QKAI---REFFRLLGLFVVKDGIP--SLGWLDLGGHEKAMKKTAKEIDSIAQEWLEEHRR  281

Query  898   RRQLGNAPAPAAGNDL-DLIHLMLSTIDKEFVKGFP-YTHQMAIKGTTQSMIIDGSDTTG  725
             R+  G        N + D + ++LS +D    K  P Y      K T+ ++I  G+DT  
Sbjct  282   RKDWGE------DNGMHDFMDVLLSVLDG---KALPEYDADTINKATSMALISGGTDTMT  332

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
               + WALSL++   + +K+ +EE++  VG ER V  SD+ KL YLQA+VKE+LRL P  P
Sbjct  333   VTLTWALSLILNNRETLKKAKEELDTHVGKERLVNASDISKLVYLQAIVKETLRLRPPGP  392

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             L  PR  ++DC IGGY +PKG +  +NL K+ RDP  W +P++F P+RFL       D  
Sbjct  393   LSGPRQFTEDCIIGGYHVPKGTRLVLNLSKLHRDPSVWLDPEEFQPERFLTTHR-DVDAR  451

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + F+ +PFG GRRSC G+ +ALQ+ HL +A  + GF  STP N  +DM E  G+T  ++
Sbjct  452   GQHFQLLPFGAGRRSCPGITFALQMLHLALASFLHGFEVSTPSNAPVDMSEIPGLTNIKS  511

Query  184   TPLQLVVTPRLPPNFY  137
             TPL++++ PRLP N Y
Sbjct  512   TPLEILIAPRLPYNSY  527



>ref|XP_009336429.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 205/498 (41%), Positives = 299/498 (60%), Gaps = 22/498 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+          TLG MADK+GP+F +R G+ P  +I   E AK+C+TT +  + 
Sbjct  53    IIGHLPLFGGSTPP-HITLGAMADKYGPIFTIRLGVHPSLVISSSEIAKECYTTQDLSIL  111

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+  V +H+ Y+YAMF F     +WR +RK V  ELLS  K++ +KHIR+SE+ T +K
Sbjct  112   SRPKMVVLDHVSYDYAMFGFGPGGPFWREIRKLVTLELLSVRKVELLKHIRVSEVATFLK  171

Query  1258  ELY-LFVTASPEPNK-AAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             EL+ L+     E +K   +V + +W+  +TLN    +VAG+RY      A GD    E K
Sbjct  172   ELHELWSAKKRESSKDGVIVELKQWLGDMTLNVILTMVAGKRYSV---AAAGD----EKK  224

Query  1084  EAQEMINVFRE-FQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             EA+++    RE F YL GMF++ DA P    +W D+ GH +AMK++  ++  I+  W+++
Sbjct  225   EARKVQTALRELFDYL-GMFLVGDAVPY--LRWLDWGGHEKAMKKSATEMHAIVAEWVEE  281

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H +RR  GNA       + D I  MLS +D   +  F       +K T+ ++I  G DTT
Sbjct  282   HKQRRAKGNAKG-----EQDFIDAMLSVLDGADLGSF--DADTIVKATSLNVIAGGGDTT  334

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                + WA+SLL+    VMK+   E++ ++G +R V + D+  L Y+QA+VKE+LRLYP  
Sbjct  335   MVTLTWAISLLLNNPHVMKKALNELDTKIGRQRVVSEEDLSNLVYIQAIVKETLRLYPVG  394

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL  PR+ ++DC I GY + KG +F  NLWKI  DPKFWPEP KF P+RFL       D 
Sbjct  395   PLSGPRVFNEDCIIAGYPIRKGTRFLPNLWKIQIDPKFWPEPLKFKPERFLTTHK-DVDL  453

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + F+++PFG GRRSC G+A+ LQ+   T+A  +  F  S P +  +DM E FG+T  +
Sbjct  454   KGQHFQFIPFGSGRRSCPGLAFGLQMVQFTLASFLHAFEISNPSSAPVDMTESFGMTNVK  513

Query  187   ATPLQLVVTPRLPPNFYG  134
             ATPL +++ PRL    YG
Sbjct  514   ATPLNVLIKPRLSSELYG  531



>ref|XP_008796321.1| PREDICTED: cytochrome P450 CYP82D47-like [Phoenix dactylifera]
Length=527

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 200/494 (40%), Positives = 293/494 (59%), Gaps = 16/494 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             ++GH+ +L S N I  R+L  +AD  GP+F +R G  P  ++   EAAK+CFT +++ +A
Sbjct  49    VLGHLHLLGSHNNI-GRSLKAVADAVGPVFALRLGAHPALVVSTWEAAKECFTANDKALA  107

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
              +P     + + YN AM  FS   +YWR +R+ +  ELLS+ +L  + H+R SE+    K
Sbjct  108   GRPPSTASKLMCYNNAMVGFSPYGSYWRQVRRILTLELLSHARLASLAHVRASEVGAFAK  167

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              L  F         AA V M++W  +LT N   R+VAG+R  F  G A+ D  S   +EA
Sbjct  168   SL--FGVCRKVEGGAARVEMNKWFQELTFNVVVRMVAGKRC-FGCG-AVDDGGS---REA  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +           L G FV+ D  P    +W D  G+ RAM+R   ++D I+  W+ +H E
Sbjct  221   RRFTGAMHRMMELLGAFVVSDVVPF--LRWMDLGGYERAMRRTAAEMDGIIGGWLREHRE  278

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR  G           D + +MLSTI+KE      +     IK  + ++II G+DTT   
Sbjct  279   RRSEGRGEGKE-----DFMDVMLSTIEKEGELFSDHDPDTVIKANSLALIIGGTDTTSVT  333

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             M W L+LL+ + +V+++ REE++++VG ER V++SDV+KL YLQA+VKE+LRLYP  P+L
Sbjct  334   MTWVLALLLNHPNVLRKAREELDSRVGKERNVDESDVEKLVYLQAIVKETLRLYPPGPVL  393

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P    ++C++ G+D+P G +  VN W I  DP+ WP+P  F P+RFL       D   +
Sbjct  394   IPHQAMEECQVRGFDVPAGTRVLVNAWAIQHDPEVWPDPSAFRPERFLTSHK-DVDIRGR  452

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRR+C G ++ALQ+ HLT+AR+I GF+  TPG   +DM EG G TLP+ATP
Sbjct  453   HFELLPFGSGRRACPGASFALQVLHLTLARVIHGFHMRTPGGGPVDMTEGKGATLPKATP  512

Query  178   LQLVVTPRLPPNFY  137
             L ++V PRL P  Y
Sbjct  513   LHVLVAPRLSPELY  526



>ref|XP_009336967.1| PREDICTED: cytochrome P450 82A4-like [Pyrus x bretschneideri]
Length=526

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 204/498 (41%), Positives = 297/498 (60%), Gaps = 22/498 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I GH+ +L         TLG MADK+GP+F +R G+ P  +I   E AK+C+TT++  + 
Sbjct  48    IFGHLHLLGGSTPP-HITLGAMADKYGPIFTIRLGVQPSLVISSSEIAKECYTTNDLSIL  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+  V +H+ Y+YAMF+F     YWR +RK V  ELLS  K++ +KH+R+SE+ T +K
Sbjct  107   SRPKMVVVDHVSYDYAMFAFGPPGPYWREIRKIVTLELLSVRKVELLKHVRVSEVATFLK  166

Query  1258  ELY-LFVTASPEPNK-AAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             EL+ L+ T   E +K   VV + +W A + LN     VAG+RY      A GD    E K
Sbjct  167   ELHELWSTKKKEGSKDGVVVELKQWFADMMLNVILTTVAGKRYSV---AAAGD----EKK  219

Query  1084  EAQEMINVFRE-FQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             EA+ +    RE F YL GMF+L DA P    +W D+ GH +AMK++  ++D I+  W+++
Sbjct  220   EARRVQTALRELFDYL-GMFLLGDAVPY--LRWLDWGGHEKAMKKSATEMDAIIAEWVEE  276

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H +RR  G+A         DL+  +LS +D E + GF        K T+ ++I  G DTT
Sbjct  277   HKQRRAKGDAKGKQ-----DLMDALLSALDGEDLGGF--DADTITKATSVAIIAGGGDTT  329

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                + WA+SLL+    VMK+   E++ ++G +R V + D+  L Y+QA+VKE+LRLYP  
Sbjct  330   MVAVTWAISLLLNNPHVMKKALNELDTKIGKQRVVSEEDITNLVYIQAIVKETLRLYPGG  389

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL  PR+ ++DC I GY +PKG +F  N WKI  DPK+WPEP +F P+RFL       D 
Sbjct  390   PLAGPRIFTEDCTIAGYHIPKGTRFIPNFWKIQTDPKYWPEPFEFKPERFLTTHK-DVDL  448

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
                 F+++PF  GRRSC G+A+ LQ+   T+A  +  F  S P +  +DM E FG+T  +
Sbjct  449   KGHHFQFIPFSSGRRSCPGLAFGLQVVQFTLASFLHAFEISNPSSAPIDMTESFGMTNVK  508

Query  187   ATPLQLVVTPRLPPNFYG  134
             A PL +++ PRL    YG
Sbjct  509   AAPLNVLIKPRLSSELYG  526



>ref|XP_002268915.2| PREDICTED: cytochrome P450 82C2 [Vitis vinifera]
Length=744

 Score =   390 bits (1003),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 200/495 (40%), Positives = 298/495 (60%), Gaps = 18/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +  +Q Q+  +TLG MADK+GP+F +R G+  I ++   E A++CFTTH+R  +
Sbjct  265   IIGHLHLFGAQ-QLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFTTHDRVFS  323

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P     + LGY++AMF F+   +YWR MRK V  ELLSN +LD +KHIR SE+ TSI+
Sbjct  324   TRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRASEVGTSIR  383

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY    +    +    V M  W   LTLN + R+V G+RY     GA  D    E +  
Sbjct  384   ELYEMWVSERGTDGRVFVDMKRWFGDLTLNLAVRLVGGKRY----FGAGADTKEGEGRTC  439

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q++I   R+F +L G+FVL DA P     W D +G+ +AMKR  K++D +   W+ +H E
Sbjct  440   QKVI---RDFAHLFGVFVLSDAIP--FLSWLDLKGYKKAMKRTAKELDSLFGGWLQEHKE  494

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +R LG        +D D + +ML+ ++     GF        K T  ++I+ GSDTT   
Sbjct  495   KRLLGG----EGKDDQDFMDVMLTVLEDVNFSGFDA--DTVNKATCLNLILAGSDTTKVT  548

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+ +  V+K+ + E++ QVG +R V++SDVK L YLQA++KE+LRLYP  P++
Sbjct  549   LTWALSLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPII  608

Query  538   MPRMTSKDCKI-GGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
                   +DC +  GY++  G Q  VN WKI RD + W  P +F P+RF+       D   
Sbjct  609   TLHAAMEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHK-DTDVRG  667

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRRSC G++ ALQ+ H  +A L+  +  + P + ++DM E  G+T  +AT
Sbjct  668   QHFELIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKAT  727

Query  181   PLQLVVTPRLPPNFY  137
             PL+++++PRL    Y
Sbjct  728   PLEVLLSPRLKAELY  742



>emb|CBI36491.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   385 bits (988),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 202/483 (42%), Positives = 292/483 (60%), Gaps = 23/483 (5%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             +GH+P+L  Q  I  RTLG MADKHGP+F++R G+    ++   EA K+CFTT+++  AS
Sbjct  73    LGHLPLLRGQTPIF-RTLGAMADKHGPVFMIRLGVHRALVVSSREAVKECFTTNDKVFAS  131

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  + G+ LGYNYA F F+   A WR MRK  + E+LS  +LD +KH+++SEL+ SIK+
Sbjct  132   RPSSSAGKLLGYNYAGFGFAPYGALWREMRKLSMMEILSARRLDALKHVQISELDLSIKD  191

Query  1255  LYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQ  1076
             LY     S   +   VV M EW   L+ N   +++AG+RY    G  I        +EA+
Sbjct  192   LYSLGKGSDWVHPVKVV-MSEWFQHLSFNIVLKMIAGKRYFNTSGHGI--------EEAR  242

Query  1075  EMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIER  896
               I   +EF  LSG FVL DA P    +W D QG++ +MKR  K+VD ++  W+++H  R
Sbjct  243   RAIATIQEFLSLSGAFVLSDAIPG--VEWMDLQGYLGSMKRVAKEVDSLVGGWVEEHEIR  300

Query  895   RQLGNAPAPAAGNDL-DLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
                      + G+ + D I +MLS ++   +  F ++ +  IK T   +I+ G++T  T 
Sbjct  301   LN-------SEGSRMQDFIDVMLSVLEDTSM--FGHSRETVIKATIVILIVGGTETVATT  351

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
               W LS L+     +KR +EE++ +VG  RWVE+SD+  L YLQAV+KE+LRLY   PL 
Sbjct  352   STWLLSALLNNKHALKRAQEELDLKVGRGRWVEESDIPNLLYLQAVIKETLRLYTAAPLS  411

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P    +DC + GY +PKG +  VN WK+ RDP  W +P+ F P+RFL   A   D   +
Sbjct  412   VPHEAMEDCHVAGYHIPKGTRLFVNAWKLHRDPSVWSDPEDFQPERFLTSHA-DLDVLGQ  470

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRRSC G+  AL++  L I RL+QGF+ STP N  +DM EG  +TL + TP
Sbjct  471   HFELIPFGSGRRSCPGITMALKLLPLVIGRLLQGFDLSTPLNAPVDMREGLSITLAKLTP  530

Query  178   LQL  170
             L++
Sbjct  531   LEV  533



>ref|XP_006375029.1| putative cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52826.1| putative cytochrome P450 family protein [Populus trichocarpa]
Length=525

 Score =   384 bits (985),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 204/498 (41%), Positives = 297/498 (60%), Gaps = 24/498 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+L +  ++    LG +ADK+GP+F +R GM P  ++   E AK+ FTT++  V+
Sbjct  44    IIGHLPLL-AGAELPHLRLGALADKYGPIFTIRIGMYPALVVSSWELAKELFTTNDAIVS  102

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    + LGYN+A F FS    ++R +RK V SELLSN +L+ +KH+R SE+E S+K
Sbjct  103   SRPKLTASKILGYNFASFGFSPYGEFFRGIRKIVASELLSNRRLELLKHVRASEVEVSVK  162

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDS---TE  1091
             ELY L+ +         +V + +W A + LN   R++AG+RY          DD+   TE
Sbjct  163   ELYKLWYSKDKNEESQILVNIKQWTADMNLNLMLRMIAGKRY----------DDAGIVTE  212

Query  1090  YKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWID  911
               EA+      REF +L+G+FVL+DA P     W D+ G+ +AMKRN +++D I   W+ 
Sbjct  213   ENEARRCQRAMREFFHLTGLFVLRDAVPF--LGWLDWGGYEKAMKRNAEELDNIFDEWLA  270

Query  910   QHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDT  731
             +H  +R  G +    A  + D + +ML  +D   + G  Y      K T+ S+II G+DT
Sbjct  271   EHRRKRDSGES----ANKEQDFMDVMLYALDGINLAG--YDADTVRKATSLSLIIGGTDT  324

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
                 + WALSLL+     +K  +EE++  VG ER V +SD++KL YLQA VKE+LRLYP 
Sbjct  325   VTVTITWALSLLLNNTVALKSAQEELDVHVGKERLVNESDIEKLTYLQACVKEALRLYPA  384

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PL   R  + DC IGGY +P G +  +N+ KI RDP+ WP P +F P+R L       D
Sbjct  385   GPLGGFREFTADCTIGGYYVPAGTRLLLNIHKIQRDPRVWPNPTEFKPERLLGSHK-AVD  443

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                + FE +PFG GRR+C G    L++SHL +A ++Q F  S P N  +DM    G+T  
Sbjct  444   VMGQHFELIPFGAGRRACPGATLGLRMSHLVLASILQAFEISPPSNAPIDMTGTAGLTCS  503

Query  190   RATPLQLVVTPRLPPNFY  137
             +ATPLQ++V PRLP + Y
Sbjct  504   QATPLQVLVKPRLPASVY  521



>ref|XP_002510297.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52484.1| cytochrome P450, putative [Ricinus communis]
Length=526

 Score =   383 bits (984),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 201/495 (41%), Positives = 301/495 (61%), Gaps = 21/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +++L +TLG MADK+GP F +R G     +I   E AK+C TT+++ VA
Sbjct  47    IIGHLRVLGGADKLLHKTLGLMADKYGPAFNIRIGSHRAFVIASKELAKECLTTNDKAVA  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  E + YN+A+F F+  +++WR MRK V+ ELLSN +L+ VK+++ SE++  ++
Sbjct  107   SRPTTAATERMCYNHAVFGFAPYSSHWREMRKIVMFELLSNRRLEMVKNVQASEVDIGLR  166

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             +LY L+      P    +V + +W   +T N   R+VAG+RY        G  D  E + 
Sbjct  167   KLYNLWADNGCLP---VLVELKQWFQDVTFNVIVRMVAGKRYA-------GSSDDYEARL  216

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ I+   +F +L G+FV+ DA P     W D +GH +AMK   K +D +L  W+++H+
Sbjct  217   CQKAIS---QFYHLMGIFVVSDALP--FLWWLDLEGHKKAMKETAKDLDTVLAGWLEEHL  271

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +RR  G           D I +MLS  +K  + GF Y   ++IK T  ++I   S TT T
Sbjct  272   QRRVPGEVKTEV---QQDFIDVMLSLEEKGNLSGFLYDADISIKATCLALIAGASGTTTT  328

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              ++WA+SLL+     +K+ +EE++  +GTER V++SD+K L YLQA++KE+LRLYP  PL
Sbjct  329   TLIWAISLLLNNQAALKKAQEELDQHIGTERQVDESDLKNLVYLQAIIKETLRLYPVAPL  388

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             + PR   +DC IGGY +  G +  +N+WKI RDP+FW  P  F P RFL   A   D   
Sbjct  389   I-PREFMEDCTIGGYHVAAGTRLLINVWKIHRDPRFWTNPLAFEPGRFLTSHA-DIDVRG  446

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRRSC G  + L   HL +AR +  F+ +TP +  +DM E  G  +P+AT
Sbjct  447   QHFELIPFGSGRRSCPGAPFGLHALHLALARFLHAFDLATPMDQPIDMSEMPGTHVPKAT  506

Query  181   PLQLVVTPRLPPNFY  137
             PL+++V+PRLP   Y
Sbjct  507   PLEVLVSPRLPAKLY  521



>ref|XP_010664626.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=534

 Score =   384 bits (985),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 200/498 (40%), Positives = 299/498 (60%), Gaps = 27/498 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L    ++  +TLG MADK+GP+F+++ G+  + M+   E AK+CFTT+++  A
Sbjct  59    VIGHLHLLGGP-ELPHKTLGAMADKYGPVFLIKLGVQRVLMLSNWEMAKECFTTNDKVFA  117

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P+    E LGYNYAMF F    +YWR +RK V + LLSN +L+ VKH+ +SE++ SI+
Sbjct  118   NRPKSIAVEVLGYNYAMFGFGPYGSYWRQVRKIVTTGLLSNRRLEIVKHVWISEVKASIR  177

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY         +   +V M +W   L+LN   R+++G R            DS+  +E 
Sbjct  178   ELYELWINKRSDSNMVLVEMKDWFGDLSLNMVLRMLSGGR------------DSSSKEER  225

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                  + R+F    G F++ DA PL   +WFDF G+ +AM++  K +D +L++W+ QH  
Sbjct  226   MRCHKLVRDFFQSMGTFLVSDALPL--LRWFDFGGYEKAMRKTAKDLDHLLESWLQQHKS  283

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDK----EFVKGFPYTHQMAIKGTTQSMIIDGSDT  731
             +R    +   A GN  D + +MLS +D     E +KGF        K T  +++  G+DT
Sbjct  284   KR----SSEQADGNQ-DFMDVMLSMLDDMATDEDLKGF--DADTINKATCLTILAGGTDT  336

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
                 ++WALSLL+    V+K  REE+++ VG ER VE+ D+K L YL A+VKE+LRLYP 
Sbjct  337   VTVSLIWALSLLLNKPQVLKTAREELDSHVGRERQVEERDMKNLAYLNAIVKETLRLYPA  396

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PL  P  +++DC +GGY +P G +   NLWKI RDP  W +PD+F P+RFL       D
Sbjct  397   GPLTAPHESTEDCLLGGYHIPAGTRLLANLWKIHRDPSIWSDPDEFRPERFLTTHK-DVD  455

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                + FE +PFG GRR C G+++ LQ    T+A LIQGF F+T  +  +DM E  G+T  
Sbjct  456   VKGQHFELIPFGSGRRICPGISFGLQFMQFTLASLIQGFEFATMSDEPVDMTESIGLTNL  515

Query  190   RATPLQLVVTPRLPPNFY  137
             +ATPL+++V PRL  + Y
Sbjct  516   KATPLEVLVAPRLSSDLY  533



>ref|XP_004291927.1| PREDICTED: cytochrome P450 82A3-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   383 bits (984),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 199/496 (40%), Positives = 295/496 (59%), Gaps = 24/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQN--QILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERD  1445
             I+GH+P+L      QI+   LG MADK+GPLF VR G+ P  ++   E AK+CFT H+  
Sbjct  49    ILGHLPLLGGSTPPQII---LGAMADKYGPLFTVRLGVYPTLVVSSSEVAKECFTIHDMA  105

Query  1444  VASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETS  1265
              +S+P+ A  E +GYNYAMF       YWR +RK    +LLSN ++  +K IR+SE+ T 
Sbjct  106   ASSRPKMAAVELIGYNYAMFGMGPSGPYWREVRKLATLKLLSNRQMQLLKDIRVSEVATF  165

Query  1264  IKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             +KEL+       + N   +V + +W   LTLN + R+VAG+RY F    A  D    E K
Sbjct  166   LKELF----KCTDHNHVDLVELKQWFGDLTLNVTLRMVAGKRYSFISDSASED----EKK  217

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EA+ + +  R+F Y +G+F++ D  P    +W D  GH +AMK+  K++D I++ W+ +H
Sbjct  218   EARRVQDAVRKFFYFAGVFMVGDLVPY--LRWLDLGGHEKAMKKTAKEIDAIIEEWLQEH  275

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              +RR+ G+        + D +  ML+ +    + G  Y      K T  +MI+ GSDTT 
Sbjct  276   KQRRRAGDT------GEHDFMDAMLTELQGADLGG--YEADTVNKATCLNMILGGSDTTM  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
               ++WA+SLL+    V+K+ ++E++A+VG ER+V +SD  KL Y+QA+VKE+LRLYP VP
Sbjct  328   VTLIWAISLLLNNRHVLKQAQDELDAEVGRERFVTESDTGKLVYIQAIVKETLRLYPAVP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             L      ++D  + GY + KG +   NLWKI  +P+ WP+P +F P+RFL       D  
Sbjct  388   LSAQHEFTEDSTVNGYHVQKGTRLITNLWKIQTNPQMWPDPLEFKPERFLTTHK-NIDVR  446

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
                FE +PFG GRRSC G+++ALQ+    +A  +  F  STP N  +DM E FG+T  +A
Sbjct  447   GHHFELIPFGSGRRSCPGISFALQMVSFALASFLHAFEVSTPSNELVDMSESFGLTNVKA  506

Query  184   TPLQLVVTPRLPPNFY  137
             TPL +++ PRL    Y
Sbjct  507   TPLNVLIKPRLCSKLY  522



>emb|CBI40977.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   384 bits (985),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 197/495 (40%), Positives = 292/495 (59%), Gaps = 32/495 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +  +Q Q+  +TLG MADK+GP+F +R G+  I ++   E A++CFTTH+R  +
Sbjct  78    IIGHLHLFGAQ-QLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEMARECFTTHDRVFS  136

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P     + LGY++AMF F+   +YWR MRK V  ELLSN +LD +KHIR SE+ TSI+
Sbjct  137   TRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDMLKHIRASEVGTSIR  196

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY    +    +    V M  W   LTLN + R+V G+RY     GA            
Sbjct  197   ELYEMWVSERGTDGRVFVDMKRWFGDLTLNLAVRLVGGKRY----FGA------------  240

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                  V R+F +L G+FVL DA P     W D +G+ +AMKR  K++D +   W+ +H E
Sbjct  241   -----VIRDFAHLFGVFVLSDAIP--FLSWLDLKGYKKAMKRTAKELDSLFGGWLQEHKE  293

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +R LG        +D D + +ML+ ++     GF        K T  ++I+ GSDTT   
Sbjct  294   KRLLGG----EGKDDQDFMDVMLTVLEDVNFSGFDA--DTVNKATCLNLILAGSDTTKVT  347

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+ +  V+K+ + E++ QVG +R V++SDVK L YLQA++KE+LRLYP  P++
Sbjct  348   LTWALSLLLNHPHVLKKAQAELDIQVGKDRQVDESDVKNLVYLQAIIKETLRLYPASPII  407

Query  538   MPRMTSKDCKI-GGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
                   +DC +  GY++  G Q  VN WKI RD + W  P +F P+RF+       D   
Sbjct  408   TLHAAMEDCTLAAGYNISAGTQIMVNAWKIHRDERVWCNPKEFQPERFMTSHK-DTDVRG  466

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRRSC G++ ALQ+ H  +A L+  +  + P + ++DM E  G+T  +AT
Sbjct  467   QHFELIPFGSGRRSCPGISLALQVVHFALASLLHSYEVTKPSDGDVDMTESLGLTNLKAT  526

Query  181   PLQLVVTPRLPPNFY  137
             PL+++++PRL    Y
Sbjct  527   PLEVLLSPRLKAELY  541



>ref|XP_008220885.1| PREDICTED: cytochrome P450 82A3-like [Prunus mume]
Length=1017

 Score =   397 bits (1020),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 209/499 (42%), Positives = 302/499 (61%), Gaps = 22/499 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I GH+P+L        + L  MADK+GPLF +R G+ P  +I   E AK+CFTT++   +
Sbjct  537   IFGHLPLLGGSTPPHIK-LAAMADKYGPLFTIRLGVYPSLVISSSEIAKECFTTNDLASS  595

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+  V EH+GYN+AMF F+    +WR MRK    +LLSN +L+ ++HIR+SE+ T ++
Sbjct  596   SRPKLVVVEHVGYNHAMFGFAPSGPFWREMRKITTLKLLSNRRLELLRHIRVSEVTTFLQ  655

Query  1258  ELY-LFVTASP-EPNK--AAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTE  1091
             ELY  + TA   E N     +V + +W   +TLN   R+VAG+RY      A  +D+ TE
Sbjct  656   ELYKTWSTAEKRESNNRDGVLVELKQWFGDMTLNVILRMVAGKRYSV----AADEDEKTE  711

Query  1090  YKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWID  911
              +  Q  + +F  F Y+ G+FVL DA P    +W D  GH +AMK+  K++D I+  W++
Sbjct  712   ARRVQSALKLF--FYYV-GLFVLGDAVPY--LRWLDLGGHEKAMKKIAKELDAIVGGWVE  766

Query  910   QHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDT  731
             +H  RR  G+A       + D I  MLS +D   + GF        K T+ +MI   SDT
Sbjct  767   EHKRRRARGDAKG-----EPDFIDAMLSVLDGADLGGF--DADTVNKATSLNMIAGASDT  819

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
             T   + WA+SLL+    ++KR + E++ ++G +R V +SD+ KL Y+QA+VKE+LRLYP 
Sbjct  820   TMVTLTWAISLLLNNPHMLKRAQTELDTEIGRQRVVSESDISKLVYIQAIVKETLRLYPA  879

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PL  PR  +KDC IGGY + KG +   NLWKI  DP+ WP+P +F P+RFL  +    D
Sbjct  880   APLSGPREFTKDCTIGGYHVSKGTRLITNLWKIQTDPRIWPDPLEFKPERFLTTQK-DVD  938

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                  FE +PFG GRR+C G+A+ALQ+   T+A  +  F  S P +  +DM E FG+T  
Sbjct  939   VKGLHFELIPFGSGRRACPGLAFALQMVQFTLASFVHAFEISNPLSAPIDMTESFGLTNV  998

Query  190   RATPLQLVVTPRLPPNFYG  134
             +ATPLQ+++ PRLP   YG
Sbjct  999   KATPLQVLIKPRLPSQLYG  1017


 Score =   338 bits (867),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 183/449 (41%), Positives = 259/449 (58%), Gaps = 20/449 (4%)
 Frame = -1

Query  1585  NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVASKPEFAVGEHL  1406
             +Q+    L  + DK+GP F +  G+    +I   E AKDCFTT++  V+S+P     +HL
Sbjct  70    SQLPHIALASLVDKYGPAFTINIGIHSALVISTWEVAKDCFTTNDMVVSSRPATLGAKHL  129

Query  1405  GYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKELYLFVTASPE  1226
             GYN+AMF FS    YWR MRK    ELLSN +L+ +K +R+SE+E S+KELY       E
Sbjct  130   GYNFAMFGFSPYGPYWREMRKLTSLELLSNRRLELLKKVRVSEVEMSLKELYTLWIKRKE  189

Query  1225  PNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQEMINVFREFQ  1046
              +   +V M  W   LTLN   R+VAG+R          + + +E KEA+      REF 
Sbjct  190   SSGERLVEMKRWFGDLTLNVIFRMVAGKR-------CFMNGNLSEEKEARRWQKAMREFF  242

Query  1045  YLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIERRQLGNAPAPA  866
             +L+G+FVL DA P     W D  G  +AMK+N K++D I+  W+++H ++          
Sbjct  243   HLAGLFVLGDAVP--WLSWLDLGGQQKAMKKNAKELDSIVAEWLEEHKQK--------IT  292

Query  865   AGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTHMVWALSLLVKY  686
              G D D + +MLS I+   V GF       IK T   +I  GSDTT   + WALSLL+  
Sbjct  293   EGKDQDFMDVMLSAINGTDVAGF--DADTVIKATCLILIAGGSDTTMVTLTWALSLLLNN  350

Query  685   GDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLLMPRMTSKDCKI  506
               V+K+  EE++  VG  R +E+SD+  L YLQA VKE++RL P  PL   R  ++DC I
Sbjct  351   RQVLKKIYEELDQYVGKGRLLEESDINNLVYLQATVKEAMRLCPAGPLSGQREFTEDCTI  410

Query  505   GGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLKRFEYVPFGCGR  326
             GGY +PKG    VNLWKI  DP+ W +P +F P+RFL       D   ++FE +PFG GR
Sbjct  411   GGYHVPKGTWLLVNLWKIQTDPRVWADPMEFKPERFLTTHK-DVDVRGQQFELMPFGSGR  469

Query  325   RSCVGMAYALQISHLTIARLIQGFNFSTP  239
             R+C G+++ LQ++ LT+A  +   ++S P
Sbjct  470   RACPGISFGLQMTLLTLASFLFSMDYSLP  498



>ref|XP_009595933.1| PREDICTED: cytochrome P450 82A4-like [Nicotiana tomentosiformis]
Length=523

 Score =   382 bits (982),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 193/498 (39%), Positives = 300/498 (60%), Gaps = 31/498 (6%)
 Frame = -1

Query  1618  IIGHIPILNS---QNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHER  1448
             +IGH+    +    ++ L++ LG++ADKHGP+F  + G     ++   +A K+CFTT++ 
Sbjct  51    VIGHLFYFKNDADHDRTLAQKLGDLADKHGPVFTYKLGFRRFLVVSSYDAIKECFTTNDI  110

Query  1447  DVASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELET  1268
               +++P    G+HL YN AM   +    YWR +RK V  E+LS  +L+K K+IR S ++ 
Sbjct  111   RFSNRPALLYGDHLCYNNAMLFIAKYGPYWRKIRKLVNQEVLSVNRLEKFKYIRFSIVQE  170

Query  1267  SIKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEY  1088
             ++KELY    ++        + + +WI +L+ +   +++AG+ Y    G           
Sbjct  171   NVKELYDHCDST--------INLTDWIDKLSFDIILKMIAGKSYNNGHG-----------  211

Query  1087  KEAQEMINV-FREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWID  911
                 E++ + F++F  ++  F L D FP+ LFKW DF G+V+ +K   K +D + Q W+D
Sbjct  212   ----EILKIAFQKFMVIAMEFELYDIFPIPLFKWVDFSGNVKVVKETFKDIDTVFQGWLD  267

Query  910   QHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDT  731
             +HI++R+  N       N+ D I  MLS    E + G  Y+    IK T  S+++D ++T
Sbjct  268   EHIKKRESNNEVLDE--NEQDFIDSMLSKTSNERL-GDTYSPSTTIKATIFSLVLDATET  324

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
                H+ W ++LL+     MK+ +EEI+  VG +RWVE+SD+K L YLQA+VKE+LRLYP 
Sbjct  325   LALHIKWVMALLINNKLEMKKAQEEIDTIVGKDRWVEESDIKNLVYLQAIVKEALRLYPP  384

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PL +P  + +DC + GY +PKG     N+ K+ RDPK W +P+KF P+RFL   A   D
Sbjct  385   APLSVPHESVEDCVVNGYHIPKGTVLLPNVMKLQRDPKMWLDPNKFDPERFLTTHA-KID  443

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                + +E +PFG GRR+C  M YALQ+ +L+IA LIQGFNF+TP N  LDM+EG G+T P
Sbjct  444   YRGQHYELIPFGTGRRACPAMTYALQVEYLSIAHLIQGFNFNTPSNEPLDMKEGVGITSP  503

Query  190   RATPLQLVVTPRLPPNFY  137
             +  P+++++TPRLP   Y
Sbjct  504   KKNPIEVLITPRLPTMLY  521



>ref|XP_002282118.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   382 bits (982),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 200/489 (41%), Positives = 287/489 (59%), Gaps = 17/489 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L     +    LG MADK+G +F VR G+    ++   + AK+CFTTH+  +A
Sbjct  47    IIGHLHLLGGSKNLPHLLLGTMADKYGAVFSVRLGLERAVVVSSWQMAKECFTTHDLALA  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+  + + LGYN AMF+FS   AYWR +RK    ELLSN +L+ +K++R+SE+ET +K
Sbjct  107   SRPQLVISKQLGYNDAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMK  166

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY             +V M +W   LTLN    +VAG+RY        G    ++ KE 
Sbjct  167   ELYKLWAEKKNEAGVVLVDMKQWFGDLTLNVILMMVAGKRY-------FGYTAESQEKET  219

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q      REF  L G+FV+ DA P     W D  GH++A K+  K++D I Q W+++H +
Sbjct  220   QRCQKSIREFFRLLGLFVVSDALP--FLGWLDVGGHLKATKKTAKEMDGIAQEWLEEHRQ  277

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R+  G     A GN  DL+ +MLS +      G  Y      K T+  +I  GSDTT   
Sbjct  278   RKDSGE----ANGNQ-DLMDVMLSILAGTDPTG--YDADTINKATSLILIAGGSDTTSVT  330

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WA+SLL+    ++++ +EE++  VG  R V + D+ KL YLQA+VKE+LRLYP  PL 
Sbjct  331   LTWAISLLLNNPCMLRKAQEELDTHVGKGRLVNEVDLSKLVYLQAIVKETLRLYPAFPLS  390

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR  ++D  +GGY +PKG +  +NL KI RDP  W  P +F P+RFL       D  +K
Sbjct  391   GPRQFNQDSILGGYRIPKGTRLVLNLTKIQRDPSIWLNPTEFQPERFLTTHK-DIDMRVK  449

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE+ PFG GRR C G  +ALQ+ HLT+A  +  F  STP +  +DM E  G+T  ++TP
Sbjct  450   NFEFTPFGGGRRICPGATFALQVLHLTLANFLHKFQLSTPSDATVDMSESLGITNIKSTP  509

Query  178   LQLVVTPRL  152
             L+++++PRL
Sbjct  510   LEVLISPRL  518



>ref|XP_007047111.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91268.1| Cytochrome P450 [Theobroma cacao]
Length=529

 Score =   382 bits (980),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 196/496 (40%), Positives = 297/496 (60%), Gaps = 19/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L  Q Q+  +TLG MADK+GP+F +R G   + ++   E AK+CFT H++  +
Sbjct  49    VIGHMHLLGGQ-QLTHKTLGAMADKYGPVFSIRLGSHRVLVLNSWEMAKECFTVHDKVFS  107

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P  A  +HLGY++AMF F+   +YWR MRK    ELLS+ ++D +KHIR SE++T+I+
Sbjct  108   TRPSIAASKHLGYDFAMFGFAPYGSYWREMRKIATIELLSSHRIDMLKHIRASEVKTAIR  167

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY    +         V M +W   LT N + R+V GRRY        G +   E  +A
Sbjct  168   ELYKSWLSKGSAETEVFVDMKQWFGDLTHNIALRMVGGRRY-------FGPNADCEEADA  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +    V R+F YL G+FVL DA P     W DFQG+ ++MKR  K++D +++ W+++H +
Sbjct  221   RRCQKVMRDFVYLFGVFVLSDAIP--FLGWLDFQGYEKSMKRTAKQLDSLVERWLEEHKQ  278

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +R  G         + D + +ML+ ++   + GF        K T  ++I+ GSDTT   
Sbjct  279   KRLSGGGVI----EEQDFMDVMLNILEDGKITGF--DADTINKATCLNLILAGSDTTMVT  332

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+    V+KR ++E++  VG +R +E+SD+  L YLQ++VKE+LRLYP  P++
Sbjct  333   LTWALSLLLNNPRVLKRAQDELDMHVGKDRPLEESDISNLVYLQSIVKETLRLYPPSPII  392

Query  538   MPRMTSKDCKIG-GYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
               R   +DC +  GY +P G +  VN WKI RD + WP+P  F P+RFL       D   
Sbjct  393   GLRAALEDCTLSTGYHIPSGTRLMVNAWKIQRDERVWPDPHDFQPERFLTSHK-DMDFRG  451

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVE-LDMEEGFGVTLPRA  185
             + FE +PFG GRRSC G + AL++ H  + R +  F+ + P  +E +DM E  G+T  +A
Sbjct  452   QTFELIPFGSGRRSCPGTSLALKMVHFILGRFLHSFDVAKPSKLEDVDMTESAGLTNLKA  511

Query  184   TPLQLVVTPRLPPNFY  137
             TPL+++VTPRL    Y
Sbjct  512   TPLEVLVTPRLNSQLY  527



>emb|CDP15727.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   383 bits (984),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 191/496 (39%), Positives = 307/496 (62%), Gaps = 19/496 (4%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             IGH+  L  Q   L+R LG MADK+GP F +R G  P  ++   E  K+CFT +++  AS
Sbjct  96    IGHLHHLGGQLP-LARILGSMADKYGPTFSLRLGSRPAIVVSSWEMVKECFTINDKTFAS  154

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P  A+ +++G N A+F+ +    YWR +RK V  ELL+N +L+K+KH+R SE    I++
Sbjct  155   RPNTALAKYMGNNNAIFALAPYGPYWRDVRKMVTLELLTNQRLEKLKHVRASEFNKWIRD  214

Query  1255  LYLFVTAS--PEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             LY   + +  P+ +    V ++EW   LT N   R++ GR +     G    +D++E + 
Sbjct  215   LYSLCSKNDRPDVDVPTKVVLNEWFELLTFNLILRMLVGRPFSTSSQG----NDNSEDRR  270

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              +E I   ++  YL G+FV  D  P    +W D  GH+++MK+  K++D++L  W+ +HI
Sbjct  271   MKEAI---KKMLYLGGVFVFSDVIPW--IEWLDIGGHIKSMKKAGKELDEVLGQWLQEHI  325

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTI-DKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             ++ +  +  + A     D + +MLSTI +   + G  +     IK TT ++I+ GS++T 
Sbjct  326   QKAKQSHPESEAVH---DFMDVMLSTIPETGEISG--HKRDAIIKSTTATLIMTGSESTA  380

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
               ++WALSLL+ + +++K  + E++ QVG +RW+E++D+K L +LQA+VKE+ RLYP  P
Sbjct  381   ETLIWALSLLLNHPNILKIAQNELDVQVGKQRWIEEADIKNLSFLQAIVKETFRLYPPGP  440

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             L  PR  ++DC +G + +PKGA+  VNLWK+ RDP+ W +P +F P+RFLN  A  +   
Sbjct  441   LSGPREATEDCYLGNFFVPKGARLIVNLWKLHRDPRIWSDPLEFKPERFLNSHANISLKG  500

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FEY+PF  GRR C  + Y + +  LT+AR++Q F+ +TP  + +DM EG GV LP+ 
Sbjct  501   -QSFEYIPFSSGRRMCPAVNYGMNVVQLTLARMLQAFDIATPMGMPVDMGEGLGVALPKL  559

Query  184   TPLQLVVTPRLPPNFY  137
              PL++++TPRLP   Y
Sbjct  560   KPLEVLLTPRLPVELY  575



>ref|XP_007134139.1| hypothetical protein PHAVU_010G022600g [Phaseolus vulgaris]
 gb|ESW06133.1| hypothetical protein PHAVU_010G022600g [Phaseolus vulgaris]
Length=530

 Score =   382 bits (980),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 197/494 (40%), Positives = 295/494 (60%), Gaps = 20/494 (4%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             IGH+ +LN++     RT   MA+K+GP+F V+ G  P  ++   E AK+C TT++R  AS
Sbjct  53    IGHLHLLNARIPYF-RTFSAMAEKYGPIFCVKLGCHPTIVVNSREIAKECLTTNDRVFAS  111

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P    G  +GYN A+F  +    YWR +RK  V E+LS+ +L+K+KH+R +E  + +K+
Sbjct  112   RPNTTGGRLMGYNNAIFGLAPYGNYWREIRKMAVLEILSSYRLEKLKHVRDTETFSLVKD  171

Query  1255  LYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQ  1076
             LY  +++      +  VA+   +   T N   R++AG+R+        GD  + E  EA 
Sbjct  172   LYSSMSSPKNVKGSTEVAISNLLEHTTFNIIVRMIAGKRFG-------GDTVNQEDNEAW  224

Query  1075  EMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIER  896
             ++    R+  YL G+FV+ DA P     WFDFQG+V  MKR  K+ D ILQ W+++H+  
Sbjct  225   KLRKSIRDSTYLFGVFVVADAIPS--LSWFDFQGYVSFMKRTAKQTDLILQKWMEEHLRD  282

Query  895   RQLGNAPAPAAGNDLDLIHLMLSTID-KEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R            + D + +M+ST + +E + G  Y  +  IK T   +I+ GS +T   
Sbjct  283   R------VRDGKCERDFMDVMISTFEEQEEICG--YKKETVIKATAMLLILTGSGSTAMT  334

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+ +  V+K   +E++  VG ERWVE+SD+K L YL A++KE+LRLYP  PL 
Sbjct  335   LTWALSLLLNHPKVLKVALQELDTHVGKERWVEESDIKNLNYLHAIIKETLRLYPPAPLT  394

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
               R   +DC + GY +PKG +  +NLW + RDP+ W  P++F P+RFL+      D   +
Sbjct  395   GIREVMEDCSLVGYHVPKGTRLLINLWNLQRDPEVWANPNEFQPERFLSSHR-DIDFMSQ  453

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PF  GRRSC GMA+ LQ++HLT+ARL+QGF+       E+DM EG GV LP+  P
Sbjct  454   DFELIPFSFGRRSCPGMAFGLQVTHLTLARLLQGFHICLKDGAEVDMTEGLGVALPKEQP  513

Query  178   LQLVVTPRLPPNFY  137
             L++++ PRLP   Y
Sbjct  514   LRVMLQPRLPLELY  527



>gb|KDP38422.1| hypothetical protein JCGZ_04347 [Jatropha curcas]
Length=523

 Score =   381 bits (978),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 201/495 (41%), Positives = 300/495 (61%), Gaps = 21/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L   +++L +TLG M DK+GP+F +R G     ++  +E+AK+CFT +++ +A
Sbjct  47    VIGHLHLLGGADKLLHQTLGTMVDKYGPVFNIRIGSRRALVVASVESAKECFTLNDKILA  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A  +H+ YN+A+F F+  + +WR MRK V+ ELLSN  L+ +K ++ +EL+  I+
Sbjct  107   SRPTTAATKHMCYNHAVFGFAPFSPHWREMRKIVMLELLSNRSLEMIKQVQHTELDLGIR  166

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             +LY L+   S  P    +  ++ W   LTLN   R+VAG++Y     G+  DD+S   ++
Sbjct  167   KLYGLWAKNSCLP---LLFELNRWFDDLTLNVIVRVVAGKQY----AGSSNDDESKRCRK  219

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             A        EF +L G+FV  DA P     W D +GHV+AMK+  + +D IL  W+++H 
Sbjct  220   A------ISEFYHLMGIFVASDALP--FLWWLDLKGHVKAMKKTAEDLDVILSGWLNKHR  271

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +RR   + P     ++ D I +MLS  +K  + GF Y    +IK T  ++I    DT  T
Sbjct  272   QRRI--SVPGEVK-SEKDFIDMMLSLEEKGRMSGFQYDADTSIKSTCLALIAGAGDTITT  328

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WA+SLL+     +K+ +EE++  VG ER V +SD+K L YLQA+VKE+LRLYP  PL
Sbjct  329   TLTWAMSLLLNNQPSLKKAQEELDLHVGIERQVVESDIKNLVYLQAIVKETLRLYPVAPL  388

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             + PR   +DC I GY +P G +  VN+ KI RDPKFW  P  F P+RFL       D   
Sbjct  389   I-PREFMEDCSIAGYRVPAGTRLLVNVGKIQRDPKFWTNPLAFQPERFLENHT-NIDVRG  446

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
               FE +PFG GRRSC G ++AL   HLT+ARL+  F+  T  +  +DM E  G   P+AT
Sbjct  447   HHFELIPFGSGRRSCPGASFALHTLHLTLARLLHMFDLRTSMDKPVDMTETPGTHTPKAT  506

Query  181   PLQLVVTPRLPPNFY  137
             PL+++++PRLP   Y
Sbjct  507   PLEVLLSPRLPEKLY  521



>ref|XP_003537400.1| PREDICTED: cytochrome P450 82A3-like [Glycine max]
Length=538

 Score =   381 bits (979),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 197/496 (40%), Positives = 298/496 (60%), Gaps = 14/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ + N+ +Q+  +TLG+MA+KHGP+F ++ G   + ++   E AK+CFT H++  +
Sbjct  48    IIGHLHLFNA-HQLTHKTLGKMAEKHGPIFTIKLGSYKVLVLSSWEMAKECFTAHDKAFS  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P  A  + +GYNYAMF F+   +YWR +RK    ELLSN +L+ +K  R  EL+ +I+
Sbjct  107   TRPCVAASKLMGYNYAMFGFTPYGSYWRQVRKLTTIELLSNNRLEPLKDTRTVELDAAIR  166

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY   T    P    +V M +W   LT N + R+V G+ Y       +GDDD  E  EA
Sbjct  167   ELYKVWTREGCPKGGVLVDMKQWFGDLTHNIALRMVGGKSY-----SGVGDDDHAE-GEA  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +    V R++  L G+FVL D+FP     W D  G+ + MKR   ++D +++ W+++H  
Sbjct  221   RRYRRVMRDWVCLFGVFVLSDSFP--FLGWLDINGYEKDMKRTASELDALVEGWLEEHKR  278

Query  898   RRQLGNAPAPAAGNDL-DLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +R+     +     +  D + +ML+ +    + G  Y     IK T  ++I+ G+D T  
Sbjct  279   KRKRKRGLSVNGKEEQDDFMDVMLNVLQGTEISG--YDSDTIIKATCLNLILAGTDPTMV  336

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WALSLL+ +   +KR R E++  +G +R VE+SD+KKL YLQAVVKE+LRLYP  P+
Sbjct  337   TLTWALSLLLNHQMELKRARHELDTLIGKDRKVEESDIKKLVYLQAVVKETLRLYPPSPI  396

Query  541   LMPRMTSKDCKIG-GYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             +  R   +DC    GY +P G Q  VN WKI RD + W EP+ F P+RFL       D  
Sbjct  397   ITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSEPNDFKPERFLTIHK-DVDVK  455

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +E VPF  GRR+C G + AL++ HLT+ARL+  F+ ++P N  +DM E FG+T  +A
Sbjct  456   GQNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFDVASPSNQVVDMTESFGLTNLKA  515

Query  184   TPLQLVVTPRLPPNFY  137
             TPL++++TPRL   FY
Sbjct  516   TPLEVLLTPRLDTKFY  531



>ref|XP_009792748.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   380 bits (976),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 191/497 (38%), Positives = 296/497 (60%), Gaps = 28/497 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQ---NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHER  1448
             +IGH+    +    ++  S+ LG++ADK+GP+F  R G      +   EA K+CF+T++ 
Sbjct  46    VIGHLFYFKNNGDDDRHFSQKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFSTNDI  105

Query  1447  DVASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELET  1268
               A +P    GE+L YN AM + +    YW+  RK V  ELLS  +L+K KH+R S ++ 
Sbjct  106   HFADRPALLYGEYLCYNNAMLAVAKYGPYWKKNRKLVNQELLSVSRLEKFKHVRFSIVQK  165

Query  1267  SIKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEY  1088
             +IKELY     SP       + + +WI +LT +   ++V G+ Y    G           
Sbjct  166   NIKELY--DGDSP----MVKINLSDWIDKLTFDIILKMVVGKTYNNGHG-----------  208

Query  1087  KEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
                + +   F++F   +    L D F +  FKW D  G+++AMK+  K +D I+Q W+D+
Sbjct  209   ---EILKAAFQKFMVQAMEIELYDVFHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDE  265

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             HI++R+  +       N+ D I ++LS    E + G  Y+H   IK T  ++++D +DT 
Sbjct  266   HIKKRETKDV---GGENEQDFIDVVLSKRSNEHL-GDGYSHDTTIKATVFTLVLDATDTL  321

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
               H+ W ++L++   +VMK+ +EE++  VG +RWVE+SD+K L YLQA+VKE LRL+P  
Sbjct  322   ALHIKWVMALMINNKNVMKKAQEEMDTIVGRDRWVEESDIKNLVYLQAIVKEVLRLHPPA  381

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL +  ++ KDC + GY +PKG     N+ K+ RDP+ W +PDKF P+RFL   A   D 
Sbjct  382   PLSVQHLSVKDCVVNGYHIPKGTALLTNIMKLQRDPQIWADPDKFDPERFLTTHA-AIDY  440

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + +E +PFG GRR+C  M Y+LQ+ HL+IA +IQGFNF+T  N  LDM++G G+TLP+
Sbjct  441   RGQHYELIPFGTGRRACPAMNYSLQVEHLSIAHMIQGFNFATTTNEPLDMKQGVGLTLPK  500

Query  187   ATPLQLVVTPRLPPNFY  137
              T +++++TPRLPP  Y
Sbjct  501   KTDVEVLITPRLPPTLY  517



>ref|XP_008464765.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=523

 Score =   380 bits (976),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 201/496 (41%), Positives = 302/496 (61%), Gaps = 26/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L ++N+   +T  +MAD +GP+F +R G+    ++   E A++CFTT+++  A
Sbjct  51    LIGHLHLL-AKNEPAHKTFAKMADAYGPIFTLRLGLYTNLIVSNWEIARECFTTNDKIFA  109

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    + LGY+YAMF  S    +WR +RK  + ELLSN +L+K++HIR+SE++TS+K
Sbjct  110   SRPKLVASKLLGYDYAMFGLSPYGPHWRHVRKLAMLELLSNYRLEKLQHIRVSEVQTSMK  169

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY     +    K A+V M  W   +TLNT  RIV G+++   V  +  ++++ EY++A
Sbjct  170   NLYELCLKN---KKNALVEMKTWFGDITLNTISRIVVGKKFSTAVDAS--NNENEEYRKA  224

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                    R+F    G+FV  D+FP    KW D  GH +AMK+  K +D++   WI  H  
Sbjct  225   ------LRDFFEWFGVFVPSDSFPF--LKWLDLGGHEKAMKKTAKVLDEVFDKWIQDH--  274

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTI--DKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
             +  LG         + D + +MLS +  D +  K   Y      K T  S+I+ GSDTT 
Sbjct  275   KNNLGEVKM----EEHDFMDVMLSNVRDDGQLSK---YDAHTVTKATCLSLILAGSDTTT  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
               M+WALSLL+   +V+KR + E++ +VG +R V++SDVK L YLQA+VKE+LRLYP  P
Sbjct  328   VTMIWALSLLLNNQEVLKRAQLELDERVGRQRQVKESDVKNLLYLQAIVKETLRLYPAAP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             +L+P  +  DC + GY +P G +  VN+ K+ RDP+ W +P +F P+RFL   A   D  
Sbjct  388   ILVPHESVDDCVVAGYHIPVGTRLIVNVQKLQRDPQIWEDPCEFRPERFLT-SAKDFDVR  446

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              +    +PFG GRR C G+++ALQ+ HL +A L+ GF  S P    LDMEE  G+T  R 
Sbjct  447   GQNPRLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPSKEFLDMEESAGMTSIRK  506

Query  184   TPLQLVVTPRLPPNFY  137
              PL++V+TPRLPP+ Y
Sbjct  507   NPLEVVLTPRLPPHVY  522



>ref|XP_008464764.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=521

 Score =   380 bits (976),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 199/495 (40%), Positives = 300/495 (61%), Gaps = 26/495 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+P+L  + ++L  TLG+ AD +G +F++R G     ++ G E AK+CFTT++++ A
Sbjct  51    VIGHLPLLTGK-ELLHNTLGKFADTYGAIFMLRLGTNKTLIVSGSEVAKECFTTNDKNFA  109

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+FA    LGYNYAMF  S   ++WR +RK V+ ELL+N ++++++HI   E++ SI+
Sbjct  110   SRPKFAAARLLGYNYAMFGVSPYGSHWRHIRKIVMLELLANHRMNRLQHIPRLEVQNSIQ  169

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             EL+    +    NK  VV M++W   +TLNT  ++V G+R+     G     D  EY+  
Sbjct  170   ELHELCRS----NKKVVVEMEKWFGDITLNTIFKMVIGKRFSIAFKGI----DGEEYQ--  219

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                 N  ++F  L   FV  D FP    +WFDF G+ ++MK+  K +D++   W+ +H E
Sbjct  220   ----NALKDFFNLFIAFVPSDLFPF--LRWFDFGGYKKSMKKTAKIMDEMHDKWLREHRE  273

Query  898   RRQLGNAPAPAAGNDLDLIHLMLS-TIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +R            D DL+H+MLS T+D++F     Y     IK T  +MI+ G  TT  
Sbjct  274   KRN----SVGVGIEDQDLMHIMLSITMDEDFSG---YDVDTIIKSTCLAMILGGFHTTTA  326

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              MVWALSLL+K+ + +K+ + E++ +VG ER V +SD+  L YLQAVVKE+LRLYP   L
Sbjct  327   EMVWALSLLLKHEEALKKVQLELDERVGRERQVNESDINDLIYLQAVVKETLRLYPAAQL  386

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
              +P  + +DC + GY +P G +  VNL+K+ RDP  W  P +F P+RFL  E     N  
Sbjct  387   SVPHESIEDCTVAGYHVPAGTRLWVNLYKLQRDPNVWESPTEFRPERFLTSEKNYDVNG-  445

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             +  E++PFG GRR C G+++A Q+ HLT+ARL+  F    P    L+MEE   + + +  
Sbjct  446   QTPEFIPFGSGRRICPGISFATQVMHLTLARLLHEFQIGLPSQEPLNMEESVALNITKKV  505

Query  181   PLQLVVTPRLPPNFY  137
             PL++VVTPRL P  Y
Sbjct  506   PLEVVVTPRLSPQIY  520



>gb|KHG29694.1| Cytochrome P450 [Gossypium arboreum]
Length=522

 Score =   380 bits (976),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 199/494 (40%), Positives = 298/494 (60%), Gaps = 19/494 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+L    +    TLG++ +K+GP +++R G+ P  ++   E AK+ FT ++  V+
Sbjct  47    IIGHLPLLGGP-KTPHETLGDLGEKYGPAYMIRIGVHPALVVNSSEVAKEIFTVNDMYVS  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+ EFA  EHLGYNYAMF FS    YWR MRK  + E+LSN ++D++K + +SE+E S+K
Sbjct  106   SRSEFAAAEHLGYNYAMFGFSPYGQYWREMRKITMLEVLSNHRIDQLKKVFVSEIEGSMK  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY    A  + +   +V M +  + LTLN   R VAG+RY       + ++D    KE 
Sbjct  166   LLYKTWAAKKDGSSKVLVEMKKHFSDLTLNVIMRTVAGKRYS-----VVAEEDQ---KEV  217

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                    R+F +L+GMFVL DA P    +W D  G+ + MK+  K++D+I   W+D H  
Sbjct  218   LRYRKALRDFFHLTGMFVLGDAVPF--LRWLDIGGYEKWMKKTAKELDEISGGWLDDH--  273

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
              R+ G         + D + +M S +    + G  Y      K T+ +MI+ GSDTT   
Sbjct  274   -RKGGRWDENK--KEKDFMDVMNSVLKGASLAG--YDADTINKATSLNMILAGSDTTTVT  328

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             ++W LSL++    ++K+ +EE++  +G +R V ++D+ KL Y+QA+VKE+LR+YP  PL 
Sbjct  329   LIWGLSLMLNKPHILKKAQEELDTYIGRDRLVNETDIGKLVYIQAIVKETLRMYPPAPLS  388

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR  S+ C IGGYD+PKG +  +NL KI RDPK WPEP +F P+RFL       D   +
Sbjct  389   APRELSESCSIGGYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHK-DVDVRGQ  447

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRRSC G ++AL + +LT++  +  F+FSTP N  +D+    G+T  ++TP
Sbjct  448   HFELMPFGSGRRSCPGTSFALHMLYLTMSNFLHAFDFSTPSNGLIDLTGTVGLTNIKSTP  507

Query  178   LQLVVTPRLPPNFY  137
             LQ +V+PRL P  Y
Sbjct  508   LQALVSPRLAPELY  521



>ref|XP_009770601.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   380 bits (975),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 190/497 (38%), Positives = 296/497 (60%), Gaps = 28/497 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQ---NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHER  1448
             +IGH+    +    ++  S+ LG++ADK+GP+F  R G      +   EA K+CF+T++ 
Sbjct  46    VIGHLFYFKNNGDDDRHFSQKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFSTNDI  105

Query  1447  DVASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELET  1268
               A +P    GE+L YN AM + +    YW+  RK V  ELLS  +L+K KH+R S ++ 
Sbjct  106   HFADRPALLYGEYLCYNNAMLAVAKYGPYWKKNRKLVNQELLSVSRLEKFKHVRFSIVQK  165

Query  1267  SIKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEY  1088
             +IKELY     SP       + + +WI +LT +   +++ G+ Y    G           
Sbjct  166   NIKELY--DGDSP----MVKINLSDWIDKLTFDIILKMIVGKTYNNGHG-----------  208

Query  1087  KEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
                + +   F++F   +    L D F +  FKW D  G+++AMK+  K +D I+Q W+D+
Sbjct  209   ---EILKAAFQKFMVQAMEIELYDVFHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDE  265

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             HI++R+  +       N+ D I ++LS    E + G  Y+H   IK T  ++++D +DT 
Sbjct  266   HIKKRETKDV---GGENEQDFIDVVLSKRSNEHL-GDGYSHDTTIKATVFTLVLDATDTL  321

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
               H+ W ++L++   +VMK+ +EE++  VG +RWVE+SD+K L YLQA+VKE LRL+P  
Sbjct  322   ALHIKWVMALMINNKNVMKKAQEEMDTIVGRDRWVEESDIKNLVYLQAIVKEVLRLHPPA  381

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL +  ++ KDC + GY +PKG     N+ K+ RDP+ W +PDKF P+RFL   A   D 
Sbjct  382   PLSVQHLSVKDCVVNGYHIPKGTALLTNIMKLQRDPQIWADPDKFDPERFLTTHA-AIDY  440

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + +E +PFG GRR+C  M Y+LQ+ HL+IA +IQGFNF+T  N  LDM++G G+TLP+
Sbjct  441   RGQHYELIPFGTGRRACPAMNYSLQVEHLSIAHMIQGFNFATTTNEPLDMKQGVGLTLPK  500

Query  187   ATPLQLVVTPRLPPNFY  137
              T +++++TPRLPP  Y
Sbjct  501   KTDVEVLITPRLPPTLY  517



>gb|ABC69420.1| CYP82E8 [Nicotiana tabacum]
Length=519

 Score =   380 bits (975),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 191/498 (38%), Positives = 299/498 (60%), Gaps = 30/498 (6%)
 Frame = -1

Query  1618  IIGHIPILNS---QNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHER  1448
             +IGH+    +   +++  S+ LG++ADK+GP+F  R G      +   EA K+CFTT++ 
Sbjct  46    VIGHLFYFKNNGDEDRHFSQKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFTTNDI  105

Query  1447  DVASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELET  1268
               A +P    GE+L YN AM + +    YW+  RK V  E+LS  +L+K KH+R S ++ 
Sbjct  106   HFADRPSLLYGEYLCYNNAMLAVAKYGPYWKKNRKLVNQEVLSVSRLEKFKHVRFSIIQK  165

Query  1267  SIKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEY  1088
             +IK+LY     SP       + + +WI +LT +   ++V G+ Y    G           
Sbjct  166   NIKQLY--NCDSP----MVKINLSDWIDKLTFDIILKMVVGKNYNNGHG-----------  208

Query  1087  KEAQEMINV-FREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWID  911
                 E++ V F++F   +    L D F +  FKW D  G+++AMK+  K +D I+Q W+D
Sbjct  209   ----EILKVAFQKFMVQAMEMELYDVFHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLD  264

Query  910   QHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDT  731
             +HI++R+  +       N+ D I ++LS +  E + G  Y+H   IK T  ++++D +DT
Sbjct  265   EHIKKRETKDV---GGENEQDFIDVVLSKMSDEHL-GEGYSHDTTIKATVFTLVLDATDT  320

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
                H+ W ++L++    VMK+ +EE++  VG +RWVE+SD+K L YLQA+VKE LRL+P 
Sbjct  321   LALHIKWVMALMINNKHVMKKAQEEMDTIVGRDRWVEESDIKNLVYLQAIVKEVLRLHPP  380

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PL +  ++ +DC + GY +PKG     N+ K+ RDP+ WP PDKF P+RFL   A   D
Sbjct  381   APLSVQHLSVEDCVVNGYHIPKGTALLTNIMKLQRDPQTWPNPDKFDPERFLTTHA-TID  439

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                + +E +PFG GRR+C  M Y+LQ+ HL+IA +IQGF+F+T  N  LDM++G G+TLP
Sbjct  440   YRGQHYESIPFGTGRRACPAMNYSLQVEHLSIAHMIQGFSFATTTNEPLDMKQGVGLTLP  499

Query  190   RATPLQLVVTPRLPPNFY  137
             + T +++++TPRLPP  Y
Sbjct  500   KKTDVEVLITPRLPPTLY  517



>ref|XP_009364178.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   380 bits (975),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 197/497 (40%), Positives = 292/497 (59%), Gaps = 20/497 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I+GH+ +L         TLG MADK+GP+F +R G+ P  +I   E AK+CFTT++  + 
Sbjct  46    ILGHLSLLGGSTPP-HITLGAMADKYGPIFTIRIGVYPSLVISSSEIAKECFTTNDLSLN  104

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+ A  EH+GYNYAMF F     YWR +RK V  ELLS  K++ +KHIR+ E+ T ++
Sbjct  105   SRPKMAAVEHIGYNYAMFGFGPSGPYWREIRKIVTLELLSIRKVELLKHIRVLEVTTFLE  164

Query  1258  ELY-LFVTASPE-PNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             EL+  + T   E  N   VV + +W   +TLN   R+V G+RY           D  E K
Sbjct  165   ELHKTWSTRQKEGSNDGVVVELKQWFGDMTLNVLVRMVNGKRYSVAA-------DEDEKK  217

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EA+ + N  REF + +G+F++ DA P    +W D  GH +A+K+  K++D I+  W+++H
Sbjct  218   EARRVQNALREFFHYAGLFLVGDAVPY--LRWLDLGGHEKAIKKIAKELDTIVGEWVEEH  275

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
              +RR  G+A       + D I  MLS +D   + GF        K T+ +MI  GSDT  
Sbjct  276   KQRRAKGDAKG-----EQDFIDAMLSVLDGAELGGF--DADTINKATSLNMIAAGSDTIM  328

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
               + WA+SLL+    V++R   E++ ++G +R V + D+  L Y+QA++KE+LRLYP  P
Sbjct  329   VTLTWAISLLLNNSHVLERALNELDTKIGRQRVVSEQDISNLVYIQAIIKETLRLYPPAP  388

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             L  PR  ++DC I GY + KG +  +NLWK+  DPK WP+P +F P+RFL       D  
Sbjct  389   LSGPREFTEDCTIAGYHIRKGTRLTMNLWKLQTDPKNWPKPFEFKPERFLTTHK-KVDVK  447

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRR+C G+A+ LQ+   T+A  +  F    P +  +DM E FG+T  + 
Sbjct  448   GQHFELIPFGSGRRACPGLAFGLQMVQFTLASFLHAFEILNPSSTPIDMTESFGLTNNKR  507

Query  184   TPLQLVVTPRLPPNFYG  134
             TPL++++ PRL    YG
Sbjct  508   TPLKVLIKPRLSFELYG  524



>dbj|BAA35080.1| putative cytochrome P450 [Nicotiana tabacum]
 gb|AAK62347.1| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=519

 Score =   379 bits (974),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 192/497 (39%), Positives = 297/497 (60%), Gaps = 28/497 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQ---NQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHER  1448
             +IGH+   N+    ++  S+ LG++ADK+GP+F  R G      +   EA K+CF+T++ 
Sbjct  46    VIGHLFYFNNNGDDDRHFSQKLGDLADKYGPVFTFRLGFRRFLAVSSYEAMKECFSTNDI  105

Query  1447  DVASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELET  1268
               A +P    GE+L YN AM + +    YW+  RK V  ELLS  +L+K KH+R S ++ 
Sbjct  106   HFADRPALLYGEYLCYNNAMLAVAKYGPYWKKNRKLVNQELLSVSRLEKFKHVRFSIVQK  165

Query  1267  SIKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEY  1088
             +IK+LY     SP       + + +WI +LT +   ++V G+ Y    G  +        
Sbjct  166   NIKQLY--NCDSP----MVKINLSDWIDKLTFDIILKMVVGKTYNNGHGEIL--------  211

Query  1087  KEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             K A      F++F   +    L D F +  FKW D  G+++AMK+  K +D I+Q W+D+
Sbjct  212   KAA------FQKFMVQAMEIELYDVFHIPFFKWLDLTGNIKAMKQTFKDIDNIIQGWLDE  265

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             HI++R+  +       N+ D I ++LS    E + G  Y+H   IK T  ++++D +DT 
Sbjct  266   HIKKRETKDV---GGENEQDFIDVLLSKRSNEHL-GDGYSHDTTIKATVFTLVLDATDTL  321

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
               H+ W ++L++   +VMK+ +EE++  VG +RWVE++D+K L YLQA+VKE LRL+P  
Sbjct  322   ALHIKWVMALMINNKNVMKKAQEEMDTIVGRDRWVEENDIKNLVYLQAIVKEVLRLHPPA  381

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL +  ++ KDC + GY +PKG     N+ K+ RDP+ W +PD F P+RFL   A   D 
Sbjct  382   PLSVQHLSVKDCVVNGYHIPKGTALLTNIMKLQRDPQIWVDPDTFDPERFLTTNA-AIDY  440

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + +E +PFG GRR+C  M Y+LQ+ HL+IA LIQGFNF+T  N  LDM++G G+TLP+
Sbjct  441   RGQHYELIPFGSGRRACPAMNYSLQVEHLSIAHLIQGFNFATTTNEPLDMKQGVGLTLPK  500

Query  187   ATPLQLVVTPRLPPNFY  137
              T +++++TPRLPP  Y
Sbjct  501   KTDVEVLITPRLPPTLY  517



>gb|KHG29587.1| Cytochrome P450 protein [Gossypium arboreum]
Length=521

 Score =   379 bits (974),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 189/494 (38%), Positives = 293/494 (59%), Gaps = 23/494 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L  +  I  + L  MADKHGPL+ ++ G   + ++   E AKDCFT ++R +A
Sbjct  42    LIGHLHLLGGKEPI-CKKLATMADKHGPLYSLKLGTHRVLVVSSWEIAKDCFTDNDRTLA  100

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++   A G H+GYN A+ + +    YWR +RK    ELLS+ +L+K+KHIR SE+++ IK
Sbjct  101   TRASIAAGRHMGYNNAVMALAPYGEYWRNIRKIATVELLSSHRLEKLKHIRFSEMDSFIK  160

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY            A V ++E + +LT N + R++ G+R+        G D      E 
Sbjct  161   ELYGL------SRNGAKVTINEALERLTFNINLRLLVGKRFS-------GCDYEEVNSEP  207

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                    +   +LSG+FVL DA P    +W D QGHVR+MK+  K++D ++  W+++H++
Sbjct  208   WRYGKAIKRALHLSGVFVLADALPY--LEWLDIQGHVRSMKKTAKELDSVISVWLEEHLK  265

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +++     +     D+ L HL   T+    + G  +     +K TT  + + G ++T   
Sbjct  266   KKKANQGTSENDFMDVMLNHLPEDTV----ISG--HNRDNIVKATTLILSLTGGESTSVT  319

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + W LSLL+ +  ++   ++E++  VG +RWVE+SD+K L+YLQA+VKE+LRLYP  P+ 
Sbjct  320   ITWVLSLLLNHPKILMAAQQELDLHVGKQRWVEESDIKNLKYLQAIVKETLRLYPPGPIT  379

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
               R  +KDC+I GYD+ KG +  VNLWK+ RDP+ W   D+F P+RF+       D   +
Sbjct  380   GIREATKDCRIAGYDVSKGTRLIVNLWKLQRDPRVWENADEFRPERFMTTHV-DFDVRGQ  438

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FEY+PF  GRRSC G+ + LQ+ HL +A+LIQGF+  T     +DMEEG G+ LP+  P
Sbjct  439   NFEYMPFSSGRRSCPGITFGLQVVHLMVAKLIQGFDIKTAEGTAVDMEEGLGLALPKLNP  498

Query  178   LQLVVTPRLPPNFY  137
             + +V+ PRL   FY
Sbjct  499   IDVVLRPRLRTEFY  512



>gb|AII31758.1| cytochrome P450 monooxygenase [Gossypium hirsutum]
Length=522

 Score =   379 bits (974),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 198/494 (40%), Positives = 299/494 (61%), Gaps = 19/494 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+L    +    TLG++ +K+GP +++R G+ P  ++   E AK+ FT ++  V+
Sbjct  47    IIGHLPLLGGP-KTPHETLGDLGEKYGPAYMIRIGVHPALVVNSSEVAKEIFTVNDMYVS  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+ EFA  EHLGYNYAMF FS    YWR MRK  + E+LSN ++D++K + +SE+E S+K
Sbjct  106   SRSEFAAAEHLGYNYAMFGFSPYGQYWREMRKITMLEVLSNHRIDQLKKVFVSEIEGSMK  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY    A  + +   +V M +  + LTLN   R VAG+RY       + ++D    KE 
Sbjct  166   LLYKTWAAKKDGSSKVLVEMKKHFSDLTLNVIMRTVAGKRYS-----VVAEEDQ---KEV  217

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                    R+F +L+GMFVL DA P    +W D  G+ + MK+  K++D+I   W+D H  
Sbjct  218   LRYRKALRDFFHLTGMFVLGDAVPF--LRWLDIGGYEKWMKKTAKELDEISGGWLDDH--  273

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
              R+ G         + D + +M S +    + G  Y      K T+ +MI+ GSDTT   
Sbjct  274   -RKGGRWDENK--KEKDFMDVMNSVLKGASLAG--YDADTINKATSLNMILAGSDTTTVT  328

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             ++W LSL++    ++K+ +EE++  +G +R+V ++D+ KL Y+QA+VKE+LR+YP  PL 
Sbjct  329   LIWGLSLMLNKPHILKKAQEELDTYIGRDRFVNETDIGKLVYIQAIVKETLRMYPPAPLS  388

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR  S+ C IGGYD+PKG +  +NL KI RDPK WPEP +F P+RFL       D   +
Sbjct  389   APRELSESCSIGGYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHK-DVDVRGQ  447

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRRSC G ++AL + +LT++  +  F+FSTP N  +D+    G+T  ++TP
Sbjct  448   HFELMPFGSGRRSCPGTSFALHMLYLTMSNFLHAFDFSTPSNGLIDLTGTVGLTNIKSTP  507

Query  178   LQLVVTPRLPPNFY  137
             L+ +V+PRL P  Y
Sbjct  508   LEALVSPRLAPELY  521



>gb|KDP38424.1| hypothetical protein JCGZ_04349 [Jatropha curcas]
Length=526

 Score =   379 bits (974),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 201/495 (41%), Positives = 298/495 (60%), Gaps = 17/495 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+L + LG MADK+GP + +R G  P+ +    E A++CFT ++R  A
Sbjct  46    IIGHLHLLGGDDQLLHQKLGMMADKYGPAYSIRLGNRPVFVASSSEVAEECFTIYDRAFA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  +  +H+ YN A+F F+  + YWR MRK VV ELLSN +L+ VK+++ SE++  I 
Sbjct  106   SRPSTSATKHMCYNDAVFGFAPYSTYWREMRKIVVLELLSNRRLEIVKNVQASEVDKGIN  165

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             +LY L+   +  P    +V +++W   LTLN    +VAG+R+        G  D  E   
Sbjct  166   KLYGLWAKNTCLP---LLVKINQWFDDLTLNVIVGMVAGKRFA-------GGSDDGEAGW  215

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              Q+ I+   EF +L G+FV+ DA P     W D QGH +AMK   K  D IL+ W+D+H 
Sbjct  216   CQKTIS---EFFHLMGVFVISDAVPF--LWWLDLQGHEKAMKNTAKYFDAILEGWVDEHR  270

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
               R    +    A  + D I +ML+  ++  +  FPY     IK T  ++I   +DTT T
Sbjct  271   RTRAASGSGEFKAEGEQDFIDVMLTLEEEGQLSNFPYDSNTIIKSTILAVIAAAADTTAT  330

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WA+SLL+ +   +K+ ++E++  VG ER V+ SD+KKL +LQA+VKE+LR+YP  PL
Sbjct  331   MLTWAISLLMNHRWALKKAQQELDFHVGVERQVDGSDLKKLIFLQAIVKETLRVYPVAPL  390

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
               PR   +DC I GY +  G +  VN+WKI RDPK W  P  F P+RFL       D   
Sbjct  391   SGPREALEDCTIAGYHVKAGTRLLVNVWKIQRDPKLWTNPLSFQPERFLTSHV-NVDVRG  449

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRR+C G ++AL   H T+ARL+  F+ +TP +  +DM EG G+TLP+A 
Sbjct  450   QNFELLPFGSGRRACPGTSFALHALHFTLARLLHSFDLATPMDQPVDMTEGTGITLPKAN  509

Query  181   PLQLVVTPRLPPNFY  137
             P++++++PRLP   Y
Sbjct  510   PVEVLLSPRLPGKLY  524



>ref|XP_004517185.1| PREDICTED: cytochrome P450 82C4-like [Cicer arietinum]
Length=522

 Score =   379 bits (973),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 193/494 (39%), Positives = 305/494 (62%), Gaps = 22/494 (4%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             IGH+ +L +Q   L+R     ADK+GP+F +  G  P  +I   E+ K+CFTT+++ +AS
Sbjct  49    IGHLHLLGNQTP-LARIFASFADKYGPIFQIYLGSYPALVISNQESIKECFTTNDKILAS  107

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P+ + G +LGYNYA F F+    Y+  +RK  + ELLS+ +++ ++H+  SE++T + +
Sbjct  108   RPKSSHGIYLGYNYAGFGFAPYGTYFTKLRKLTMLELLSSRRIESLRHLYESEIDTLVND  167

Query  1255  LYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQ  1076
             L+L+V  + +  KA V++  +W+ +LT N   ++++G+RY F+    + D       EA 
Sbjct  168   LWLYVKDNNKVTKAVVIS--KWLEKLTFNIITKMISGKRY-FEYLQDVDD------VEAH  218

Query  1075  EMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHV-RAMKRNNKKVDKILQAWIDQHIE  899
              ++ + +EF ++SG FV  D  P+    WF F+G V ++MKR  + +DK++  W+D+H++
Sbjct  219   GIVKLIKEFMHISGEFVPSDLIPI--IGWFGFEGQVLKSMKRVGRDLDKVVGRWVDEHVQ  276

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +   G           D I +MLS I+ +   G  +     IK    ++++ GSDTT T 
Sbjct  277   KIDDG------VNEKHDFIDVMLSVIEDDPSSG--HDRDTIIKANIMNLMLAGSDTTSTT  328

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             M W L++L+   + +KR +EEI   +G +R VE SD+K L YLQA++KE+LRLYP  PLL
Sbjct  329   MTWILAILLNNTNALKRAQEEINHHIGKKRRVESSDIKNLVYLQAIMKETLRLYPPGPLL  388

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P   +KDC I GY++PKG +   N+WK+ RDP  W E +KF P+RF+N E  G      
Sbjct  389   VPHEATKDCYIQGYNVPKGTRVFANVWKLHRDPSIWLEAEKFSPERFIN-EKNGELYEGH  447

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FEY+PFG GRR+C G  +A Q+  +T+ARLI GF+   P   ++DM EG G+TLP+ TP
Sbjct  448   NFEYLPFGLGRRACPGSMFATQVCLITLARLIHGFDLEVPMGEDVDMREGLGITLPKLTP  507

Query  178   LQLVVTPRLPPNFY  137
             L +++TPRL    Y
Sbjct  508   LNVILTPRLTYELY  521



>ref|XP_009768110.1| PREDICTED: cytochrome P450 82A4-like [Nicotiana sylvestris]
Length=520

 Score =   379 bits (973),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 190/498 (38%), Positives = 298/498 (60%), Gaps = 32/498 (6%)
 Frame = -1

Query  1618  IIGHIPILNS---QNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHER  1448
             +IGH+    +    ++ L++ LG++ADKHGP+F  + G     ++   EA K+CFTT++ 
Sbjct  49    VIGHLFYFKNDGDHDRTLAQKLGDLADKHGPVFTYKLGFRRFLVVSSYEAIKECFTTNDI  108

Query  1447  DVASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELET  1268
               +++P    G+HL YN AM   +    YWR +RK V  E+LS  +L+K K IR S ++ 
Sbjct  109   RFSNRPALLYGDHLCYNNAMLFIAKYGPYWRKIRKLVNQEVLSVNRLEKFKCIRFSIVQK  168

Query  1267  SIKELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEY  1088
             ++KELY    ++        + + +WI +L+ +   +++AG+ Y    G           
Sbjct  169   NVKELYDHCDST--------INLTDWIDKLSFDIILKMIAGKSYNNGHG-----------  209

Query  1087  KEAQEMINV-FREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWID  911
                 E++ + F++F  ++  F L D FP+ LFKW DF G+++ +K   K +D + Q W+D
Sbjct  210   ----EILKIAFQKFMVIAMEFELYDIFPIPLFKWVDFSGNIKVVKETFKDIDTVFQGWLD  265

Query  910   QHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDT  731
             +HI++R+          N+ D I  MLS    E + G  ++    IK T  S+++D ++T
Sbjct  266   EHIKKRERNET---LDENEEDFIDSMLSKTSNEHL-GDTHSPNTTIKATIFSLVLDATET  321

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
                H+ W ++LL+     MK+ ++EI+  VG +RWVE+SD+K L YLQA+VKE+LRLYP 
Sbjct  322   LALHIKWVMALLINNKLEMKKAQKEIDTIVGKDRWVEESDIKNLVYLQAIVKEALRLYPP  381

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PL +P  + +DC + GY +PKG     N+ K+ RDPK W +PDKF P+RFL   A   D
Sbjct  382   APLSVPHESVEDCVVNGYHIPKGTVLLPNVMKLQRDPKIWSDPDKFDPERFLTTHA-KID  440

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                + +E++PFG GRR+C  M YALQ+ +L+IA LIQGFNF+TP N  LDM+EG G+T P
Sbjct  441   YRGQHYEFIPFGTGRRACPAMTYALQVEYLSIAHLIQGFNFNTPSNESLDMKEGVGITSP  500

Query  190   RATPLQLVVTPRLPPNFY  137
             +  P+++++TPRL    Y
Sbjct  501   KKNPIEVLITPRLSTTLY  518



>ref|XP_002282133.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=525

 Score =   379 bits (972),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 198/489 (40%), Positives = 284/489 (58%), Gaps = 17/489 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L     +    LG MADK+G +F VR G+    ++   + AK+CFTTH+  +A
Sbjct  47    IIGHLHLLGGSKNLPHLLLGTMADKYGAVFSVRLGLKRAVVVSSWQMAKECFTTHDLALA  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+  + + LGYN AMF+FS   AYWR +RK    ELLSN +L+ +K++R+SE+ET +K
Sbjct  107   SRPQLVISKQLGYNDAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMK  166

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY             +V M +W   LTLN    +V G+RY        G    ++ KE 
Sbjct  167   ELYKLWAEKKNEAGVVLVDMKQWFGDLTLNVILMMVVGKRY-------FGYTAESQEKET  219

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q      REF  L G+FV+ DA P     W D  GH++A K+  K++D I Q W+++H  
Sbjct  220   QRCQKSIREFFRLLGLFVVSDALP--FLGWLDVGGHLKATKKTAKEMDGIAQEWLEEHRR  277

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R+  G     A+GN  DL+ +MLS +      G  Y      K T+  +I  GSDTT   
Sbjct  278   RKDSGE----ASGNQ-DLMDVMLSILAGTDPTG--YDADTINKATSLILIAGGSDTTSVT  330

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + W +SLL+    ++++ +EE++  VG  R V + D+ KL YLQA+VKE+LRLYP +PL 
Sbjct  331   LTWVISLLLNNPCMLRKAQEELDTHVGKGRLVNEVDLSKLVYLQAIVKETLRLYPALPLS  390

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR  ++D  +GGY +P G +  +NL KI RDP  W  P +F P+RFL       D   K
Sbjct  391   GPRQFNQDSILGGYRIPNGTRLVLNLTKIQRDPSVWLNPTEFQPERFLTTHK-DVDMRGK  449

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE+ PFG GRR C G  +ALQ+ HLT+A  +  F  STP N  +DM E  G+T  ++TP
Sbjct  450   NFEFTPFGGGRRICPGATFALQVLHLTLANFLHKFQLSTPSNATVDMSESLGITNIKSTP  509

Query  178   LQLVVTPRL  152
             L+++++PRL
Sbjct  510   LEVLISPRL  518



>dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=511

 Score =   378 bits (971),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/496 (39%), Positives = 295/496 (59%), Gaps = 18/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +++  +TLG MADK+GP+F +R G+    ++   + AK+CFTT+++  A
Sbjct  34    IIGHLHLLGG-SELRHKTLGAMADKYGPIFKIRIGVNHALVVSNSDIAKECFTTNDKAFA  92

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     + LGY+Y MF  +    YW  +RK  +SELLSN +L+ +KH+R SE++ SI+
Sbjct  93    SRPTSTASKILGYDYVMFGMAPYGQYWVELRKITMSELLSNRRLELLKHVRDSEIDASIQ  152

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LY       +     +V M +W   LTLN   R++AG+RY     G++   D TE +  
Sbjct  153   DLYKVWKNHDKAKGPVLVDMKQWFGDLTLNVILRMIAGKRY----SGSMSSCDETEARTC  208

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q+ +   R+F  L G+F+++DA P     WFD QG+ + MK   K++D + Q W+++H  
Sbjct  209   QKGM---RDFFRLLGLFIIEDALPY--LSWFDLQGYKKEMKNTAKELDSVFQRWLEEHNR  263

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
              RQ G         + D + +++S ++   +    Y +   IK T  S++  G DTT   
Sbjct  264   MRQTGEL-----NREQDFMDVLMSILEDTRIS--EYDNDTIIKSTCLSIVTGGGDTTMVT  316

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + W LSLL+     +K+ ++E+++ VG +R VE+SD+K L YLQA+ KE+LRLYP  PL 
Sbjct  317   LTWILSLLLNNKHALKKAQDELDSHVGKDRQVEESDIKNLVYLQAITKEALRLYPAGPLS  376

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR+   DC + GY +P G +  VN +KI RDP  W EP +F P+RFL       D    
Sbjct  377   GPRVADADCTVAGYHVPAGTRLIVNTYKIQRDPLVWSEPSEFRPERFLTSHV-NMDVKGL  435

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              +E +PFG GRRSC GM++ LQ+  L +AR +  F+  T  ++ +DM E  G+T  +ATP
Sbjct  436   HYELIPFGAGRRSCPGMSFTLQVVPLVLARFLHEFDSKTEMDMPVDMTETAGLTNAKATP  495

Query  178   LQLVVTPRLPPNFYGL  131
             L++V+TPRL P  YGL
Sbjct  496   LEVVITPRLHPEIYGL  511



>ref|XP_010547840.1| PREDICTED: cytochrome P450 82C4-like [Tarenaya hassleriana]
Length=527

 Score =   379 bits (972),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 193/494 (39%), Positives = 299/494 (61%), Gaps = 14/494 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L  +N +L RTLG +AD +GP F +R G     ++   E AK+C T +++  A
Sbjct  46    IIGHLHLLGGKNNLLYRTLGALADDYGPAFGLRLGSRKALVVSSWEVAKECLTANDKTFA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     + +GYNYA+F F+  ++Y+R MRK V  ELLSN ++  ++H+R+SE+E  IK
Sbjct  106   SRPNTVGAKLMGYNYALFGFAPYDSYFREMRKIVTFELLSNRRIQMLRHVRISEIEMGIK  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ++Y  + +    +   +V + +W+  L LN   ++VAG+RY F      GD  + E  EA
Sbjct  166   DIY-SLWSKKGGSGPVLVDVKQWLEDLNLNMIVKLVAGKRYSF------GDATADEADEA  218

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +        F  L G+FV+ DAFP      FD QG+ + MK+   ++D IL+ W+ +H  
Sbjct  219   RRCPKATARFFQLMGLFVIADAFPF--LGRFDLQGYEKEMKKTAAEIDGILEGWLQEHER  276

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR  G +       D D I +MLS  D+  +    +  +  IK T  +MI+ GSDT    
Sbjct  277   RRASGESEG-----DSDFIDVMLSLADQGKLSDLKHDERTCIKSTCLAMILGGSDTLVGT  331

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             ++WA +LL    +++K+ +EEI+  VG +R V DSD++ L YLQA+ KE+LR+YP  PLL
Sbjct  332   LIWAFALLANNREILKKAQEEIDFHVGKDRKVVDSDIENLVYLQAITKETLRMYPAAPLL  391

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR  ++DC + GY +  G +  VN+WKI RDP+FWP P++F P+RFL   A       +
Sbjct  392   GPREATEDCTVAGYHVTAGTRLMVNVWKIHRDPRFWPNPEEFRPERFLTGPASEYSVRGQ  451

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRRSC G++ ALQ+ HL +AR++  F+ +T   +++DM E  G+T+P+  P
Sbjct  452   SFELLPFGSGRRSCPGISLALQMLHLLLARVLHSFDLTTVSGLDVDMGESPGLTIPKTKP  511

Query  178   LQLVVTPRLPPNFY  137
             L+++++PRL    Y
Sbjct  512   LEVLLSPRLKKELY  525



>ref|XP_011008137.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=516

 Score =   378 bits (971),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/497 (39%), Positives = 306/497 (62%), Gaps = 22/497 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             + GH+P L  ++    +TLG +ADK+GP++ ++ G+    ++   E  KDC  T++R +A
Sbjct  39    LFGHLPSLVGKDPA-CKTLGAIADKYGPIYSLKFGIHRTLVVSSWETVKDCLNTNDRVLA  97

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++   A G+H+ YN A F+ ++   YWR +RK    +LLSN +L+ +KH+R+SE++T IK
Sbjct  98    TRAGIAAGKHMFYNNAAFALATYGQYWRDVRKLATLQLLSNQRLEMLKHVRVSEVDTFIK  157

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTE---Y  1088
              L+ F   S +    A V + + +  LT N + R + G+RY      +  D +++E   Y
Sbjct  158   GLHSFYAGSVD--SPAKVNISKLLESLTFNINLRTIVGKRY----CSSTYDKENSEPWRY  211

Query  1087  KEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             K+A       ++  YLSG+FV+ DA P    +W D+QGHV AMK+  K++D +++ W+D+
Sbjct  212   KKA------IKKALYLSGIFVMSDAIPF--LEWLDYQGHVSAMKKTAKELDAVIRNWLDE  263

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H++++  G      +  + D + +M+S + +   K   Y+  + IK T   + + G+ +T
Sbjct  264   HLKKKIDGEL---GSDRESDFMDVMISNLAEGPDKISGYSRDVVIKATALILTLTGAGST  320

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
              T +VW LSLL+    V+K  +EE++ QVG ERWVE+SD++ L+YLQA+VKE+LRLYP  
Sbjct  321   ATTLVWTLSLLLNNPTVLKAAQEELDKQVGRERWVEESDIQDLKYLQAIVKETLRLYPPG  380

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL   R   +DC IGGYD+PKG +  VN+WK+ RDP+ W  P++F P RFL   A   D 
Sbjct  381   PLTGIREAMEDCSIGGYDVPKGTRLVVNIWKLHRDPRVWKNPNEFKPDRFLTTHA-DLDF  439

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               +  E++PF  GRRSC  +   L + HLT+AR++QGF+ +T   + +DM EG G+ LP+
Sbjct  440   RGQNMEFIPFSSGRRSCPAINLGLIVVHLTLARILQGFDLTTVAGLPVDMIEGPGIALPK  499

Query  187   ATPLQLVVTPRLPPNFY  137
              TPL++V+ PRL    Y
Sbjct  500   ETPLEVVIKPRLGLELY  516



>ref|XP_006376421.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP54218.1| cytochrome P450 family protein [Populus trichocarpa]
Length=511

 Score =   377 bits (969),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 195/497 (39%), Positives = 299/497 (60%), Gaps = 28/497 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+P L  Q+    +TL  +ADK+GP++ +R G   I ++   E  KDC TT++R +A
Sbjct  39    VIGHLPRLRGQDPA-CKTLAAIADKYGPIYSLRLGSHRIVVVSSWETVKDCLTTNDRILA  97

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++   A G+H+GYN A F+ S    YWR +RK V  +LLSN +L+ +KH+R+ E++  IK
Sbjct  98    TRANIAAGKHMGYNNAAFALSPYGKYWRDVRKLVTLQLLSNHRLEMLKHVRVLEVDAFIK  157

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTE---Y  1088
              L+     + E    A V M +    LT N S R + G+RY      ++ D +++E   Y
Sbjct  158   GLHNSYAETAE--YPAKVTMSKLFESLTFNISLRTIVGKRY----CSSLYDKENSEPWRY  211

Query  1087  KEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             K+A E      +  YLSG+FV+ DA P    +W DFQGH+ AMKR  K++D ++ +W+++
Sbjct  212   KKAIE------KALYLSGIFVMSDAIPW--LEWIDFQGHISAMKRTAKELDAVIGSWLEE  263

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H+++   G +         D + +++S +     +   Y+  + IK TT  + + G+ +T
Sbjct  264   HLKKEIQGES---------DFMDVIISNLADGAAEMSGYSRDVVIKATTLILTLTGAGST  314

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                + WALSLL+ +  V+K  +EE++ QVG E+WVE+SD++ L YLQA+VKE+LRLYP  
Sbjct  315   AVTLTWALSLLLNHPSVLKAAQEELDKQVGREKWVEESDIQNLMYLQAIVKETLRLYPPG  374

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL   R   +DC I GY +PKG +  VN+WK+ RDP+ W  PD F P+RFL   A   D 
Sbjct  375   PLTGIREAMEDCHICGYYVPKGTRLVVNIWKLHRDPRVWKNPDDFQPERFLTTHA-DLDF  433

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + FE++PF  GRRSC  +   + + HLT+ARL+QGF+ +T   + +DM EG G+ LP+
Sbjct  434   RGQDFEFIPFSSGRRSCPAINLGMAVVHLTLARLLQGFDLTTVAGLPVDMNEGPGIALPK  493

Query  187   ATPLQLVVTPRLPPNFY  137
               PL+ V+ PRL    Y
Sbjct  494   LIPLEAVIKPRLGLPLY  510



>ref|XP_010919967.1| PREDICTED: cytochrome P450 CYP82D47-like [Elaeis guineensis]
Length=518

 Score =   378 bits (970),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 201/497 (40%), Positives = 292/497 (59%), Gaps = 25/497 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             ++GH+ +L S N I  R L  +AD  GP+F +R G  P  ++   EAA++CFTT+++ +A
Sbjct  43    VLGHLHLLGSHNNI-GRALKAVADAVGPVFALRLGARPALVVSTWEAARECFTTNDKALA  101

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
              +P     + + YN AM  FS    YWR +RK    ELLS+ +L    H+R SE++   K
Sbjct  102   GRPTSTASKLMCYNNAMVGFSPYGPYWRQVRKIFTVELLSHARLCSHAHVRASEVDAFAK  161

Query  1258  ELYLF---VTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEY  1088
              LY     V   P     A V M +W  +LT N   R+VAG+R    V GA+ D  +   
Sbjct  162   TLYGLCRKVDGGP-----ARVEMSKWFQELTFNVVARMVAGKR--CFVYGAVDDGGN---  211

Query  1087  KEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             +EA+           L G F++ D  P    +W D  G+ RAMKR   ++D I+  W+ +
Sbjct  212   REARRFTGAMHRMMELLGAFMVSDVVPF--LRWLDLGGYQRAMKRTAAEMDGIIGGWLRE  269

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H +RR  G A         D + +MLST++KE      +     IK  + ++II G+DTT
Sbjct  270   HRDRRSEGRAEGKE-----DFMDVMLSTMEKEGELFSDHDPDTVIKANSLALIIAGTDTT  324

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                M+WAL+LL+ + +V++  +EE+++ VG +R V++SDV+KL YLQA+VKE+LRLYP  
Sbjct  325   SVTMIWALALLLNHPNVLRTAQEELDSHVGKDRNVKESDVEKLVYLQAIVKETLRLYPPG  384

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             P L+P  T +DC++ G+D+P G Q  VN W I  DP+ WP+P  F P+RFL       D 
Sbjct  385   PTLIPHQTMEDCQVSGFDVPAGTQVLVNAWAIQHDPEVWPDPSAFRPERFLTSHK-DVDI  443

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + FE +PFG GRR+C G ++ALQ+ HL +AR+I GF+ +      +DM EG G TLP+
Sbjct  444   RGRHFELLPFGSGRRACPGASFALQVVHLALARIIHGFDMA---GGPVDMTEGKGATLPK  500

Query  187   ATPLQLVVTPRLPPNFY  137
             ATPLQ++VTPRLPP  Y
Sbjct  501   ATPLQVLVTPRLPPGLY  517



>ref|XP_002282085.3| PREDICTED: cytochrome P450 82A1-like [Vitis vinifera]
Length=1053

 Score =   392 bits (1008),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 202/490 (41%), Positives = 297/490 (61%), Gaps = 18/490 (4%)
 Frame = -1

Query  1618  IIGHIPIL-NSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDV  1442
             IIGH+ +L    +Q+   TLG MADK+GP+F +R G+    ++   E AK+C T +++  
Sbjct  47    IIGHLHLLAGGSHQLPHITLGNMADKYGPVFTIRIGLHRAVVVSSWEMAKECSTANDQVS  106

Query  1441  ASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSI  1262
             +S+PE    + LGYNYAMF FS   +YWR MRK +  ELLSN +L+ +K +R SE+ TSI
Sbjct  107   SSRPELLASKLLGYNYAMFGFSPYGSYWREMRKIISLELLSNSRLELLKDVRASEVVTSI  166

Query  1261  KELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             KELY         +    V M +W   LTLN   R+VAG+RY           D++E K+
Sbjct  167   KELYKLWAEKKNESGLVSVEMKQWFGDLTLNVILRMVAGKRY-------FSASDASENKQ  219

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             AQ    VFREF +LSG+FV+ DA P     W D+  H + +K+   ++D I Q W+++H 
Sbjct  220   AQRCRRVFREFFHLSGLFVVADAIP--FLGWLDWGRHEKTLKKTAIEMDSIAQEWLEEHR  277

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
              R+  G+  +       D + +M S +D + + G  Y      K T  ++I  GSDTT  
Sbjct  278   RRKDSGDDNSTQ-----DFMDVMQSVLDGKNLGG--YDADTINKATCLTLISGGSDTTVV  330

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WALSL++   D +K+ +EE++ QVG ER V + D+ KL YLQA+VKE+LRLYP  PL
Sbjct  331   SLTWALSLVLNNRDTLKKAQEELDIQVGKERLVNEQDISKLVYLQAIVKETLRLYPPGPL  390

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
                R  ++DC +GGY + KG +  +NL KI +DP+ W +P +F P+RFL       D   
Sbjct  391   GGLRQFTEDCTLGGYHVSKGTRLIMNLSKIQKDPRIWSDPTEFQPERFLTTHK-DVDPRG  449

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             K FE++PFG GRR+C G+ + LQ+ HLT+A  +  F FSTP N +++M E  G+T  ++T
Sbjct  450   KHFEFIPFGAGRRACPGITFGLQVLHLTLASFLHAFEFSTPSNEQVNMRESLGLTNMKST  509

Query  181   PLQLVVTPRL  152
             PL+++++PRL
Sbjct  510   PLEVLISPRL  519


 Score =   391 bits (1005),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 205/495 (41%), Positives = 287/495 (58%), Gaps = 18/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L     +     G MADK+GP+F +R G+    ++   E AK+CFTTH+  +A
Sbjct  575   IIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHDLALA  634

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+PE    ++LGYNYAMF+FS   AYWR +RK    ELLSN +L+ +K++R+SE+ET +K
Sbjct  635   SRPELVAAKYLGYNYAMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMK  694

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY             +V M +W   L+LN   ++V G+RY        G    ++ KEA
Sbjct  695   ELYKLWAEKKSEAGVVLVDMKQWFGHLSLNVILKMVVGKRY-------FGYAAESKEKEA  747

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q+     REF  L G+FV+ DA P     W D  GHV+AMK+  K++D I Q W+++H  
Sbjct  748   QQCQKAIREFFRLLGLFVVSDALP--FLGWLDVGGHVKAMKKTAKELDGIAQEWLEEHRR  805

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R+  G A       D D + +MLS +      G  Y      K T+  +I  G+DTT   
Sbjct  806   RKDSGEADG-----DQDFMDVMLSILGATDPNG--YDADTINKATSLILIAGGTDTTSVT  858

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WA+SLL+    V+++ +EE++  VG ER V + D+ KL YLQA+VKE+LRLYP  PL 
Sbjct  859   LTWAISLLLNNPHVLRKAQEELDTHVGKERLVNEMDISKLVYLQAIVKETLRLYPAAPLS  918

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
               R   +D  +GGY +PKG +  +NL KI RDP+ W  P KF P RFL       D   K
Sbjct  919   GQRQFIQDSVLGGYHIPKGTRLLLNLTKIQRDPRVWLNPTKFQPSRFLTTYK-DVDVKGK  977

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              F   PFG GRR C G A+ALQ+  LT+A  +  F  STP N  +DM E FG+T  ++TP
Sbjct  978   HFVLTPFGGGRRICPGAAFALQVLPLTLANFLHKFQLSTPSNSPIDMSESFGITNIKSTP  1037

Query  178   LQLVVTPRLPP-NFY  137
             L+++++PRL   N Y
Sbjct  1038  LEVLISPRLASYNLY  1052



>ref|XP_003619137.1| Cytochrome P450 [Medicago truncatula]
 gb|AES75355.1| cytochrome P450 family protein [Medicago truncatula]
Length=521

 Score =   377 bits (969),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 194/495 (39%), Positives = 290/495 (59%), Gaps = 17/495 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+  S++Q     LG MADK+GP+F ++ G      I   + AK+C+TT++  VA
Sbjct  43    IIGHLPLF-SKSQATHHLLGSMADKYGPIFTIKLGTATTLAINNWKTAKECYTTNDIAVA  101

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
              +P     EH+ YNYAM  F+    +WR MRK V    LSN +++ + HI +SE++TSIK
Sbjct  102   YRPNLVAFEHMTYNYAMLGFAPYGPFWREMRKIVTLNFLSNHQINLLTHICVSEVQTSIK  161

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY F     + N   +V M +W+ +L  N   R+VAG+RY        G+    + +EA
Sbjct  162   ELYNFWKNRKDENGYLLVEMKKWLNELAFNIVLRMVAGKRY-------FGESVMVKEEEA  214

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                +N  R++  L+G+F + DA P    +WFDF GH + MK+N K++D ++  W+D+H +
Sbjct  215   NRCLNALRDYMRLTGVFPIADAVP--FLRWFDFGGHEKNMKQNFKELDGVITEWLDEHKK  272

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             ++  G      +    D + +MLSTID   + GF       IK TT ++++  +DT+   
Sbjct  273   KKSEG---VDKSKEGQDFMDVMLSTIDGTNIHGF--HSDTVIKATTMALVLGATDTSSVT  327

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERW-VEDSDVKKLEYLQAVVKESLRLYPTVPL  542
               WAL LL+     +++ +EEI+  +G ER  + +SD+ KL YLQAVVKE+LRLYP  PL
Sbjct  328   HTWALCLLLNNPHTLEKVKEEIDLHIGKERLCILESDINKLVYLQAVVKETLRLYPASPL  387

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
                R   +DC+IGGYD+ KG +   NLWKI  DP  WP+P +F P+RFL       D   
Sbjct  388   SGIREFREDCQIGGYDVKKGTRLFTNLWKIQTDPSVWPDPLEFKPERFLTTHK-DVDVRG  446

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
               FE +PFG GRR C G+++AL+ ++LT+A  +  F  S   N  +DM      T  + T
Sbjct  447   NHFELLPFGSGRRMCPGISFALRSAYLTLANFLHSFEVSKTSNEPIDMTAVVETTNIKVT  506

Query  181   PLQLVVTPRLPPNFY  137
             PL++++ PRL PN+Y
Sbjct  507   PLEVLIKPRLSPNYY  521



>ref|XP_011037409.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
 ref|XP_011037412.1| PREDICTED: cytochrome P450 82G1-like [Populus euphratica]
Length=511

 Score =   377 bits (967),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 197/497 (40%), Positives = 296/497 (60%), Gaps = 28/497 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+P L  Q+    +TL  + DK+GP++ +R G   I ++   E  KDC TT++R +A
Sbjct  39    VIGHLPCLRGQDPA-CKTLAAIDDKYGPIYSLRLGSHRIVVVSSRETVKDCLTTNDRILA  97

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++   A G+H+GYN A F+ S    YWR +RK V  +LLSN +L+ +KH+R  E++  IK
Sbjct  98    TRANIAAGKHMGYNNAAFALSPYGKYWRDVRKLVTLQLLSNHRLEMLKHVRKLEVDAFIK  157

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTE---Y  1088
              L+     + E    A V M +    LT N S R + G+RY       I D +++E   Y
Sbjct  158   GLHNSYAETAE--YPAKVTMSKLFESLTFNISLRTIVGKRY----CSTIYDKENSEPWRY  211

Query  1087  KEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             K+A E      +  YLSG+FV+ DA P    +W DFQGHV AMKR  K++D ++ +W+++
Sbjct  212   KKAIE------KALYLSGIFVMSDAIPW--LEWIDFQGHVSAMKRTAKELDAVIGSWLEE  263

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H+++   G +         D + +M+S +     +   Y+  + IK TT  + + G+ +T
Sbjct  264   HLKKEIQGES---------DFMDVMISNLADGAAEMSGYSRDVVIKATTLILTLTGAGST  314

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                + WALSLL+ +  V+K  +EE++ QVG E+WVE+SD++ L YLQA+VKE+LRLYP  
Sbjct  315   AVTLTWALSLLLNHPSVLKAAQEELDKQVGREKWVEESDIQNLVYLQAIVKETLRLYPPG  374

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL   R   +DC I GY +PKG +  VN+WK+ RDP+ W  P+ F P+RFL   A   D 
Sbjct  375   PLTGIREAMEDCHICGYYVPKGTRLVVNIWKLHRDPRVWKNPNDFQPERFLTTHA-DLDF  433

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + FE++PF  GRRSC  +   + + HLT+ARL+QGF+ +T   + +DM EG G+ LP+
Sbjct  434   RGQDFEFIPFSSGRRSCPAINLGMAVVHLTLARLLQGFDLTTVAGLPVDMNEGPGIALPK  493

Query  187   ATPLQLVVTPRLPPNFY  137
               PL+ VV PRL    Y
Sbjct  494   LIPLEAVVKPRLGLRLY  510



>ref|XP_004147802.1| PREDICTED: cytochrome P450 82A4-like [Cucumis sativus]
 ref|XP_004168431.1| PREDICTED: cytochrome P450 82A4-like [Cucumis sativus]
Length=517

 Score =   377 bits (967),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 198/491 (40%), Positives = 299/491 (61%), Gaps = 24/491 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+P+L  + ++L  TLG+ AD +GP+F++R G     ++ G E AK+CFTT+++  A
Sbjct  51    VIGHLPLLTGK-ELLHNTLGKFADNYGPIFMLRFGTKKTLIVSGWEVAKECFTTNDKIFA  109

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+FA  + LGYNYAMF  S   ++WR +RK V+ ELL+N ++++++HI   E++ SI+
Sbjct  110   SRPKFAAAQLLGYNYAMFGTSPYGSHWRHIRKIVMLELLANHRMNRLQHIPRLEVQNSIE  169

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             EL+    +    NK AVV M++W   +TLNT  ++V G+R+     G  G+    EY+  
Sbjct  170   ELHELCRS----NKKAVVEMEKWFGDITLNTIFKMVIGKRFSTTFEGCHGE----EYQ--  219

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                 N  ++F  L   FV  D FP    +WFDF G+ ++MK+  K +D++   W+ +H E
Sbjct  220   ----NALKDFFNLFIAFVPSDLFPF--LRWFDFGGYKKSMKKTAKIMDEMHDKWLREHRE  273

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +R            D DL+ +MLS    E   G  Y     IK T  +MI+ G  TT   
Sbjct  274   KRNSDGL----VIEDQDLMDIMLSITKDEDFSG--YDVDTIIKSTCLAMILGGFHTTTAQ  327

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             MVWALSLL+K+ + +K+ + E++ +VG ER V +SD+  L YLQAVVKE+LRLYP   L 
Sbjct  328   MVWALSLLLKHEEALKKVQLELDERVGRERQVNESDINDLIYLQAVVKEALRLYPAAQLS  387

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P  + +DC + GY +P G +  VNL+K+ RDP  W  P +F P+RFL  E     N  +
Sbjct  388   VPHESIEDCTVAGYHVPAGTRLWVNLYKLQRDPNVWESPTEFRPERFLTSEKNYDVNG-Q  446

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
               E++PFG GRR C G+++A+Q+ HLT+ARL+  F    P    ++MEE  G+ + +  P
Sbjct  447   TPEFIPFGSGRRICPGISFAIQVMHLTLARLLHEFQIGLPTQEPINMEESVGLNITKKVP  506

Query  178   LQLVVTPRLPP  146
             L++VVTPRL P
Sbjct  507   LEVVVTPRLSP  517



>gb|KHN42044.1| Cytochrome P450 82A3 [Glycine soja]
Length=538

 Score =   377 bits (968),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 196/496 (40%), Positives = 297/496 (60%), Gaps = 14/496 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ + N+ +Q+  +TLG+MA+KHGP+F ++ G   + ++   E AK+CFT H++  +
Sbjct  48    IIGHLHLFNA-HQLTHKTLGKMAEKHGPIFTIKLGSYKVLVLSSWEMAKECFTAHDKAFS  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P  A  + +GYNYAMF F+   +YWR + K    ELLSN +L+ +K  R  EL+ +I+
Sbjct  107   TRPCVAASKLMGYNYAMFGFTPYGSYWRPVPKLTTIELLSNNRLEPLKDTRTVELDAAIR  166

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY   T    P    +V M +W   LT N + R+V G+ Y       +GDDD  E  EA
Sbjct  167   ELYKVWTREGCPKGGVLVDMKQWFGDLTHNIALRMVGGKSY-----SGVGDDDHAE-GEA  220

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +    V R++  L G+FVL D+FP     W D  G+ + MKR   ++D +++ W+++H  
Sbjct  221   RRYRRVMRDWVCLFGVFVLSDSFP--FLGWLDINGYEKDMKRTASELDALVEGWLEEHKR  278

Query  898   RRQLGNAPAPAAGNDL-DLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +R+     +     +  D + +ML+ +    + G  Y     IK T  ++I+ G+D T  
Sbjct  279   KRKRKRGLSVNGKEEQDDFMDVMLNVLQGTEISG--YDSDTIIKATCLNLILAGTDPTMV  336

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WALSLL+ +   +KR R E++  +G +R VE+SD+KKL YLQAVVKE+LRLYP  P+
Sbjct  337   TLTWALSLLLNHQMELKRARHELDTLIGKDRKVEESDIKKLVYLQAVVKETLRLYPPSPI  396

Query  541   LMPRMTSKDCKIG-GYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             +  R   +DC    GY +P G Q  VN WKI RD + W EP+ F P+RFL       D  
Sbjct  397   ITLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSEPNDFKPERFLTIHK-DVDVK  455

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + +E VPF  GRR+C G + AL++ HLT+ARL+  F+ ++P N  +DM E FG+T  +A
Sbjct  456   GQNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFDVASPSNQVVDMTESFGLTNLKA  515

Query  184   TPLQLVVTPRLPPNFY  137
             TPL++++TPRL   FY
Sbjct  516   TPLEVLLTPRLDTKFY  531



>emb|CBI37514.3| unnamed protein product [Vitis vinifera]
Length=1113

 Score =   392 bits (1006),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 203/487 (42%), Positives = 304/487 (62%), Gaps = 21/487 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L+ Q  I  RTLG MADKHGP+F+++ GM P  ++   EA K+CFTT+++  A
Sbjct  644   IIGHLHLLSGQVPIF-RTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDKVFA  702

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  +V + LGYNYAMF  +    +WR MRK  V E+LS  +L+++K +R+SEL+  IK
Sbjct  703   SRPRSSVSKLLGYNYAMFGSAPYGLFWREMRKLSVVEILSARRLNELKDVRISELDACIK  762

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LY     +   +   VV M EW   LT N + R++AG+RY         D+     +EA
Sbjct  763   DLYSLGKDNNWISPIKVV-MSEWFEHLTFNFALRMIAGKRYF--------DNAVHGNEEA  813

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +  I   +++  LSG FV  D FP    +  D QG++ +MK   +++D ++ +W+++H+ 
Sbjct  814   RGAIITIKKYLSLSGAFVPSDVFPF--LERLDLQGYLGSMKHVTEELDCLVGSWVEEHVM  871

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R  L + P    G   D I ++LST+    +  F +T +  IK T  ++I+ GSD+T   
Sbjct  872   R--LKSEP----GCRHDFIDVLLSTVQDTSM--FGHTRETVIKATIVNLIVGGSDSTSIT  923

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
               W LS L+   + MK  +EE++ +VG  RWVE+SD++KL+YL+A++KESLRLYP  PLL
Sbjct  924   STWILSALLNNREAMKHAQEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYPAAPLL  983

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P   ++DC + GY +PKG +  VN WK+ RDP+ W  P++F P+RFL   A   D    
Sbjct  984   VPHEATQDCHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHA-NLDVFGH  1042

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
             +FE +PFG GRR+C G+  ALQ+ HLT ARL+QGF+ +TP N  +DM EG   T+P+ TP
Sbjct  1043  QFELIPFGSGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTP  1102

Query  178   LQLVVTP  158
             L+  + P
Sbjct  1103  LRSSINP  1109


 Score =   383 bits (984),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 199/481 (41%), Positives = 300/481 (62%), Gaps = 21/481 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L+ Q  I  RTLG MADKHGP+F+++ GM P  ++   EA K+CFTT+++  A
Sbjct  47    IIGHLHLLSGQVPIF-RTLGAMADKHGPVFMIQLGMHPAVVVSSHEAVKECFTTNDKVFA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  +V + LGYNYA F F+    +WR MRK  V E+LS  +L+++K +R+SEL+  I+
Sbjct  106   SRPRSSVSKLLGYNYAGFGFAPYGPFWREMRKLSVVEILSARRLNELKDVRISELDACIQ  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LY     +   +   VV M EW   LT N   R++AG+RY         D+     +EA
Sbjct  166   DLYSLGKDNNWISPIEVV-MSEWFEHLTFNFVLRMIAGKRYF--------DNAVHGNEEA  216

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +  I   ++F  LSG FV  D FP    +  D +G++ +MK   +++D ++ +W+++H+ 
Sbjct  217   RGAIIAIKKFLSLSGAFVPSDVFPF--LERLDLKGYLGSMKHVAEELDCLVGSWVEEHVM  274

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R  L + P    G+  D I ++LS +    +  F ++ +  IK T  ++I+ GSD+T   
Sbjct  275   R--LKSEP----GSRHDFIDVLLSAVQDTSM--FGHSRETVIKATIGNLIVGGSDSTSIT  326

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
               W LS L+   + MKR +EE++ +VG  RWVE+SD++KL+YL+A++KESLRLY   PLL
Sbjct  327   STWILSALLNNREAMKRAQEELDLKVGRSRWVEESDIQKLDYLRAIIKESLRLYSAAPLL  386

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P   ++DC + GY +PKG +  VN WK+ RDP+ W  P++F P+RFL   A   D    
Sbjct  387   VPHEATQDCHVCGYHIPKGTRLFVNAWKLHRDPRVWSNPEEFEPERFLGSHA-NLDVFGH  445

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
             +FE +PFG GRR+C G+  ALQ+ HLT ARL+QGF+ +TP N  +DM EG   T+P+ TP
Sbjct  446   QFELIPFGSGRRACPGINMALQMLHLTFARLLQGFDMATPSNAPVDMTEGISFTMPKLTP  505

Query  178   L  176
             L
Sbjct  506   L  506



>ref|XP_004154826.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 82C4-like [Cucumis 
sativus]
Length=532

 Score =   376 bits (965),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 199/499 (40%), Positives = 299/499 (60%), Gaps = 20/499 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L+ +N+    T  +MAD +GP+F +R G+    ++   E A++CFTT+++  A
Sbjct  51    LIGHLHLLD-KNEPAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEIARECFTTNDKIFA  109

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    + LGY+YAM   S    +WR +RK  + ELL++ +L K++HIR+SE++TSIK
Sbjct  110   SRPKLVASKLLGYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKLQHIRVSEVQTSIK  169

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
              LY L +       K A+V M  W   +TLNT  RIV G+++   V       D +   E
Sbjct  170   NLYELCLKNKKNNEKNALVEMKTWFGDITLNTISRIVVGKQFSTAV-------DVSNTNE  222

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              +E     R+F    G+FV  D+FP    KW D  GH +AMK+  + +D++   WI +H 
Sbjct  223   NEEYRKALRDFSNXFGVFVPSDSFPF--LKWLDLGGHEKAMKKTAQVLDEVFDKWIQEHQ  280

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTI--DKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             +++   N        + D + +MLS +  D +  K   Y   +  K T  ++I+ GSDTT
Sbjct  281   QKK---NNLGAVKMEEHDFMDVMLSNVRDDGQLSK---YDAHIVTKATCLALILAGSDTT  334

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                M+WALSLL+   +V+KR + E++  VG +R V++SDVK L YLQAVVKE+LRLYP  
Sbjct  335   TVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQAVVKETLRLYPAA  394

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             P+L+P  + +DC + GY +P G +  VN+ K+ RDP+ W +P +F P+RFL  E    D 
Sbjct  395   PILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFRPERFLTSEK-DFDV  453

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               +  + +PFG GRR C G+++ALQ+ HL +A L+ GF  S P    LDMEE  G+T  R
Sbjct  454   RGQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELLDMEESAGMTSIR  513

Query  187   ATPLQLVVTPRLPPNFYGL  131
               PL++V+TPRLPP  Y L
Sbjct  514   KNPLEVVLTPRLPPQVYEL  532



>gb|KHG01290.1| Cytochrome P450 [Gossypium arboreum]
Length=522

 Score =   375 bits (963),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 195/494 (39%), Positives = 301/494 (61%), Gaps = 19/494 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+L    +    +LG++ +K+GP +++R G+ P  ++   + AK+ FT ++  V+
Sbjct  47    IIGHLPLLGGP-KAPHESLGDLGEKYGPAYMIRIGVHPALVVNSSDVAKEIFTVNDMHVS  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+ EFA  EHLGYNYAMF FS    +WR MRK  + E+LSN ++D++K + +SE+E S+K
Sbjct  106   SRSEFAAAEHLGYNYAMFGFSPYGQFWREMRKITMLEVLSNHRIDQLKKVFLSEIEGSMK  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY         +   +V M +  + LTLN   R VAG+RY      ++G ++  + KE 
Sbjct  166   LLYNTWADKKNGSGKVLVEMKKHFSDLTLNVIMRTVAGKRY------SVGAEE--DQKEV  217

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                    R+F +L+GMFVL DA P    +W DF G+ + MK+  K++D+I   W+D H  
Sbjct  218   LRYRTALRDFFHLTGMFVLGDAVPF--LRWLDFGGYEKKMKKTAKELDEISGGWLDDH--  273

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
              R+ G+        + D + +M S +    + G  Y      K T+ +MI+ GSDTT   
Sbjct  274   -RKGGHWDENK--KEKDFMDVMNSVLKGASLAG--YDADTINKATSLNMILAGSDTTTVT  328

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             ++W LSL++    V+K+ +EE++  +G +R+V ++D+ KL Y+QA+VKE+LR+YP  PL 
Sbjct  329   LIWGLSLMLNKPHVLKKAQEELDTHIGRDRFVNETDIGKLVYIQAIVKETLRMYPPAPLS  388

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR  S+ C IGGYD+PKG +  +NL KI RDPK WPEP +F P+RFL       D   +
Sbjct  389   APRELSESCSIGGYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHK-DIDVKGQ  447

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRRSC G ++AL + +LT++  +  F+FSTP +  +D+    G+T  ++TP
Sbjct  448   HFELMPFGSGRRSCPGTSFALHMLYLTMSNFLHAFDFSTPSDGLIDLTGTDGLTNIKSTP  507

Query  178   LQLVVTPRLPPNFY  137
             L+ +V+PRL P  Y
Sbjct  508   LEALVSPRLAPELY  521



>ref|XP_003619141.1| Cytochrome P450 [Medicago truncatula]
 gb|AES75359.1| cytochrome P450 family protein [Medicago truncatula]
Length=525

 Score =   375 bits (963),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 191/495 (39%), Positives = 290/495 (59%), Gaps = 16/495 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+L S++Q     LG MADK+GP+F ++ G     +I   E AK+C+TT++  V+
Sbjct  43    IIGHLPLL-SKSQATHHLLGAMADKYGPIFTIKLGTATTLVINNWETAKECYTTNDTAVS  101

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
              +P     +H+ YN+AM  F+    +WR MRK V    LSN ++D + H+R+SE++TSIK
Sbjct  102   YRPNLVAFKHMTYNHAMLGFAPYGPFWREMRKIVTLSFLSNHRIDLLTHVRVSEVQTSIK  161

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             EL+       + N   +V M +W  +L  NT+ R+VAG+RY        G+    + +EA
Sbjct  162   ELFSIWKNKRDENGYLLVEMKKWFHELAFNTALRMVAGKRY-------FGESVMVKEEEA  214

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                +N  R++  L G+F + DA P    +WFDF GH ++MK N K++D ++  W+++H  
Sbjct  215   NRCLNALRDYMRLIGVFPIADAIP--FLRWFDFGGHEKSMKENFKELDTVVTEWLNEHKN  272

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +R+ G      +  D D I +MLSTID   + GF       IK TT ++++  +DT+   
Sbjct  273   KREDGG--DDKSKGDHDFIDVMLSTIDGTNIHGF--DSDTIIKATTMALVLGATDTSSVT  328

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERW-VEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              +WAL LL+     +++ +EEI+  +G ER  + +SD+ KL YLQAVVKE+LRLYP  PL
Sbjct  329   HIWALCLLLNNPHALEKVKEEIDRHIGKERLCITESDINKLVYLQAVVKETLRLYPASPL  388

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
                R   +DC IGGY + KG +   NLWKI  DP  WP+P +F P RFL       D   
Sbjct  389   SGIREFREDCNIGGYHVKKGTRLFTNLWKIQTDPSVWPDPLEFKPGRFLTTHK-DVDVKG  447

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
               FE++PFG GRR C G+++ L+ ++LT+A  +  F      +  +DM      T  + T
Sbjct  448   HHFEFLPFGSGRRICPGISFGLRTAYLTLANFLHSFEVLKTSSEPIDMTAVVETTNIKVT  507

Query  181   PLQLVVTPRLPPNFY  137
             PL++++ PRLP N+Y
Sbjct  508   PLEVLIKPRLPFNYY  522



>gb|AII31760.1| cytochrome P450 monooxygenase [Gossypium hirsutum]
Length=522

 Score =   375 bits (962),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 197/494 (40%), Positives = 298/494 (60%), Gaps = 19/494 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+L    +    +LG++ +K+GP + +R G+ P  ++   + AK+ FT ++  V+
Sbjct  47    IIGHLPLLGGP-KAPHESLGDLGEKYGPAYTIRIGVHPALVVNSSDVAKEIFTVNDMYVS  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+ EFA  EHLGYNYAMF FS    +WR MRK  + E+LSN ++D++K +  SE+E S+K
Sbjct  106   SRSEFAAAEHLGYNYAMFGFSPYRQFWREMRKITMLEVLSNHRIDQLKKVFASEIEGSMK  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY         +   +V M +  + LTLN   R VAG+RY      ++G ++  + KE 
Sbjct  166   LLYNTWADKKNGSGKVLVEMKKHFSDLTLNVIMRTVAGKRY------SVGAEE--DQKEV  217

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                    R+F +L+GMFVL DA P    +W DF G+ + MK+  K +D+I   W+D H  
Sbjct  218   LRYRTALRDFFHLTGMFVLGDAVPF--LRWLDFGGYEKKMKKTAKALDEISGGWLDDH--  273

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
              R+ G+        + D + +M S +    + G  Y      K T+ +MI+ GSDTT   
Sbjct  274   -RKGGHWDENK--KEKDFMDVMNSVLKGASLAG--YDADTINKATSLNMILAGSDTTTVT  328

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             ++W LSL++    V+K+ +EE++  +G +R+V ++D+ KL Y+QA+VKE+LR+YP  PL 
Sbjct  329   LIWGLSLMLNKPHVLKKAQEELDTHIGRDRFVNETDIGKLVYIQAIVKETLRMYPPAPLS  388

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR  S+ C IGGYD+PKG +  +NL KI RDPK WPEP +F P+RFL       D   +
Sbjct  389   APRELSESCSIGGYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHK-DIDVKGQ  447

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRRSC G ++AL + +LT++  +  F+FSTP N  +D+    G+T  ++TP
Sbjct  448   HFELMPFGSGRRSCPGTSFALHMLYLTMSNFLHAFDFSTPSNGLIDLTGTDGLTNIKSTP  507

Query  178   LQLVVTPRLPPNFY  137
             LQ +V+PRL P  Y
Sbjct  508   LQALVSPRLAPELY  521



>ref|XP_002305292.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
 gb|EEE85803.2| hypothetical protein POPTR_0004s10630g [Populus trichocarpa]
Length=516

 Score =   374 bits (961),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 190/497 (38%), Positives = 305/497 (61%), Gaps = 22/497 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             + GH+P L  ++    +TLG +ADK+GP++ ++ G+    ++   E  KDC  T++R +A
Sbjct  39    LFGHLPSLVGKDPA-CKTLGAIADKYGPIYSLKFGIHRTLVVSSWETVKDCLNTNDRVLA  97

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++   A G+H+ YN A F+ +    YWR +RK    +LLSN +L+ +KH+R+SE++T IK
Sbjct  98    TRAGIAAGKHMFYNNAAFALAPYGQYWRDVRKLATLQLLSNQRLEMLKHVRVSEVDTFIK  157

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTE---Y  1088
              L+ F   + +    A V + + +  LT N + R + G+RY      +  D +++E   Y
Sbjct  158   GLHSFYAGNVD--SPAKVNISKLLESLTFNINLRTIVGKRY----CSSTYDKENSEPWRY  211

Query  1087  KEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             K+A       ++  YLSG+FV+ DA P    +W D+QGHV AMK+  K++D +++ W+++
Sbjct  212   KKA------IKKALYLSGIFVMSDAIPF--LEWLDYQGHVSAMKKTAKELDAVIRNWLEE  263

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H++++  G      +  + D + +M+S + +   K   Y+  + IK T   + + G+ +T
Sbjct  264   HLKKKIDGEL---GSDRESDFMDVMISNLAEGPDKISGYSRDVVIKATALILTLTGAGST  320

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
              T +VW LSLL+    V+K  +EE++ QVG ERWVE+SD++ L+YLQA+VKE+LRLYP  
Sbjct  321   ATTLVWTLSLLLNNPTVLKAAQEELDKQVGRERWVEESDIQNLKYLQAIVKETLRLYPPG  380

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL   R   +DC IGGYD+PKG +  VN+WK+ RDP+ W  P++F P RFL   A   D 
Sbjct  381   PLTGIREAMEDCSIGGYDVPKGTRLVVNIWKLHRDPRVWKNPNEFKPDRFLTTHA-DLDF  439

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               +  E++PF  GRRSC  +   L + HLT+AR++QGF+ +T   + +DM EG G+ LP+
Sbjct  440   RGQNMEFIPFSSGRRSCPAINLGLIVVHLTLARILQGFDLTTVAGLPVDMIEGPGIALPK  499

Query  187   ATPLQLVVTPRLPPNFY  137
              TPL++V+ PRL    Y
Sbjct  500   ETPLEVVIKPRLGLELY  516



>gb|AAS90126.1| cytochrome P450 [Ammi majus]
Length=530

 Score =   375 bits (962),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 202/495 (41%), Positives = 301/495 (61%), Gaps = 20/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L   ++IL   LG+MAD++GP+F +  G+    +I   E AK+CFTT +R  A
Sbjct  54    LIGHLHLLGG-SKILHHILGDMADEYGPIFSLNLGINKTVVITSWEVAKECFTTQDRVFA  112

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P+  VG+ +GYN  +  F    AYWR MRK  + ELLSN +LD +KH+R SE+   IK
Sbjct  113   TRPKSVVGQVVGYNSRVMIFQQYGAYWREMRKLAIIELLSNRRLDMLKHVRESEVNLFIK  172

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY   +A+   +K  VV M +    LT N   R VAG++Y     G  G+++S ++++A
Sbjct  173   ELYEQWSANGNGSKV-VVEMMKRFGDLTTNIVVRTVAGKKYSGT--GVHGNEESRQFQKA  229

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFD-FQGHVRAMKRNNKKVDKILQAWIDQHI  902
                     EF +L G+ ++ DA PL    W D  +G    MK+  +++D IL + + +H 
Sbjct  230   ------MAEFMHLGGLLMVSDALPL--LGWIDTVKGCKGKMKKTAEEIDHILGSCLKEHQ  281

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             ++R           ++ D I++MLS +D     G       AIKGT  S+I+ G DTT  
Sbjct  282   QKR----TNISNNHSEDDFIYVMLSAMDGNQFPGIDT--DTAIKGTCLSLILGGYDTTSA  335

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              ++WALSLL+    V+K+ ++E++  VG +R V++SDVK L YLQA+VKE+LRLYP  PL
Sbjct  336   TLMWALSLLLNNRHVLKKAQDEMDQYVGRDRQVKESDVKNLTYLQAIVKETLRLYPAAPL  395

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
              +      DC + G+++P G +  VNLWK+ RDPK W +P +F P+RFL +     D   
Sbjct  396   SVQHKAMADCTVAGFNIPAGTRLVVNLWKMHRDPKVWSDPLEFQPERFLQKHI-NVDIWG  454

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRRSC G+ +A+Q+ HLT+A+L+ GF   T  +  +DM E  G+T PRAT
Sbjct  455   QNFELLPFGSGRRSCPGITFAMQVLHLTLAQLLHGFELGTVLDSSIDMTESSGITDPRAT  514

Query  181   PLQLVVTPRLPPNFY  137
             PL++ +TPRLPP  Y
Sbjct  515   PLEVTLTPRLPPAVY  529



>ref|XP_006432714.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
 ref|XP_006471503.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45954.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
Length=525

 Score =   374 bits (961),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 194/496 (39%), Positives = 291/496 (59%), Gaps = 25/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L    +   R LG MADK+GP+F ++ G+    ++   E AK+C TTH++  A
Sbjct  54    VIGHLHLLGGP-EPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFA  112

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    E LGYN++MF FS   +YWR  RK    ELLSN +L+K+K +R  EL+T +K
Sbjct  113   SRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLEKLKQVREYELKTCLK  172

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY     +   NK  +V M  W+A    N   RI+        VG      DS E+KE 
Sbjct  173   ELYQLWDNNKSTNKMLLVEMKRWLADSIRNVVLRII--------VGKGCNSMDSEEWKE-  223

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                  +   F  +SG FV+ DA P    +W D  G  R+MK+  K++D ++Q W+++H  
Sbjct  224   -----LLTRFFEMSGKFVVSDALPF--LRWLDIGGDERSMKKIAKELDVVVQGWLEEHKM  276

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTI-DKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +R            + D +++MLS + D E   G         K     +I+  +DTT  
Sbjct  277   KRD----SQEMNQEEEDFMYVMLSILGDTEQYYGRDV--DTINKAICLGLILAATDTTAV  330

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + W +SLL+ + D++ + R E++ QVGT+R V +SD+KKL YLQA++KE++RLYP  PL
Sbjct  331   TLTWIISLLLNHHDILNKARNELDIQVGTKRQVNESDIKKLVYLQAILKEAMRLYPAAPL  390

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L+P  + ++C + GY++P G Q  +N+WK+ RDP  W EP KF P+RFL R     D   
Sbjct  391   LIPHESIEECTVSGYNVPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHK-DTDVRG  449

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PF  GRR C G+++ALQ+   T+A L+ GF+ +TP N  LDM EG G+T+ ++T
Sbjct  450   QNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSNEPLDMGEGLGLTVEKST  509

Query  181   PLQLVVTPRLPPNFYG  134
             PL+++V PRL  + YG
Sbjct  510   PLEVLVAPRLSASLYG  525



>ref|XP_006340061.1| PREDICTED: cytochrome P450 82C4-like [Solanum tuberosum]
Length=511

 Score =   374 bits (959),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 194/495 (39%), Positives = 289/495 (58%), Gaps = 34/495 (7%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDV-A  1439
             IGH+ +LN    +  RTLG MADK+GP+F ++ G  P  ++   E  KDCFT +   + +
Sbjct  46    IGHLHLLNGHLPV-CRTLGLMADKYGPIFQLQLGDHPAIVVSNWEIVKDCFTANNDKIFS  104

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  AV ++LGYN A+F+ +    YWR +RK V  ELL++ +L+K+KH+R SE+   IK
Sbjct  105   SRPNMAVSKYLGYNGAVFAMAPYGPYWRDIRKMVTVELLTHSRLEKLKHVRTSEVNCCIK  164

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY         N  + V +  W   +T N   R++AG+R+        G  +   +KE+
Sbjct  165   ELY--------SNCPSQVNLSSWFENITCNIIVRMLAGKRFT-------GCAEEMNFKES  209

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                    ++  YL G FV  DA P    +W D  GH++AMK   K+VD +  +W+ QHI 
Sbjct  210   ------IKKALYLGGAFVFSDAIPW--LEWMDIGGHIKAMKETYKEVDSVFDSWLKQHI-  260

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEF-VKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
                +G+      G   D I +MLST+ +E  ++   Y     IK TT  +I+  S++T  
Sbjct  261   -NSIGD------GEQSDFIDIMLSTLPEETNMESAAYNRHAIIKATTLILIMTASESTAE  313

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              ++WALSLL+     +K  + E++ Q+G  +WVE+SD+K L YLQA+VKE+LRLYP  PL
Sbjct  314   TLIWALSLLMNNTHSLKLAQNELDEQIGRNKWVEESDIKNLPYLQAIVKETLRLYPPGPL  373

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
               PR   +DC IG Y + KG +  VNLWK+ RD + W +P++F P+R+   E    +   
Sbjct  374   AGPREAIEDCYIGKYHIKKGTRLIVNLWKLQRDSRIWEDPNEFKPERWFLNEHTNINFRG  433

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FEY+PF  GRR C G+ +A Q+ HLT+A+L+ GFN S P    +D+ EG G+ LP+  
Sbjct  434   QHFEYIPFSSGRRMCPGLTFATQVVHLTLAKLLHGFNISMPKEEPVDVSEGLGIALPKVK  493

Query  181   PLQLVVTPRLPPNFY  137
             PLQ +++PRL    Y
Sbjct  494   PLQPLLSPRLAVELY  508



>ref|XP_006486179.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   374 bits (960),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 196/499 (39%), Positives = 292/499 (59%), Gaps = 29/499 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ IL   ++   R LG MADK+GP+F ++ G+    ++   E AK+CFTT+++  A
Sbjct  55    LIGHLHILRG-SEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFA  113

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
              +P+    E LGYN+ +  F+    YWR  RK    ELLSN +L+K+KH+R SE++ SI+
Sbjct  114   GRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQ  173

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY    +S    K   V M  W+    L+   RI+AG+RY            S E  + 
Sbjct  174   RLYKNCISSSSSRKVVSVEMIHWLEGTVLDIILRIIAGKRYT---------SQSQEVNDW  224

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q+ I    +F  LSG FV+ DA P    +W D  G+ R M +  K  D ILQ W+D+H  
Sbjct  225   QQQIT---KFTALSGQFVVSDALPF--LRWLDIGGYERLMSKTAKYFDIILQEWLDEHKM  279

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +R  G+A       D D ++++LS +D    +         IK    ++I+  +DT+   
Sbjct  280   KRDSGDAKG-----DEDFMYVLLSLLDDNAEQLPDRDADAVIKAICVTLIVAAADTSVVT  334

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WA++LLV   DV+K+ ++E++ QVGTER V +SD + L YLQA++KE++RLYP  PLL
Sbjct  335   LTWAIALLVNNRDVLKKAQDELDIQVGTERPVNESDARNLVYLQAIIKETMRLYPAAPLL  394

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNR----EAGGAD  371
             +P    ++C + GY +P G Q  VN WKI RDP  W EP +F P+RFL R    + GG D
Sbjct  395   LPHECIEECIVNGYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGGQD  454

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                  FE +PFG GRR C  +++ LQ+  L +A L+ GF+F+TP +  +DM E  G+T+ 
Sbjct  455   -----FELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIA  509

Query  190   RATPLQLVVTPRLPPNFYG  134
             +ATPL+++V+PRL  + YG
Sbjct  510   KATPLEVLVSPRLSASLYG  528



>gb|KGN59914.1| hypothetical protein Csa_3G852630 [Cucumis sativus]
Length=538

 Score =   374 bits (960),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 199/499 (40%), Positives = 299/499 (60%), Gaps = 20/499 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L+ +N+    T  +MAD +GP+F +R G+    ++   E A++CFTT+++  A
Sbjct  57    LIGHLHLLD-KNEPAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEIARECFTTNDKIFA  115

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    + LGY+YAM   S    +WR +RK  + ELL++ +L K++HIR+SE++TSIK
Sbjct  116   SRPKLVASKLLGYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKLQHIRVSEVQTSIK  175

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
              LY L +       K A+V M  W   +TLNT  RIV G+++   V       D +   E
Sbjct  176   NLYELCLKNKKNNEKNALVEMKTWFGDITLNTISRIVVGKQFSTAV-------DVSNTNE  228

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              +E     R+F    G+FV  D+FP    KW D  GH +AMK+  + +D++   WI +H 
Sbjct  229   NEEYRKALRDFFEWFGVFVPSDSFPF--LKWLDLGGHEKAMKKTAQVLDEVFDKWIQEHQ  286

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTI--DKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             +++   N        + D + +MLS +  D +  K   Y   +  K T  ++I+ GSDTT
Sbjct  287   QKK---NNLGAVKMEEHDFMDVMLSNVRDDGQLSK---YDAHIVTKATCLALILAGSDTT  340

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                M+WALSLL+   +V+KR + E++  VG +R V++SDVK L YLQAVVKE+LRLYP  
Sbjct  341   TVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQAVVKETLRLYPAA  400

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             P+L+P  + +DC + GY +P G +  VN+ K+ RDP+ W +P +F P+RFL  E    D 
Sbjct  401   PILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFHPERFLTSEK-DFDV  459

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               +  + +PFG GRR C G+++ALQ+ HL +A L+ GF  S P    LDMEE  G+T  R
Sbjct  460   RGQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELLDMEESAGMTSIR  519

Query  187   ATPLQLVVTPRLPPNFYGL  131
               PL++V+TPRLPP  Y L
Sbjct  520   KNPLEVVLTPRLPPQVYEL  538



>ref|XP_004147803.1| PREDICTED: cytochrome P450 82C4-like [Cucumis sativus]
Length=532

 Score =   374 bits (959),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 199/499 (40%), Positives = 299/499 (60%), Gaps = 20/499 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L+ +N+    T  +MAD +GP+F +R G+    ++   E A++CFTT+++  A
Sbjct  51    LIGHLHLLD-KNEPAHITFAKMADAYGPIFTLRLGLYTNLIVSNWEIARECFTTNDKIFA  109

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    + LGY+YAM   S    +WR +RK  + ELL++ +L K++HIR+SE++TSIK
Sbjct  110   SRPKLVASKLLGYDYAMLGLSPYGPHWRHVRKLTMLELLTSHRLQKLQHIRVSEVQTSIK  169

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
              LY L +       K A+V M  W   +TLNT  RIV G+++   V       D +   E
Sbjct  170   NLYELCLKNKKNNEKNALVEMKTWFGDITLNTISRIVVGKQFSTAV-------DVSNTNE  222

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
              +E     R+F    G+FV  D+FP    KW D  GH +AMK+  + +D++   WI +H 
Sbjct  223   NEEYRKALRDFFEWFGVFVPSDSFPF--LKWLDLGGHEKAMKKTAQVLDEVFDKWIQEHQ  280

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTI--DKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             +++   N        + D + +MLS +  D +  K   Y   +  K T  ++I+ GSDTT
Sbjct  281   QKK---NNLGAVKMEEHDFMDVMLSNVRDDGQLSK---YDAHIVTKATCLALILAGSDTT  334

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                M+WALSLL+   +V+KR + E++  VG +R V++SDVK L YLQAVVKE+LRLYP  
Sbjct  335   TVTMIWALSLLLNNQEVLKRAQLELDEHVGRQRQVKESDVKNLLYLQAVVKETLRLYPAA  394

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             P+L+P  + +DC + GY +P G +  VN+ K+ RDP+ W +P +F P+RFL  E    D 
Sbjct  395   PILIPHESIEDCVVAGYHIPLGTRLIVNVQKLQRDPQIWEDPCEFHPERFLTSEK-DFDV  453

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               +  + +PFG GRR C G+++ALQ+ HL +A L+ GF  S P    LDMEE  G+T  R
Sbjct  454   RGQSPQLIPFGSGRRMCPGISFALQVMHLALANLLHGFEISRPTKELLDMEESAGMTSIR  513

Query  187   ATPLQLVVTPRLPPNFYGL  131
               PL++V+TPRLPP  Y L
Sbjct  514   KNPLEVVLTPRLPPQVYEL  532



>ref|XP_006432712.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
 ref|XP_006471502.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45952.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
Length=537

 Score =   374 bits (959),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 195/503 (39%), Positives = 301/503 (60%), Gaps = 23/503 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L      L R LG+MADK+GP+F +R G+    ++   E AK+C TTH+R  A
Sbjct  50    VIGHLHLLGRFP--LHRVLGDMADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFA  107

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+  V E LG+N++MF FS    +WR +RK    ELLSN +L+K+KH+R  E++T +K
Sbjct  108   SRPKALVAEILGFNFSMFGFSPYGPHWRQIRKIATLELLSNHRLEKLKHVREGEVKTCLK  167

Query  1258  ELYLF-------VTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDD  1100
             ELY F        ++    NK  +V M++W   +TLNT  R+  G+R       +   +D
Sbjct  168   ELYEFWERTNNYKSSDHNNNKKVLVEMNKWFEDVTLNTILRVTVGQR----CNSSSSQED  223

Query  1099  STEYKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQA  920
             +      +E +  F  F   SG FV+ D+ P    +WFD  G  RAMK+N +++D + Q 
Sbjct  224   TDHEGAWKEELTKFFAF---SGKFVVSDSLPF--LRWFDIGGDERAMKKNARELDVLAQG  278

Query  919   WIDQHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAI-KGTTQSMIID  743
             W+D+H  +R+ G       G++ D + +MLS + ++  +  P      I K T  ++I+ 
Sbjct  279   WLDEHKRKRESGQM-INKEGHE-DFMDVMLSIL-RDDAQQLPGDDADTINKATCLALILA  335

Query  742   GSDTTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLR  563
              SDT+   + W LSLL+ + DV+K+ + E++  +G  R V + D+K L YLQA++KE++R
Sbjct  336   ASDTSKITLTWILSLLLNHRDVLKKAQNELDVHIGKRRQVNELDIKNLVYLQAIIKEAMR  395

Query  562   LYPTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREA  383
             LYP  PL  P  +++DC +  Y +P G    VN+WKI RDP+ WPEP KF P+RFL    
Sbjct  396   LYPAGPLAAPHASTEDCTVNDYFVPAGTVLYVNVWKIHRDPRVWPEPYKFKPERFLTTHK  455

Query  382   GGADNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFG  203
                D   + FE +PF  GRR C G ++A+ ++HLT+A L+ GF+F TP +  +DM EG  
Sbjct  456   -HIDVRGQNFELLPFSSGRRMCPGPSFAIPVTHLTLATLLHGFDFETPLDEPVDMSEGMS  514

Query  202   VTLPRATPLQLVVTPRLPPNFYG  134
             +TL + TP+++++TPRL  + YG
Sbjct  515   LTLVKTTPVKVLITPRLSASLYG  537



>gb|AII31759.1| cytochrome P450 monooxygenase [Gossypium hirsutum]
Length=522

 Score =   373 bits (958),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 197/494 (40%), Positives = 295/494 (60%), Gaps = 19/494 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+L    +     LG++ +K+GP +++R G+ P  ++   E AK+ FT ++  V+
Sbjct  47    IIGHLPLLGGP-KAPHEALGDLEEKYGPAYMIRIGVHPALVVNSSEVAKEIFTVNDMHVS  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+ EFA  EHLGYNYAMF FS    YWR MRK  + E+LSN ++D++K + +SE+E S+K
Sbjct  106   SRSEFAAAEHLGYNYAMFGFSPYGQYWREMRKITMLEVLSNHRIDQLKKVFVSEIEGSMK  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY       + +   +V M +  + LTLN   R VAG+RY       + ++D    KE 
Sbjct  166   LLYKTWAQKKDGSGKVLVEMKKHFSDLTLNVIMRTVAGKRYS-----VVAEEDQ---KEV  217

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                    R+F +L+GMFVL DA P    +W D  G+ + MK   K++D+I   W+D H  
Sbjct  218   LRYRKALRDFFHLTGMFVLGDAVPF--LRWLDIGGYEKRMKITAKELDEISGGWLDDH--  273

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
              R+ G         + D + +M S +    + G  Y      K T+ +MI+ GSDTT   
Sbjct  274   -RKGGRWDENK--KEKDFMDVMNSVLKGASLAG--YDADTINKATSLNMILAGSDTTTVT  328

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             ++W LSL++    ++K+ +EE++  +G +R+V ++D+ KL Y+QA+VKE+LRLYP  PL 
Sbjct  329   LIWGLSLMLNKPHILKKAQEELDTHIGKDRFVNETDIGKLVYIQAIVKETLRLYPPAPLS  388

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR  S+ C IGGYD+PKG +  +NL KI RDPK WPEP +F P+RFL       D   +
Sbjct  389   APRELSETCSIGGYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHK-DVDVRGQ  447

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRRSC G ++AL +  LT++  +  F+FSTP N  +D+    G+T  ++TP
Sbjct  448   HFELMPFGSGRRSCPGTSFALHMLFLTMSNFLHAFDFSTPSNGLIDLTGTAGLTNIKSTP  507

Query  178   LQLVVTPRLPPNFY  137
             L+ +V+PRL P  Y
Sbjct  508   LEALVSPRLAPELY  521



>ref|XP_007017415.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14640.1| Cytochrome P450, putative [Theobroma cacao]
Length=529

 Score =   373 bits (958),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 198/495 (40%), Positives = 303/495 (61%), Gaps = 19/495 (4%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             +GH+ +L   ++     LG++AD +GP+F +R GM P  ++   E AK+CFTT+++  A+
Sbjct  51    LGHLHLLGG-SKPAHVVLGDLADTNGPIFTIRLGMHPTLVVSNWEIAKECFTTNDKAFAN  109

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P     E LGYNYAMF FS    YWR +RK    E+LSN +L+K+KHIR SE+ TSIKE
Sbjct  110   RPRTIAAELLGYNYAMFGFSPYGPYWRQIRKIATLEVLSNHRLEKLKHIRESEVRTSIKE  169

Query  1255  LYLFVT--ASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             LY       S   +   +V M  W   L +N   ++V G+RY  +   + G D++  +++
Sbjct  170   LYELGVEGVSNSSSGKVLVEMKRWFWTLNINMVFKMVVGKRYS-EAETSHGKDENDGHRK  228

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             A       R+F  L+G F + D+ P    +W D  GH +AMK+  K++D IL+ W+++H 
Sbjct  229   A------LRDFFELTGTFTVGDSLPF--LRWLDLGGHEKAMKKTAKELDHILEEWLEEHK  280

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             ++R  GNA +     + D + +MLS ++ +  +   Y     IK T  ++I+ G+DTT  
Sbjct  281   QKRNSGNAES-----EHDFMGMMLSLLN-DAAELPSYNADTIIKATCLAIILGGTDTTTV  334

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WALSLL+ + DV+++ + E++  VG ER V++SDVK L YLQA++KE+ RLYP  PL
Sbjct  335   TITWALSLLLNHHDVLEKAQHELDTYVGRERPVQESDVKNLVYLQAIIKETTRLYPAAPL  394

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
              +   + +DC   GY +P G +  VNL K+ RDPK W  PD+F P+RFL       D   
Sbjct  395   SVMHESVEDCTTAGYFIPAGTRLLVNLSKLQRDPKAWSNPDEFRPERFLTTHK-HFDVRG  453

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + +E VPFG GRR C G+++ALQ+   ++A L+Q F  +TP +  +DM EG G+T  +AT
Sbjct  454   QNYELVPFGSGRRVCPGISFALQVLQFSLASLLQAFEITTPSDEPVDMGEGAGLTNLKAT  513

Query  181   PLQLVVTPRLPPNFY  137
             PL++++TPRLPP+ Y
Sbjct  514   PLEVILTPRLPPHLY  528



>ref|XP_004292356.1| PREDICTED: cytochrome P450 82C4-like [Fragaria vesca subsp. vesca]
Length=492

 Score =   372 bits (954),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 195/494 (39%), Positives = 303/494 (61%), Gaps = 18/494 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I+GH+  L  +N +  +TL  MADK+GP+F +  G     +I   EAAK+CFTT++R  A
Sbjct  15    ILGHLHQLGGRNPLF-QTLANMADKYGPIFTIWLGKNRALVISNYEAAKECFTTNDRVFA  73

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P  A G++LGYNYA F  S    YWR  RK VV ELLS+ +L+ +KH+++SE++  + 
Sbjct  74    TRPSSAQGKYLGYNYAAFGVSPYGKYWRDTRKLVVMELLSSRRLETLKHVQISEVDAFVI  133

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY  V  +   +  + V +   I  LT N   +I+AG+RY     G   D+   E K+ 
Sbjct  134   GLY-SVWKNKGHDGPSKVVISTGIEHLTCNVMTKIIAGKRYF----GVKSDEFDGEVKKI  188

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             ++++   +EF Y +   V+  ++ + + +W DF+GH+R MK    ++D ++ +W+++H  
Sbjct  189   RKLM---KEFMYAAVNRVV--SYVVGIPEWIDFKGHLRTMKNVGGQLDSLMTSWVEEHNT  243

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +++  ++    +  + D I ++LS I+   + G  +T    IK T   +++ GS+TT   
Sbjct  244   KKRKNDS----SNEEQDFIDVLLSEIEDGSMLG--HTRDTIIKSTALILVLAGSETTSVS  297

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + W LSLL+     +K  +EE++  VG  RWVED+D+K L YLQA+ KE+LRLYP  PL 
Sbjct  298   LTWMLSLLLNNRRTLKLAQEELDRIVGRHRWVEDTDIKNLVYLQAIAKETLRLYPPGPLS  357

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
             +P    +DCK+GG+ +PKG    VNLWK+ RDP  WP+P+ F P+RFL  +A   D   +
Sbjct  358   VPHEAMEDCKVGGFHVPKGTHLYVNLWKLHRDPNVWPDPEVFSPERFLTTQA-SVDAFGQ  416

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE++PFG GRR C G+  A Q+ HLT+ARLIQGF  +TP +  +DM EG G+++ RAT 
Sbjct  417   HFEFIPFGAGRRICPGITLAFQLMHLTVARLIQGFELATPLDKAVDMTEGSGLSMARATA  476

Query  178   LQLVVTPRLPPNFY  137
             L++V+T RL    Y
Sbjct  477   LEVVLTARLAYELY  490



>ref|XP_003516592.1| PREDICTED: cytochrome P450 82A3-like isoform X1 [Glycine max]
Length=530

 Score =   373 bits (958),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 192/495 (39%), Positives = 293/495 (59%), Gaps = 15/495 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ + N  +Q+  +TLG MA+KHGP+F ++ G   + ++   E AK+CFT H++  +
Sbjct  48    IIGHLHLFNG-HQLTHKTLGMMAEKHGPIFTIKLGSYKVLVLSSWEMAKECFTVHDKAFS  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P  A  + +GYNYAMF F+   +YWR +RK    ELLSN +L+ +K  R  EL+ ++K
Sbjct  107   TRPCVAASKLMGYNYAMFGFTPYGSYWRQVRKLTTIELLSNNRLEPLKETRTFELDAAVK  166

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY   T +  P    +V M +W   LT N + R+V G+ Y       +GDD +    EA
Sbjct  167   ELYKLWTRNGCPKGGVLVDMKQWFGDLTHNIALRMVGGKSY-----CGVGDDHAE--GEA  219

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +    V R++  L G+FV  D+FP     W D  G+ + MKR   ++D +++ W+++H  
Sbjct  220   RRYRRVMRDWVCLFGVFVWSDSFP--FLGWLDINGYEKDMKRTASELDTLVEGWLEEHKR  277

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +++ G +       D D + +ML+ +    + G  Y     IK T  ++I+ G+D T   
Sbjct  278   KKKRGLSVNGKEEQD-DFMDVMLNVLQGTEISG--YDSDTIIKATCLNLILAGTDPTMVT  334

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+ +   +KR + E+   +G  R V++SD+KKL YLQAVVKE+LRLYP  P++
Sbjct  335   LTWALSLLLNHQTELKRAQHELGTLMGKHRKVDESDIKKLVYLQAVVKETLRLYPPSPII  394

Query  538   MPRMTSKDCKIG-GYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
               R   +DC    GY +P G Q  VN WKI RD + W +P+ F P+RFL       D   
Sbjct  395   TLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSDPNDFKPERFLTSHK-DVDVKG  453

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + +E VPF  GRR+C G + AL++ HLT+ARL+  FN ++P N  +DM E FG+T  +AT
Sbjct  454   QNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFNVASPSNQVVDMTESFGLTNLKAT  513

Query  181   PLQLVVTPRLPPNFY  137
             PL++++TPR    FY
Sbjct  514   PLEVLLTPRQDTKFY  528



>ref|XP_007222623.1| hypothetical protein PRUPE_ppa004179mg [Prunus persica]
 gb|EMJ23822.1| hypothetical protein PRUPE_ppa004179mg [Prunus persica]
Length=525

 Score =   373 bits (957),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 206/501 (41%), Positives = 294/501 (59%), Gaps = 26/501 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I GH+P+L         TL  MAD++GPLF +R G+ P  +I   E AK+CFTT++  + 
Sbjct  45    IFGHLPLLGGSTPP-HITLAAMADQYGPLFTIRLGVHPSLVISSSEIAKECFTTNDLVLN  103

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+ AV +H+GYN AMF+F+    +WR MRK    ELLSN +L+ ++ IR+SE+ T ++
Sbjct  104   SRPKLAVVDHIGYNGAMFAFAPSGPFWREMRKITTLELLSNRRLELLRRIRVSEVTTFLQ  163

Query  1258  ELYLFVTASPEPNKAA------VVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDS  1097
             ELY   T S E  + +      +V + +W   +TLN   R+VAG+RY           D 
Sbjct  164   ELY--KTWSTEEKRESNNSDGVLVELKQWFGDMTLNVILRMVAGKRYLVAA-------DE  214

Query  1096  TEYKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAW  917
              E KEA  +    REF +  G+FV+ DA P    +W D  GH +AMK+  K++D I+  W
Sbjct  215   DEKKEASRVQTALREFFHYWGLFVVGDAVPY--LRWLDLGGHEKAMKKIGKELDAIVGEW  272

Query  916   IDQHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGS  737
             ++ H +RR  G A       + D I  MLS +D   + GF        K T  +MI   S
Sbjct  273   VEGHKQRRASGYAKG-----EQDFIDAMLSVLDGADLGGF--DADTVNKATILTMISGAS  325

Query  736   DTTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLY  557
             DTT   + WA+SLL+    V+KR + E++ ++G +R V +SD+ KL Y+QA+VKE+LRLY
Sbjct  326   DTTMVTLTWAISLLLNNPHVLKRAQNELDTEIGRQRVVSESDISKLVYIQAIVKETLRLY  385

Query  556   PTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGG  377
             P  PL  PR  ++DC IGGY + KG +   NLWKI  DP+ WP+P +F P+RFL      
Sbjct  386   PAAPLSGPREFTEDCTIGGYHVSKGTRLITNLWKIQTDPRIWPDPLEFKPERFLTSHR-D  444

Query  376   ADNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVT  197
              D     FE +PFG GRR+C G+A+ LQ+   T+A  +  F  S P +  +DM E FG+T
Sbjct  445   VDVKGLHFELIPFGSGRRACPGLAFGLQMVQFTLASFVHAFEISNPSSAPIDMTESFGLT  504

Query  196   LPRATPLQLVVTPRLPPNFYG  134
               +ATPLQ+++ PRLP   YG
Sbjct  505   NVKATPLQVLINPRLPSQLYG  525



>gb|KHN36187.1| Cytochrome P450 82A3 [Glycine soja]
Length=530

 Score =   373 bits (957),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 192/495 (39%), Positives = 293/495 (59%), Gaps = 15/495 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ + N  +Q+  +TLG MA+KHGP+F ++ G   + ++   E AK+CFT H++  +
Sbjct  48    IIGHLHLFNG-HQLTHKTLGMMAEKHGPIFTIKLGSYKVLVLSSWEMAKECFTVHDKAFS  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P  A  + +GYNYAMF F+   +YWR +RK    ELLSN +L+ +K  R  EL+ ++K
Sbjct  107   TRPCVAASKLMGYNYAMFGFTPYGSYWRQVRKLTTIELLSNNRLEPLKDTRTFELDAAVK  166

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY   T +  P    +V M +W   LT N + R+V G+ Y       +GDD +    EA
Sbjct  167   ELYKLWTRNGCPKGGVLVDMKQWFGDLTHNIALRMVGGKSY-----CGVGDDHAE--GEA  219

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +    V R++  L G+FV  D+FP     W D  G+ + MKR   ++D +++ W+++H  
Sbjct  220   RRYRRVMRDWVCLFGVFVWSDSFP--FLGWLDINGYEKDMKRTASELDTLVEGWLEEHKR  277

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +++ G +       D D + +ML+ +    + G  Y     IK T  ++I+ G+D T   
Sbjct  278   KKKRGLSVNGKEEQD-DFMDVMLNVLQGTEISG--YDSDTIIKATCLNLILAGTDPTMVT  334

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WALSLL+ +   +KR + E+   +G  R V++SD+KKL YLQAVVKE+LRLYP  P++
Sbjct  335   LTWALSLLLNHQTELKRAQHELGTLMGKHRKVDESDIKKLVYLQAVVKETLRLYPPSPII  394

Query  538   MPRMTSKDCKIG-GYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
               R   +DC    GY +P G Q  VN WKI RD + W +P+ F P+RFL       D   
Sbjct  395   TLRAAMEDCTFSCGYHIPAGTQLMVNAWKIHRDGRVWSDPNDFKPERFLTSHK-DVDVKG  453

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + +E VPF  GRR+C G + AL++ HLT+ARL+  FN ++P N  +DM E FG+T  +AT
Sbjct  454   QNYELVPFSSGRRACPGASLALRVVHLTLARLLHSFNVASPSNQVVDMTESFGLTNLKAT  513

Query  181   PLQLVVTPRLPPNFY  137
             PL++++TPR    FY
Sbjct  514   PLEVLLTPRQDTKFY  528



>ref|XP_007017406.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14631.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=1044

 Score =   386 bits (992),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 208/497 (42%), Positives = 301/497 (61%), Gaps = 20/497 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+L    ++   TLG+MA+K+GP++ +R G+ P  ++   E  K+ FT H+  VA
Sbjct  566   IIGHLPLLRGP-KLPHLTLGDMAEKYGPIYAIRLGVHPALVVSSWEILKEIFTNHDVAVA  624

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+ +    +H+ Y+YAMF FS    YWR MRK V  ELLSN KL+ +KH+R+SE+ETS+K
Sbjct  625   SRLKVTSAKHMSYDYAMFGFSPYGPYWREMRKIVNLELLSNHKLELLKHVRVSEVETSLK  684

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY       + +  A+V M +W   L LN   R+VAG+RY    G  +   D    KEA
Sbjct  685   ELYKLWAEKKDSSNRALVEMKQWFGDLALNVIFRMVAGKRY---FGTGLKGHD----KEA  737

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +      RE+ +L G+FVL+DA PL  F   D  G  +AMK   K++D I   W+ +H +
Sbjct  738   RRCQRALREWFHLLGVFVLKDAVPLLGF--LDLGGQEKAMKETAKEMDSIASEWLKEHKQ  795

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKG--FPYTHQMAIKGTTQSMIIDGSDTTG  725
             ++ LG         + D + ++LS ++ E        +      K T  ++I  GSDTT 
Sbjct  796   KKTLGEV------KEKDFMDVLLSLVEAESTNPNLSGWNVDTITKTTCLNLIGGGSDTTK  849

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
               ++WALSLL+     +K+ +EE++  VG ER V DSD+  L YLQAVVKE+LRLYP   
Sbjct  850   VTLIWALSLLLNNRHCLKKVQEELDIHVGKERLVNDSDLSNLIYLQAVVKETLRLYPPA-  908

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             LL PR+ ++D  + GY + KG    +NLWKI  DP+ W +P +F P+RFL+      D  
Sbjct  909   LLFPRLCTQDITLNGYHVSKGTWIFLNLWKIQTDPRVWSDPYEFKPERFLSSHK-EVDVR  967

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFGCGRR C G+++ LQ+ +LT+A L+ GF+ STP N  +DM E  G+T  +A
Sbjct  968   GRHFEMIPFGCGRRVCPGISFGLQVLNLTLAGLLHGFDISTPSNARVDMTESPGLTSIKA  1027

Query  184   TPLQLVVTPRLPPNFYG  134
             TPL++++TPRL PN YG
Sbjct  1028  TPLEVLITPRLSPNSYG  1044


 Score =   295 bits (754),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 166/414 (40%), Positives = 240/414 (58%), Gaps = 17/414 (4%)
 Frame = -1

Query  1417  GEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKELYLFVT  1238
              EHLG+NYAM   +   +YWR MRK +   LLSN +L+ +K +R+SE + S+KELY   +
Sbjct  4     AEHLGFNYAMAGVAPYGSYWREMRKIINFALLSNRRLEILKQVRVSEAQVSVKELYKTWS  63

Query  1237  ASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQEMINVF  1058
                  +   +V M +W   LTLN   R+VAG+RY F   GA GDD     KEA+      
Sbjct  64    KRNNGSGHVLVEMKQWFGDLTLNVIVRMVAGKRY-FG-SGAKGDD-----KEARRCQRAM  116

Query  1057  REFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIERRQLGNA  878
             RE+ +L G+F L+DA P   F   D  GH +A+K   K+++ I   W+ +H ++R  G A
Sbjct  117   REWFHLLGVFALKDAVPFLGF--LDLGGHEKAVKETAKELESIASEWLKEHKQKRASGGA  174

Query  877   PAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTHMVWALSL  698
                    D D + ++LS ++   +    +      K    SMI  GSDT    + W LSL
Sbjct  175   ------KDQDFMDVLLSLLEGTNLAS-EFDVDTINKANCLSMITGGSDTPKVTLTWILSL  227

Query  697   LVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLLMPRMTSK  518
             L+     +++ +EE++  VG ER V +SD+ KLE LQAVVKE+LRL+P V LL PR  + 
Sbjct  228   LLNNLHWLRKVQEELDIHVGKERLVNESDLSKLECLQAVVKETLRLHPPV-LLFPRFCTD  286

Query  517   DCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLKRFEYVPF  338
             +  + GY +P+ +   +NLWKI  DP+ W +P +FMP+RFL           + FE +PF
Sbjct  287   EIIVSGYHVPRDSWIFLNLWKIQTDPRVWSDPLEFMPERFLTTNKDFDVGGDQYFELIPF  346

Query  337   GCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATPL  176
             G GRR C GM++ LQ+ H+T+A L+Q F+ STP N  +DM EG G++  +AT L
Sbjct  347   GFGRRVCPGMSFGLQMVHVTLASLLQAFDISTPSNAMVDMTEGAGLSNMKATAL  400


 Score =   120 bits (302),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 92/152 (61%), Gaps = 5/152 (3%)
 Frame = -1

Query  586  AVVKESLRLYPTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMP  407
              + ESLRLYP  PL   R  ++DC IGGY +PKG +  VNLWKI   P+FW +P +F P
Sbjct  398  TALDESLRLYPAGPLSGAREFTEDCTIGGYHVPKGTRLIVNLWKIQTAPQFWFDPLEFKP  457

Query  406  KRFLNREAGGADNPLK--RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGN  233
            +RF+    G  D  +K   FE +PFG  RR C G+ +  Q +HL +A L+  F+  TP N
Sbjct  458  ERFV---TGHLDVDVKGQHFELIPFGACRRLCPGINFGPQTTHLVLALLLHAFDIWTPSN  514

Query  232  VELDMEEGFGVTLPRATPLQLVVTPRLPPNFY  137
              +DM    G+T  +ATPL+++V PR  PN Y
Sbjct  515  EPVDMTGSPGLTNIKATPLEVLVKPRSSPNLY  546



>ref|XP_010248151.1| PREDICTED: cytochrome P450 82C4-like, partial [Nelumbo nucifera]
Length=464

 Score =   370 bits (949),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 197/483 (41%), Positives = 292/483 (60%), Gaps = 29/483 (6%)
 Frame = -1

Query  1555  MADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVASKPEFAVGEHLGYNYAMFSFS  1376
             MADKHGP FIVR G+  + ++   E AK+CFT +++  +++P       LGYN AMF F+
Sbjct  1     MADKHGPAFIVRLGVHRLLVVNSWEVAKECFTINDKAFSNRPSTVAIRLLGYNRAMFGFA  60

Query  1375  SDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKELY-LFV-----TASPE---P  1223
                +YWR +RK    +LLSN +L+ +KHI+ SE++ SI+ LY L+V     TAS +   P
Sbjct  61    PYGSYWREIRKIATLQLLSNNRLEMLKHIQASEIDMSIRHLYELWVNKTTATASLDQGRP  120

Query  1222  NKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQEMINVFREFQY  1043
             N+  +V M +W   LTLN   R+VAG+R    V G   + D     +A       R+F +
Sbjct  121   NQV-LVEMKQWFGNLTLNIITRMVAGKR----VAGVTDEGD-----DALRCQKAIRDFFH  170

Query  1042  LSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIERRQLGNAPAPAA  863
             L G+F+L DA P     W D QG+ RAM+R  K++D  L+ W+ +H  R       +  A
Sbjct  171   LMGLFILPDAIPF--LGWLDLQGYKRAMRRTAKELDCFLEVWLQEHKHR-----ILSSDA  223

Query  862   GNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTHMVWALSLLVKYG  683
              ++ D + +MLS ++    K   +     IK T  ++I+ G+DTT   + W +SLL+   
Sbjct  224   IDEKDFMDIMLSILEDS--KLPDHNLGTIIKSTCLNLILGGNDTTAVTLTWCISLLLNNR  281

Query  682   DVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLLMPRMTSKDCKIG  503
               MK+ +EE++ QVG ER VE+SD++ L+YLQA++K + RLYP  PL  P++T++DC + 
Sbjct  282   HAMKKAQEELDIQVGRERIVEESDIENLKYLQAIIKXTFRLYPAAPLSAPQITTEDCTVA  341

Query  502   GYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLKRFEYVPFGCGRR  323
             G+ +P G +   N+WKI RDP  W +P  F P+RFL R     D   + FE + FG GRR
Sbjct  342   GFYVPSGTRLVTNIWKIQRDPAVWMDPSNFNPERFLTRHT-NLDVWGQHFELITFGLGRR  400

Query  322   SCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATPLQLVVTPRLPPN  143
             SC G+  AL++ +LT+ RL+QGF F+TP +  +DM E  G+T  +ATPLQ+++TPR P  
Sbjct  401   SCPGINLALRVVNLTLXRLLQGFEFATPSDAPVDMTEKAGLTNLKATPLQILLTPRFPSK  460

Query  142   FYG  134
             FYG
Sbjct  461   FYG  463



>emb|CAN76287.1| hypothetical protein VITISV_027433 [Vitis vinifera]
Length=538

 Score =   372 bits (954),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 200/511 (39%), Positives = 287/511 (56%), Gaps = 37/511 (7%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L     +     G MADK+GP+F +R G+     +   E AK+CFTTH+  +A
Sbjct  36    IIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVXVSSWEMAKECFTTHDLALA  95

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    ++LGYNY MF  S   AYWR +RK    ELLSN +L+ +K++R+SE+ET +K
Sbjct  96    SRPZLVAAKYLGYNYXMFXXSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMK  155

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY             +V M +W   L+LN   ++V G+RY        G    ++ K A
Sbjct  156   ELYKLWAEXKSEAGVVLVDMKQWFGHLSLNVILKMVVGKRY-------FGYAAESKEKGA  208

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q+     REF  L G+FV+ DA P     W D  GHV+AMK+  K++D I Q W+++H  
Sbjct  209   QQCQKAIREFFRLMGLFVVSDAIP--FLGWLDVGGHVKAMKKTAKELDGIXQEWLEEHRR  266

Query  898   RRQLGNAPAPAAGNDLDLIHLMLS-------------TIDK--------EFVKGFPYTH-  785
             R+  G A       D D + +MLS             TI+K        EF     + H 
Sbjct  267   RKDSGEADG-----DQDFMDVMLSILGGRDTTDYDADTINKATXLEEAAEFAPLGGWAHR  321

Query  784   QMAIKGTTQSMIIDGSDTTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVK  605
             +   +   + MI  G+DTT   + WA+SLL+    ++++ +EE++A VG ER V + D+ 
Sbjct  322   KYXCQKIVKVMIGGGADTTSGTLTWAISLLLNNPHILRKAQEELDAHVGKERLVNEMDIS  381

Query  604   KLEYLQAVVKESLRLYPTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPE  425
             KL YLQA+VKE+LRL P  PL  PR   +D  +GGY + KG +  +NL KI RDP+ W  
Sbjct  382   KLVYLQAIVKETLRLNPIAPLSGPRQFIQDSILGGYHISKGTRLILNLTKIQRDPRVWLN  441

Query  424   PDKFMPKRFLNREAGGADNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFS  245
             P +F P RFL       D   K FE  PFG GRR C G+ +ALQ+ HLT+A  +  F  S
Sbjct  442   PMEFQPDRFLTTHK-DVDVRGKHFELTPFGGGRRICPGIVFALQVLHLTLANFLHRFQLS  500

Query  244   TPGNVELDMEEGFGVTLPRATPLQLVVTPRL  152
             TP +  +DM E FG+T  ++TPL+++++PRL
Sbjct  501   TPSDAPVDMSEDFGLTNIKSTPLEVLISPRL  531



>gb|KDO40894.1| hypothetical protein CISIN_1g009786mg [Citrus sinensis]
Length=525

 Score =   371 bits (953),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 190/498 (38%), Positives = 293/498 (59%), Gaps = 29/498 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L    +   R LG MADK+GP+F ++ G+    ++   E AK+C TTH++  A
Sbjct  54    VIGHLHLLGGP-EPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMAKECLTTHDKVFA  112

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    E LGYN++MF FS   +YWR  RK    ELLSN +L+K+K +R  EL+T +K
Sbjct  113   SRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLEKLKQVREYELKTCLK  172

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY     +   NK  +V M  W+A    N   R++        VG      DS E+KE 
Sbjct  173   ELYQLWDNNKSTNKMLLVEMKRWLADSIRNVVLRMI--------VGKGCNSMDSEEWKE-  223

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                  +   F  +SG FV+ DA P    +W D  G  R+MK+  K++D ++Q W+++H  
Sbjct  224   -----LLTRFFEMSGKFVVSDALPF--LRWLDIGGDERSMKKIAKELDVVVQGWLEEHKM  276

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTI---DKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             +R            + D +++MLS +   D+ + +     ++    G    +I+  +DTT
Sbjct  277   KRD----SQEMNQEEEDFMYVMLSILGDTDQYYGRDVDTINKAICLG----LILAATDTT  328

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                + W +SLL+ + D++ + R E++ QVGT+R V +SD+K L YLQA++KE++RLYP  
Sbjct  329   AVTLTWIISLLLNHHDILNKARNELDIQVGTKRQVNESDIKNLVYLQAILKEAMRLYPAA  388

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PLL+P  + ++C + GY++P G Q  +N+WK+ RDP  W EP KF P+RFL R     D 
Sbjct  389   PLLIPHESIEECTVSGYNVPSGTQLFINVWKLQRDPHVWEEPCKFQPERFLTRHK-DTDV  447

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + FE +PF  GRR C G+++ALQ+   T+A L+ GF+ +TP N  LDM EG G+T+ +
Sbjct  448   RGQNFELLPFSSGRRMCPGVSFALQVMQFTLASLLHGFDIATPSNEPLDMGEGLGLTVEK  507

Query  187   ATPLQLVVTPRLPPNFYG  134
             +TPL+++V PRL  + YG
Sbjct  508   STPLEVLVAPRLSASLYG  525



>gb|KHG29695.1| Cytochrome P450 [Gossypium arboreum]
Length=522

 Score =   371 bits (952),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 197/494 (40%), Positives = 294/494 (60%), Gaps = 19/494 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+L    +     LG++ +K+GP +++R G+ P  ++   E AK+ FT ++  V+
Sbjct  47    IIGHLPLLGGP-KAPHEALGDLEEKYGPAYMIRIGVHPALVVNSSEVAKEIFTVNDMYVS  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+ EFA  EHLGYNYAMF FS    YWR MRK  + E+LSN ++D++K + +SE+E S+K
Sbjct  106   SRSEFAAAEHLGYNYAMFGFSPYGQYWREMRKITMLEVLSNHRIDQLKKVFVSEIEGSMK  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY       + +   +V M +  + LTLN   R VAG+RY       + ++D    KE 
Sbjct  166   LLYKTWAEKKDGSGKVLVEMKKHFSDLTLNVIMRTVAGKRYS-----VVAEEDQ---KEV  217

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                    R+F +L+GMFVL DA P    +W D  G+ + MK   K++D+I   W+D H  
Sbjct  218   LRYRKALRDFFHLTGMFVLGDAVPF--LRWLDIGGYEKRMKITAKELDEISGGWLDDH--  273

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
              R+ G         + D + +M S +    + G  Y      K T+ +MI+ GSDTT   
Sbjct  274   -RKSGRWDENK--KEKDFMDVMNSVLKGASLAG--YDADTINKATSLNMILAGSDTTTVT  328

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             ++W LSL++    ++K+ +EE++  +G +R+V ++D+ KL Y+QA+VKE+LRLYP  PL 
Sbjct  329   LIWGLSLMLNKPHILKKAQEELDTHIGKDRFVNETDIGKLVYIQAIVKETLRLYPPAPLS  388

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR  S+ C IGGYD+PKG +  +NL KI RDPK WPEP +F P+RFL       D    
Sbjct  389   APRELSETCSIGGYDIPKGTRLIINLHKIQRDPKKWPEPSEFKPERFLTTHK-DVDVRGL  447

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRRSC G ++AL +  LT++  +  F+FSTP N  +D+    G+T  ++TP
Sbjct  448   HFELMPFGSGRRSCPGTSFALHMLFLTMSNFLHAFDFSTPSNGLIDLTGTAGLTNIKSTP  507

Query  178   LQLVVTPRLPPNFY  137
             L+ +V+PRL P  Y
Sbjct  508   LEALVSPRLAPELY  521



>gb|KCW58033.1| hypothetical protein EUGRSUZ_H00761 [Eucalyptus grandis]
Length=537

 Score =   372 bits (954),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 197/504 (39%), Positives = 306/504 (61%), Gaps = 26/504 (5%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSG----MTPIAMICGLEAAKDCFTTHER  1448
             IGH+ +L  +   L++TL  MAD  GP+          +T  A   G       FTTH++
Sbjct  43    IGHLHLLRGETP-LAKTLAAMADAQGPIPHWPRPWPPWLTRKARCSG------SFTTHDK  95

Query  1447  DVASKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELET  1268
             ++AS+ +   G HLGY  A F+F+    +WR MRK  + ELLS  +LD +KH++ SE++T
Sbjct  96    ELASRTKSKAGVHLGYGNAAFAFAEYGDFWREMRKITMLELLSIRRLDNLKHVQASEIDT  155

Query  1267  SIKELYLFVTASP---EPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIG---D  1106
              +K+L+     +    +   + VV + + +  LTLN   R++A +RY   +  + G   D
Sbjct  156   FVKDLHALCRTNAIDAQNGSSKVVVISQLLELLTLNIIIRMIASKRYFGLLSASTGSSTD  215

Query  1105  DDSTEYKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKIL  926
             DD    +EA  +  V +EF Y+SG   + +  P     W D  G V+ MKR  +++D+I+
Sbjct  216   DD----EEASHLRKVIKEFMYISGFPTVSELVPFT--GWTDCVGTVKTMKRVAREMDEIV  269

Query  925   QAWIDQHIERRQLGNAPAPAAGN-DLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMI  749
               W+++H  +R+ G+      G+   D I +MLS I ++ +  F ++ +  IK T  ++I
Sbjct  270   GKWVEEHKLKRE-GDQRGEVIGDVKEDFIDVMLSVIGEDGLAQFGHSPETLIKATVVNII  328

Query  748   IDGSDTTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKES  569
             + GSDTT  ++ W LSLL+ +  V+KR +EEI+ +VG ++WV+DSD+  L YLQA+VKE+
Sbjct  329   VAGSDTTSLNLTWVLSLLLNHKHVLKRAQEEIDLKVGKDKWVQDSDIGSLHYLQAIVKET  388

Query  568   LRLYPTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNR  389
             LRLYP  PL +P     DC + GY +PKG +  VN+WK+ RDP+ W +P+KF+P+RFL  
Sbjct  389   LRLYPPGPLSIPHEARADCNVRGYLIPKGTRIFVNVWKLHRDPQVWSDPEKFLPERFLTN  448

Query  388   EAGGADNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEG  209
              + G D   + FE++PFG GRR C G A+AL+ +HLT+ARL+QGF+ +   +  +DM EG
Sbjct  449   HS-GVDASGQHFEFIPFGSGRRICPGAAFALRATHLTLARLLQGFDLAISSDELVDMTEG  507

Query  208   FGVTLPRATPLQLVVTPRLPPNFY  137
              G+ LP+ATPL++V+ PRLP   Y
Sbjct  508   IGLNLPKATPLRVVLNPRLPSMLY  531



>ref|XP_006435903.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
 gb|ESR49143.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
Length=528

 Score =   371 bits (953),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 195/499 (39%), Positives = 291/499 (58%), Gaps = 29/499 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ IL   ++   R LG MADK+GP+F ++ G+    ++   E AK+CFTT+++  A
Sbjct  55    LIGHLHILRG-SEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFTTNDKAFA  113

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
              +P+    E LGYN+ +  F+    YWR  RK    ELLSN +L+K+KH+R SE++ SI+
Sbjct  114   GRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRESEVKASIQ  173

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY    +S    K   V M  W+    L+   RI+AG+RY            S E  + 
Sbjct  174   RLYKNCISSSSSRKVVSVEMIHWLEGTVLDIILRIIAGKRYT---------SQSQEVNDW  224

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q+ I    +F  LSG FV+ DA P    +W D  G+ R M +  K  D ILQ W+D+H  
Sbjct  225   QQQIT---KFTALSGQFVVSDALPF--LRWLDIGGYERLMSKTAKYFDIILQEWLDEHKM  279

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +R  G+A       D D ++++LS +D    +         IK    ++I+  +DT+   
Sbjct  280   KRDSGDAKG-----DEDFMYVLLSLLDDNAEQLPDRDADAVIKAICVTLIVAAADTSVVT  334

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WA++LLV   DV+K+ ++E++ QVGTER V +SD + L YLQA++KE++RLYP  PLL
Sbjct  335   LTWAIALLVNNRDVLKKAQDELDIQVGTERPVNESDARNLVYLQAIIKETMRLYPAAPLL  394

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNR----EAGGAD  371
             +P    ++C + GY +P G Q  VN WKI RDP  W EP +F P+RFL R    + GG D
Sbjct  395   LPHECIEECIVNGYHVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGGQD  454

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                  FE +PFG GRR C  +++ LQ+  L +A L+ GF+F+TP +  +DM E  G+T+ 
Sbjct  455   -----FELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIA  509

Query  190   RATPLQLVVTPRLPPNFYG  134
             +ATPL+++V+PR   + YG
Sbjct  510   KATPLEVLVSPRHSASLYG  528



>ref|XP_007017417.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
 gb|EOY14642.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
Length=528

 Score =   371 bits (952),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 195/495 (39%), Positives = 299/495 (60%), Gaps = 19/495 (4%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVAS  1436
             +GH+ +L   ++     LG++AD +GP+F +R G+    ++   E AK+CFTT+++  A+
Sbjct  51    LGHLHLLGG-SKPAHVVLGDLADTYGPIFTIRLGVRLTLVVSNWEIAKECFTTNDKAFAN  109

Query  1435  KPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKE  1256
             +P     E LGYNYAMF FS    YWR +RK V  E+LSN +L+K+KHIR SE+ TSIKE
Sbjct  110   RPRTLAAELLGYNYAMFGFSPYGPYWRQIRKIVTLEVLSNHRLEKLKHIRESEVRTSIKE  169

Query  1255  LYLFVT--ASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             LY       S   +   +V M  W   L +N   ++V G+RY  +   + G D++   ++
Sbjct  170   LYKLGVEGVSNSSSGKVLVEMKRWFWTLNINMVFKMVVGKRYS-EAETSHGKDENDRRRK  228

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             A       R+F  L+G F + D+ P    +W D  GH +AMK+  K++D IL+ W+++H 
Sbjct  229   A------LRDFFELTGTFTVGDSLPF--LRWLDLGGHEKAMKKTAKELDHILEEWLEEHK  280

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             ++R  GNA +     + D + +MLS ++ +  +   Y      K T  S+I+  SDTT  
Sbjct  281   QKRNSGNAES-----EHDFMGMMLSLLN-DAAELPSYDADTINKATCLSLILAASDTTMV  334

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WALSLL+   + +K+ +EE++  VG ++ VE+SD+KKL YLQA++KE+LRLYP  PL
Sbjct  335   TLTWALSLLLNNRNALKKAQEELDIHVGRDKLVEESDIKKLVYLQAIIKETLRLYPAAPL  394

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
              +P  + +DC + GY +P G +  +NL+KI RDP  W +P +F P+RFL       D   
Sbjct  395   SVPHESMEDCVVSGYHIPAGTRLLINLYKIHRDPHAWSDPCEFQPERFLTTYK-DFDVRG  453

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRR C G++ ALQ+  LT+A L+QGF   TP +  +DM E  G+T  + +
Sbjct  454   QNFELIPFGSGRRMCPGVSLALQVLELTLANLLQGFELGTPLDEPVDMGEAIGITNLKVS  513

Query  181   PLQLVVTPRLPPNFY  137
             PL++++TPRLP   Y
Sbjct  514   PLEVLITPRLPAVCY  528



>gb|KDO40892.1| hypothetical protein CISIN_1g009347mg [Citrus sinensis]
Length=537

 Score =   371 bits (953),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 194/503 (39%), Positives = 300/503 (60%), Gaps = 23/503 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L      L R LG+MADK+GP+F +R G+    ++   E AK+C TTH+R  A
Sbjct  50    VIGHLHLLGRFP--LHRVLGDMADKYGPIFTIRMGVHRALVVSNWEMAKECLTTHDRVFA  107

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+  V E LG+N++MF FS    +WR +RK    ELLSN +L+K+KH+R  E++T +K
Sbjct  108   SRPKALVAEILGFNFSMFGFSPYGPHWRQIRKIATLELLSNHRLEKLKHVREGEVKTCLK  167

Query  1258  ELYLF-------VTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDD  1100
             ELY F        ++    NK  +V M++W   +TLN   R+  G+R       +   +D
Sbjct  168   ELYDFWERTNNYKSSDHNNNKKVLVEMNKWFEDVTLNAILRVTVGQR----CNSSSSQED  223

Query  1099  STEYKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQA  920
             +      +E +  F  F   SG FV+ D+ P    +WFD  G  RAMK+N +++D + Q 
Sbjct  224   TDHEGAWKEELTKFFAF---SGKFVVSDSLPF--LRWFDIGGDERAMKKNARELDVLAQG  278

Query  919   WIDQHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAI-KGTTQSMIID  743
             W+D+H  +R+ G       G++ D + +MLS + ++  +  P      I K T  ++I+ 
Sbjct  279   WLDEHKRKRESGQM-INKEGHE-DFMDVMLSIL-RDDAQQLPGDDADTINKATCLALILA  335

Query  742   GSDTTGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLR  563
              SDT+   + W LSLL+ + DV+K+ + E++  +G  R V + D+K L YLQA++KE++R
Sbjct  336   ASDTSKITLTWILSLLLNHRDVLKKAQNELDVHIGKRRQVNELDIKNLVYLQAIIKEAMR  395

Query  562   LYPTVPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREA  383
             LYP  PL  P  +++DC +  Y +P G    VN+WKI RDP+ WPEP KF P+RFL    
Sbjct  396   LYPAGPLAAPHASTEDCTVNDYFVPAGTVLYVNVWKIHRDPRVWPEPYKFKPERFLTTHK  455

Query  382   GGADNPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFG  203
                D   + FE +PF  GRR C G ++A+ ++HLT+A L+ GF+F TP +  +DM EG  
Sbjct  456   -HIDVRGQNFELLPFSSGRRMCPGPSFAIPVTHLTLATLLHGFDFETPLDEPVDMSEGMS  514

Query  202   VTLPRATPLQLVVTPRLPPNFYG  134
             +TL + TP+++++TPRL  + YG
Sbjct  515   LTLVKTTPVKVLITPRLSASLYG  537



>ref|XP_003548652.1| PREDICTED: cytochrome P450 82C4-like [Glycine max]
Length=521

 Score =   370 bits (951),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 200/496 (40%), Positives = 307/496 (62%), Gaps = 24/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L ++   L+R    +ADK+GP+F +  G  P  +IC  EA K+CFTT+++ +A
Sbjct  47    LIGHLHLLGAKTP-LARIFASLADKYGPIFQIHLGAYPALVICNQEAIKECFTTNDKVLA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+ + G HL YN+A F F+   +YW  +RK  + ELLS  +L+ ++ +  SE++T I+
Sbjct  106   SRPKSSHGVHLSYNFAGFGFAPYGSYWIKLRKLTMLELLSARRLEFLRPVYESEIDTLIR  165

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +L++++    +      V + EW+ +LT N   +++AG+RY       + D D     EA
Sbjct  166   DLWMYLGGKSD----VKVTISEWLERLTFNMITKMIAGKRY----FSYLQDVDDV---EA  214

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHV-RAMKRNNKKVDKILQAWIDQHI  902
               ++ + +EF ++SG FVL D  P  L  W    G V + MKR  K +D ++  W+++H+
Sbjct  215   HGIVKLIKEFMHISGEFVLSDLIP--LLGWLGVHGTVLKNMKRIAKDLDTLVGGWVEEHM  272

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +   L N     +    D I +MLS I+ + V G  +T    IK    ++++ GSDTT T
Sbjct  273   KSDTLTN----KSWEKHDFIDVMLSVIEDDSVSG--HTRDTIIKANVMNLMLAGSDTTST  326

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTE-RWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
              M W L++L+K    +KR +EEI+ QVG E R VE  D+K L YLQA+VKE+LRLYP  P
Sbjct  327   TMTWTLAMLMKNPHALKRAQEEIDHQVGRERRRVEARDIKDLIYLQAIVKETLRLYPPGP  386

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             +L+P    +DC I GY +PKG +   N+WK+ RDP  W EP+KF P+RF++ E G  D  
Sbjct  387   VLVPHEAREDCNIQGYHVPKGTRVFANVWKLHRDPSLWSEPEKFSPERFIS-ENGELDE-  444

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
             +  FEY+PFG GRR+C G  +A Q+  LT++RL+QGF+   P +  +D+EEG G+TLP+ 
Sbjct  445   VHHFEYLPFGSGRRACPGSTFATQVCLLTLSRLLQGFDLHVPMDEPVDLEEGLGITLPKM  504

Query  184   TPLQLVVTPRLPPNFY  137
              PLQ+V++PRLP  FY
Sbjct  505   NPLQIVLSPRLPSEFY  520



>ref|XP_008464766.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=521

 Score =   370 bits (950),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 195/498 (39%), Positives = 296/498 (59%), Gaps = 32/498 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L S  +    TL ++AD +GP+F ++ GM+   ++   E AK+CFTT++R  A
Sbjct  51    VIGHLHLL-SATEPAHITLAKLADTYGPIFTLKLGMSKALVVSSWEIAKECFTTNDRIFA  109

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    + LGYNY M   S    YWR +RK    ELL+N +L + +HIR  E++TSIK
Sbjct  110   SRPKLVASKLLGYNYNMLGLSPYGPYWRHIRKLATLELLTNRRLHQFQHIREFEVQTSIK  169

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             +LY     S   NK A+V M+ W   +TLNT  RIV G+++   + G+   D +  Y+ A
Sbjct  170   KLY----ESCIRNKKALVEMNTWFGDITLNTIFRIVVGKKFSIAMDGSA--DRNEVYRTA  223

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                    REF    G+FV  D+FP    KWFD  GH +AMK+  K +D++   W+ +H +
Sbjct  224   ------LREFFEWFGVFVPSDSFPF--LKWFDLGGHEKAMKKTAKILDEVFDKWLQEHRQ  275

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFP-YTHQMAIKGTTQSMIIDGSDTTGT  722
             RR+   +       + D + ++LS +     + FP Y     IK +   +I+ G DTT  
Sbjct  276   RRKFEES-------ENDFMDVLLSNVKD--AEQFPNYDADTVIKSSCLGLILAGFDTTTV  326

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              M+WALSLL+   + +KR + E++ Q+G  + V++SD+  L+YL+A+VKE+LRLYP  PL
Sbjct  327   TMIWALSLLLNNEEALKRAQLELDEQIGRHKQVKESDIVNLKYLRAIVKETLRLYPAGPL  386

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAG---GAD  371
              +P  +++DCKI GY +P G +  VN+ K+ RDP+ W +P +F P+RFL  E     G  
Sbjct  387   GVPHESTEDCKIAGYHIPAGTRLMVNIQKLQRDPREWKDPCEFRPERFLTSEKDFDVGGK  446

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
             NP    + +PFG GRR C  +++ALQI HLT+A  + GF    P    +DMEE  G+T  
Sbjct  447   NP----KLIPFGTGRRMCPAVSFALQIMHLTLANFLHGFEIERPSQDLIDMEESAGMTSI  502

Query  190   RATPLQLVVTPRLPPNFY  137
             +  PL+++++PRLPP  Y
Sbjct  503   KKEPLRVIISPRLPPQLY  520



>ref|XP_009336438.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   370 bits (950),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 191/479 (40%), Positives = 279/479 (58%), Gaps = 19/479 (4%)
 Frame = -1

Query  1564  LGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVASKPEFAVGEHLGYNYAMF  1385
             LG MADK+GP+F VR G+ P  ++   E AK+C+TT++  + S+P+  V +H+ YNYAMF
Sbjct  70    LGAMADKYGPIFTVRLGVQPSLVVSSSEIAKECYTTNDLSILSRPKMVVVDHVSYNYAMF  129

Query  1384  SFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKELYLFVTASPEPNK--AA  1211
              F     YWR +RK V  ELLS  K++ +KH+R+SE+ T +KEL+   +A  +       
Sbjct  130   GFGPPGPYWREIRKIVTLELLSVRKVELLKHVRVSEVATFLKELHQLWSAKKKEGSKDGV  189

Query  1210  VVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQEMINVFREFQYLSGM  1031
             VV + +W A + LN    IVAG+RY          D   E KEA+ +    REF    GM
Sbjct  190   VVELKQWFADMMLNVILTIVAGKRYSVA-------DAGDEKKEARRVQTALREFFDYLGM  242

Query  1030  FVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIERRQLGNAPAPAAGNDL  851
             F+L DA P    +W D+ GH +AMK++  ++  I+  W+++H +RR  G+A       + 
Sbjct  243   FLLGDAVPY--LRWLDWGGHEKAMKKSATEMHAIIAEWVEEHKQRRAKGDAKG-----EQ  295

Query  850   DLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTHMVWALSLLVKYGDVMK  671
             D I  +LS ++   +  F        K T+ ++I  GSDTT   M WA+SLL+    VMK
Sbjct  296   DFIDALLSVLNGADLGSF--DADTVTKATSLTVIAGGSDTTMVAMTWAISLLLNNPHVMK  353

Query  670   RCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLLMPRMTSKDCKIGGYDL  491
             +   E++A++G +R V + D+  L Y+QA+VKE+LRLYP  PL  PR+ ++DC I GY +
Sbjct  354   KALNELDAKIGKQRVVSEEDISNLVYIQAIVKETLRLYPGGPLSGPRIFTEDCTIAGYHI  413

Query  490   PKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLKRFEYVPFGCGRRSCVG  311
              KG +F  N WKI  DPK WPEP +F P+RFL       D     F+++PF  GRRSC G
Sbjct  414   QKGTRFIPNFWKIQTDPKNWPEPFEFKPERFLTTHK-DVDLKGHHFQFIPFSSGRRSCPG  472

Query  310   MAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATPLQLVVTPRLPPNFYG  134
             + + LQ+   T+A  +  F  S P +  +DM E FG+T  +A PL +++ PRL    YG
Sbjct  473   LVFGLQLVQFTLASFLHAFEISNPSSAPIDMTESFGMTNLKAAPLNVLIKPRLSFELYG  531



>ref|XP_009364766.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   370 bits (950),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 191/479 (40%), Positives = 278/479 (58%), Gaps = 19/479 (4%)
 Frame = -1

Query  1564  LGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVASKPEFAVGEHLGYNYAMF  1385
             LG MADK+GP+F VR G+ P  ++   E AK+C+TT++  + S+P+  V +H+ YNYAMF
Sbjct  70    LGAMADKYGPIFTVRLGVQPSLVVSSSEIAKECYTTNDLSILSRPKMVVVDHVSYNYAMF  129

Query  1384  SFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKELYLFVTASPEPNK--AA  1211
              F     YWR +RK V  ELLS  K++ +KH+R+SE+ T +KEL+   +A  +       
Sbjct  130   GFGPPGPYWREIRKIVTLELLSVRKVELLKHVRVSEVATFLKELHQLWSAKKKEGSKDGV  189

Query  1210  VVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQEMINVFREFQYLSGM  1031
             VV + +W A + LN    IVAG+RY          D   E KEA+ +    REF    GM
Sbjct  190   VVELKQWFADMMLNVILTIVAGKRYSVA-------DAGDEKKEARRVQTALREFFDYLGM  242

Query  1030  FVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIERRQLGNAPAPAAGNDL  851
             F+L DA P    +W D+ GH +AMK++  ++  I+  W+++H +RR  G+A       + 
Sbjct  243   FLLGDAVPY--LRWLDWGGHEKAMKKSATEMHAIIAEWVEEHKQRRAKGDAKG-----EQ  295

Query  850   DLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTHMVWALSLLVKYGDVMK  671
             D I  +LS +D   +  F        K T+ ++I  GSDTT   M WA+SLL+    VMK
Sbjct  296   DFIDALLSVLDGADLGSF--DADTVTKATSLTVIAGGSDTTMVAMTWAISLLLNNPHVMK  353

Query  670   RCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLLMPRMTSKDCKIGGYDL  491
             +   E++ ++G +R V + D+  L Y+QA+VKE+LRLYP  PL  PR+ ++DC I GY +
Sbjct  354   KALNELDTKIGKQRVVSEEDISNLVYIQAIVKETLRLYPGGPLSGPRIFTEDCTIAGYHI  413

Query  490   PKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLKRFEYVPFGCGRRSCVG  311
              KG +F  N WKI  DPK WPEP +F P+RFL       D     F+++PF  GRRSC G
Sbjct  414   QKGTRFIPNFWKIQTDPKNWPEPFEFKPERFLTTHK-DVDLKGHHFQFIPFSSGRRSCPG  472

Query  310   MAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATPLQLVVTPRLPPNFYG  134
             + + LQ+   T+A  +  F  S P +  +DM E FG+T  +A PL +++ PRL    YG
Sbjct  473   LVFGLQLVQFTLASFLHAFEISNPSSAPIDMTESFGMTNLKAAPLNVLIKPRLSFELYG  531



>ref|XP_003519977.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=525

 Score =   370 bits (949),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 192/496 (39%), Positives = 285/496 (57%), Gaps = 22/496 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I+GH+P+L +++      LG +AD HGPLF ++ G     ++   E AK+CFTT++  V+
Sbjct  47    ILGHLPLL-ARSPTTHHLLGAIADDHGPLFTIKLGTVKALVVSNWETAKECFTTNDVAVS  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
              +P     EH+ YN AM  F+    +WR MRK + S  LS+ ++D + H+R+SE+ TS+K
Sbjct  106   YRPYVVATEHMTYNVAMLGFAPYGPFWRDMRKNIASAFLSDHRIDTLSHVRVSEVRTSLK  165

Query  1258  ELYLFVTASPEPNKAAVVA--MDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             ELY   T   +  K+  +A  M EW+ +L+ N   R+VAG+RY        GD    +  
Sbjct  166   ELYSKWTRGTDGGKSDFLAVEMKEWLKELSFNVVLRMVAGKRY-------FGDTAVVDED  218

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EAQ  +   RE+  L G+F + DA P    +W DF+ H +AMK N K++D ++  W+++H
Sbjct  219   EAQRCLKALREYMRLLGVFAVADAVPW--LRWLDFK-HEKAMKENFKELDVVVTEWLEEH  275

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
               ++ L        GN  DLI +MLS I    + GF       IK T  +MI+ G+DT+ 
Sbjct  276   KRKKDLN------GGNSGDLIDVMLSMIGGTTIHGF--DADTVIKATAMAMILGGTDTSS  327

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
                +W L LL+     +++ +EEI+  +G ER V + D+ KL YLQAV+KESLRLYP  P
Sbjct  328   ATNIWTLCLLLNNPHTLEKVKEEIDTHIGKERIVTEEDISKLVYLQAVLKESLRLYPATP  387

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             L  PR   +DCK+G Y + KG +   NLWKI  DP  WPEP +F P+RFL       D  
Sbjct  388   LSGPREFREDCKVGEYHVKKGTRLITNLWKIQTDPSIWPEPLEFKPERFLTTHK-DIDVK  446

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRR C G+++ L+ S LT+A  +  F  S   +  +DM     +T  + 
Sbjct  447   GRHFELIPFGSGRRICPGISFGLRTSLLTLANFLHCFEVSKTSSEPIDMTAAVEITNVKV  506

Query  184   TPLQLVVTPRLPPNFY  137
             TPL++++ PRL P+ Y
Sbjct  507   TPLEVLIKPRLSPSLY  522



>ref|XP_003523886.1| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=526

 Score =   370 bits (949),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 189/490 (39%), Positives = 292/490 (60%), Gaps = 19/490 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L    Q    TLG +ADK+GP+F +R G+    ++   E AK+CFTT +  ++
Sbjct  45    LIGHLHLLGGSTQPPYITLGSLADKYGPIFSMRIGVHHAVVVSSWELAKECFTTLDVVIS  104

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+F   + LGYNYA F F+    +WRVMRK   SELLS  + + ++ IR SE++ S+K
Sbjct  105   SRPKFTAAKILGYNYANFGFTPYGDFWRVMRKIAASELLSTARFELLQRIRDSEMQISLK  164

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY         +   +V M +W   + LN   R+++G+RY  K      +DD    ++ 
Sbjct  165   ELYRTWVDKRGVSDDLLVEMKQWFGDVNLNVILRMISGKRYSAK-----SEDD---LQQV  216

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             + +  VFREF  L+G+FV+ DA P     W D  G V+ MK+   ++D I+  W+++H  
Sbjct  217   RRIRRVFREFFRLTGLFVVGDAIPF--LGWLDLGGEVKEMKKTAIEMDNIVSEWLEEH--  272

Query  898   RRQLGNAPAPAAGND-LDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             ++Q+ ++       D +D++  +L  +D   + G+ +     IK T   +I   +DTT  
Sbjct  273   KQQITDSGDTKTEQDFIDVLLFVLKGVD---LAGYDF--DTVIKATCTMLIAGATDTTAV  327

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              M WALSLL+     +K+ ++E++  VG ER V +SD+ KL YLQAVVKE+LRLYP  P 
Sbjct  328   TMTWALSLLLNNHHALKKVKDELDEHVGKERLVNESDINKLVYLQAVVKETLRLYPAGPF  387

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
               PR  +++C +GGY +  G +F +N+WK+ RDP+ W  P +F P+RFLN      D   
Sbjct  388   SGPREFTENCTLGGYKIEAGTRFMLNIWKLHRDPRVWSNPLEFQPERFLNTHK-NVDVKG  446

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRRSC G+++ LQ+SHL +A  +Q F  +TP N ++DM   FG+T  + T
Sbjct  447   QHFELLPFGGGRRSCPGISFGLQMSHLALASFLQAFEITTPSNAQVDMSATFGLTNMKTT  506

Query  181   PLQLVVTPRL  152
             PL+++V P L
Sbjct  507   PLEVLVRPVL  516



>gb|KHN00733.1| Cytochrome P450 82A4 [Glycine soja]
Length=523

 Score =   369 bits (948),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 193/496 (39%), Positives = 283/496 (57%), Gaps = 24/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I+GH+P+L      L   LG +AD HGPLF ++ G     ++   E AK+CFTT++  V+
Sbjct  47    ILGHLPLLARSTPHL---LGAIADDHGPLFTIKLGTVKALVVSNWETAKECFTTNDVAVS  103

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
              +P     EH+ YN AM  F+    +WR MRK + S  LS+ ++D + H+R+SE+ TS+K
Sbjct  104   YRPYVVATEHMTYNVAMLGFAPYGPFWRDMRKNIASAFLSDHRIDTLSHVRVSEVRTSLK  163

Query  1258  ELYLFVTASPEPNKAAVVA--MDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             ELY   T   +  K+  +A  M EW+ +L+ N   R+VAG+RY        GD    +  
Sbjct  164   ELYSKWTRGTDGGKSDFLAVEMKEWLKELSFNVVLRMVAGKRY-------FGDTAVVDED  216

Query  1084  EAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQH  905
             EAQ  +   RE+  L G+F + DA P    +W DF+ H +AMK N K++D ++  W+++H
Sbjct  217   EAQRCLKALREYMRLLGVFAVADAVPW--LRWLDFK-HEKAMKENFKELDVVVTEWLEEH  273

Query  904   IERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTG  725
               ++ L        GN  DLI +MLS I    + GF       IK T  +MI+ G+DT+ 
Sbjct  274   KRKKDLN------GGNSGDLIDVMLSMIGGTTIHGF--DADTVIKATAMAMILGGTDTSS  325

Query  724   THMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVP  545
                +W L LL+     +++ +EEI+  +G ER V + D+ KL YLQAV+KESLRLYP  P
Sbjct  326   ATNIWTLCLLLNNPHTLEKVKEEIDTHIGKERIVTEEDISKLVYLQAVLKESLRLYPATP  385

Query  544   LLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNP  365
             L  PR   +DCK+G Y + KG +   NLWKI  DP  WPEP +F P+RFL       D  
Sbjct  386   LSGPREFREDCKVGEYHVKKGTRLITNLWKIQTDPSIWPEPLEFKPERFLTTHK-DIDVK  444

Query  364   LKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRA  185
              + FE +PFG GRR C G+++ L+ S LT+A  +  F  S   +  +DM     +T  + 
Sbjct  445   GRHFELIPFGSGRRICPGISFGLRTSLLTLANFLHCFEVSKTSSEPIDMTAAVEITNVKV  504

Query  184   TPLQLVVTPRLPPNFY  137
             TPL++++ PRL P+ Y
Sbjct  505   TPLEVLIKPRLSPSLY  520



>ref|XP_008378426.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=523

 Score =   369 bits (948),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 196/495 (40%), Positives = 290/495 (59%), Gaps = 19/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             ++GHI +L +  ++    LG + DK+GP+F +  G+    ++   EAAK+CFTT++  V+
Sbjct  48    LLGHIHLL-AGPELPHIVLGGLVDKYGPVFSINVGLNSALVVNCWEAAKECFTTNDLAVS  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    EHL YN A+ ++S    YWR +RK    ELLSN +L+ +KH+R+SE+E S+K
Sbjct  107   SRPKIVGVEHLSYNGALVAYSPYGPYWREIRKITTHELLSNSRLELLKHVRVSEVEMSLK  166

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY         +   +V M EW   LTLN   R+VAG+R+   + G++ D+     K+A
Sbjct  167   ELYKLWIKRKGGSGEILVEMKEWFGDLTLNVVFRMVAGKRFFNVMNGSLSDE-----KKA  221

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +   NV R+  +  G+FVL DA P    +W D  GH +AM+R  K++D I+  W+++H +
Sbjct  222   RRCQNVIRDMFHYIGLFVLGDAVPW--LRWLDIGGHEKAMRRTAKELDSIVMEWLEEHKQ  279

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR          G + D + +MLS ++   V GF        K T  ++I  GSDT    
Sbjct  280   RR--------TQGQEQDFMDVMLSVLNGADVVGF--DADTVNKATCLAVIAGGSDTPMVT  329

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             M WALSLL+     + + +EE++  VG  R V +SD+  LEYLQA+ KE+LR+YP  PL 
Sbjct  330   MTWALSLLLNNRHTLVKAQEELDKHVGRGRLVNESDISNLEYLQAIFKETLRMYPPAPLS  389

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
               R  S+DC IGGY +PK     +NLWKI  DP+ W +P +F P+RFL       D    
Sbjct  390   GIRKFSEDCTIGGYHVPKDTWLMMNLWKIHSDPRVWVDPMEFKPERFLTTHK-DIDVKGH  448

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRR C GM +ALQ+  LT+A  +  ++ STP N  +DM    G++  ++TP
Sbjct  449   NFELIPFGGGRRICPGMGFALQVIQLTLASFLHAYDISTPENAAVDMTGSLGLSNVKSTP  508

Query  178   LQLVVTPRLPPNFYG  134
             L+++V PRL  N YG
Sbjct  509   LRVLVKPRLSENIYG  523



>gb|KDP38427.1| hypothetical protein JCGZ_04352 [Jatropha curcas]
Length=520

 Score =   369 bits (947),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 192/494 (39%), Positives = 297/494 (60%), Gaps = 22/494 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+P+L + +++L  T G +AD++GP+F ++ G+    ++   E AK+ FTT++  V+
Sbjct  49    IIGHLPLL-AGSKLLHITFGSLADRYGPIFTMQIGIHQAVVVSSGELAKELFTTNDMAVS  107

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
              +P F   ++LGY+  MF+F+    YWR MRK +  +LLSN +++ +KH+R+SE+ET +K
Sbjct  108   ERPNFTAFKYLGYDGVMFAFAPYGDYWREMRKIISLKLLSNHQIELLKHVRLSEIETLLK  167

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY   T     +   +V +++W  +L LN   R+V G+R     GG           EA
Sbjct  168   ELYKLWTEKKNGSGHVLVDLNKWFGELGLNVILRMVVGKRCS---GGG----------EA  214

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             +      REF +  GMFVL+DA P     W D  GH + MK   K+++ ++   +++H  
Sbjct  215   EHFRKTMREFFHYLGMFVLRDAIPF--LGWLDAGGHEKGMKTTAKEMNCLVSELLEEH--  270

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             RR+ G+A    A  + D +  MLS ++++   G  Y   M IK    ++I  GSDT+   
Sbjct  271   RRKRGSA-GKVATKEQDFMDSMLSVLEEKDFAG--YDSDMIIKSACLNLIAGGSDTSTVT  327

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + W +SLL+     +++ +EE++  VG ER V + D+ KL YLQA++KESLRLYP  PL 
Sbjct  328   LTWTISLLLNNKQALEKAQEELDRLVGRERQVNEFDISKLIYLQAIIKESLRLYPPAPLS  387

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR+T ++C IGG  + KG +  +N+WKI RDPK WP+P +F P+RFL       D   +
Sbjct  388   APRVTRENCTIGGCHIKKGTRLIINVWKIHRDPKNWPDPLQFTPERFLTSHK-DIDVRGQ  446

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE +PFG GRR+C G A+ LQ+ H+ +AR +Q F  S P    +DM E  G+T  +ATP
Sbjct  447   NFELIPFGSGRRACPGTAFGLQMVHIALARFLQAFQISNPTTEPIDMTESPGLTNLKATP  506

Query  178   LQLVVTPRLPPNFY  137
             L+++++PRLPP  Y
Sbjct  507   LEVLLSPRLPPGLY  520



>ref|XP_003634362.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   369 bits (948),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 198/489 (40%), Positives = 285/489 (58%), Gaps = 17/489 (3%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L     +     G MADK+GP+F +R G+    ++   E AK+CFTTH+  +A
Sbjct  47    IIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWEMAKECFTTHDLALA  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    ++LGYNY+MF+FS   AYWR +RK    ELLSN +L+ +K++R+SE+ET +K
Sbjct  107   SRPQLVAAKYLGYNYSMFAFSPHGAYWREVRKIATLELLSNRRLELLKNVRISEVETCMK  166

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY     +       +V M +W   L+LN   ++V G+RY        G    ++ K A
Sbjct  167   ELYKLWAETKSEAGVVLVDMKQWFGHLSLNVILKMVVGKRY-------FGYAAESKEKGA  219

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q+     REF  L G+FV+ DA P     W D  GHV+AMK+  K++D I Q W+++H  
Sbjct  220   QQCQKAIREFFRLMGLFVVSDALP--FLGWLDVGGHVKAMKKTAKELDGIAQEWLEEHRR  277

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             R+  G A       D D + +MLS +         Y      K T   +I  G+DTT   
Sbjct  278   RKDSGEADG-----DQDFMDVMLSILGGRDTTD--YDADTINKATALILIGGGTDTTSGT  330

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WA+SLL+    ++++ +EE++A VG ER V + D+ KL YLQA+VKE+LRL PT PL 
Sbjct  331   LTWAISLLLNNPHILRKAQEELDAHVGKERIVNEMDISKLVYLQAIVKETLRLNPTAPLS  390

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR   +D  +GGY + KG +  +NL KI RDP+ W  P +F P RFL       D   K
Sbjct  391   GPRQFIQDSILGGYYISKGTRLILNLTKIQRDPRVWLNPMEFQPDRFLTTHK-DVDVRGK  449

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE  PFG GRR C G  +ALQ+ HLT+A  +  F  STP +  +DM E FG+T  ++TP
Sbjct  450   HFELTPFGGGRRICPGAIFALQVLHLTLANFLHRFQLSTPSDAPVDMSESFGLTNIKSTP  509

Query  178   LQLVVTPRL  152
             L+++++PRL
Sbjct  510   LEVLISPRL  518



>ref|XP_010092357.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXB51033.1| Cytochrome P450 82A3 [Morus notabilis]
Length=534

 Score =   369 bits (947),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 200/499 (40%), Positives = 288/499 (58%), Gaps = 18/499 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+   TL  +ADK GP+F VR G  P  ++   E AK+CFT ++  +A
Sbjct  50    IIGHLHLLGG-SQLPHITLANLADKCGPIFTVRIGSHPGLVVSSSEMAKECFTINDLALA  108

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +H+GYNYAMF  +    +WR +RK    +LLSN +L+ +KHIR+SE+ + +K
Sbjct  109   SRPNLLAAKHMGYNYAMFGLAPHGPFWREIRKIATVQLLSNRRLELLKHIRISEVASFVK  168

Query  1258  ELYLFVTASPEPNK----AAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTE  1091
             ELY   T     N      A V M +    L+LN   R+VAG+RY      ++  +D  +
Sbjct  169   ELYEHWTTKWNDNDHHSGQASVEMKQRFLDLSLNVILRMVAGKRY------SVDANDGGD  222

Query  1090  YKEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWID  911
              KEA+ +    +EF  L G+FV  DA P     W D  G  +AMK+  K +D I+  W++
Sbjct  223   VKEARLVQKEIKEFFKLLGLFVPGDAIPY--LGWLDLGGCEKAMKKTAKALDGIVGEWLE  280

Query  910   QHIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDT  731
             +H + R   N       +D   + +MLS +      GF       IK T  +MI  GSDT
Sbjct  281   EHKQNRAEMNNDEKKEQDDF--MDVMLSVLHGSDFGGF--DADTIIKATILNMIAGGSDT  336

Query  730   TGTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPT  551
                 + WA+SLL+    V+K+ +EE+E  VG  R V +SD+ KL Y+ A+VKE+LRLYP 
Sbjct  337   IPATLTWAVSLLLNNHHVLKKAQEELENNVGKNRVVSESDIGKLTYIFAIVKETLRLYPV  396

Query  550   VPLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGAD  371
              PL +P +  KDC IGGY + KG +   N+WKI  +P  WP+P +F P+RFL       D
Sbjct  397   APLSVPHVFLKDCTIGGYHVAKGTRLITNIWKIQTNPILWPDPFEFKPERFLTTNK-DVD  455

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                + FE +PFG GRR+C G ++ALQ+   T+A  +Q F+ STP N  +DM E FG+T  
Sbjct  456   IRGQHFELIPFGSGRRACPGTSFALQMVQFTLASFLQAFDISTPLNAPVDMTESFGLTNT  515

Query  190   RATPLQLVVTPRLPPNFYG  134
             +ATPL++++TPRLP   Y 
Sbjct  516   KATPLEVLITPRLPAELYA  534



>ref|XP_009336448.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   369 bits (946),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/481 (41%), Positives = 286/481 (59%), Gaps = 21/481 (4%)
 Frame = -1

Query  1567  TLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVASKPEFAVGEHLGYNYAM  1388
             TLG MADK+GP+F +R G+ P  +I   E AK+C+TT +  V S+P+  V +H+ YNYAM
Sbjct  64    TLGAMADKYGPIFTIRLGVHPSLVISSSEIAKECYTTKDLSVLSRPKMVVVDHVSYNYAM  123

Query  1387  FSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIKELY-LFVTASPEPNK-A  1214
             F F     YWR +RK V  ELLS  K++ +KH+R+SE+ T +KEL+ L+ T   E ++  
Sbjct  124   FGFGPPGPYWREIRKIVTLELLSVRKVELLKHVRVSEVATFLKELHELWSTKKKEGSEDR  183

Query  1213  AVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEAQEMINVFRE-FQYLS  1037
              VV + +W+  +TLN    +VAG+RY      A GD    E KEA+ +    RE F YL 
Sbjct  184   MVVELKQWLGDMTLNVILTMVAGKRYSV---AAAGD----EKKEARRVQTALRELFDYL-  235

Query  1036  GMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIERRQLGNAPAPAAGN  857
             GMF++ DA P    +W D+ GH +AMK+   ++  I+  W+++H +RR  G+A       
Sbjct  236   GMFLVGDAVPY--LRWLDWGGHEKAMKKGATEMHAIIAEWVEEHKQRRAKGDAKG-----  288

Query  856   DLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTHMVWALSLLVKYGDV  677
             + D I  +LS +D   +  F        + T+ ++I  G DTT   + WALSLL+    V
Sbjct  289   EQDFIDALLSVLDGADLGSF--DADTITRATSLNVIAGGGDTTMVTLTWALSLLLNNPHV  346

Query  676   MKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLLMPRMTSKDCKIGGY  497
             MK+   E++ ++G +R V + D+  L Y+QA+VKE+LRLYP  PL  PR+ ++DC I GY
Sbjct  347   MKKALNELDTKIGKQRVVSEEDISNLVYIQAIVKETLRLYPVGPLSGPRIFTEDCTIAGY  406

Query  496   DLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLKRFEYVPFGCGRRSC  317
              + KG +F  N WKI  DPK WPEP +F P+RFL       D   + F+++PF  GRRSC
Sbjct  407   HIRKGTRFIPNFWKIQTDPKNWPEPFEFKPERFLTTHK-DVDLKGQHFQFIPFSSGRRSC  465

Query  316   VGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATPLQLVVTPRLPPNFY  137
              G+A+ LQ+   T+A  +  F  S P +  +DM E FG+T  +A PL +++ PRL    Y
Sbjct  466   PGLAFGLQMVQFTLASFLHAFEISNPSSAPIDMTESFGMTNVKAAPLNVLIKPRLSSELY  525

Query  136   G  134
             G
Sbjct  526   G  526



>ref|NP_001240972.1| cytochrome P450 82A3 [Glycine max]
 sp|O49858.1|C82A3_SOYBN RecName: Full=Cytochrome P450 82A3; AltName: Full=Cytochrome 
P450 CP6 [Glycine max]
 emb|CAA71876.1| putative cytochrome P450 [Glycine max]
 gb|KHN13273.1| Cytochrome P450 82A3 [Glycine soja]
Length=527

 Score =   369 bits (946),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 190/495 (38%), Positives = 290/495 (59%), Gaps = 18/495 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             I+GH+ +LN  +Q   + LG +ADK+GPLF ++ GM P  ++   E +K+ FTT++  V+
Sbjct  47    ILGHLSLLNG-SQTPHKVLGALADKYGPLFTIKLGMKPALVLSNWEMSKELFTTNDLAVS  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    E + YN A    +    YWR +RK V  E LSN ++++  HIR+SE+ TSIK
Sbjct  106   SRPKLVAVEVMSYNQAFVGLAPYGPYWRELRKIVTFEFLSNRRIEQRNHIRVSEVRTSIK  165

Query  1258  ELY-LFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKE  1082
             EL+ ++   +   ++  +V + +W+A LT N   R+V G+RY F V    G D      +
Sbjct  166   ELFDIWSNGNKNESRYTLVDIKQWLAYLTFNMVVRMVVGKRY-FGVMHVEGKD------K  218

Query  1081  AQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHI  902
             AQ  +   REF  L G F + D  P    +W D  GH +AMK N K+VDK+L  W+++H 
Sbjct  219   AQRFMKNIREFMNLMGTFTVADGVPC--LRWLDLGGHEKAMKANAKEVDKLLSEWLEEHR  276

Query  901   ERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +++ LG        +D D + +M+S ++   +  F        K T+  +I+ G+D+T  
Sbjct  277   QKKLLGEN----VESDRDFMDVMISALNGAQIGAF--DADTICKATSLELILGGTDSTAV  330

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + WALSLL++    + + +EEI+ Q+G + ++ +SD+ KL YLQA+VKE+LRLYP  P 
Sbjct  331   TLTWALSLLLRNPLALGKAKEEIDMQIGKDEYIRESDISKLVYLQAIVKETLRLYPPAPF  390

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
               PR  +++C +GGY + KG +   NLWKI RDP  W +P +F P+RFL       D   
Sbjct  391   SSPREFTENCILGGYHIKKGTRLIHNLWKIHRDPSVWSDPLEFKPERFLTTHK-DVDLRG  449

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
               FE +PFG GRR C GM+  L + H T+A L+  F+   P    +DM E FG T  +AT
Sbjct  450   HNFELLPFGSGRRVCAGMSLGLNMVHFTLANLLHSFDILNPSAEPVDMTEFFGFTNTKAT  509

Query  181   PLQLVVTPRLPPNFY  137
             PL+++V PR  PN+Y
Sbjct  510   PLEILVKPRQSPNYY  524



>ref|XP_010106082.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07352.1| Cytochrome P450 82A3 [Morus notabilis]
Length=532

 Score =   368 bits (945),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 201/498 (40%), Positives = 286/498 (57%), Gaps = 18/498 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             IIGH+ +L   +Q+   TL  +ADK GP+F +R G     ++   E AK+CFT ++   A
Sbjct  50    IIGHLHLLGG-SQLPHITLANLADKWGPIFTIRIGSYRGLVVSSSEMAKECFTINDLASA  108

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P     +HLGY YAMF  +    +WR +RK    +LLSN +L+ +KHIR+SE+ + +K
Sbjct  109   SRPNLLAAKHLGYKYAMFGLAPHGPFWREIRKIATVQLLSNRRLELLKHIRISEVASFVK  168

Query  1258  ELYLFVTASPEPNK---AAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEY  1088
             ELY   T     N     A V M +  + LTLN   R+VAG+RY      +I  +D  + 
Sbjct  169   ELYEHWTTKWNDNDHSGQASVEMKQRFSDLTLNVILRMVAGKRY------SIDANDGGDV  222

Query  1087  KEAQEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             KEA+ +    +EF    G+FV  DA P     W D  G  +AMK+  K +D I+  W+++
Sbjct  223   KEARLVQKEIKEFLKHLGLFVPGDAIPY--LGWLDLGGCEKAMKKTAKALDGIVGEWLEE  280

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H + R   N        + D + +MLS +      GF       IK T  +MI  GSDTT
Sbjct  281   HKQNRAEMNNEEK---KEQDFMDVMLSVLHGSDFGGFDA--DTIIKATILNMIAGGSDTT  335

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                + WA+SLL+    V+K+ +EE+E  VG  R V +SD+ KL Y+ A+VKE+LRLYP  
Sbjct  336   ALTLTWAVSLLLNNHHVLKKAQEELENNVGKNRTVNESDIGKLTYIFAIVKETLRLYPVA  395

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL  PR+  +DC IGGY + KG +   N+WKI  DP  WP+P +F P+RFL       D 
Sbjct  396   PLSAPRVFLEDCTIGGYHVAKGTRLITNIWKIQTDPILWPDPFEFKPERFLTTNK-DVDV  454

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               + FE +PFG GRR+C G ++ALQ+   T+A  +Q F+ STP N  +DM E FG+T  +
Sbjct  455   RGQHFELIPFGSGRRACPGTSFALQMVQFTLASFLQAFDISTPLNALVDMTESFGLTNTK  514

Query  187   ATPLQLVVTPRLPPNFYG  134
             ATPL++++TPRLP   Y 
Sbjct  515   ATPLEVLITPRLPAELYA  532



>ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52500.1| cytochrome P450, putative [Ricinus communis]
Length=528

 Score =   368 bits (944),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 195/497 (39%), Positives = 282/497 (57%), Gaps = 19/497 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L    Q      G MADK+GP+F ++ G+ P  +    E AK+CFTT+++  A
Sbjct  47    LIGHLHLLRGP-QPSHIVFGNMADKYGPIFTIKMGVHPTLVASNWEMAKECFTTNDKAFA  105

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             ++P     + LGY  +MF+FS    YWR +RK    ELLSN +L    H+R SE+ T++K
Sbjct  106   NRPNILAMDLLGYGRSMFAFSPYGNYWRQIRKISTLELLSNHRLQMFNHVRESEVGTALK  165

Query  1258  ELYLF--VTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYK  1085
             ELY       +   N   +V M  W   +TLN   RI+        VG  IG + + E K
Sbjct  166   ELYKLWEKNKTTNSNNKVLVEMKRWFGDITLNIILRII--------VGKFIGYETADEGK  217

Query  1084  EAQE-MINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQ  908
             E+ E      R+F +LSG F+  DA P    +W D  GH + MK    K+D ++  W+++
Sbjct  218   ESNEGWKQALRDFFHLSGRFIAADAVPF--LRWLDIGGHEKTMKHTANKLDIVVTEWLNE  275

Query  907   HIERRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTT  728
             H E++    A       + D + L+L  +D E             K T  ++ +  SDTT
Sbjct  276   HKEKK----ASGCVKKGEEDFMDLILDIMDDEAEATLSRDSDTINKATCLALTLAASDTT  331

Query  727   GTHMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTV  548
                ++WALSLLV   DV+K+ ++E++ QVG ER V +SDV  L +L+A+VKE+LRLYP  
Sbjct  332   SVTLIWALSLLVNNPDVLKKAQDELDVQVGRERQVHESDVNNLIFLKAIVKETLRLYPAG  391

Query  547   PLLMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADN  368
             PL +P  + KDC + GY +P G +   NL KI RDP+ W  P ++  +RFL       D 
Sbjct  392   PLSVPHESMKDCTVAGYHIPAGTRLVTNLSKIHRDPRVWSNPSEYQQERFLTSHQ-DFDV  450

Query  367   PLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPR  188
               K FE++PFG GRR C G+++ALQ+ H+T+A L+ GFNF TP    LDM E FG+T  R
Sbjct  451   RGKTFEFIPFGSGRRMCPGVSFALQVLHITLATLLHGFNFGTPTGEPLDMTENFGLTNLR  510

Query  187   ATPLQLVVTPRLPPNFY  137
             ATPL++ + PRL P+ Y
Sbjct  511   ATPLEVAINPRLGPHLY  527



>ref|XP_004247061.1| PREDICTED: cytochrome P450 82C4-like [Solanum lycopersicum]
Length=518

 Score =   367 bits (943),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 189/494 (38%), Positives = 287/494 (58%), Gaps = 32/494 (6%)
 Frame = -1

Query  1615  IGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTT-HERDVA  1439
             IGH+ +L+    +  RTLG MADK+GP+F ++ G  P  ++   E  KDCFT  +++  A
Sbjct  53    IGHLHLLSGHLPV-CRTLGLMADKYGPIFQLQLGDHPAIVVSNWEMVKDCFTAKNDKIFA  111

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P  A+ ++LGYN A+F+ +    YWR +RK V  ELL+N +L+K+KH+R SE+ + IK
Sbjct  112   SRPNMAISKYLGYNGAIFALAPYGPYWRNIRKMVTLELLTNSRLEKLKHVRTSEVNSCIK  171

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY         N    V +  W   +T N   R++AG+R+        G  +   +KE+
Sbjct  172   ELY-------SNNCPGQVNLSSWFENITCNIIIRMLAGKRF-------TGSAEEMNFKES  217

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                    ++  YL G FV  D+ P   F+W D  GH++AMK   K+VD +  +W+ QHI 
Sbjct  218   ------IKKALYLGGTFVFSDSIPW--FEWMDIGGHIKAMKDTYKEVDSVFDSWLKQHIN  269

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
                +G+      G   D I +MLST+ +E      Y     IK TT  +I+  S++T   
Sbjct  270   --SIGD------GEQSDFIDIMLSTLPEETNMESGYNRDAIIKATTLILIMTASESTAET  321

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             ++WALSLL+     +K  ++E++  +G  +WVE+SD+K L YLQA+VKE+LRLYP  PL 
Sbjct  322   LIWALSLLLNNTHSLKLAQDELDEHIGRNKWVEESDIKNLPYLQAIVKETLRLYPPGPLA  381

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
              PR   +DC +  Y + KG +  VNLWK+ RD + W +P++F P+R+  +E    +   +
Sbjct  382   GPREALEDCYVDKYHIKKGTRLIVNLWKLQRDSRIWKDPNEFKPERWFLKEHTNINFRGQ  441

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FEY+PF  GRR C G+ +  Q+ HLT+A+L+ GFN S      +D+ EG G+ LP+  P
Sbjct  442   NFEYIPFSSGRRMCPGLTFGSQVVHLTLAKLLHGFNVSMLKEEPVDLSEGLGIALPKVKP  501

Query  178   LQLVVTPRLPPNFY  137
             LQ +++PRL    Y
Sbjct  502   LQPLLSPRLAVELY  515



>ref|XP_006486181.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
Length=526

 Score =   368 bits (944),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 191/499 (38%), Positives = 292/499 (59%), Gaps = 29/499 (6%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             ++GH+ +L    +   R LG+MADK+GP+F ++ G+    M+   E AK+CFTT+++  A
Sbjct  53    LVGHLHLLGGP-EPAHRVLGDMADKYGPIFTMKLGVKQALMVSNWEIAKECFTTNDKAFA  111

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    E L YN+++ SF+    YWR   K    ELLS+ +L+K+KH+R  E++ SI+
Sbjct  112   SRPKTMAMELLEYNFSVISFAPYGNYWRQSLKIATIELLSSHRLEKLKHVREYEVKASIQ  171

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
              LY    +S    K  +V M  W+    L+   RI+AG+R+            S E  + 
Sbjct  172   RLYKNCVSSSSSRKVVLVDMIHWLEGTVLDVVLRIIAGKRHT---------SQSQEINDW  222

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             Q  I    +F  L+G FV+ DA P    +W D  G+ R M +  K  D ILQ W+D+H  
Sbjct  223   QRQIT---KFTALTGQFVVSDALPF--LRWLDIGGYERLMSKTAKYFDIILQEWLDEHKM  277

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +R  G         D D I+++LS +D    +         IK    ++I+  +DTT   
Sbjct  278   KRVSGEVKG-----DEDFIYVLLSLLDDNAEQLPDRDADTVIKAICVTLIVAATDTTAVT  332

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             + WA++LL+   DV+K+ ++E++ QVGTER V +SD++ L YLQA++KE++RLYP  PLL
Sbjct  333   LTWAIALLLNNPDVLKKAQDELDIQVGTERQVNESDMRNLVYLQAIIKETMRLYPAGPLL  392

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNR----EAGGAD  371
             +P  + ++C + GY +P G Q  VN WKI RDP  W EP +F P+RFL R    + GG D
Sbjct  393   LPHESIEECIVNGYLVPAGTQLFVNAWKIQRDPCVWEEPCQFQPERFLTRHKDIDVGGQD  452

Query  370   NPLKRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLP  191
                  FE +PFG GRR C  +++ LQ+  L +A L+ GF+F+TP +  +DM E  G+T+ 
Sbjct  453   -----FELIPFGSGRRMCPAVSFGLQVMQLMLASLVHGFDFTTPSDEPVDMGEAMGLTIA  507

Query  190   RATPLQLVVTPRLPPNFYG  134
             +ATPL+++V+PRL  + YG
Sbjct  508   KATPLEVLVSPRLSASLYG  526



>gb|KHN04536.1| Cytochrome P450 82A1, partial [Glycine soja]
Length=490

 Score =   366 bits (940),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 188/490 (38%), Positives = 291/490 (59%), Gaps = 19/490 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ +L    Q    TLG +ADK+GP+F +R G+    ++   E AK+CFTT +  ++
Sbjct  9     LIGHLHLLGGSTQPPYITLGSLADKYGPIFSMRIGVHHAVVVSSWELAKECFTTLDVVIS  68

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+F   + LGYNYA F F+    +WR MRK   SELLS  + + ++ IR SE++ S+K
Sbjct  69    SRPKFTAAKILGYNYANFGFTPYGDFWREMRKIAASELLSTARFELLQRIRDSEMQISLK  128

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY         +   +V M +W   + LN   R+++G+RY  K      +DD    ++ 
Sbjct  129   ELYRTWVDKRGVSDDLLVEMKQWFGDVNLNVILRMISGKRYSAK-----SEDD---LQQV  180

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
             + +  VFREF  L+G+FV+ DA P     W D  G V+ MK+   ++D I+  W+++H  
Sbjct  181   RRIRRVFREFFRLTGLFVVGDAIPF--LGWLDLGGEVKEMKKTAIEMDNIVSEWLEEH--  236

Query  898   RRQLGNAPAPAAGND-LDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             ++Q+ ++       D +D++  +L  +D   + G+ +     IK T   +I   +DTT  
Sbjct  237   KQQITDSGDTKTEQDFIDVLLFVLKGVD---LAGYDF--DTVIKATCTMLIAGATDTTAV  291

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              M WALSLL+     +K+ ++E++  VG ER V +SD+ KL YLQAVVKE+LRLYP  P 
Sbjct  292   TMTWALSLLLNNHHALKKVKDELDEHVGKERLVNESDINKLVYLQAVVKETLRLYPAGPF  351

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
               PR  +++C +GGY +  G +F +N+WK+ RDP+ W  P +F P+RFLN      D   
Sbjct  352   SGPREFTENCTLGGYKIEAGTRFMLNIWKLHRDPRVWSNPLEFQPERFLNTHK-NVDVKG  410

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             + FE +PFG GRRSC G+++ LQ+SHL +A  +Q F  +TP N ++DM   FG+T  + T
Sbjct  411   QHFELLPFGGGRRSCPGISFGLQMSHLALASFLQAFEITTPSNAQVDMSATFGLTNMKTT  470

Query  181   PLQLVVTPRL  152
             PL+++V P L
Sbjct  471   PLEVLVRPVL  480



>ref|XP_010036785.1| PREDICTED: cytochrome P450 82G1 [Eucalyptus grandis]
 gb|KCW48425.1| hypothetical protein EUGRSUZ_K02129 [Eucalyptus grandis]
Length=523

 Score =   367 bits (941),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 186/494 (38%), Positives = 296/494 (60%), Gaps = 21/494 (4%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             ++GH+ +L        R LG MAD  GP+F ++ G+  + ++   EAA++C T+++R +A
Sbjct  48    LVGHLHLLWGPGPAF-RKLGAMADALGPVFSLQLGVHRVVVLSSREAARECLTSNDRALA  106

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+ A G H+GYN A+   +    Y R++RK    EL S+ +L +++ +R SE++   K
Sbjct  107   SRPDIAAGRHMGYNSAVLGLAPYGPYLRLVRKIATLELFSSQRLKELRPVRSSEVDALTK  166

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             EL+       +P  + V A+ E +  +T N + RI+ G RYK +    +G D +  +K+A
Sbjct  167   ELW------HQPASSGV-AIGEKLEHMTFNMNLRIITGNRYKDEEFEEVGSD-AWRFKKA  218

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                     +  +L G+FVL DA P    +W DFQGHVR+MK   +++D +L+ W+ QH+E
Sbjct  219   ------INKALHLCGVFVLSDAIPW--LEWLDFQGHVRSMKETGRELDSVLEKWLRQHLE  270

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTIDKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGTH  719
             +R   N      G D D + L+L ++ ++ V    +  +  IK T   +I+ G+++T   
Sbjct  271   KRS--NKGIHVDGGDADFMDLLLESLPEDDVV-LGHERKDIIKATALILIMTGTESTSIT  327

Query  718   MVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPLL  539
             M WALSLL+ +   +K  ++E++  +G E+WV++SD+  L+Y+QA+VKE+LRLYP  PL 
Sbjct  328   MTWALSLLLNHPAALKSAQQELDTVIGREKWVQESDISNLKYVQAIVKETLRLYPPAPLT  387

Query  538   MPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPLK  359
               R   +DC I G  +PKG +  +N+WK+ RDP+ WPEPD F+P+RFL  E    D   K
Sbjct  388   GIREAMEDCYISGCHVPKGTRVLINIWKLQRDPRVWPEPDAFLPERFLE-EHKEVDLRAK  446

Query  358   RFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRATP  179
              FE++PF  GRRSC G    LQ+   T+AR++QGF  +      +DMEEG G+ LP+  P
Sbjct  447   NFEFIPFSSGRRSCPGATLGLQVVEFTLARILQGFEVTLAEGARVDMEEGPGIALPKVNP  506

Query  178   LQLVVTPRLPPNFY  137
             L++ + PRLP + Y
Sbjct  507   LRVALQPRLPLHLY  520



>gb|KDO42182.1| hypothetical protein CISIN_1g046041mg [Citrus sinensis]
Length=531

 Score =   367 bits (942),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 194/496 (39%), Positives = 288/496 (58%), Gaps = 26/496 (5%)
 Frame = -1

Query  1618  IIGHIPILNSQNQILSRTLGEMADKHGPLFIVRSGMTPIAMICGLEAAKDCFTTHERDVA  1439
             +IGH+ IL    + L R LG MADK+GP+F ++ G+    ++   E AK+C TT+++  A
Sbjct  61    VIGHLHILGGP-EPLHRVLGSMADKYGPIFTIKIGINRALVVSSWEMAKECLTTNDKIFA  119

Query  1438  SKPEFAVGEHLGYNYAMFSFSSDNAYWRVMRKFVVSELLSNVKLDKVKHIRMSELETSIK  1259
             S+P+    E LGYN++MF FS   +YW   RK    ELLSN +L+K++H+R  E++T +K
Sbjct  120   SRPKTLAMEILGYNFSMFGFSPYGSYWCETRKIATLELLSNHRLEKLRHVRDYEVKTCLK  179

Query  1258  ELYLFVTASPEPNKAAVVAMDEWIAQLTLNTSCRIVAGRRYKFKVGGAIGDDDSTEYKEA  1079
             ELY     S   NK  +V M  W A    N   R++        VG      DS E+ E 
Sbjct  180   ELYELWDKSKSTNKM-LVEMKRWFADTIRNVILRMI--------VGKGCNSVDSEEWME-  229

Query  1078  QEMINVFREFQYLSGMFVLQDAFPLRLFKWFDFQGHVRAMKRNNKKVDKILQAWIDQHIE  899
                  +   F  +SG FV+ DA P    +W D  G  R+MK+  K++D ++Q W ++H  
Sbjct  230   -----LLTRFLEMSGKFVVSDALPF--LRWLDIGGDERSMKKTAKELDIVVQGWFEEHKR  282

Query  898   RRQLGNAPAPAAGNDLDLIHLMLSTI-DKEFVKGFPYTHQMAIKGTTQSMIIDGSDTTGT  722
             +R          G +LD + +M S + D E   G         K     +II G DTT  
Sbjct  283   KRD----SREVKGEELDFMSVMPSILGDTEQYSGRDV--DTINKAVCLGLIIAGLDTTTV  336

Query  721   HMVWALSLLVKYGDVMKRCREEIEAQVGTERWVEDSDVKKLEYLQAVVKESLRLYPTVPL  542
              + W +SLL+ + D++ + + E++ QVGT+R V +SD+K L YLQA +KE++RLYP VPL
Sbjct  337   TLTWVISLLLNHRDILDKVQNELDIQVGTKRQVNESDLKNLVYLQATLKEAMRLYPAVPL  396

Query  541   LMPRMTSKDCKIGGYDLPKGAQFNVNLWKIMRDPKFWPEPDKFMPKRFLNREAGGADNPL  362
             L+P    ++C + GY +P   Q  +N+WK+ RDP+ W EP KF P+RFL +     D   
Sbjct  397   LIPHEAIEECTVNGYHVPARTQLLINVWKLQRDPRVWEEPCKFQPERFLTKHK-DIDVRG  455

Query  361   KRFEYVPFGCGRRSCVGMAYALQISHLTIARLIQGFNFSTPGNVELDMEEGFGVTLPRAT  182
             +  E +PFG GRR C G+++ALQ+   TIA L+QGF+F+TP N  LDM EGFG+T+ ++ 
Sbjct  456   QHLELLPFGSGRRMCPGVSFALQVMQFTIASLLQGFDFATPSNEPLDMGEGFGLTMEKSR  515

Query  181   PLQLVVTPRLPPNFYG  134
             PL++++ PRL  + YG
Sbjct  516   PLEVLIAPRLSASLYG  531



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5156615493492