BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19328_g2_i1 len=633 path=[1:0-276 278:277-315 317:316-632]

Length=633
                                                                      Score     E

ref|XP_007041995.1|  SAUR family protein                                177   4e-53   
ref|XP_007201436.1|  hypothetical protein PRUPE_ppa013764mg             177   5e-53   
ref|XP_010548084.1|  PREDICTED: auxin-induced protein 15A-like          177   6e-53   
ref|XP_002270504.1|  PREDICTED: auxin-induced protein 15A               176   1e-52   Vitis vinifera
ref|XP_008382358.1|  PREDICTED: auxin-induced protein 15A               176   2e-52   
emb|CDO96975.1|  unnamed protein product                                175   2e-52   
ref|XP_009379569.1|  PREDICTED: auxin-induced protein 15A-like          175   3e-52   
ref|XP_009347329.1|  PREDICTED: auxin-induced protein 15A-like          175   4e-52   
ref|XP_010530799.1|  PREDICTED: auxin-induced protein 15A               174   8e-52   
ref|XP_009108706.1|  PREDICTED: auxin-induced protein 15A-like          174   9e-52   
ref|NP_001147174.1|  SAUR9 - auxin-responsive SAUR family member        174   1e-51   Zea mays [maize]
ref|XP_006284811.1|  hypothetical protein CARUB_v10006081mg             174   1e-51   
ref|XP_010432377.1|  PREDICTED: auxin-induced protein 15A-like          174   1e-51   
ref|XP_004507523.1|  PREDICTED: indole-3-acetic acid-induced prot...    173   2e-51   
ref|XP_010437567.1|  PREDICTED: auxin-induced protein 15A-like          172   3e-51   
ref|XP_010665869.1|  PREDICTED: auxin-induced protein 15A-like          172   4e-51   
ref|XP_009138325.1|  PREDICTED: indole-3-acetic acid-induced prot...    173   4e-51   
ref|NP_195202.1|  SAUR-like auxin-responsive protein                    172   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109058.1|  PREDICTED: auxin-induced protein 15A               172   6e-51   
emb|CDX75460.1|  BnaA01g02420D                                          171   8e-51   
ref|XP_002313002.2|  hypothetical protein POPTR_0009s12890g             173   1e-50   Populus trichocarpa [western balsam poplar]
emb|CDY45331.1|  BnaA03g53040D                                          171   1e-50   
gb|AAK68742.2|  Putative auxin-regulated protein                        171   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002306147.1|  auxin-responsive family protein                    170   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_006412187.1|  hypothetical protein EUTSA_v10026631mg             170   2e-50   
ref|XP_004230993.1|  PREDICTED: auxin-induced protein 15A-like          170   3e-50   
gb|ABK94211.1|  unknown                                                 170   3e-50   Populus trichocarpa [western balsam poplar]
ref|XP_009627092.1|  PREDICTED: auxin-induced protein 15A-like          169   4e-50   
emb|CDX72500.1|  BnaC07g45220D                                          169   4e-50   
ref|XP_009766631.1|  PREDICTED: auxin-induced protein 15A-like          169   6e-50   
emb|CDX69086.1|  BnaC01g03670D                                          169   7e-50   
ref|XP_006359615.1|  PREDICTED: indole-3-acetic acid-induced prot...    169   7e-50   
ref|XP_011047025.1|  PREDICTED: uncharacterized protein LOC105141486    171   8e-50   
ref|XP_004500759.1|  PREDICTED: auxin-induced protein 15A-like          169   1e-49   
ref|XP_010113367.1|  hypothetical protein L484_026699                   168   1e-49   
ref|XP_003527098.1|  PREDICTED: indole-3-acetic acid-induced prot...    168   1e-49   
ref|XP_009589238.1|  PREDICTED: auxin-induced protein 15A-like          168   1e-49   
ref|XP_002867104.1|  auxin-responsive family protein                    168   2e-49   
ref|XP_004290373.1|  PREDICTED: auxin-induced protein 15A-like          167   2e-49   
gb|EYU37907.1|  hypothetical protein MIMGU_mgv1a020562mg                167   3e-49   
ref|XP_010246407.1|  PREDICTED: auxin-induced protein 15A               167   4e-49   
gb|AFT92005.1|  SAUR family protein                                     167   4e-49   
gb|KDP27623.1|  hypothetical protein JCGZ_19628                         166   6e-49   
ref|XP_009759020.1|  PREDICTED: auxin-induced protein 15A-like          166   7e-49   
ref|XP_011088533.1|  PREDICTED: uncharacterized protein LOC105169738    168   8e-49   
ref|XP_007135908.1|  hypothetical protein PHAVU_009G002000g             166   8e-49   
ref|XP_010095663.1|  hypothetical protein L484_012234                   169   1e-48   
ref|NP_001237264.1|  uncharacterized protein LOC100306339               165   2e-48   
ref|XP_003604016.1|  Auxin-induced protein 6B                           165   3e-48   
ref|XP_006409422.1|  hypothetical protein EUTSA_v10023118mg             165   3e-48   
gb|KHG20301.1|  Auxin-induced 15A                                       164   7e-48   
ref|XP_011092874.1|  PREDICTED: auxin-induced protein 15A-like          164   7e-48   
ref|XP_003607093.1|  Auxin-induced protein 15A                          163   9e-48   
ref|XP_007131739.1|  hypothetical protein PHAVU_011G037900g             163   1e-47   
ref|XP_006423533.1|  hypothetical protein CICLE_v10029633mg             163   1e-47   
ref|XP_009626194.1|  PREDICTED: auxin-induced protein 15A-like          163   1e-47   
ref|XP_010917983.1|  PREDICTED: auxin-induced protein 15A-like          163   1e-47   
ref|XP_010516567.1|  PREDICTED: auxin-induced protein 15A-like          163   1e-47   
emb|CDP07416.1|  unnamed protein product                                163   1e-47   
ref|XP_006299025.1|  hypothetical protein CARUB_v10015162mg             163   1e-47   
ref|XP_010467386.1|  PREDICTED: auxin-induced protein 15A-like          163   2e-47   
emb|CAN73226.1|  hypothetical protein VITISV_026201                     163   2e-47   Vitis vinifera
ref|XP_010908422.1|  PREDICTED: auxin-induced protein 15A-like          162   3e-47   
ref|XP_010531493.1|  PREDICTED: auxin-induced protein 15A-like          162   3e-47   
ref|XP_007017765.1|  SAUR family protein                                162   4e-47   
ref|XP_008811428.1|  PREDICTED: auxin-induced protein 15A               162   4e-47   
ref|XP_009802208.1|  PREDICTED: auxin-induced protein 15A-like          162   5e-47   
ref|NP_179248.1|  SAUR-like auxin-responsive protein                    161   7e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006435151.1|  hypothetical protein CICLE_v10002928mg             161   7e-47   
ref|XP_009590415.1|  PREDICTED: auxin-induced protein 15A-like          161   8e-47   
ref|XP_003634383.2|  PREDICTED: uncharacterized protein LOC100247221    163   9e-47   
ref|XP_002886058.1|  auxin-responsive family protein                    160   1e-46   
ref|XP_007046722.1|  SAUR family protein                                161   2e-46   
ref|XP_006359708.1|  PREDICTED: auxin-induced protein X15-like          160   2e-46   
ref|XP_009759019.1|  PREDICTED: auxin-induced protein 15A-like          160   2e-46   
ref|XP_009628643.1|  PREDICTED: auxin-induced protein 15A-like          160   3e-46   
ref|XP_007202790.1|  hypothetical protein PRUPE_ppa013735mg             159   3e-46   
ref|XP_009391130.1|  PREDICTED: auxin-induced protein 15A-like          159   5e-46   
ref|XP_004230999.1|  PREDICTED: auxin-induced protein 15A-like          159   6e-46   
ref|XP_003534356.1|  PREDICTED: auxin-induced protein 15A-like          158   8e-46   
ref|XP_006365926.1|  PREDICTED: indole-3-acetic acid-induced prot...    158   1e-45   
ref|XP_009802207.1|  PREDICTED: auxin-induced protein 15A-like          158   1e-45   
ref|XP_011025945.1|  PREDICTED: auxin-induced protein 15A-like          158   1e-45   
ref|XP_008377157.1|  PREDICTED: auxin-induced protein 15A-like          158   1e-45   
ref|XP_008391894.1|  PREDICTED: auxin-induced protein 15A-like          157   2e-45   
ref|XP_006359617.1|  PREDICTED: auxin-induced protein 15A-like          157   2e-45   
ref|XP_007224038.1|  hypothetical protein PRUPE_ppa015189mg             157   2e-45   
gb|KDP46721.1|  hypothetical protein JCGZ_06509                         157   3e-45   
gb|AFK46645.1|  unknown                                                 157   3e-45   
gb|KFK30241.1|  hypothetical protein AALP_AA7G235900                    157   3e-45   
ref|XP_009136313.1|  PREDICTED: uncharacterized protein LOC103860467    158   3e-45   
ref|XP_009335221.1|  PREDICTED: auxin-induced protein 15A-like          157   3e-45   
ref|XP_004230996.1|  PREDICTED: auxin-induced protein 15A-like          157   3e-45   
ref|XP_010271407.1|  PREDICTED: auxin-induced protein 15A-like          157   4e-45   
ref|XP_008241809.1|  PREDICTED: auxin-induced protein 15A               157   4e-45   
emb|CDY02251.1|  BnaA03g39160D                                          157   5e-45   
gb|KHN25441.1|  Auxin-induced protein 15A                               156   6e-45   
ref|XP_010066236.1|  PREDICTED: auxin-induced protein 15A-like          156   6e-45   
gb|KDP36943.1|  hypothetical protein JCGZ_08234                         156   6e-45   
ref|XP_002310856.1|  hypothetical protein POPTR_0007s14060g             156   8e-45   Populus trichocarpa [western balsam poplar]
ref|XP_010327424.1|  PREDICTED: auxin-induced protein 15A-like          156   8e-45   
ref|XP_006359616.1|  PREDICTED: indole-3-acetic acid-induced prot...    155   9e-45   
ref|XP_008372780.1|  PREDICTED: auxin-induced protein 15A-like          155   1e-44   
ref|XP_006359710.1|  PREDICTED: indole-3-acetic acid-induced prot...    155   1e-44   
emb|CDX89731.1|  BnaC03g46450D                                          155   1e-44   
ref|XP_008387950.1|  PREDICTED: auxin-induced protein 15A               155   2e-44   
ref|XP_002269183.1|  PREDICTED: auxin-induced protein 15A-like          154   3e-44   Vitis vinifera
ref|NP_001235552.1|  uncharacterized protein LOC100500265               154   3e-44   
ref|NP_177688.1|  SAUR-like auxin-responsive protein                    154   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887604.1|  hypothetical protein ARALYDRAFT_476705             154   4e-44   
ref|XP_009400356.1|  PREDICTED: auxin-induced protein 15A-like          154   4e-44   
ref|XP_004291382.1|  PREDICTED: indole-3-acetic acid-induced prot...    154   4e-44   
ref|XP_009378184.1|  PREDICTED: auxin-induced protein 15A               154   4e-44   
ref|XP_010104433.1|  hypothetical protein L484_016032                   154   5e-44   
ref|XP_009758646.1|  PREDICTED: auxin-induced protein 15A-like          154   5e-44   
gb|KFK41991.1|  hypothetical protein AALP_AA2G198100                    154   5e-44   
ref|XP_002878540.1|  hypothetical protein ARALYDRAFT_900533             154   5e-44   
emb|CDY13560.1|  BnaC02g23710D                                          154   6e-44   
ref|XP_009607051.1|  PREDICTED: auxin-induced protein 15A-like          154   6e-44   
ref|XP_009759642.1|  PREDICTED: auxin-induced protein 15A-like          153   7e-44   
ref|NP_179718.1|  SAUR-like auxin-responsive protein                    153   9e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009628641.1|  PREDICTED: auxin-induced protein 15A-like          153   1e-43   
ref|XP_004230997.1|  PREDICTED: auxin-induced protein 15A-like          153   1e-43   
ref|XP_006295292.1|  hypothetical protein CARUB_v10024381mg             152   2e-43   
ref|XP_010028665.1|  PREDICTED: auxin-induced protein 15A               152   2e-43   
ref|XP_010416863.1|  PREDICTED: auxin-induced protein 15A-like          152   2e-43   
ref|XP_009759018.1|  PREDICTED: auxin-induced protein 15A-like          152   2e-43   
ref|XP_009128112.1|  PREDICTED: auxin-induced protein 15A-like          152   2e-43   
ref|XP_010539864.1|  PREDICTED: auxin-induced protein 15A               152   3e-43   
ref|XP_006590723.1|  PREDICTED: auxin-induced protein 15A-like          152   3e-43   
ref|XP_010061037.1|  PREDICTED: auxin-induced protein 15A               152   4e-43   
gb|KFK30111.1|  hypothetical protein AALP_AA7G218300                    151   4e-43   
ref|XP_006303028.1|  hypothetical protein CARUB_v10021184mg             151   5e-43   
ref|XP_010416447.1|  PREDICTED: auxin-induced protein 15A-like          151   5e-43   
ref|XP_010428583.1|  PREDICTED: auxin-induced protein 15A-like          151   6e-43   
emb|CDY47511.1|  BnaAnng09090D                                          151   6e-43   
ref|XP_008791264.1|  PREDICTED: auxin-induced protein 15A-like          151   7e-43   
ref|XP_009106208.1|  PREDICTED: auxin-induced protein 15A-like          151   9e-43   
ref|XP_007157926.1|  hypothetical protein PHAVU_002G109600g             150   1e-42   
emb|CDX73181.1|  BnaC06g36290D                                          150   1e-42   
ref|XP_010429019.1|  PREDICTED: auxin-induced protein 15A-like          150   1e-42   
ref|XP_011083512.1|  PREDICTED: auxin-induced protein 15A-like          150   1e-42   
ref|XP_009117430.1|  PREDICTED: auxin-induced protein 15A               150   2e-42   
ref|XP_006390291.1|  hypothetical protein EUTSA_v10019345mg             150   2e-42   
ref|XP_004230998.2|  PREDICTED: auxin-induced protein 15A-like          150   3e-42   
ref|XP_006404561.1|  hypothetical protein EUTSA_v10000385mg             149   3e-42   
ref|XP_004500950.1|  PREDICTED: indole-3-acetic acid-induced prot...    149   4e-42   
ref|XP_006282761.1|  hypothetical protein CARUB_v10006088mg             149   4e-42   
ref|NP_001235483.1|  uncharacterized protein LOC100305700               149   4e-42   
ref|XP_004147005.1|  PREDICTED: auxin-induced protein 15A-like          149   4e-42   
ref|NP_195597.1|  SAUR-like auxin-responsive protein                    149   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002300717.1|  hypothetical protein POPTR_0002s02590g             149   4e-42   Populus trichocarpa [western balsam poplar]
ref|XP_008457621.1|  PREDICTED: auxin-induced protein 15A               149   4e-42   
ref|XP_010029694.1|  PREDICTED: auxin-induced protein 15A-like          149   6e-42   
ref|XP_009104700.1|  PREDICTED: auxin-induced protein 15A-like          149   6e-42   
ref|XP_010934541.1|  PREDICTED: auxin-induced protein 15A-like          149   7e-42   
gb|KHN36041.1|  Auxin-induced protein 15A                               148   8e-42   
ref|XP_009382023.1|  PREDICTED: auxin-induced protein 15A-like          148   9e-42   
gb|KGN61863.1|  hypothetical protein Csa_2G258100                       150   1e-41   
gb|KFK40069.1|  hypothetical protein AALP_AA3G326200                    148   1e-41   
ref|XP_006411676.1|  hypothetical protein EUTSA_v10026642mg             148   1e-41   
ref|XP_009628642.1|  PREDICTED: auxin-induced protein X15-like          147   1e-41   
ref|XP_009627643.1|  PREDICTED: auxin-induced protein 15A-like          147   1e-41   
ref|XP_002869044.1|  hypothetical protein ARALYDRAFT_491020             147   1e-41   
ref|XP_009391842.1|  PREDICTED: auxin-induced protein 15A-like          147   3e-41   
ref|XP_009788456.1|  PREDICTED: auxin-induced protein 15A-like          147   3e-41   
ref|XP_002307708.1|  hypothetical protein POPTR_0005s25840g             147   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006573558.1|  PREDICTED: uncharacterized protein LOC100776099    148   4e-41   
ref|XP_004512127.1|  PREDICTED: auxin-induced protein 15A-like          146   4e-41   
ref|XP_006282477.1|  hypothetical protein CARUB_v10006094mg             146   4e-41   
ref|XP_006359707.1|  PREDICTED: indole-3-acetic acid-induced prot...    147   4e-41   
ref|XP_009101924.1|  PREDICTED: auxin-induced protein 15A-like          146   5e-41   
emb|CDX85905.1|  BnaC06g22290D                                          146   6e-41   
ref|XP_010446822.1|  PREDICTED: auxin-induced protein 15A-like          146   7e-41   
ref|XP_004287824.1|  PREDICTED: auxin-induced protein 15A-like          146   7e-41   
ref|XP_006412024.1|  hypothetical protein EUTSA_v10026647mg             145   7e-41   
ref|XP_004238342.1|  PREDICTED: auxin-induced protein 15A               146   7e-41   
ref|XP_009134559.1|  PREDICTED: auxin-induced protein 15A-like          145   8e-41   
gb|KEH36239.1|  SAUR-like auxin-responsive family protein               145   9e-41   
emb|CDY47053.1|  BnaAnng08410D                                          145   1e-40   
ref|NP_195334.1|  SAUR-like auxin-responsive protein                    145   2e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30480.1|  hypothetical protein AALP_AA7G266200                    145   2e-40   
ref|XP_003629338.1|  Auxin-induced protein 6B                           145   2e-40   
ref|XP_010667387.1|  PREDICTED: auxin-induced protein 15A-like          145   2e-40   
emb|CDY42589.1|  BnaC01g00010D                                          145   2e-40   
ref|XP_009109257.1|  PREDICTED: auxin-induced protein 15A-like          144   2e-40   
ref|XP_009788457.1|  PREDICTED: auxin-induced protein 15A-like          144   2e-40   
ref|XP_003612148.1|  Auxin-induced protein 6B                           144   3e-40   
emb|CDY08909.1|  BnaC08g11390D                                          144   3e-40   
ref|XP_007136080.1|  hypothetical protein PHAVU_009G015900g             144   3e-40   
ref|XP_010467599.1|  PREDICTED: auxin-induced protein 15A-like          144   3e-40   
ref|XP_009138408.1|  PREDICTED: auxin-induced protein 15A-like          144   3e-40   
gb|AFK33343.1|  unknown                                                 144   4e-40   
ref|XP_004509350.1|  PREDICTED: auxin-induced protein 15A-like          144   4e-40   
gb|KFK44112.1|  hypothetical protein AALP_AA1G217300                    144   6e-40   
gb|KFK41735.1|  hypothetical protein AALP_AA2G165700                    143   6e-40   
ref|XP_010489444.1|  PREDICTED: auxin-induced protein 15A               143   6e-40   
ref|XP_010315342.1|  PREDICTED: auxin-induced protein 15A-like          143   6e-40   
ref|XP_010437379.1|  PREDICTED: auxin-induced protein 15A-like          143   8e-40   
ref|XP_010432200.1|  PREDICTED: auxin-induced protein 15A-like          143   8e-40   
gb|AFK47147.1|  unknown                                                 143   8e-40   
ref|XP_010531081.1|  PREDICTED: auxin-induced protein 15A               143   1e-39   
ref|XP_009588624.1|  PREDICTED: auxin-induced protein 15A-like          142   1e-39   
ref|XP_006304311.1|  hypothetical protein CARUB_v10010680mg             142   3e-39   
gb|KHN34296.1|  Indole-3-acetic acid-induced protein ARG7               142   3e-39   
ref|NP_001238664.1|  uncharacterized protein LOC100500218               141   3e-39   
ref|NP_001236795.1|  uncharacterized protein LOC100527235               141   4e-39   
ref|XP_006359709.1|  PREDICTED: auxin-induced protein 15A-like          141   4e-39   
ref|XP_006342031.1|  PREDICTED: indole-3-acetic acid-induced prot...    141   5e-39   
gb|AAG14455.1|AF283707_1  auxin-induced protein TGSAUR21                140   8e-39   Tulipa gesneriana
ref|XP_009605446.1|  PREDICTED: auxin-induced protein 15A-like          140   9e-39   
emb|CDY44482.1|  BnaC07g15580D                                          140   1e-38   
ref|XP_009774610.1|  PREDICTED: auxin-induced protein 15A-like          140   2e-38   
ref|XP_004134870.1|  PREDICTED: auxin-induced protein 15A-like          140   2e-38   
ref|XP_008440807.1|  PREDICTED: auxin-induced protein 15A               140   2e-38   
ref|XP_009615597.1|  PREDICTED: auxin-induced protein 15A-like          139   2e-38   
ref|NP_173411.1|  SAUR-like auxin-responsive protein                    140   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007156154.1|  hypothetical protein PHAVU_003G262800g             139   3e-38   
emb|CDX72576.1|  BnaC07g45980D                                          139   3e-38   
ref|XP_009772515.1|  PREDICTED: auxin-induced protein 15A-like          139   3e-38   
gb|EYU38835.1|  hypothetical protein MIMGU_mgv1a025368mg                139   4e-38   
ref|XP_004144828.1|  PREDICTED: auxin-induced protein 15A-like          138   5e-38   
ref|XP_009147025.1|  PREDICTED: auxin-induced protein 15A-like          138   5e-38   
gb|AAG14456.1|AF283708_1  auxin-induced protein TGSAUR22                138   6e-38   Tulipa gesneriana
ref|XP_006416461.1|  hypothetical protein EUTSA_v10009412mg             139   6e-38   
ref|XP_004170990.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    138   6e-38   
ref|XP_002890355.1|  hypothetical protein ARALYDRAFT_472207             138   7e-38   
ref|XP_008448019.1|  PREDICTED: auxin-induced protein 15A-like          138   8e-38   
ref|XP_004234539.1|  PREDICTED: auxin-induced protein 15A               137   1e-37   
ref|XP_009416593.1|  PREDICTED: auxin-induced protein 15A-like          137   2e-37   
ref|XP_009610455.1|  PREDICTED: auxin-induced protein 15A-like          137   2e-37   
gb|AAM12780.1|  auxin-induced SAUR-like protein                         137   2e-37   Capsicum annuum
ref|XP_006298850.1|  hypothetical protein CARUB_v10014976mg             137   3e-37   
ref|XP_006343372.1|  PREDICTED: auxin-induced protein X10A-like         136   3e-37   
ref|XP_009764004.1|  PREDICTED: auxin-induced protein 15A-like          136   3e-37   
ref|XP_006340725.1|  PREDICTED: auxin-induced protein X10A-like         136   5e-37   
ref|XP_010413202.1|  PREDICTED: auxin-induced protein 15A-like          136   5e-37   
ref|XP_009407865.1|  PREDICTED: auxin-induced protein 15A-like          135   5e-37   
ref|XP_006842411.1|  hypothetical protein AMTR_s00204p00035590          136   6e-37   
ref|XP_006830480.1|  hypothetical protein AMTR_s00245p00017720          136   6e-37   
ref|XP_004232480.1|  PREDICTED: auxin-induced protein 15A-like          135   8e-37   
ref|XP_009411467.1|  PREDICTED: auxin-induced protein 15A-like          135   8e-37   
gb|KGN48903.1|  hypothetical protein Csa_6G505810                       135   1e-36   
emb|CDY55152.1|  BnaC05g50280D                                          135   1e-36   
ref|XP_004233554.1|  PREDICTED: auxin-induced protein 15A               134   1e-36   
ref|XP_009600970.1|  PREDICTED: auxin-induced protein 15A-like          135   1e-36   
gb|KFK40177.1|  hypothetical protein AALP_AA3G340300                    135   1e-36   
ref|XP_006366565.1|  PREDICTED: auxin-induced protein X10A-like         134   2e-36   
ref|XP_011074994.1|  PREDICTED: auxin-induced protein 15A-like          134   2e-36   
ref|XP_009611984.1|  PREDICTED: auxin-induced protein 15A               134   2e-36   
ref|XP_010477205.1|  PREDICTED: auxin-induced protein 15A-like          134   2e-36   
ref|NP_179392.1|  SAUR-like auxin-responsive protein                    134   4e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459659.1|  PREDICTED: auxin-induced protein 15A-like          134   5e-36   
ref|XP_006409208.1|  hypothetical protein EUTSA_v10023080mg             133   5e-36   
emb|CDP21324.1|  unnamed protein product                                133   7e-36   
ref|XP_010498404.1|  PREDICTED: auxin-induced protein 15A-like          133   8e-36   
ref|XP_009765477.1|  PREDICTED: auxin-induced protein X10A-like         134   9e-36   
ref|XP_002884096.1|  auxin-responsive family protein                    130   9e-35   
emb|CDY29398.1|  BnaA06g13980D                                          130   1e-34   
emb|CDY68553.1|  BnaCnng59500D                                          129   2e-34   
emb|CDY38169.1|  BnaA07g02140D                                          128   6e-34   
ref|XP_009102288.1|  PREDICTED: auxin-induced protein 15A-like          127   1e-33   
ref|XP_009112463.1|  PREDICTED: auxin-induced protein 15A-like          127   1e-33   
ref|XP_010548293.1|  PREDICTED: auxin-induced protein 15A-like          125   6e-33   
ref|XP_004152658.1|  PREDICTED: auxin-induced protein 15A-like          125   1e-32   
ref|XP_009149469.1|  PREDICTED: auxin-induced protein 15A               124   3e-32   
ref|XP_008466496.1|  PREDICTED: auxin-induced protein 15A               124   3e-32   
gb|AAG14454.1|AF283706_1  auxin-induced protein TGSAUR12                123   3e-32   Tulipa gesneriana
ref|XP_009150752.1|  PREDICTED: auxin-induced protein 15A-like          123   4e-32   
ref|XP_004952398.1|  PREDICTED: auxin-induced protein 15A-like          123   4e-32   
gb|EPS67974.1|  hypothetical protein M569_06800                         123   4e-32   
ref|XP_004136391.1|  PREDICTED: auxin-induced protein 15A-like          122   9e-32   
ref|XP_008444786.1|  PREDICTED: auxin-induced protein 15A-like          122   1e-31   
ref|XP_010539047.1|  PREDICTED: auxin-induced protein X15-like          119   2e-30   
ref|XP_010060232.1|  PREDICTED: auxin-induced protein X15-like          119   3e-30   
ref|XP_010526792.1|  PREDICTED: auxin-induced protein 15A-like          117   8e-30   
ref|XP_006648602.1|  PREDICTED: auxin-induced protein X15-like          117   1e-29   
ref|NP_001046748.1|  Os02g0445100                                       116   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006647238.1|  PREDICTED: auxin-induced protein 15A-like          115   3e-29   
ref|XP_010550458.1|  PREDICTED: auxin-induced protein 15A-like          115   5e-29   
ref|XP_006393819.1|  hypothetical protein EUTSA_v10005393mg             114   1e-28   
ref|XP_010060233.1|  PREDICTED: auxin-induced protein X15-like          114   2e-28   
ref|XP_006282125.1|  hypothetical protein CARUB_v10028377mg             113   3e-28   
ref|XP_002866762.1|  predicted protein                                  112   4e-28   
ref|NP_201427.1|  SAUR-like auxin-responsive protein                    112   5e-28   
ref|XP_010444818.1|  PREDICTED: auxin-induced protein 15A-like          112   8e-28   
ref|XP_010484669.1|  PREDICTED: auxin-induced protein 15A-like          111   1e-27   
ref|XP_010465729.1|  PREDICTED: auxin-induced protein 15A-like          111   2e-27   
ref|NP_001167758.1|  uncharacterized protein LOC100381449               111   2e-27   
gb|KFK28299.1|  hypothetical protein AALP_AA8G498200                    110   4e-27   
ref|XP_009112288.1|  PREDICTED: auxin-induced protein 15A               110   4e-27   
emb|CDX81404.1|  BnaC09g08150D                                          110   5e-27   
ref|XP_006425512.1|  hypothetical protein CICLE_v10027377mg             108   9e-27   
ref|XP_004952399.1|  PREDICTED: auxin-induced protein 15A-like          108   1e-26   
gb|EPS72391.1|  hypothetical protein M569_02373                         108   2e-26   
gb|KDO71155.1|  hypothetical protein CISIN_1g040904mg                   107   4e-26   
ref|XP_006292433.1|  hypothetical protein CARUB_v10018649mg             103   2e-24   
ref|XP_010507386.1|  PREDICTED: auxin-induced protein 15A-like          102   2e-24   
emb|CDY20904.1|  BnaC06g01240D                                          103   3e-24   
ref|XP_010412720.1|  PREDICTED: auxin-induced protein 15A-like          102   3e-24   
ref|XP_010431238.1|  PREDICTED: auxin-induced protein 15A-like          102   6e-24   
ref|XP_009115797.1|  PREDICTED: auxin-induced protein 15A               100   2e-23   
gb|ABR17640.1|  unknown                                                 101   3e-23   
ref|XP_006846965.1|  hypothetical protein AMTR_s00017p00065780        99.8    4e-23   
gb|EAY85685.1|  hypothetical protein OsI_07054                        99.4    7e-23   
gb|EYU37882.1|  hypothetical protein MIMGU_mgv1a022555mg              99.0    7e-23   
ref|XP_009368370.1|  PREDICTED: auxin-induced protein 15A-like        97.4    3e-22   
gb|EPS68786.1|  hypothetical protein M569_05980                       97.4    5e-22   
ref|XP_008236178.1|  PREDICTED: auxin-induced protein 15A-like        96.7    7e-22   
ref|XP_009621718.1|  PREDICTED: auxin-induced protein 15A-like        96.7    7e-22   
ref|XP_009770671.1|  PREDICTED: auxin-induced protein 15A-like        96.7    7e-22   
emb|CDO96966.1|  unnamed protein product                              96.3    7e-22   
emb|CDX73741.1|  BnaC08g22620D                                        96.3    1e-21   
ref|XP_011088520.1|  PREDICTED: indole-3-acetic acid-induced prot...  96.3    1e-21   
ref|XP_010228109.1|  PREDICTED: uncharacterized protein LOC100828255  97.8    2e-21   
ref|XP_010649243.1|  PREDICTED: auxin-induced protein 15A             95.1    2e-21   
ref|XP_002271891.1|  PREDICTED: auxin-induced protein 15A             95.1    2e-21   
ref|XP_008369486.1|  PREDICTED: auxin-induced protein 15A-like        94.7    3e-21   
gb|AFK49405.1|  unknown                                               94.4    5e-21   
ref|XP_010028679.1|  PREDICTED: auxin-induced protein 15A-like        94.0    5e-21   
ref|XP_007135898.1|  hypothetical protein PHAVU_009G001000g           94.0    6e-21   
ref|XP_009799352.1|  PREDICTED: auxin-induced protein 15A-like        93.6    6e-21   
ref|XP_009368374.1|  PREDICTED: auxin-induced protein 15A-like        94.0    6e-21   
ref|XP_010246399.1|  PREDICTED: auxin-induced protein 15A-like        94.0    7e-21   
ref|XP_004248873.1|  PREDICTED: auxin-induced protein 15A-like        93.6    7e-21   
ref|XP_011088519.1|  PREDICTED: auxin-induced protein 15A-like        93.6    8e-21   
ref|XP_007014781.1|  SAUR-like auxin-responsive protein family        93.6    9e-21   
ref|NP_001046749.1|  Os02g0445600                                     93.2    1e-20   
gb|KDP27603.1|  hypothetical protein JCGZ_19608                       93.2    1e-20   
ref|XP_010246395.1|  PREDICTED: auxin-induced protein X15-like        93.2    1e-20   
ref|XP_010105322.1|  hypothetical protein L484_000538                 93.2    1e-20   
ref|XP_010436261.1|  PREDICTED: auxin-induced protein 15A-like        93.2    1e-20   
emb|CDY66643.1|  BnaUnng01620D                                        93.2    1e-20   
ref|XP_006423557.1|  hypothetical protein CICLE_v10030256mg           92.8    1e-20   
ref|XP_009765338.1|  PREDICTED: auxin-induced protein 15A-like        93.2    2e-20   
gb|KDO42792.1|  hypothetical protein CISIN_1g040932mg                 92.8    2e-20   
ref|NP_195203.1|  SAUR-like auxin-responsive protein                  93.2    2e-20   
ref|XP_010086682.1|  hypothetical protein L484_000889                 92.8    2e-20   
ref|XP_008391973.1|  PREDICTED: auxin-induced protein 15A-like        92.8    2e-20   
ref|XP_006282478.1|  hypothetical protein CARUB_v10006095mg           92.8    2e-20   
ref|XP_002276412.1|  PREDICTED: auxin-induced protein 15A             92.4    2e-20   
ref|XP_010246398.1|  PREDICTED: auxin-induced protein 15A-like        92.8    2e-20   
ref|XP_009784495.1|  PREDICTED: auxin-induced protein 15A-like        92.4    2e-20   
ref|XP_009764192.1|  PREDICTED: auxin-induced protein 15A-like        92.0    2e-20   
ref|XP_009759641.1|  PREDICTED: auxin-induced protein 15A-like        92.0    2e-20   
ref|XP_010315343.1|  PREDICTED: auxin-induced protein 15A-like        92.0    2e-20   
ref|XP_010536039.1|  PREDICTED: auxin-induced protein 15A-like        92.4    3e-20   
ref|XP_010246416.1|  PREDICTED: auxin-induced protein 15A-like        92.4    3e-20   
ref|XP_003620152.1|  Auxin-induced SAUR-like protein                  92.4    3e-20   
ref|XP_010271402.1|  PREDICTED: auxin-induced protein X10A-like       92.0    3e-20   
ref|XP_009772683.1|  PREDICTED: auxin-induced protein 15A-like        91.7    3e-20   
ref|XP_009108704.1|  PREDICTED: auxin-induced protein 15A-like        92.4    3e-20   
ref|XP_009606929.1|  PREDICTED: auxin-induced protein 15A-like        92.0    3e-20   
ref|XP_009770669.1|  PREDICTED: auxin-induced protein 15A             92.0    4e-20   
ref|XP_003534342.1|  PREDICTED: indole-3-acetic acid-induced prot...  91.7    4e-20   
ref|XP_006359714.1|  PREDICTED: indole-3-acetic acid-induced prot...  92.0    4e-20   
ref|XP_002272387.1|  PREDICTED: auxin-induced protein 15A-like        91.7    4e-20   
ref|XP_007199259.1|  hypothetical protein PRUPE_ppa022603mg           91.7    4e-20   
ref|XP_004144829.1|  PREDICTED: auxin-induced protein X15-like        91.7    4e-20   
ref|XP_009780508.1|  PREDICTED: auxin-induced protein 15A-like        91.7    5e-20   
ref|NP_001237107.1|  uncharacterized protein LOC100500377             91.7    5e-20   
ref|XP_004170628.1|  PREDICTED: auxin-induced protein 6B-like         91.7    5e-20   
ref|XP_009764194.1|  PREDICTED: auxin-induced protein 15A-like        91.7    5e-20   
ref|XP_009379590.1|  PREDICTED: auxin-induced protein 15A-like        91.7    6e-20   
ref|XP_004144905.1|  PREDICTED: indole-3-acetic acid-induced prot...  91.3    6e-20   
ref|XP_007041969.1|  SAUR-like auxin-responsive protein family        91.7    6e-20   
ref|NP_190688.1|  SAUR-like auxin-responsive protein                  91.7    6e-20   
ref|XP_004290377.1|  PREDICTED: indole-3-acetic acid-induced prot...  91.3    6e-20   
ref|XP_006359716.1|  PREDICTED: indole-3-acetic acid-induced prot...  91.3    7e-20   
ref|XP_007131726.1|  hypothetical protein PHAVU_011G036600g           92.4    7e-20   
ref|XP_010244114.1|  PREDICTED: auxin-induced protein 15A-like        91.3    7e-20   
ref|XP_006359625.1|  PREDICTED: auxin-induced protein 15A-like        91.3    7e-20   
ref|XP_010526566.1|  PREDICTED: auxin-induced protein X15             91.3    7e-20   
emb|CBI17626.3|  unnamed protein product                              90.9    7e-20   
ref|XP_004300216.1|  PREDICTED: indole-3-acetic acid-induced prot...  91.3    7e-20   
ref|XP_009620275.1|  PREDICTED: auxin-induced protein 15A-like        90.5    8e-20   
ref|XP_002271427.1|  PREDICTED: auxin-induced protein 15A             90.9    8e-20   
ref|XP_003607162.1|  Auxin-induced protein 6B                         90.9    8e-20   
gb|EYU40409.1|  hypothetical protein MIMGU_mgv1a017192mg              90.5    8e-20   
ref|XP_004230987.1|  PREDICTED: auxin-induced protein 15A-like        90.9    8e-20   
ref|XP_004230990.1|  PREDICTED: auxin-induced protein 15A-like        90.5    9e-20   
ref|XP_010444967.1|  PREDICTED: auxin-induced protein 15A-like        90.9    9e-20   
ref|XP_006423555.1|  hypothetical protein CICLE_v10030043mg           90.9    1e-19   
ref|XP_006359632.1|  PREDICTED: auxin-induced protein 15A-like        90.1    1e-19   
ref|XP_002312989.1|  hypothetical protein POPTR_0009s13020g           90.9    1e-19   
ref|XP_009108953.1|  PREDICTED: auxin-induced protein 15A             90.5    1e-19   
ref|XP_007041961.1|  SAUR-like auxin-responsive protein family        92.4    1e-19   
ref|XP_009621716.1|  PREDICTED: auxin-induced protein 15A             90.5    1e-19   
gb|KGN61877.1|  hypothetical protein Csa_2G258730                     90.5    1e-19   
ref|XP_002869127.1|  auxin-responsive family protein                  90.5    1e-19   
ref|XP_006359626.1|  PREDICTED: auxin-induced protein 15A-like        90.5    1e-19   
ref|XP_010315351.1|  PREDICTED: auxin-induced protein 15A-like        90.1    1e-19   
ref|XP_010028671.1|  PREDICTED: indole-3-acetic acid-induced prot...  90.1    1e-19   
ref|XP_007200676.1|  hypothetical protein PRUPE_ppa016329mg           90.5    1e-19   
gb|EYU35271.1|  hypothetical protein MIMGU_mgv1a020811mg              90.1    1e-19   
ref|XP_009765339.1|  PREDICTED: auxin-induced protein 15A-like        90.1    2e-19   
ref|XP_008392043.1|  PREDICTED: auxin-induced protein 15A-like        90.1    2e-19   
ref|XP_006359712.1|  PREDICTED: auxin-induced protein 15A-like        89.7    2e-19   
ref|XP_004231444.1|  PREDICTED: auxin-induced protein 15A             91.3    2e-19   
gb|KCW55443.1|  hypothetical protein EUGRSUZ_I01345                   89.7    2e-19   
ref|XP_010536042.1|  PREDICTED: auxin-induced protein 15A-like        89.7    2e-19   
ref|XP_004231441.1|  PREDICTED: auxin-induced protein 15A-like        90.1    2e-19   
ref|XP_008457634.1|  PREDICTED: auxin-induced protein 15A-like        89.7    2e-19   
ref|XP_004173149.1|  PREDICTED: auxin-induced protein X10A-like       90.1    2e-19   
ref|XP_007041959.1|  SAUR-like auxin-responsive protein family        90.5    2e-19   
ref|XP_009770357.1|  PREDICTED: auxin-induced protein 15A-like        89.4    2e-19   
gb|KCW55450.1|  hypothetical protein EUGRSUZ_I01352                   89.7    2e-19   
gb|KFK30112.1|  hypothetical protein AALP_AA7G218400                  90.1    2e-19   
ref|XP_006359713.1|  PREDICTED: auxin-induced protein 15A-like        89.7    2e-19   
ref|XP_004230984.1|  PREDICTED: auxin-induced protein 15A-like        89.4    2e-19   
gb|KGN43200.1|  hypothetical protein Csa_7G008960                     89.7    2e-19   
gb|KCW55462.1|  hypothetical protein EUGRSUZ_I01364                   89.7    2e-19   
ref|XP_003631580.1|  PREDICTED: auxin-induced protein 15A             89.7    2e-19   
emb|CBI17635.3|  unnamed protein product                              89.4    2e-19   
ref|XP_007135904.1|  hypothetical protein PHAVU_009G001600g           89.7    2e-19   
ref|XP_004162911.1|  PREDICTED: auxin-induced protein X10A-like       89.7    2e-19   
ref|XP_010246402.1|  PREDICTED: auxin-induced protein X10A-like       89.4    3e-19   
gb|KCW55456.1|  hypothetical protein EUGRSUZ_I01358                   89.4    3e-19   
gb|AAM12778.1|  auxin-induced SAUR-like protein                       89.4    3e-19   
ref|XP_010664793.1|  PREDICTED: auxin-induced protein 15A             89.7    3e-19   
ref|XP_010691636.1|  PREDICTED: auxin-induced protein 15A-like        89.4    3e-19   
ref|XP_002276227.1|  PREDICTED: auxin-induced protein 15A             89.4    3e-19   
ref|XP_009606928.1|  PREDICTED: auxin-induced protein 15A-like        89.4    3e-19   
ref|XP_010271569.1|  PREDICTED: auxin-induced protein 15A-like        89.4    3e-19   
ref|XP_006359629.1|  PREDICTED: auxin-induced protein 15A-like        89.0    4e-19   
gb|KCW55452.1|  hypothetical protein EUGRSUZ_I01354                   89.0    4e-19   
ref|XP_006423551.1|  hypothetical protein CICLE_v10029685mg           89.0    4e-19   
gb|AAM12777.1|  putative auxin-induced SAUR-like protein              88.6    4e-19   
ref|XP_004144906.1|  PREDICTED: auxin-induced protein X10A-like       89.0    4e-19   
ref|XP_010649241.1|  PREDICTED: auxin-induced protein 15A             89.0    4e-19   
ref|XP_002313745.1|  hypothetical protein POPTR_0009s13050g           90.1    4e-19   
ref|XP_006577905.1|  PREDICTED: auxin-induced protein X10A-like       89.0    4e-19   
ref|XP_009620276.1|  PREDICTED: auxin-induced protein 15A-like        88.6    4e-19   
ref|XP_010255166.1|  PREDICTED: indole-3-acetic acid-induced prot...  89.4    4e-19   
ref|XP_004147014.1|  PREDICTED: auxin-induced protein X10A-like       89.0    4e-19   
ref|XP_009347321.1|  PREDICTED: auxin-induced protein 15A-like        89.0    4e-19   
ref|XP_009615595.1|  PREDICTED: auxin-induced protein 15A-like        88.6    4e-19   
ref|XP_006365925.1|  PREDICTED: auxin-induced protein 10A5-like       89.0    4e-19   
ref|XP_010527467.1|  PREDICTED: auxin-induced protein 15A-like        88.6    4e-19   
ref|XP_011088768.1|  PREDICTED: auxin-induced protein 15A-like        89.4    4e-19   
ref|XP_010536046.1|  PREDICTED: auxin-induced protein 15A-like        89.7    4e-19   
emb|CBI17628.3|  unnamed protein product                              88.6    5e-19   
gb|KGN61879.1|  hypothetical protein Csa_2G258750                     89.0    5e-19   
ref|XP_008448016.1|  PREDICTED: auxin-induced protein 15A-like        89.0    5e-19   
ref|XP_003631553.1|  PREDICTED: auxin-induced protein X15-like        88.6    5e-19   
ref|XP_003607159.1|  Auxin-induced protein-like protein               88.6    5e-19   
ref|XP_009620280.1|  PREDICTED: auxin-induced protein 15A-like        88.2    6e-19   
ref|XP_011004678.1|  PREDICTED: auxin-induced protein 15A-like        89.0    6e-19   
ref|XP_006359634.1|  PREDICTED: auxin-induced protein 15A-like        88.2    6e-19   
ref|XP_008457638.1|  PREDICTED: auxin-induced protein 15A-like        88.6    6e-19   
ref|XP_008448002.1|  PREDICTED: auxin-induced protein 15A-like        88.6    6e-19   
gb|EPS58732.1|  hypothetical protein M569_16082                       88.6    6e-19   
ref|XP_002313746.2|  hypothetical protein POPTR_0009s13040g           88.6    7e-19   
gb|ABK22919.1|  unknown                                               90.5    7e-19   
ref|XP_004230981.1|  PREDICTED: auxin-induced protein 15A-like        88.2    7e-19   
gb|EYU23191.1|  hypothetical protein MIMGU_mgv1a020984mg              88.2    7e-19   
gb|KCW55447.1|  hypothetical protein EUGRSUZ_I01349                   88.2    7e-19   
ref|XP_004147006.1|  PREDICTED: auxin-induced protein 10A5-like       88.2    7e-19   
ref|XP_004501106.1|  PREDICTED: auxin-induced protein X10A-like       88.6    8e-19   
gb|AFW85957.1|  hypothetical protein ZEAMMB73_461401                  89.0    8e-19   
ref|XP_007041990.1|  SAUR family protein                              88.2    8e-19   
ref|XP_004147013.1|  PREDICTED: auxin-induced protein 10A5-like       88.2    8e-19   
ref|XP_010246401.1|  PREDICTED: auxin-induced protein 15A-like        88.2    8e-19   
ref|XP_006400350.1|  hypothetical protein EUTSA_v10015720mg           88.2    8e-19   
ref|XP_009765341.1|  PREDICTED: auxin-induced protein 15A-like        89.4    8e-19   
ref|XP_010315354.1|  PREDICTED: auxin-induced protein 15A-like        87.8    8e-19   
emb|CAN62606.1|  hypothetical protein VITISV_016867                   87.4    8e-19   
ref|XP_010271405.1|  PREDICTED: auxin-induced protein 15A-like        88.6    9e-19   
ref|XP_002271794.1|  PREDICTED: auxin-induced protein 15A-like        88.2    9e-19   
ref|XP_008448010.1|  PREDICTED: auxin-induced protein 15A-like        88.2    9e-19   
ref|XP_009108669.1|  PREDICTED: auxin-induced protein 15A             88.2    9e-19   
ref|XP_004231003.1|  PREDICTED: auxin-induced protein 15A-like        87.8    9e-19   
ref|XP_004147060.1|  PREDICTED: uncharacterized protein LOC101203413  90.5    1e-18   
emb|CDY02650.1|  BnaC02g07850D                                        88.2    1e-18   
ref|XP_009358224.1|  PREDICTED: auxin-induced protein 15A-like        88.2    1e-18   
ref|XP_009620278.1|  PREDICTED: auxin-induced protein 15A-like        87.8    1e-18   
gb|KDO42791.1|  hypothetical protein CISIN_1g039421mg                 88.2    1e-18   
ref|XP_006494595.1|  PREDICTED: auxin-induced protein 10A5-like       88.2    1e-18   
ref|XP_006423556.1|  hypothetical protein CICLE_v10030035mg           88.2    1e-18   
ref|XP_008448013.1|  PREDICTED: auxin-induced protein 15A-like        88.2    1e-18   
ref|XP_004172954.1|  PREDICTED: auxin-induced protein X10A-like       88.2    1e-18   
gb|KHN25461.1|  Auxin-induced protein X10A                            87.8    1e-18   
ref|XP_009121020.1|  PREDICTED: auxin-induced protein 15A-like        87.8    1e-18   
ref|XP_004163654.1|  PREDICTED: auxin-induced protein 15A-like        88.2    1e-18   
ref|XP_011088531.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  90.1    1e-18   
ref|XP_004230986.1|  PREDICTED: auxin-induced protein 15A-like        87.8    1e-18   
ref|XP_011046971.1|  PREDICTED: indole-3-acetic acid-induced prot...  89.0    1e-18   
ref|XP_010271400.1|  PREDICTED: auxin-induced protein 6B-like         87.8    1e-18   
ref|XP_008448014.1|  PREDICTED: auxin-induced protein 15A-like        87.8    1e-18   
ref|XP_010691632.1|  PREDICTED: auxin-induced protein 15A-like        87.4    1e-18   
ref|XP_010691631.1|  PREDICTED: auxin-induced protein X15-like        87.4    1e-18   
ref|XP_010315344.1|  PREDICTED: auxin-induced protein 15A-like        87.4    1e-18   
ref|XP_010246396.1|  PREDICTED: auxin-induced protein 15A-like        87.8    1e-18   
ref|XP_010691630.1|  PREDICTED: auxin-induced protein X15             87.8    1e-18   
ref|XP_002271501.1|  PREDICTED: auxin-induced protein X15             87.4    1e-18   
ref|XP_002271861.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  90.1    1e-18   
ref|XP_002272231.1|  PREDICTED: auxin-induced protein X15-like        87.4    1e-18   
ref|XP_010447034.1|  PREDICTED: auxin-induced protein 15A-like        87.8    1e-18   
ref|XP_007201638.1|  hypothetical protein PRUPE_ppa021647mg           87.8    1e-18   
emb|CBI37962.3|  unnamed protein product                              88.6    1e-18   



>ref|XP_007041995.1| SAUR family protein [Theobroma cacao]
 gb|EOX97826.1| SAUR family protein [Theobroma cacao]
Length=104

 Score =   177 bits (449),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 93/105 (89%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MAI RK +KL QTAVLKQILKRCSSLGKK+GYD      DVPKGHF VYVGENRSRY+VP
Sbjct  1    MAI-RKSSKLPQTAVLKQILKRCSSLGKKHGYDEDGLPLDVPKGHFAVYVGENRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFLTHPEFQCLLRRAEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  60   ISFLTHPEFQCLLRRAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  104



>ref|XP_007201436.1| hypothetical protein PRUPE_ppa013764mg [Prunus persica]
 ref|XP_008236818.1| PREDICTED: auxin-induced protein 15A-like [Prunus mume]
 gb|EMJ02635.1| hypothetical protein PRUPE_ppa013764mg [Prunus persica]
Length=104

 Score =   177 bits (448),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 92/102 (90%), Gaps = 6/102 (6%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISF  350
            +RK  KLAQTAVLKQILKRCSSLGKK+GYD      DVPKGHFPVYVGENR+RY+VPISF
Sbjct  3    IRKSNKLAQTAVLKQILKRCSSLGKKHGYDEDGLPLDVPKGHFPVYVGENRTRYIVPISF  62

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            LTHP+FQCLLR+AEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  63   LTHPQFQCLLRQAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  104



>ref|XP_010548084.1| PREDICTED: auxin-induced protein 15A-like [Tarenaya hassleriana]
Length=104

 Score =   177 bits (448),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 92/101 (91%), Gaps = 6/101 (6%)
 Frame = -3

Query  508  RKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISFL  347
            +KPAKL QTA+LKQILKRCSSLGKK GY+      DVPKGHFPVYVG+NRSRYVVPISFL
Sbjct  4    KKPAKLTQTAMLKQILKRCSSLGKKQGYEEDGLCLDVPKGHFPVYVGQNRSRYVVPISFL  63

Query  346  THPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            THPEFQCLLRRAEEEFGFDHDMG+TIPCEEVAF++LT M+R
Sbjct  64   THPEFQCLLRRAEEEFGFDHDMGLTIPCEEVAFQALTSMIR  104



>ref|XP_002270504.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera]
 emb|CAN82489.1| hypothetical protein VITISV_036184 [Vitis vinifera]
Length=104

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 92/105 (88%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MAI RK  KL QTAVLKQILKRCSSLGKKNGYD      DVPKGHF VYVGENRSRY+VP
Sbjct  1    MAI-RKSNKLPQTAVLKQILKRCSSLGKKNGYDEDGLPLDVPKGHFAVYVGENRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFL+HPEFQCLL+RAEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  60   ISFLSHPEFQCLLQRAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  104



>ref|XP_008382358.1| PREDICTED: auxin-induced protein 15A [Malus domestica]
Length=104

 Score =   176 bits (445),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 92/102 (90%), Gaps = 6/102 (6%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISF  350
            +RKP KLAQTAVLKQILKRCSSLGKK+GYD      DVPKGHFPVYVGENR+RY+VPISF
Sbjct  3    IRKPNKLAQTAVLKQILKRCSSLGKKHGYDEDGLPIDVPKGHFPVYVGENRTRYIVPISF  62

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            LTHP+FQCLLR+AEEEFGFDHDMG+TIPCEE  FRSLT ML+
Sbjct  63   LTHPQFQCLLRQAEEEFGFDHDMGLTIPCEEEVFRSLTSMLK  104



>emb|CDO96975.1| unnamed protein product [Coffea canephora]
Length=105

 Score =   175 bits (444),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 91/105 (87%), Gaps = 6/105 (6%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MAI +  +KL Q AV+KQILKRCSSLGKK+GYD      DVPKGHF VYVGENRSRY+VP
Sbjct  1    MAIRKSSSKLPQAAVIKQILKRCSSLGKKHGYDEDGLPLDVPKGHFAVYVGENRSRYIVP  60

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFLTHPEFQCLLRRAEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  61   ISFLTHPEFQCLLRRAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  105



>ref|XP_009379569.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=105

 Score =   175 bits (443),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 6/101 (6%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISF  350
            +RK  KLAQTAVLKQILKRCSSLGKK+GYD      DVPKGHFPVYVGENR+RY+VPISF
Sbjct  3    IRKTNKLAQTAVLKQILKRCSSLGKKHGYDEDGLPIDVPKGHFPVYVGENRTRYIVPISF  62

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            LTHP+FQCLLR+AEEEFGFDHDMG+TIPCEEV FRSLT ML
Sbjct  63   LTHPQFQCLLRQAEEEFGFDHDMGLTIPCEEVVFRSLTSML  103



>ref|XP_009347329.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=104

 Score =   175 bits (443),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 91/102 (89%), Gaps = 6/102 (6%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISF  350
            +RKP KLAQTAVLKQILKRCSSLGKK GYD      DVPKGHFPVYVGENR+RY+VPISF
Sbjct  3    IRKPNKLAQTAVLKQILKRCSSLGKKYGYDEDGLPIDVPKGHFPVYVGENRTRYIVPISF  62

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            LTHP+FQCLLR+AEEEFGFDHDMG+TIPCEE  FRSLT ML+
Sbjct  63   LTHPQFQCLLRQAEEEFGFDHDMGLTIPCEEEVFRSLTSMLK  104



>ref|XP_010530799.1| PREDICTED: auxin-induced protein 15A [Tarenaya hassleriana]
Length=104

 Score =   174 bits (440),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 6/102 (6%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISF  350
            ++KPA+L QTA+LKQI+KRCSSLGKK GYD      DVPKGHFPVYVG+NRSRY+VPISF
Sbjct  3    IKKPARLTQTAMLKQIMKRCSSLGKKQGYDEDGLPLDVPKGHFPVYVGQNRSRYIVPISF  62

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            LTHPEFQCLLRRAEEEFGFDHDMG+TIPCEEV F++LT M++
Sbjct  63   LTHPEFQCLLRRAEEEFGFDHDMGLTIPCEEVVFQALTSMIK  104



>ref|XP_009108706.1| PREDICTED: auxin-induced protein 15A-like [Brassica rapa]
Length=107

 Score =   174 bits (440),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 93/107 (87%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YDD------VPKGHFPVYVGENRSRYV  365
            MAIM+K  KL QTA+LKQILKRCSSLGKKNG  YDD      VPKGHFPVYVGENRSRY+
Sbjct  1    MAIMKKSLKLTQTAMLKQILKRCSSLGKKNGRGYDDDYLPLDVPKGHFPVYVGENRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VP+SFLTHPEFQ LLRRAEEEFGFDHDMG+TIPC+EV F+SLT M+R
Sbjct  61   VPVSFLTHPEFQFLLRRAEEEFGFDHDMGLTIPCDEVVFQSLTSMIR  107



>ref|NP_001147174.1| SAUR9 - auxin-responsive SAUR family member [Zea mays]
 gb|ACG25834.1| SAUR9 - auxin-responsive SAUR family member [Zea mays]
 emb|CDY70461.1| BnaCnng68470D [Brassica napus]
 emb|CDY63257.1| BnaA03g58660D [Brassica napus]
 emb|CDX76303.1| BnaA08g10970D [Brassica napus]
Length=107

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 93/107 (87%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YDD------VPKGHFPVYVGENRSRYV  365
            MAIM+K  KL QTA+LKQILKRCSSLGKKNG  YDD      VPKGHFPVYVGENRSRY+
Sbjct  1    MAIMKKSLKLTQTAMLKQILKRCSSLGKKNGGGYDDDYLPLDVPKGHFPVYVGENRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VP+SFLTHPEFQ LLRRAEEEFGFDHDMG+TIPC+EV F+SLT M+R
Sbjct  61   VPVSFLTHPEFQFLLRRAEEEFGFDHDMGLTIPCDEVVFQSLTSMIR  107



>ref|XP_006284811.1| hypothetical protein CARUB_v10006081mg [Capsella rubella]
 gb|EOA17709.1| hypothetical protein CARUB_v10006081mg [Capsella rubella]
Length=107

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YD------DVPKGHFPVYVGENRSRYV  365
            MAI++K +KL QTA+LKQILKRCSSLGKKNG  YD      DVPKGHFPVYVGENRSRY+
Sbjct  1    MAIIKKTSKLTQTAMLKQILKRCSSLGKKNGGGYDEDCLPLDVPKGHFPVYVGENRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHPEFQ LLRRAEEEFGFDHDMG+TIPC+E+AF++LT M+R
Sbjct  61   VPISFLTHPEFQTLLRRAEEEFGFDHDMGLTIPCDELAFQTLTSMIR  107



>ref|XP_010432377.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
 ref|XP_010447036.1| PREDICTED: auxin-induced protein 15A [Camelina sativa]
Length=107

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YD------DVPKGHFPVYVGENRSRYV  365
            MAI++K +KL QTA+LKQILKRCSSLGKKNG  YD      DVPKGHFPVYVGENRSRY+
Sbjct  1    MAIIKKTSKLTQTAMLKQILKRCSSLGKKNGGGYDEDCLPLDVPKGHFPVYVGENRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHPEFQ LLRRAEEEFGFDHDMG+TIPC+E+AF++LT M+R
Sbjct  61   VPISFLTHPEFQSLLRRAEEEFGFDHDMGLTIPCDELAFQTLTSMIR  107



>ref|XP_004507523.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Cicer 
arietinum]
Length=102

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/102 (82%), Positives = 89/102 (87%), Gaps = 3/102 (3%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD---DVPKGHFPVYVGENRSRYVVPISF  350
            MAI +   KL Q AVLKQILKRCSSLGKKN YD   DVPKGHFPVYVGENRSRYVVPISF
Sbjct  1    MAIKKYSNKLPQNAVLKQILKRCSSLGKKNEYDHNLDVPKGHFPVYVGENRSRYVVPISF  60

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            LTHPEFQ LLR+AEEEFGFDHDMG+TIPCEE+ FRSLT M+R
Sbjct  61   LTHPEFQSLLRQAEEEFGFDHDMGLTIPCEELVFRSLTSMIR  102



>ref|XP_010437567.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=107

 Score =   172 bits (437),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 95/107 (89%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YD------DVPKGHFPVYVGENRSRYV  365
            MAI++K +K+ QTA+LKQILKRCSSLGKKNG  YD      DVPKGHFPVYVGENRSRY+
Sbjct  1    MAIIKKTSKVTQTAMLKQILKRCSSLGKKNGGGYDEDCLPLDVPKGHFPVYVGENRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHPEFQ LLRRAEEEFGFDHDMG+TIPC+E+AF++LT M+R
Sbjct  61   VPISFLTHPEFQSLLRRAEEEFGFDHDMGLTIPCDELAFQTLTSMIR  107



>ref|XP_010665869.1| PREDICTED: auxin-induced protein 15A-like [Beta vulgaris subsp. 
vulgaris]
Length=104

 Score =   172 bits (436),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 6/101 (6%)
 Frame = -3

Query  508  RKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISFL  347
            RK  KL+Q+A+LKQILKRCSSLGKK+GYD      DVPKGHF VYVGENRSRY+VPISFL
Sbjct  4    RKSNKLSQSALLKQILKRCSSLGKKHGYDEDGLPLDVPKGHFAVYVGENRSRYIVPISFL  63

Query  346  THPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +HP+FQCLLRRAEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  64   SHPQFQCLLRRAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  104



>ref|XP_009138325.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Brassica 
rapa]
Length=140

 Score =   173 bits (439),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YD------DVPKGHFPVYVGENRSRYV  365
            MAIM+K +KL QTA+LKQILKRCSSLGK NG  YD      DVPKGHFPVYVGENRSRY+
Sbjct  34   MAIMKKSSKLTQTAMLKQILKRCSSLGKTNGGGYDEDFLPLDVPKGHFPVYVGENRSRYI  93

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VP+SFLTHPEFQ LLRRAEEEFGFDHDMGITIPC+E+ F++LT ++R
Sbjct  94   VPVSFLTHPEFQSLLRRAEEEFGFDHDMGITIPCDELVFQNLTSVIR  140



>ref|NP_195202.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 emb|CAA18855.1| putative auxin-regulated protein [Arabidopsis thaliana]
 emb|CAB80193.1| putative auxin-regulated protein [Arabidopsis thaliana]
 gb|AAM60931.1| putative auxin-regulated protein [Arabidopsis thaliana]
 gb|AEE86420.1| SAUR-like auxin-responsive protein 9 [Arabidopsis thaliana]
Length=107

 Score =   172 bits (436),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 94/107 (88%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YD------DVPKGHFPVYVGENRSRYV  365
            MAIM+K +KL QTA+LKQILKRCSSLGKKNG  YD      DVPKGHFPVYVGENRSRY+
Sbjct  1    MAIMKKTSKLTQTAMLKQILKRCSSLGKKNGGGYDEDCLPLDVPKGHFPVYVGENRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHPEFQ LL+RAEEEFGFDHDMG+TIPC+E+ F++LT M+R
Sbjct  61   VPISFLTHPEFQSLLQRAEEEFGFDHDMGLTIPCDELVFQTLTSMIR  107



>ref|XP_009109058.1| PREDICTED: auxin-induced protein 15A [Brassica rapa]
Length=107

 Score =   172 bits (435),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 93/107 (87%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YD------DVPKGHFPVYVGENRSRYV  365
            MAIM+K +KL QTA+LKQILKRCSSLGKKNG  YD      DVPKGHFPVYVGENRSRY+
Sbjct  1    MAIMKKSSKLTQTAMLKQILKRCSSLGKKNGGGYDEECLPLDVPKGHFPVYVGENRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHPEFQ LL RAEEEFGFDHDMG+TIPC+E+ F++LT M+R
Sbjct  61   VPISFLTHPEFQTLLSRAEEEFGFDHDMGLTIPCDELVFQTLTSMIR  107



>emb|CDX75460.1| BnaA01g02420D [Brassica napus]
Length=107

 Score =   171 bits (434),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 93/107 (87%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YD------DVPKGHFPVYVGENRSRYV  365
            MAIM+K +KL QTA+LKQILKRCSSLGKKNG  YD      DVPKGHFPVYVGENRSRY+
Sbjct  1    MAIMKKSSKLTQTAMLKQILKRCSSLGKKNGGGYDEECLPLDVPKGHFPVYVGENRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHPEFQ LL RAEEEFGFDHDMG+TIPC+E+ F++LT M+R
Sbjct  61   VPISFLTHPEFQTLLIRAEEEFGFDHDMGLTIPCDEIVFQTLTSMIR  107



>ref|XP_002313002.2| hypothetical protein POPTR_0009s12890g [Populus trichocarpa]
 gb|EEE86957.2| hypothetical protein POPTR_0009s12890g [Populus trichocarpa]
Length=162

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 91/105 (87%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVVP  359
            MAI RK  KL QTAVLKQILKRCSSLGKK+GYDD      VPKGHF VYVGENRSRY+VP
Sbjct  59   MAI-RKSQKLPQTAVLKQILKRCSSLGKKHGYDDDGLPLDVPKGHFAVYVGENRSRYIVP  117

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFL+HPEFQ LL+RAEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  118  ISFLSHPEFQFLLQRAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  162



>emb|CDY45331.1| BnaA03g53040D [Brassica napus]
Length=107

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YD------DVPKGHFPVYVGENRSRYV  365
            MAIM+K +KL QTA+LKQILKRCSSLGK NG  YD      DVPKGHFPVYVGENRSRY+
Sbjct  1    MAIMKKSSKLTQTAMLKQILKRCSSLGKTNGGGYDEDFLPLDVPKGHFPVYVGENRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VP+SFLTHPEFQ LLRRAEEEFGFDHDMGITIPC+E+ F++LT ++R
Sbjct  61   VPVSFLTHPEFQSLLRRAEEEFGFDHDMGITIPCDELVFQNLTSVIR  107



>gb|AAK68742.2| Putative auxin-regulated protein [Arabidopsis thaliana]
 gb|AAN15677.1| Putative auxin-regulated protein [Arabidopsis thaliana]
Length=107

 Score =   171 bits (432),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 94/107 (88%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YD------DVPKGHFPVYVGENRSRYV  365
            MAIM+K +KL QTA+L+QILKRCSSLGKKNG  YD      DVPKGHFPVYVGENRSRY+
Sbjct  1    MAIMKKTSKLTQTAMLEQILKRCSSLGKKNGGGYDEDCLPLDVPKGHFPVYVGENRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHPEFQ LL+RAEEEFGFDHDMG+TIPC+E+ F++LT M+R
Sbjct  61   VPISFLTHPEFQSLLQRAEEEFGFDHDMGLTIPCDELVFQTLTSMIR  107



>ref|XP_002306147.1| auxin-responsive family protein [Populus trichocarpa]
 ref|XP_011037240.1| PREDICTED: auxin-induced protein 15A [Populus euphratica]
 gb|EEE86658.1| auxin-responsive family protein [Populus trichocarpa]
 gb|AGM20677.1| AUX/IAA [Populus tomentosa]
Length=104

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 91/105 (87%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVVP  359
            MAI RK  KL QTAVLKQILKRCSSLGKK+GYDD      VPKGHF VYVGENRSRY+VP
Sbjct  1    MAI-RKSHKLPQTAVLKQILKRCSSLGKKHGYDDDGLPLDVPKGHFAVYVGENRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFL+HPEFQ LL+RAEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  60   ISFLSHPEFQSLLQRAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  104



>ref|XP_006412187.1| hypothetical protein EUTSA_v10026631mg [Eutrema salsugineum]
 gb|ESQ53640.1| hypothetical protein EUTSA_v10026631mg [Eutrema salsugineum]
Length=107

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YD------DVPKGHFPVYVGENRSRYV  365
            MAIM+K +KL QTA+LKQIL+RCSSLGKKNG  YD      DVPKGHFPVYVG NRSRY+
Sbjct  1    MAIMKKSSKLTQTAMLKQILRRCSSLGKKNGGGYDEDFLPLDVPKGHFPVYVGVNRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHPEFQ LLRRAEEEFGFDHDMG+TIPC+E+ F++LT M+R
Sbjct  61   VPISFLTHPEFQSLLRRAEEEFGFDHDMGLTIPCDELVFQTLTSMIR  107



>ref|XP_004230993.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=105

 Score =   170 bits (430),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 90/106 (85%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  K+ Q A+LKQILKRCSSLGKKN Y+D       VPKGHF VYVGENRSRY+V
Sbjct  1    MAI-RKSNKMPQAAILKQILKRCSSLGKKNSYNDEDHLPIDVPKGHFAVYVGENRSRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLTHPEFQCLLR++EEEFGFDHDMGITIPCEEV FRSLT MLR
Sbjct  60   PISFLTHPEFQCLLRQSEEEFGFDHDMGITIPCEEVVFRSLTSMLR  105



>gb|ABK94211.1| unknown [Populus trichocarpa]
 gb|AFT92006.1| SAUR family protein [Populus alba x Populus glandulosa]
 gb|AFT92018.1| SAUR family protein [Populus alba x Populus glandulosa]
Length=104

 Score =   170 bits (430),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 91/105 (87%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVVP  359
            MAI RK  KL QTAVLKQILKRCSSLGKK+GYDD      VPKGHF VYVGENRSRY+VP
Sbjct  1    MAI-RKSQKLPQTAVLKQILKRCSSLGKKHGYDDDGLPLDVPKGHFAVYVGENRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFL+HPEFQ LL+RAEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  60   ISFLSHPEFQFLLQRAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  104



>ref|XP_009627092.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=105

 Score =   169 bits (429),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 91/106 (86%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  KL QTAVLKQILK+CSSLGKK+ Y+D       VPKGHF VYVGENR+RY++
Sbjct  1    MAI-RKTNKLPQTAVLKQILKKCSSLGKKHDYNDEDGLPLDVPKGHFAVYVGENRTRYII  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEV FRSLT MLR
Sbjct  60   PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVVFRSLTSMLR  105



>emb|CDX72500.1| BnaC07g45220D [Brassica napus]
Length=107

 Score =   169 bits (429),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 94/107 (88%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YD------DVPKGHFPVYVGENRSRYV  365
            MAIM+K +K+ QTA+LK+ILKRCSSLGKKNG  YD      DVPKGHFPVYVG+NRSRY+
Sbjct  1    MAIMKKSSKVTQTAMLKKILKRCSSLGKKNGGEYDEDFLPLDVPKGHFPVYVGDNRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VP+SFLTHPEFQ LLRRAEEEFGFDHDMG+TIPC+E+ F++LT M+R
Sbjct  61   VPVSFLTHPEFQSLLRRAEEEFGFDHDMGLTIPCDELVFQNLTSMIR  107



>ref|XP_009766631.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=105

 Score =   169 bits (428),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 91/106 (86%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  KL QTAVLKQILK+CSSLGKK+GY+D       VPKGHF VYVGENR+RY++
Sbjct  1    MAI-RKTNKLPQTAVLKQILKKCSSLGKKHGYNDEDGLPLDVPKGHFAVYVGENRTRYII  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLTHPEFQCLLRR EEEFGFDH+MGITIPCEEV FRSLT MLR
Sbjct  60   PISFLTHPEFQCLLRRTEEEFGFDHEMGITIPCEEVVFRSLTSMLR  105



>emb|CDX69086.1| BnaC01g03670D [Brassica napus]
Length=107

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 91/107 (85%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD--------DVPKGHFPVYVGENRSRYV  365
            MAIM+K +KL QTA+LKQILKRCSSLGKKNG D        DVPKGHFPVYVGENRSRY+
Sbjct  1    MAIMKKSSKLTQTAMLKQILKRCSSLGKKNGGDYDEECLPLDVPKGHFPVYVGENRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHPEFQ  L RAEEEFGFDHDMG+TIPC+E+ F++LT M+R
Sbjct  61   VPISFLTHPEFQTPLSRAEEEFGFDHDMGLTIPCDELVFQTLTSMIR  107



>ref|XP_006359615.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum 
tuberosum]
Length=105

 Score =   169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 90/106 (85%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  K+ Q A+LKQILKRCSSLGKKN Y+D       VPKGHF VYVGENR+RY+V
Sbjct  1    MAI-RKSNKMPQAAILKQILKRCSSLGKKNSYNDEDHLPIDVPKGHFAVYVGENRTRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLTHPEFQCLLR++EEEFGFDHDMGITIPCEEV FRSLT MLR
Sbjct  60   PISFLTHPEFQCLLRQSEEEFGFDHDMGITIPCEEVVFRSLTSMLR  105



>ref|XP_011047025.1| PREDICTED: uncharacterized protein LOC105141486 [Populus euphratica]
Length=162

 Score =   171 bits (432),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 90/105 (86%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVVP  359
            MAI RK  KL QTAVLKQILKRCSSLGKK+GYDD      VPKGHF VYVGENR RY+VP
Sbjct  59   MAI-RKSQKLPQTAVLKQILKRCSSLGKKHGYDDDGLPLDVPKGHFAVYVGENRRRYIVP  117

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFL+HPEFQ LL+RAEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  118  ISFLSHPEFQFLLQRAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  162



>ref|XP_004500759.1| PREDICTED: auxin-induced protein 15A-like [Cicer arietinum]
 ref|XP_004517179.1| PREDICTED: auxin-induced protein 15A-like [Cicer arietinum]
Length=110

 Score =   169 bits (427),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 88/110 (80%), Gaps = 11/110 (10%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-----------VPKGHFPVYVGENRS  374
            MAI  K  KL QT VLKQILKRCSSLGKKNGY+D           VPKGHF VYVGENRS
Sbjct  1    MAIRSKSTKLVQTTVLKQILKRCSSLGKKNGYEDEEEDDGTLPHDVPKGHFAVYVGENRS  60

Query  373  RYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            RY+VPISFLTHP FQ LLR+AEEEFGFDHDMG+TIPC+EV FRSLT M+R
Sbjct  61   RYIVPISFLTHPHFQTLLRQAEEEFGFDHDMGLTIPCQEVVFRSLTSMIR  110



>ref|XP_010113367.1| hypothetical protein L484_026699 [Morus notabilis]
 gb|EXC35374.1| hypothetical protein L484_026699 [Morus notabilis]
Length=105

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 7/102 (7%)
 Frame = -3

Query  508  RKPAKLAQTAVLKQILKRCSSLGKKNGY-------DDVPKGHFPVYVGENRSRYVVPISF  350
            +K  KLAQTAVLKQILKRCSS GKKNGY       DDVPKGHF VYVG+NRSRY+VPIS+
Sbjct  4    KKSNKLAQTAVLKQILKRCSSFGKKNGYNEQGLIPDDVPKGHFAVYVGQNRSRYIVPISW  63

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            L HPEFQ LL+RAEEEFGFDHDMGITIPCEEV FR+LT M+R
Sbjct  64   LAHPEFQSLLQRAEEEFGFDHDMGITIPCEEVVFRNLTAMIR  105



>ref|XP_003527098.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Glycine 
max]
 gb|KHN20023.1| Auxin-induced protein 15A [Glycine soja]
 gb|KHN33706.1| Auxin-induced protein 15A [Glycine soja]
Length=106

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 88/105 (84%), Gaps = 6/105 (6%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVVP  359
            MAI +     +QT VLKQILKRCSSLGKKNGYDD      VPKGHF VYVG+NRSRY+VP
Sbjct  1    MAIRKSNKTTSQTTVLKQILKRCSSLGKKNGYDDDGLPLDVPKGHFAVYVGQNRSRYIVP  60

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFLTHPEFQ LLR+AEEEFGFDH+MG+TIPCEEV FRSLT MLR
Sbjct  61   ISFLTHPEFQSLLRQAEEEFGFDHEMGLTIPCEEVVFRSLTSMLR  105



>ref|XP_009589238.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=107

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 91/107 (85%), Gaps = 9/107 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD--------DVPKGHFPVYVGENRSRYV  365
            MAI RKP KL+Q  VLKQILKRCSSLGKK GYD        DVPKGHF VYVGENR+RYV
Sbjct  1    MAI-RKPNKLSQATVLKQILKRCSSLGKKQGYDNEDYCLPIDVPKGHFAVYVGENRTRYV  59

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHP+FQCLL++AEEEFGFDHDMGITIPCEE+ F+SLT M+R
Sbjct  60   VPISFLTHPQFQCLLQQAEEEFGFDHDMGITIPCEELVFQSLTSMIR  106



>ref|XP_002867104.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43363.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
Length=107

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD--------DVPKGHFPVYVGENRSRYV  365
            MAI++K +KL QTA+LKQILKRCSSLGKKNG          DVPKGHFPVYVGENRSRY+
Sbjct  1    MAIIKKTSKLTQTAMLKQILKRCSSLGKKNGGGCDDDCLPLDVPKGHFPVYVGENRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHPEFQ LL+RAEEEFGFDHDMG+TIPC+E+ F++LT M+R
Sbjct  61   VPISFLTHPEFQSLLQRAEEEFGFDHDMGLTIPCDELVFQTLTSMIR  107



>ref|XP_004290373.1| PREDICTED: auxin-induced protein 15A-like [Fragaria vesca subsp. 
vesca]
Length=105

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/106 (81%), Positives = 92/106 (87%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKK-NGYD------DVPKGHFPVYVGENRSRYVV  362
            MA+ RK  KL QTAVLKQILKRCSSLGKK +GYD      DVPKGHFPVYVGENR+RY+V
Sbjct  1    MAV-RKYNKLPQTAVLKQILKRCSSLGKKQHGYDEDGLPIDVPKGHFPVYVGENRTRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLTHPEFQCLLR+AEEEFGFDHDMG+TIPCEEV FRSLT  LR
Sbjct  60   PISFLTHPEFQCLLRQAEEEFGFDHDMGLTIPCEEVVFRSLTSTLR  105



>gb|EYU37907.1| hypothetical protein MIMGU_mgv1a020562mg [Erythranthe guttata]
Length=106

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 88/106 (83%), Gaps = 7/106 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            M +  K  +L Q  +LKQILKRCSSLGKKNGYDD       VPKGHF VYVG+NRSRY+V
Sbjct  1    MGMKSKSNRLPQAVLLKQILKRCSSLGKKNGYDDECSLPEDVPKGHFAVYVGQNRSRYIV  60

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLTHPEFQCLLRRAEEEFGFDH+MG+T+PCEEV FRSLT MLR
Sbjct  61   PISFLTHPEFQCLLRRAEEEFGFDHEMGLTLPCEEVVFRSLTSMLR  106



>ref|XP_010246407.1| PREDICTED: auxin-induced protein 15A [Nelumbo nucifera]
Length=104

 Score =   167 bits (422),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 86/102 (84%), Gaps = 6/102 (6%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVVPISF  350
            +RK  KL QTAV+KQILKRCSSLGKK GYDD      VPKGHF VYVGE RSRY+VPIS 
Sbjct  3    LRKSNKLPQTAVIKQILKRCSSLGKKQGYDDEGLPVDVPKGHFAVYVGEKRSRYIVPISL  62

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            LTHPEFQ LL+RAEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  63   LTHPEFQSLLQRAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  104



>gb|AFT92005.1| SAUR family protein [Populus tomentosa]
 gb|AFT92017.1| SAUR family protein [Populus tomentosa]
Length=104

 Score =   167 bits (422),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 90/105 (86%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVVP  359
            MAI RK  KL QTAVLKQILKRCSSLGKK+GYDD      VPKGHF VYVGENRSRY+VP
Sbjct  1    MAI-RKSQKLPQTAVLKQILKRCSSLGKKHGYDDDGLPLDVPKGHFAVYVGENRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFL+HP+FQ LL+RAEEEFGFDHDMG+T PCEEV FRSLT MLR
Sbjct  60   ISFLSHPQFQFLLQRAEEEFGFDHDMGLTFPCEEVVFRSLTSMLR  104



>gb|KDP27623.1| hypothetical protein JCGZ_19628 [Jatropha curcas]
Length=104

 Score =   166 bits (421),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 90/105 (86%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVVP  359
            MAI RK  KL+QTAVLKQILKRCSSLGKK+GYDD      VPKGHF VYVGENRSRY+VP
Sbjct  1    MAI-RKSNKLSQTAVLKQILKRCSSLGKKHGYDDDGLPLDVPKGHFAVYVGENRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS LTHPEFQ LLR+AEEEFGFDH+MG+TIPCEEV FRSLT  LR
Sbjct  60   ISLLTHPEFQYLLRQAEEEFGFDHEMGLTIPCEEVVFRSLTSSLR  104



>ref|XP_009759020.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=107

 Score =   166 bits (421),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 90/107 (84%), Gaps = 9/107 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD--------DVPKGHFPVYVGENRSRYV  365
            MAI RK  KL+Q  VLKQILKRCSSLGKK GYD        DVPKGHF VYVGENR+RYV
Sbjct  1    MAI-RKSNKLSQATVLKQILKRCSSLGKKQGYDNEDYCLPIDVPKGHFAVYVGENRTRYV  59

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHP+FQCLL++AEEEFGFDHDMGITIPCEE+ F+SLT M+R
Sbjct  60   VPISFLTHPQFQCLLQQAEEEFGFDHDMGITIPCEEMVFQSLTSMIR  106



>ref|XP_011088533.1| PREDICTED: uncharacterized protein LOC105169738 [Sesamum indicum]
Length=153

 Score =   168 bits (425),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 90/106 (85%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI +K  KL Q A LKQIL+RCSSLGKKNGYDD       VPKGHF VYVGENRSR++V
Sbjct  49   MAI-KKSNKLPQAAALKQILRRCSSLGKKNGYDDQHELPDDVPKGHFAVYVGENRSRHIV  107

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFL+HPEFQCLLRRAEEEFGFDH+MG+TIPCEEV FRSLT MLR
Sbjct  108  PISFLSHPEFQCLLRRAEEEFGFDHEMGLTIPCEEVVFRSLTSMLR  153



>ref|XP_007135908.1| hypothetical protein PHAVU_009G002000g [Phaseolus vulgaris]
 gb|ESW07902.1| hypothetical protein PHAVU_009G002000g [Phaseolus vulgaris]
Length=104

 Score =   166 bits (420),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 89/106 (84%), Gaps = 9/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD-------DVPKGHFPVYVGENRSRYVV  362
            MAI  + AK +QT VLKQILKRCSSLGKKN YD       DVPKGHF VYVGENRSRY+V
Sbjct  1    MAI--RKAKTSQTKVLKQILKRCSSLGKKNDYDHDDALPLDVPKGHFAVYVGENRSRYIV  58

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLTHP+FQ LLR+AEEEFGFDHDMG+TIPC+EV FRSLT MLR
Sbjct  59   PISFLTHPQFQSLLRQAEEEFGFDHDMGLTIPCQEVVFRSLTSMLR  104



>ref|XP_010095663.1| hypothetical protein L484_012234 [Morus notabilis]
 gb|EXB61802.1| hypothetical protein L484_012234 [Morus notabilis]
Length=197

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 91/107 (85%), Gaps = 9/107 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKN--GYD------DVPKGHFPVYVGENRSRYV  365
            MAI RK  KL QTAVLKQILKRCSSLGKKN  GYD      DVPKGHF VYVGENR+RY+
Sbjct  92   MAI-RKANKLPQTAVLKQILKRCSSLGKKNNNGYDEDGLPLDVPKGHFAVYVGENRTRYI  150

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHPEFQ LLRRAEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  151  VPISFLTHPEFQSLLRRAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  197



>ref|NP_001237264.1| uncharacterized protein LOC100306339 [Glycine max]
 gb|ACU14466.1| unknown [Glycine max]
Length=106

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 87/105 (83%), Gaps = 6/105 (6%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVVP  359
            MAI +     +QT VLKQILKRCSSLGKKNGYDD      VPKGHF VYVG+NRSRY+VP
Sbjct  1    MAIRKSNKTTSQTTVLKQILKRCSSLGKKNGYDDDGLPLDVPKGHFAVYVGQNRSRYIVP  60

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFLTHPEFQ  LR+AEEEFGFDH+MG+TIPCEEV FRSLT MLR
Sbjct  61   ISFLTHPEFQSPLRQAEEEFGFDHEMGLTIPCEEVVFRSLTSMLR  105



>ref|XP_003604016.1| Auxin-induced protein 6B [Medicago truncatula]
 gb|AES74267.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=111

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 88/108 (81%), Gaps = 10/108 (9%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD----------DVPKGHFPVYVGENRSR  371
            MAI  K +KLAQ  VLKQIL+RCSSLGKKN YD          DVPKGHF VYVGENRSR
Sbjct  1    MAIRSKSSKLAQNTVLKQILRRCSSLGKKNEYDQDEDDHGLPLDVPKGHFAVYVGENRSR  60

Query  370  YVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            Y+VPISFLTHP+FQ LLR+AEEEFGFDHDMG+TIPC+EV FRSLT ++
Sbjct  61   YIVPISFLTHPQFQSLLRQAEEEFGFDHDMGLTIPCQEVVFRSLTSIM  108



>ref|XP_006409422.1| hypothetical protein EUTSA_v10023118mg [Eutrema salsugineum]
 gb|ESQ50875.1| hypothetical protein EUTSA_v10023118mg [Eutrema salsugineum]
Length=107

 Score =   165 bits (417),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG-----YD---DVPKGHFPVYVGENRSRYV  365
            MAI+++  KLAQTA+LKQILKRCSSLGKKNG     YD   DVPKGHFPVYVG NRSRY+
Sbjct  1    MAILKRSTKLAQTAMLKQILKRCSSLGKKNGRGYEQYDLPLDVPKGHFPVYVGHNRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLT+ +FQCLLRRAEEEFGFDHDMG+TIPC+E+ F+ LT M+R
Sbjct  61   VPISFLTNLDFQCLLRRAEEEFGFDHDMGLTIPCDELFFQDLTSMIR  107



>gb|KHG20301.1| Auxin-induced 15A [Gossypium arboreum]
Length=106

 Score =   164 bits (414),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 86/106 (81%), Gaps = 7/106 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  KLAQTA++KQILKRCSSLGKK  Y D       VPKGHF VYVGENRSRY+V
Sbjct  1    MAISRKSNKLAQTAMIKQILKRCSSLGKKQSYADEQGLPLDVPKGHFVVYVGENRSRYIV  60

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLT PEFQ LL  AEEEFGFDHDMG+TIPCEEV F+SLT MLR
Sbjct  61   PISFLTRPEFQSLLHEAEEEFGFDHDMGLTIPCEEVVFQSLTSMLR  106



>ref|XP_011092874.1| PREDICTED: auxin-induced protein 15A-like [Sesamum indicum]
Length=102

 Score =   164 bits (414),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 87/103 (84%), Gaps = 5/103 (5%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD----DVPKGHFPVYVGENRSRYVVPIS  353
            MAI +K  KL Q A LKQILKRCSSLGKK   D    DVPKGHF VYVGENRSRY+VPIS
Sbjct  1    MAI-KKSNKLPQAAALKQILKRCSSLGKKYDEDGLPVDVPKGHFAVYVGENRSRYIVPIS  59

Query  352  FLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            FLTHPEFQCLLRRAEEEFGFDH+MG+TIPCEEV FRSLT MLR
Sbjct  60   FLTHPEFQCLLRRAEEEFGFDHEMGLTIPCEEVVFRSLTSMLR  102



>ref|XP_003607093.1| Auxin-induced protein 15A [Medicago truncatula]
 gb|ACJ86136.1| unknown [Medicago truncatula]
 gb|AES89290.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
 gb|AFK45277.1| unknown [Medicago truncatula]
Length=100

 Score =   163 bits (413),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = -3

Query  520  MAIMRK-PAKLAQTAVLKQILKRCSSLGKKNGYDDVPKGHFPVYVGENRSRYVVPISFLT  344
            MAI++K   KL Q AVLKQILKRCSSLGK     DVPKGHFPVYVGENRSRY+VPISFLT
Sbjct  1    MAIIKKYSNKLPQNAVLKQILKRCSSLGKNEQPMDVPKGHFPVYVGENRSRYIVPISFLT  60

Query  343  HPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            HPEFQ LLR+AEEEFGFDHDMG+TIPC+EV F+SLT M+R
Sbjct  61   HPEFQSLLRQAEEEFGFDHDMGLTIPCQEVVFQSLTSMIR  100



>ref|XP_007131739.1| hypothetical protein PHAVU_011G037900g [Phaseolus vulgaris]
 gb|ESW03733.1| hypothetical protein PHAVU_011G037900g [Phaseolus vulgaris]
Length=104

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 88/105 (84%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVVP  359
            MAI RK  KL Q AVLKQILKRCSSLGKKNGY+D      VPKGHF VYVGENRSRY+VP
Sbjct  1    MAI-RKSNKLPQHAVLKQILKRCSSLGKKNGYEDDGHPGDVPKGHFAVYVGENRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFL HPEFQ LLR+AEEEFGFDH+MG+TIPCEEV FRSLT  LR
Sbjct  60   ISFLAHPEFQSLLRQAEEEFGFDHEMGLTIPCEEVVFRSLTSSLR  104



>ref|XP_006423533.1| hypothetical protein CICLE_v10029633mg [Citrus clementina]
 ref|XP_006487289.1| PREDICTED: auxin-induced protein 15A-like [Citrus sinensis]
 gb|ESR36773.1| hypothetical protein CICLE_v10029633mg [Citrus clementina]
 gb|KDO46695.1| hypothetical protein CISIN_1g046487mg [Citrus sinensis]
Length=106

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 91/107 (85%), Gaps = 9/107 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKK--NGYD------DVPKGHFPVYVGENRSRYV  365
            MAI RK +KL Q AVLKQILKRCSSLGKK  + YD      DVPKGHF VYVGE+RSRY+
Sbjct  1    MAI-RKSSKLPQAAVLKQILKRCSSLGKKQHSSYDEDGLPLDVPKGHFAVYVGEHRSRYI  59

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFL+HPEFQCLLR+AEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  60   VPISFLSHPEFQCLLRQAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  106



>ref|XP_009626194.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=105

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 90/106 (85%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  KL+Q  +LKQILKRCSSLGKK+GY+D       VPKGHF VYVGENR+RY+V
Sbjct  1    MAI-RKSNKLSQAVLLKQILKRCSSLGKKHGYNDEDCLPIDVPKGHFAVYVGENRTRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFL+HPEFQCLLR AEEEFGFDHDMGITIPCEE+ F+SLT MLR
Sbjct  60   PISFLSHPEFQCLLRFAEEEFGFDHDMGITIPCEELVFQSLTNMLR  105



>ref|XP_010917983.1| PREDICTED: auxin-induced protein 15A-like [Elaeis guineensis]
Length=103

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 88/104 (85%), Gaps = 6/104 (6%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD-----DVPKGHFPVYVGENRSRYVVPI  356
            MAI RK  KL QTAVLKQIL+RCSSLG+  G       DVPKGHFPVYVGENRSR++VPI
Sbjct  1    MAI-RKSNKLPQTAVLKQILRRCSSLGRSGGEQEGLPVDVPKGHFPVYVGENRSRFIVPI  59

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            S+L+HPEFQ LLRRAEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  60   SYLSHPEFQSLLRRAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  103



>ref|XP_010516567.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=108

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 90/108 (83%), Gaps = 9/108 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD---------DVPKGHFPVYVGENRSRY  368
            MAI++K  KLAQTA+L+QILKRCSSLGKKNG           DVPKGHFPVYVG NRSRY
Sbjct  1    MAILKKSTKLAQTAMLRQILKRCSSLGKKNGGGGYIESDLPLDVPKGHFPVYVGNNRSRY  60

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +VPISFLT+ +FQCLLRRAEEEFGFDHDMG+TIPC+E+ F+ LT M+R
Sbjct  61   IVPISFLTNLDFQCLLRRAEEEFGFDHDMGLTIPCDELFFQDLTSMIR  108



>emb|CDP07416.1| unnamed protein product [Coffea canephora]
Length=105

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 86/105 (82%), Gaps = 6/105 (6%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MAI +   K +Q AV+KQI+KRCSSLGKK GYD      DVPKGHF VYVGENR+RY+VP
Sbjct  1    MAIRKSSNKFSQAAVIKQIMKRCSSLGKKQGYDEEGLPVDVPKGHFVVYVGENRTRYIVP  60

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFLT PEFQ LL+RAEEEFGFDHDMG+TIPCEEV F SLT MLR
Sbjct  61   ISFLTRPEFQILLQRAEEEFGFDHDMGLTIPCEEVVFESLTSMLR  105



>ref|XP_006299025.1| hypothetical protein CARUB_v10015162mg [Capsella rubella]
 gb|EOA31923.1| hypothetical protein CARUB_v10015162mg [Capsella rubella]
Length=107

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD--------DVPKGHFPVYVGENRSRYV  365
            MAI++K +KLAQTA+L+QILKRCSSLGKKNG          DVPKGHFPVYVG NRSRY+
Sbjct  1    MAILKKSSKLAQTAMLRQILKRCSSLGKKNGGGYVEDDLPLDVPKGHFPVYVGHNRSRYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLT+ +FQCLLRRAEEEFGFDHDMG+TIPC+E+ F+ LT M+R
Sbjct  61   VPISFLTNLDFQCLLRRAEEEFGFDHDMGLTIPCDELFFQDLTSMIR  107



>ref|XP_010467386.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
 ref|XP_010497777.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=108

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 92/108 (85%), Gaps = 9/108 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG---YD------DVPKGHFPVYVGENRSRY  368
            MAI++K  KLAQTA+L+QILKRCSSLGKKNG   Y+      DVPKGHFPVYVG NRSRY
Sbjct  1    MAILKKSTKLAQTAMLRQILKRCSSLGKKNGGGGYEEGDLPLDVPKGHFPVYVGNNRSRY  60

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +VPISFLT+ +FQCLLRRAEEEFGFDHDMG+TIPC+E+ F+ LT M+R
Sbjct  61   IVPISFLTNLDFQCLLRRAEEEFGFDHDMGLTIPCDELFFQDLTSMIR  108



>emb|CAN73226.1| hypothetical protein VITISV_026201 [Vitis vinifera]
Length=104

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 87/102 (85%), Gaps = 6/102 (6%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISF  350
            + K  KL+QTAVLKQILKRCSSLGKK GYD      DVPKGHF VYVGENR+RY+VPISF
Sbjct  3    LGKSNKLSQTAVLKQILKRCSSLGKKQGYDQEGLPLDVPKGHFAVYVGENRTRYIVPISF  62

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            LT PEFQ LL++AEEEFGFDH+MG+TIPCEEV F+SLT MLR
Sbjct  63   LTRPEFQSLLQQAEEEFGFDHEMGLTIPCEEVVFQSLTSMLR  104



>ref|XP_010908422.1| PREDICTED: auxin-induced protein 15A-like [Elaeis guineensis]
Length=103

 Score =   162 bits (410),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 87/104 (84%), Gaps = 6/104 (6%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD-----DVPKGHFPVYVGENRSRYVVPI  356
            MAI RK  KL QTAVLKQILKRCSSLG+  G       DVPKGHF VYVGENRSR++VPI
Sbjct  1    MAI-RKSNKLHQTAVLKQILKRCSSLGRSGGQQEGLPVDVPKGHFAVYVGENRSRFIVPI  59

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            S+LTHPEFQ LLRRAEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  60   SYLTHPEFQRLLRRAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  103



>ref|XP_010531493.1| PREDICTED: auxin-induced protein 15A-like [Tarenaya hassleriana]
Length=101

 Score =   162 bits (410),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 89/102 (87%), Gaps = 4/102 (4%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD---DVPKGHFPVYVGENRSRYVVPISF  350
            MA+ +K  KL+QTA+LKQILKRCSSLGKK GYD   DVPKGHFPVYVGE R+RY+VPISF
Sbjct  1    MAV-KKSQKLSQTAMLKQILKRCSSLGKKQGYDEHGDVPKGHFPVYVGEKRTRYIVPISF  59

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            L HPEFQ LL++AEEEFGF+HDMG+TIPCEEV F SLT M+R
Sbjct  60   LGHPEFQTLLQQAEEEFGFNHDMGLTIPCEEVVFLSLTSMIR  101



>ref|XP_007017765.1| SAUR family protein [Theobroma cacao]
 gb|EOY14990.1| SAUR family protein [Theobroma cacao]
Length=104

 Score =   162 bits (409),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 87/105 (83%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MAI RK  KL QTAV+KQILKRCSSLGKK  YD      DVPKGHF VYVGENRSRY+VP
Sbjct  1    MAI-RKSNKLPQTAVIKQILKRCSSLGKKQSYDEQGLPLDVPKGHFVVYVGENRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFLT PEFQ LL +AEEEFGFDHDMG+TIPCEEV F+SLT MLR
Sbjct  60   ISFLTRPEFQSLLHQAEEEFGFDHDMGLTIPCEEVVFQSLTSMLR  104



>ref|XP_008811428.1| PREDICTED: auxin-induced protein 15A [Phoenix dactylifera]
Length=103

 Score =   162 bits (409),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 87/104 (84%), Gaps = 6/104 (6%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD-----DVPKGHFPVYVGENRSRYVVPI  356
            MAI RK  KL QTAVLKQILKRCSSLG+  G       DVPKGHF VYVGENRSR++VPI
Sbjct  1    MAI-RKSNKLPQTAVLKQILKRCSSLGRSGGEQEGLPVDVPKGHFAVYVGENRSRFIVPI  59

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            S+L+HPEFQ LLRRAEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  60   SYLSHPEFQSLLRRAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  103



>ref|XP_009802208.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=107

 Score =   162 bits (409),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 88/106 (83%), Gaps = 9/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD--------VPKGHFPVYVGENRSRYV  365
            MAI RK  KL+Q A+LKQILKRCSSLGKKNGYDD        VPKGHF VYVGENR+RY+
Sbjct  1    MAI-RKSNKLSQAAILKQILKRCSSLGKKNGYDDDEDCLPIDVPKGHFAVYVGENRTRYI  59

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            +PISFLTHP+FQ LLR AEEEFGF+HDMGITIPCEEV FRSLT  +
Sbjct  60   IPISFLTHPQFQSLLRCAEEEFGFNHDMGITIPCEEVVFRSLTNSI  105



>ref|NP_179248.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 gb|AAD26489.1| putative auxin-induced protein [Arabidopsis thaliana]
 gb|AEC06511.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=108

 Score =   161 bits (408),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 92/108 (85%), Gaps = 9/108 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG---YD------DVPKGHFPVYVGENRSRY  368
            M+I++K  KLAQTA+L+QILKRCSSLGKKNG   Y+      DVPKGHFPVYVG NRSRY
Sbjct  1    MSILKKSTKLAQTAMLRQILKRCSSLGKKNGGGGYEEVDLPLDVPKGHFPVYVGHNRSRY  60

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +VPISFLT+ +FQCLLRRAEEEFGFDHDMG+TIPC+E+ F+ LT M+R
Sbjct  61   IVPISFLTNLDFQCLLRRAEEEFGFDHDMGLTIPCDELFFQDLTSMIR  108



>ref|XP_006435151.1| hypothetical protein CICLE_v10002928mg [Citrus clementina]
 ref|XP_006473634.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Citrus 
sinensis]
 gb|ESR48391.1| hypothetical protein CICLE_v10002928mg [Citrus clementina]
 gb|KDO84802.1| hypothetical protein CISIN_1g047827mg [Citrus sinensis]
Length=104

 Score =   161 bits (407),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 88/105 (84%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MAI RK  KL+QTAV+KQILKRCSSLGKK  YD      DVPKGHF VYVGENRSRY++P
Sbjct  1    MAI-RKSNKLSQTAVIKQILKRCSSLGKKQSYDEQGLPLDVPKGHFVVYVGENRSRYIIP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            I+FLT PEFQ LL++AEEEFGFDHDMG+TIPCEE  F+SLT MLR
Sbjct  60   ITFLTRPEFQSLLQQAEEEFGFDHDMGLTIPCEEQVFQSLTSMLR  104



>ref|XP_009590415.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=106

 Score =   161 bits (407),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 87/105 (83%), Gaps = 8/105 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  KL+Q AVLKQILKRCSSLGKKNGYDD       VPKGHF VYVGENR RY++
Sbjct  1    MAI-RKSNKLSQAAVLKQILKRCSSLGKKNGYDDEDGLPIDVPKGHFAVYVGENRKRYII  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PISFL+HP+FQ LLR AEEEFGF+HDMGITIPCEEV FRSLT  +
Sbjct  60   PISFLSHPQFQSLLRCAEEEFGFNHDMGITIPCEEVVFRSLTNSM  104



>ref|XP_003634383.2| PREDICTED: uncharacterized protein LOC100247221 [Vitis vinifera]
Length=165

 Score =   163 bits (412),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 87/102 (85%), Gaps = 6/102 (6%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISF  350
            + K  KL+QTAVLKQILKRCSSLGKK GYD      DVPKGHF VYVGENR+RY+VPISF
Sbjct  64   LGKSNKLSQTAVLKQILKRCSSLGKKQGYDQEGLPLDVPKGHFAVYVGENRTRYIVPISF  123

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            LT PEFQ LL++AEEEFGFDH+MG+TIPCEEV F+SLT MLR
Sbjct  124  LTRPEFQSLLQQAEEEFGFDHEMGLTIPCEEVVFQSLTSMLR  165



>ref|XP_002886058.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62317.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata]
Length=107

 Score =   160 bits (406),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 8/107 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YD------DVPKGHFPVYVGENRSRYV  365
            MAI++K  KLAQTA+L+QILKRCSSLGKKNG  Y+      DVPKGHFPVYVG NRS Y+
Sbjct  1    MAILKKSTKLAQTAMLRQILKRCSSLGKKNGGGYEEDDLPLDVPKGHFPVYVGHNRSTYI  60

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLT+ +FQCLLRRAEEEFGFDHDMG+TIPC+E+ F+ LT M+R
Sbjct  61   VPISFLTNLDFQCLLRRAEEEFGFDHDMGLTIPCDELFFQDLTSMIR  107



>ref|XP_007046722.1| SAUR family protein, partial [Theobroma cacao]
 gb|EOX90879.1| SAUR family protein, partial [Theobroma cacao]
Length=130

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 87/105 (83%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MAI +K  KL QTA +KQILKRCSS GKK GYD      DVPKGHF VYVGENRSRY++P
Sbjct  27   MAI-KKSNKLPQTAAIKQILKRCSSFGKKQGYDESSLPDDVPKGHFVVYVGENRSRYIIP  85

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS+L HPEFQ LL+RAEEEFGF+HDMG+TIPCEEV FRSLT M+R
Sbjct  86   ISWLAHPEFQSLLQRAEEEFGFNHDMGLTIPCEEVVFRSLTAMIR  130



>ref|XP_006359708.1| PREDICTED: auxin-induced protein X15-like [Solanum tuberosum]
Length=108

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 89/108 (82%), Gaps = 10/108 (9%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD--------VPKGHFPVYVGENRSRYV  365
            MAI RK  KL+ +A+LKQI+ RCSSLG K GYDD        VPKGHF VYVGENR+RY+
Sbjct  1    MAI-RKSNKLSHSAILKQIIIRCSSLGVKQGYDDEDYQLPIDVPKGHFAVYVGENRTRYI  59

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTE-MLR  224
            VPISFLTHPEFQCLLR++EEEFGFDHDMGITIPCEEV FRSLT  MLR
Sbjct  60   VPISFLTHPEFQCLLRQSEEEFGFDHDMGITIPCEEVVFRSLTNSMLR  107



>ref|XP_009759019.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=105

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 89/106 (84%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  KL+Q  +LKQILKRCSSLGKK+ Y+D       VPKGHF VYVGENR+RY+V
Sbjct  1    MAI-RKSNKLSQAVLLKQILKRCSSLGKKHVYNDEDFLPIDVPKGHFAVYVGENRTRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFL+HPEFQCLLR AEEEFGFDHDMGITIPCEE+ F+SLT MLR
Sbjct  60   PISFLSHPEFQCLLRCAEEEFGFDHDMGITIPCEELVFQSLTNMLR  105



>ref|XP_009628643.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=106

 Score =   160 bits (404),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 88/107 (82%), Gaps = 9/107 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG-YD-------DVPKGHFPVYVGENRSRYV  365
            MAI RK  KL+Q AVLKQIL RCSSLGKK+  YD       DVPKGHF VYVGENR+RYV
Sbjct  1    MAI-RKSNKLSQAAVLKQILIRCSSLGKKHDFYDQDYYLPIDVPKGHFAVYVGENRTRYV  59

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPIS LTHPEFQCLL RAEEEFGFDHDMGITIPCEEV FRSLT M++
Sbjct  60   VPISLLTHPEFQCLLHRAEEEFGFDHDMGITIPCEEVVFRSLTSMIQ  106



>ref|XP_007202790.1| hypothetical protein PRUPE_ppa013735mg [Prunus persica]
 gb|EMJ03989.1| hypothetical protein PRUPE_ppa013735mg [Prunus persica]
Length=106

 Score =   159 bits (403),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 85/105 (81%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD-------DVPKGHFPVYVGENRSRYVV  362
            MAI +K  KL QTA LKQILKRCSS GKKNGY+       DVPKGHF VYVGENRSRY++
Sbjct  1    MAISKKSNKLPQTAALKQILKRCSSFGKKNGYNNEGGLPEDVPKGHFAVYVGENRSRYII  60

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PIS+L HPEFQ LL+RAEEEFGF+HDMG+TIPCEEV FRSL   +
Sbjct  61   PISWLGHPEFQTLLQRAEEEFGFNHDMGLTIPCEEVVFRSLMHQI  105



>ref|XP_009391130.1| PREDICTED: auxin-induced protein 15A-like [Musa acuminata subsp. 
malaccensis]
Length=99

 Score =   159 bits (402),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDDVPKGHFPVYVGENRSRYVVPISFLTH  341
            MAI R   KL Q A +KQILKRCSSLG+K    DVPKGHF VYVGE+RSR++VPIS+LTH
Sbjct  1    MAIRRSNNKLPQAAGIKQILKRCSSLGRKQQPVDVPKGHFAVYVGESRSRFIVPISYLTH  60

Query  340  PEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PEFQ LLR+AEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  61   PEFQSLLRQAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  99



>ref|XP_004230999.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=108

 Score =   159 bits (402),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 88/108 (81%), Gaps = 10/108 (9%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD--------VPKGHFPVYVGENRSRYV  365
            MAI RK  K + +A+LKQI+ RCSSLG K GYDD        VPKGHF VYVGENRSRY+
Sbjct  1    MAI-RKSNKQSHSAILKQIIIRCSSLGMKQGYDDEDYQFPIDVPKGHFAVYVGENRSRYI  59

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTE-MLR  224
            VPISFLTHPEFQCLLR++EEEFGFDHDMGITIPCEEV FRSLT  MLR
Sbjct  60   VPISFLTHPEFQCLLRQSEEEFGFDHDMGITIPCEEVVFRSLTNSMLR  107



>ref|XP_003534356.1| PREDICTED: auxin-induced protein 15A-like [Glycine max]
 gb|KHN11752.1| Auxin-induced protein 15A [Glycine soja]
Length=104

 Score =   158 bits (400),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 87/105 (83%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVVP  359
            MAI RK  KL Q AVLKQILKRCSSLGKKNGYDD      VPKGHF VYVGENR+RY+VP
Sbjct  1    MAI-RKSNKLPQHAVLKQILKRCSSLGKKNGYDDDGHPVDVPKGHFAVYVGENRTRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFL HP+FQ LLR+AEEEFG+DH+MG+TIPC+E  FRSLT  LR
Sbjct  60   ISFLAHPQFQSLLRQAEEEFGYDHEMGLTIPCDEDVFRSLTSSLR  104



>ref|XP_006365926.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum 
tuberosum]
Length=109

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 89/107 (83%), Gaps = 10/107 (9%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG-YDD--------VPKGHFPVYVGENRSRY  368
            MAI RK  KL+Q+A+LKQILKRCSSLGKKN  YDD        VPKGHF VYVGENR+RY
Sbjct  1    MAI-RKSNKLSQSAMLKQILKRCSSLGKKNNSYDDDENSLPIDVPKGHFAVYVGENRTRY  59

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            +VPISFL++PEFQCLL RAEEEFGFDHDMGITIPCEE+ F+SLT  +
Sbjct  60   IVPISFLSYPEFQCLLHRAEEEFGFDHDMGITIPCEEIVFQSLTSSM  106



>ref|XP_009802207.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=110

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 86/106 (81%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  KL Q  VLK+ILKRCSSLGKKNGYDD       VPKGHF VYVGENR+RY++
Sbjct  1    MAI-RKSNKLPQAVVLKKILKRCSSLGKKNGYDDEDGLPTDVPKGHFAVYVGENRTRYII  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFL HP+F+ LL RAEEEFGF+HDMGITIPCEE  FRSLT ML+
Sbjct  60   PISFLAHPKFKSLLHRAEEEFGFNHDMGITIPCEEFVFRSLTSMLQ  105



>ref|XP_011025945.1| PREDICTED: auxin-induced protein 15A-like [Populus euphratica]
Length=104

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 83/101 (82%), Gaps = 6/101 (6%)
 Frame = -3

Query  508  RKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISFL  347
            RK  K  QT+ LKQI+KRCSS GKKNGYD      DVPKGHF VYVGENRSRY++PIS+L
Sbjct  4    RKSNKSPQTSALKQIVKRCSSFGKKNGYDQDGLPDDVPKGHFAVYVGENRSRYIIPISWL  63

Query  346  THPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
             HPEFQ LL+RAEEEFGF H MG+TIPCEEV FRSLTEM+R
Sbjct  64   DHPEFQSLLQRAEEEFGFKHGMGLTIPCEEVVFRSLTEMIR  104



>ref|XP_008377157.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
 ref|XP_008357133.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=105

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 89/106 (84%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG-YD------DVPKGHFPVYVGENRSRYVV  362
            MAI RK ++L QTAVLKQILKRCSSLGKK   YD      DVPKGHF VYVGENRSRY+V
Sbjct  1    MAI-RKSSRLPQTAVLKQILKRCSSLGKKQQHYDEQGLPLDVPKGHFVVYVGENRSRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLT PEFQ LL +AEEEFGFDHDMG+TIPCEEVAF++LT MLR
Sbjct  60   PISFLTRPEFQSLLHQAEEEFGFDHDMGLTIPCEEVAFQTLTSMLR  105



>ref|XP_008391894.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=106

 Score =   157 bits (398),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 84/105 (80%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGY-------DDVPKGHFPVYVGENRSRYVV  362
            MAI +K  KL QTA L QILKRCSS GKKNGY       DDVPKGHF VYVGENRSRY++
Sbjct  1    MAISKKSNKLPQTAALMQILKRCSSFGKKNGYNNEGGLPDDVPKGHFAVYVGENRSRYII  60

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PIS+L HPEFQ LL+R+EEEFGF+HDMG+TIPCEEV FRSL   +
Sbjct  61   PISWLGHPEFQTLLQRSEEEFGFNHDMGLTIPCEEVVFRSLIHQI  105



>ref|XP_006359617.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=101

 Score =   157 bits (398),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD---DVPKGHFPVYVGENRSRYVVPISF  350
            MAI +K  KL+Q+ VLKQILK+CSSLGKKN      DVPKGHF VYVGENR+RY+VPISF
Sbjct  1    MAI-KKSTKLSQSPVLKQILKKCSSLGKKNEDHLPVDVPKGHFAVYVGENRTRYIVPISF  59

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            L+HPEFQCLLR AEEEFGFDHDMGITIPCEE  F+SLT MLR
Sbjct  60   LSHPEFQCLLRCAEEEFGFDHDMGITIPCEEFVFQSLTSMLR  101



>ref|XP_007224038.1| hypothetical protein PRUPE_ppa015189mg [Prunus persica]
 ref|XP_008221293.1| PREDICTED: auxin-induced protein 15A [Prunus mume]
 gb|EMJ25237.1| hypothetical protein PRUPE_ppa015189mg [Prunus persica]
Length=105

 Score =   157 bits (398),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 88/106 (83%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG-YD------DVPKGHFPVYVGENRSRYVV  362
            MAI RK  +L QTAVLKQILKRCSSLGKK   YD      DVPKGHF VYVGENRSRY++
Sbjct  1    MAI-RKSNRLPQTAVLKQILKRCSSLGKKQQHYDEQGLPLDVPKGHFVVYVGENRSRYII  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLT PEFQ LL +AEEEFGFDHDMG+TIPCEEVAF+SLT MLR
Sbjct  60   PISFLTRPEFQSLLHQAEEEFGFDHDMGLTIPCEEVAFQSLTSMLR  105



>gb|KDP46721.1| hypothetical protein JCGZ_06509 [Jatropha curcas]
Length=104

 Score =   157 bits (397),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MAI RK  KL QTA LKQI+KRCSSLGKK GYD      DVPKGHF VYVGENRSRY+VP
Sbjct  1    MAI-RKSNKLPQTAALKQIIKRCSSLGKKQGYDQEGLPEDVPKGHFAVYVGENRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS+L HPEFQ LL+RA EEFGF HDMG+TIPCEEV F+SLT  +R
Sbjct  60   ISWLDHPEFQSLLQRAAEEFGFKHDMGLTIPCEEVVFQSLTATIR  104



>gb|AFK46645.1| unknown [Lotus japonicus]
Length=105

 Score =   157 bits (397),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 84/102 (82%), Gaps = 7/102 (7%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVVPIS  353
            ++K  KL Q AV KQILKRCSSLGKK G+ D       VPKGHF VYVGENRSRY+VPIS
Sbjct  3    VKKSNKLPQNAVFKQILKRCSSLGKKPGFVDDYGLPLDVPKGHFAVYVGENRSRYIVPIS  62

Query  352  FLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            FLTHPEFQ LLR+AEEEFGFDHDMG+TIPCEEV FRSLT M+
Sbjct  63   FLTHPEFQSLLRQAEEEFGFDHDMGLTIPCEEVVFRSLTSMI  104



>gb|KFK30241.1| hypothetical protein AALP_AA7G235900 [Arabis alpina]
Length=103

 Score =   157 bits (397),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 86/103 (83%), Gaps = 4/103 (4%)
 Frame = -3

Query  520  MAIMR-KPAKLAQTAVLKQILKRCSSLGKKNG---YDDVPKGHFPVYVGENRSRYVVPIS  353
            MAI +   A L+Q A LKQILKRCSSLGKKNG   ++DVPKGHFPVYVG+NRSRYVVPIS
Sbjct  1    MAIKKSNKAALSQAATLKQILKRCSSLGKKNGNCYFNDVPKGHFPVYVGQNRSRYVVPIS  60

Query  352  FLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +L HPEFQ LL+ AEEEFGF+HDMG+TIPC+EV FRSL  M R
Sbjct  61   WLAHPEFQTLLQLAEEEFGFEHDMGLTIPCDEVVFRSLISMFR  103



>ref|XP_009136313.1| PREDICTED: uncharacterized protein LOC103860467 [Brassica rapa]
Length=146

 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 91/108 (84%), Gaps = 9/108 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG------YD---DVPKGHFPVYVGENRSRY  368
            MAI++K  +L+QT +L+ ILKRCSSLGKKNG      YD   DVPKGHFPVYVG++RSRY
Sbjct  39   MAILKKSTQLSQTTMLRHILKRCSSLGKKNGGGGYEEYDLPLDVPKGHFPVYVGKSRSRY  98

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +VPISFLT+ +FQCLLRRAEEEFGFDHDMG+TIPC+E+ F+ LT M+R
Sbjct  99   IVPISFLTNLDFQCLLRRAEEEFGFDHDMGLTIPCDELFFQDLTSMIR  146



>ref|XP_009335221.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
 ref|XP_009337656.1| PREDICTED: auxin-induced protein 15A-like [Pyrus x bretschneideri]
Length=105

 Score =   157 bits (397),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 88/106 (83%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG-YD------DVPKGHFPVYVGENRSRYVV  362
            MAI RK  +L QTAVLKQILKRCSSLGKK   YD      DVPKGHF VYVGENRSRY+V
Sbjct  1    MAI-RKSNRLPQTAVLKQILKRCSSLGKKQQHYDEQGLPLDVPKGHFVVYVGENRSRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLT PEFQ LL +AEEEFGFDHDMG+TIPCEEVAF++LT MLR
Sbjct  60   PISFLTRPEFQSLLHQAEEEFGFDHDMGLTIPCEEVAFQTLTSMLR  105



>ref|XP_004230996.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=101

 Score =   157 bits (396),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD---DVPKGHFPVYVGENRSRYVVPISF  350
            MAI +K  KL+Q+ VLKQILK+CSSLGKKN      DVPKGHF VYVGENRSRY+VPISF
Sbjct  1    MAI-KKSNKLSQSPVLKQILKKCSSLGKKNEDHLPIDVPKGHFAVYVGENRSRYIVPISF  59

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            L+HPEFQCLLR AEEEFGFDHDMGITIPCEE  F++LT MLR
Sbjct  60   LSHPEFQCLLRCAEEEFGFDHDMGITIPCEEFVFQTLTSMLR  101



>ref|XP_010271407.1| PREDICTED: auxin-induced protein 15A-like [Nelumbo nucifera]
Length=104

 Score =   157 bits (396),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 84/102 (82%), Gaps = 6/102 (6%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISF  350
            + K  KL QTAV+KQILKRCSSLGKK GYD      DVPKGHF VYVGE RSR++VPISF
Sbjct  3    LGKSNKLPQTAVIKQILKRCSSLGKKQGYDEEGLPVDVPKGHFVVYVGEKRSRFIVPISF  62

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            LTHPEFQ LL+RAEEEFGF H+MG+TIPCEEV FRSLT  LR
Sbjct  63   LTHPEFQSLLQRAEEEFGFHHEMGLTIPCEEVVFRSLTSTLR  104



>ref|XP_008241809.1| PREDICTED: auxin-induced protein 15A [Prunus mume]
Length=106

 Score =   157 bits (396),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 84/105 (80%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD-------DVPKGHFPVYVGENRSRYVV  362
            MAI +K  KL QTA LKQILKRCSS GKKN Y+       DVPKGHF VYVGENRSRY++
Sbjct  1    MAISKKSNKLPQTAALKQILKRCSSFGKKNDYNNEGGLPEDVPKGHFAVYVGENRSRYII  60

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PIS+L HPEFQ LL+RAEEEFGF+HDMG+TIPCEEV FRSL   +
Sbjct  61   PISWLGHPEFQTLLQRAEEEFGFNHDMGLTIPCEEVVFRSLMHQI  105



>emb|CDY02251.1| BnaA03g39160D [Brassica napus]
Length=108

 Score =   157 bits (396),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 91/108 (84%), Gaps = 9/108 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG------YD---DVPKGHFPVYVGENRSRY  368
            MAI++K  +L+QT +L+ ILKRCSSLGKKNG      YD   DVPKGHFPVYVG++RSRY
Sbjct  1    MAILKKSTQLSQTTMLRHILKRCSSLGKKNGGGGYEEYDLPLDVPKGHFPVYVGKSRSRY  60

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +VPISFLT+ +FQCLLRRAEEEFGFDHDMG+TIPC+E+ F+ LT M+R
Sbjct  61   IVPISFLTNLDFQCLLRRAEEEFGFDHDMGLTIPCDELFFQDLTSMIR  108



>gb|KHN25441.1| Auxin-induced protein 15A [Glycine soja]
Length=105

 Score =   156 bits (395),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 87/106 (82%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAV-LKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVV  362
            MAI RK  KL Q AV LKQILKRCSSLGKKNGYDD      VPKGHF VYVGENR RY+V
Sbjct  1    MAI-RKSNKLPQHAVVLKQILKRCSSLGKKNGYDDDGHPVDVPKGHFAVYVGENRRRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFL HPEFQ LLR+AEEEFG+DH+MG+TIPC+EV FRSLT  LR
Sbjct  60   PISFLAHPEFQSLLRQAEEEFGYDHEMGLTIPCDEVVFRSLTSSLR  105



>ref|XP_010066236.1| PREDICTED: auxin-induced protein 15A-like [Eucalyptus grandis]
 gb|KCW64084.1| hypothetical protein EUGRSUZ_G01746 [Eucalyptus grandis]
Length=106

 Score =   156 bits (395),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 88/104 (85%), Gaps = 8/104 (8%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK-NGYD-------DVPKGHFPVYVGENRSRYVVPI  356
            + KP KL Q AV+KQILKRCSSLGKK +GYD       DVPKGHF VYVGE+RSRYVVP+
Sbjct  3    LTKPNKLPQAAVIKQILKRCSSLGKKLHGYDIKDGLPFDVPKGHFTVYVGESRSRYVVPL  62

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            SFL+HP+FQCLL++AEEEFGFDHDMGIT+PCEEV F+SL  M+R
Sbjct  63   SFLSHPDFQCLLQQAEEEFGFDHDMGITLPCEEVVFQSLASMIR  106



>gb|KDP36943.1| hypothetical protein JCGZ_08234 [Jatropha curcas]
Length=106

 Score =   156 bits (395),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 83/106 (78%), Gaps = 7/106 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI +   KL+QT V+KQILKRCSSLGKK GY D       VPKGHF VYVGENRSRY+V
Sbjct  1    MAIRKSSNKLSQTTVIKQILKRCSSLGKKQGYHDQEGLPLDVPKGHFVVYVGENRSRYIV  60

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLT PEFQ LL  AEEEFGFDHDMG+TIPC+E  F SLT MLR
Sbjct  61   PISFLTRPEFQTLLHEAEEEFGFDHDMGLTIPCQEQVFLSLTSMLR  106



>ref|XP_002310856.1| hypothetical protein POPTR_0007s14060g [Populus trichocarpa]
 gb|EEE91306.1| hypothetical protein POPTR_0007s14060g [Populus trichocarpa]
Length=104

 Score =   156 bits (394),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 85/105 (81%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MAI RK  K  QT+ LKQI+KRCSS GKKNGYD      DVPKGHF VYVGENRSRY++P
Sbjct  1    MAI-RKSNKSPQTSALKQIVKRCSSFGKKNGYDQDGLPDDVPKGHFAVYVGENRSRYIIP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS+L  PEFQ LL+RAEEEFGF H MG+TIPCEEV FRSLTEM+R
Sbjct  60   ISWLDRPEFQSLLQRAEEEFGFKHGMGLTIPCEEVVFRSLTEMIR  104



>ref|XP_010327424.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=109

 Score =   156 bits (394),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 10/107 (9%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG-YDD--------VPKGHFPVYVGENRSRY  368
            MAI RK  KL+Q+ +LKQILKRCSSLG+KN  YDD        VPKGHF VYVGENR+RY
Sbjct  1    MAI-RKSNKLSQSTMLKQILKRCSSLGRKNNSYDDAENSLPIDVPKGHFAVYVGENRTRY  59

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            +VPISFL++PEFQCLL RAEEEFGFDHDMGITIPCEEV F+SLT  +
Sbjct  60   IVPISFLSYPEFQCLLHRAEEEFGFDHDMGITIPCEEVVFQSLTSSM  106



>ref|XP_006359616.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum 
tuberosum]
Length=105

 Score =   155 bits (393),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 86/106 (81%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD-------DVPKGHFPVYVGENRSRYVV  362
            MAI RK  KL Q  +LKQI+K+CSSL KKN YD       DVPKGHF VYVGENR+RY+V
Sbjct  1    MAI-RKSNKLPQVVLLKQIMKKCSSLVKKNDYDGEDRLPIDVPKGHFAVYVGENRTRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLTHPEFQCLLR AEEEFGFDHDMGITIPCEE  F+SLT +LR
Sbjct  60   PISFLTHPEFQCLLRCAEEEFGFDHDMGITIPCEEFIFQSLTSVLR  105



>ref|XP_008372780.1| PREDICTED: auxin-induced protein 15A-like [Malus domestica]
Length=106

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 83/101 (82%), Gaps = 7/101 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGY-------DDVPKGHFPVYVGENRSRYVV  362
            MAI +K  KL QTA LKQILKRCSS GKKN Y       DDVPKGHF VYVGENRSRY++
Sbjct  1    MAISKKSNKLPQTAALKQILKRCSSFGKKNVYNNECGLPDDVPKGHFAVYVGENRSRYII  60

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL  239
            PI++L HPEFQ LL+RAEEEFGF+HDMG+TIPCEEV FRSL
Sbjct  61   PITWLGHPEFQTLLQRAEEEFGFNHDMGLTIPCEEVVFRSL  101



>ref|XP_006359710.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum 
tuberosum]
Length=106

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 86/106 (81%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDDV-------PKGHFPVYVGENRSRYVV  362
            MAI R   KL+QTAVLKQI+KRCSSLGKK GYDDV       PK HF VYVGENR+RY+V
Sbjct  1    MAI-RISNKLSQTAVLKQIMKRCSSLGKKQGYDDVDHLPIDVPKRHFAVYVGENRTRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLTHP FQCLL+ AEEEFGF HDMGITIPCEEV F +LT MLR
Sbjct  60   PISFLTHPLFQCLLQCAEEEFGFHHDMGITIPCEEVVFLALTSMLR  105



>emb|CDX89731.1| BnaC03g46450D [Brassica napus]
Length=108

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 90/108 (83%), Gaps = 9/108 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG------YD---DVPKGHFPVYVGENRSRY  368
            MAI +K  KL+QT +L+ ILKRCSSLGKKNG      YD   DVPKGHFPVYVG+NRSRY
Sbjct  1    MAIPKKSTKLSQTTMLRHILKRCSSLGKKNGGGGYEEYDLPLDVPKGHFPVYVGKNRSRY  60

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +VPISFLT+ +FQCLLRRAEEEFGFDHDMG+TIPC+E+ F+ LT ++R
Sbjct  61   IVPISFLTNLDFQCLLRRAEEEFGFDHDMGLTIPCDELFFQDLTSVIR  108



>ref|XP_008387950.1| PREDICTED: auxin-induced protein 15A [Malus domestica]
Length=105

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 87/106 (82%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG-YD------DVPKGHFPVYVGENRSRYVV  362
            MAI RK  +L QTAVLKQILKRCSSLGKK   YD      DVPKGHF VYVGENRSRY+V
Sbjct  1    MAI-RKSNRLPQTAVLKQILKRCSSLGKKQQHYDEQGLPLDVPKGHFVVYVGENRSRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLT PEFQ LL +AEEEFGFDHDMG+TIPCEEV F++LT MLR
Sbjct  60   PISFLTRPEFQSLLHQAEEEFGFDHDMGLTIPCEEVVFQTLTSMLR  105



>ref|XP_002269183.1| PREDICTED: auxin-induced protein 15A-like [Vitis vinifera]
Length=104

 Score =   154 bits (390),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 83/102 (81%), Gaps = 6/102 (6%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISF  350
            ++K  KL Q A LKQILKRCSS GKK GYD      DVPKGHF VYVGENRSRY+VPIS+
Sbjct  3    LKKSNKLPQPAALKQILKRCSSFGKKPGYDQGSLPDDVPKGHFAVYVGENRSRYIVPISW  62

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            L HPEFQ LL+RAEEEFGF+HDMG+TIPCEEV F SLT M+R
Sbjct  63   LAHPEFQGLLQRAEEEFGFNHDMGLTIPCEEVVFLSLTAMIR  104



>ref|NP_001235552.1| uncharacterized protein LOC100500265 [Glycine max]
 gb|ACU15288.1| unknown [Glycine max]
Length=105

 Score =   154 bits (390),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 86/106 (81%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAV-LKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVV  362
            MAI RK  KL Q AV LKQILKRCS LGKKNGYDD      VPKGHF VYVGENR RY+V
Sbjct  1    MAI-RKSNKLPQHAVVLKQILKRCSGLGKKNGYDDDGHPVDVPKGHFAVYVGENRRRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFL HPEFQ LLR+AEEEFG+DH+MG+TIPC+EV FRSLT  LR
Sbjct  60   PISFLAHPEFQSLLRQAEEEFGYDHEMGLTIPCDEVVFRSLTSSLR  105



>ref|NP_177688.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 gb|AAF87127.1|AC006434_23 F10A5.21 [Arabidopsis thaliana]
 gb|ABE77397.1| At1g75580 [Arabidopsis thaliana]
 gb|AEE35735.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=108

 Score =   154 bits (390),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 85/106 (80%), Gaps = 10/106 (9%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKN----GYD------DVPKGHFPVYVGENRSRYVV  362
            M+K  KL QTA++KQILKRCSSLGKK     G D      +VPKGHF VYVGENR RYVV
Sbjct  3    MKKANKLTQTAMIKQILKRCSSLGKKQSNVYGEDENGSPLNVPKGHFVVYVGENRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLT PEFQ LL++AEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  63   PISFLTRPEFQLLLQQAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  108



>ref|XP_002887604.1| hypothetical protein ARALYDRAFT_476705 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63863.1| hypothetical protein ARALYDRAFT_476705 [Arabidopsis lyrata subsp. 
lyrata]
Length=108

 Score =   154 bits (390),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 85/106 (80%), Gaps = 10/106 (9%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK--NGYD--------DVPKGHFPVYVGENRSRYVV  362
            M+K  KL QTA++KQILKRCSSLGKK  N Y         +VPKGHF VYVGENR RYVV
Sbjct  3    MKKANKLTQTAMIKQILKRCSSLGKKQSNVYSEDENGSPLNVPKGHFVVYVGENRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLT PEFQ LL++AEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  63   PISFLTRPEFQLLLQQAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  108



>ref|XP_009400356.1| PREDICTED: auxin-induced protein 15A-like [Musa acuminata subsp. 
malaccensis]
Length=98

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -3

Query  508  RKPAKLAQTAVLKQILKRCSSLGKKNGYDDVPKGHFPVYVGENRSRYVVPISFLTHPEFQ  329
            R+  KL Q A +KQILKRCSSLG++    DVPKGHF VYVGE+RSR++VPIS+LT+PEFQ
Sbjct  4    RRSNKLPQAAAIKQILKRCSSLGRRQQPADVPKGHFAVYVGESRSRFIVPISYLTYPEFQ  63

Query  328  CLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
             LLR+AEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  64   SLLRQAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  98



>ref|XP_004291382.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Fragaria 
vesca subsp. vesca]
Length=106

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 86/105 (82%), Gaps = 8/105 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG-YD------DVPKGHFPVYVGENRSRYVV  362
            MAI RKP +L Q A+LKQILKRCSSLGKK   YD      DVPKGHF VYVGENRSRY+V
Sbjct  1    MAI-RKPNRLTQAAMLKQILKRCSSLGKKQQHYDEQGLPLDVPKGHFVVYVGENRSRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PISFLT PEFQ LL +AEEEFGFDHDMG+TIPCEE AF+SLT ML
Sbjct  60   PISFLTRPEFQSLLHQAEEEFGFDHDMGLTIPCEEEAFQSLTSML  104



>ref|XP_009378184.1| PREDICTED: auxin-induced protein 15A [Pyrus x bretschneideri]
Length=106

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 82/101 (81%), Gaps = 7/101 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGY-------DDVPKGHFPVYVGENRSRYVV  362
            MAI +K  KL QTA LKQILKR SS GKKN Y       DDVPKGHF VYVGENRSRY++
Sbjct  1    MAISKKSNKLPQTAALKQILKRYSSFGKKNVYNNEGGLPDDVPKGHFAVYVGENRSRYII  60

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL  239
            PIS+L HPEFQ LL+RAEEEFGF+HDMG+TIPCEEV FRSL
Sbjct  61   PISWLGHPEFQTLLQRAEEEFGFNHDMGLTIPCEEVVFRSL  101



>ref|XP_010104433.1| hypothetical protein L484_016032 [Morus notabilis]
 gb|EXC00966.1| hypothetical protein L484_016032 [Morus notabilis]
Length=105

 Score =   154 bits (389),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 86/106 (81%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKN-GYD------DVPKGHFPVYVGENRSRYVV  362
            MAI RK  +L QTAVLKQILKRCSSLGKK   YD      DVPKGHF VYVGENRSRY+V
Sbjct  1    MAI-RKSNRLPQTAVLKQILKRCSSLGKKQQDYDEQGLPLDVPKGHFVVYVGENRSRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLT PEFQ LL++AEEEFGFDHDMG+TIPCEE  F SLT MLR
Sbjct  60   PISFLTRPEFQTLLQQAEEEFGFDHDMGLTIPCEEEVFLSLTSMLR  105



>ref|XP_009758646.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=106

 Score =   154 bits (389),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 84/106 (79%), Gaps = 7/106 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI +   KL+QTAV+KQILKRCSSLGKK+GY D       VPKGHF VYVGENR+RY+V
Sbjct  1    MAIRKSSNKLSQTAVIKQILKRCSSLGKKHGYQDEEGLPLDVPKGHFVVYVGENRTRYIV  60

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PIS LT PEFQ LL RAEEEFGFDHDMG+TIPC+E  F SLT  LR
Sbjct  61   PISILTRPEFQYLLHRAEEEFGFDHDMGLTIPCDEHVFESLTSTLR  106



>gb|KFK41991.1| hypothetical protein AALP_AA2G198100 [Arabis alpina]
Length=108

 Score =   154 bits (389),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 85/106 (80%), Gaps = 10/106 (9%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK---------NGYD-DVPKGHFPVYVGENRSRYVV  362
            M+K  KL Q A++KQILKRCSSLGKK         NG+  DVPKGHF VYVGENR RYVV
Sbjct  3    MKKANKLTQKAMIKQILKRCSSLGKKQSNVYSEDENGHPYDVPKGHFVVYVGENRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLT PEFQ LL++AEEEFGFDHDMG+TIPCEEV FRSLT MLR
Sbjct  63   PISFLTRPEFQVLLQQAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR  108



>ref|XP_002878540.1| hypothetical protein ARALYDRAFT_900533 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54799.1| hypothetical protein ARALYDRAFT_900533 [Arabidopsis lyrata subsp. 
lyrata]
Length=104

 Score =   154 bits (388),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 86/105 (82%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MA+ R P KL QTA+LKQILKRCSSL K   YD      DVPKGHF VYVGE RSRY+VP
Sbjct  1    MAVKRSP-KLTQTAMLKQILKRCSSLAKNQCYDEESLPVDVPKGHFAVYVGEKRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFLTHP+F+ LL++AEEEFGF+HDMG+TIPCEEV FRSLT M+R
Sbjct  60   ISFLTHPKFKSLLQQAEEEFGFNHDMGLTIPCEEVFFRSLTSMIR  104



>emb|CDY13560.1| BnaC02g23710D [Brassica napus]
Length=108

 Score =   154 bits (388),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 86/106 (81%), Gaps = 10/106 (9%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK--NGYD--------DVPKGHFPVYVGENRSRYVV  362
            M+K +KL QTA++KQILKRCSSLGK+  N Y         DVPKGHF VYVGENR RYVV
Sbjct  3    MKKTSKLTQTAMIKQILKRCSSLGKRQSNVYSEDENGQPLDVPKGHFVVYVGENRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLT PEFQ LL++AEEEFGF+HDMG+TIPCEEV FRSLT MLR
Sbjct  63   PISFLTRPEFQLLLQQAEEEFGFEHDMGLTIPCEEVVFRSLTSMLR  108



>ref|XP_009607051.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=106

 Score =   154 bits (388),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 84/106 (79%), Gaps = 7/106 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI +   KL+QTAV+KQILKRCSSLGKK+GY D       VPKGHF VYVGENR+RY+V
Sbjct  1    MAIRKSSNKLSQTAVIKQILKRCSSLGKKHGYQDEEGLPLDVPKGHFVVYVGENRTRYIV  60

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PIS LT PEFQ LL RAEEEFGFDHDMG+TIPC+E  F SLT  LR
Sbjct  61   PISILTRPEFQYLLHRAEEEFGFDHDMGLTIPCDEHVFESLTSSLR  106



>ref|XP_009759642.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=106

 Score =   153 bits (387),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 84/107 (79%), Gaps = 9/107 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGY--------DDVPKGHFPVYVGENRSRYV  365
            MAI RK  KL Q  +LKQI+KRC SLGKK  Y         DVPKGHF VYVGENR+RY+
Sbjct  1    MAI-RKLNKLPQATMLKQIMKRCLSLGKKQDYYDEEYGLSIDVPKGHFAVYVGENRTRYI  59

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFLTHPEFQCLL+ AEEEFGFDHDMGITIPCEE  FRSLT MLR
Sbjct  60   VPISFLTHPEFQCLLQCAEEEFGFDHDMGITIPCEETIFRSLTSMLR  106



>ref|NP_179718.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 gb|AAD24828.1| putative auxin-regulated protein [Arabidopsis thaliana]
 gb|AAM15223.1| putative auxin-regulated protein [Arabidopsis thaliana]
 dbj|BAC42954.1| putative auxin-regulated protein [Arabidopsis thaliana]
 gb|AAO63964.1| putative auxin-regulated protein [Arabidopsis thaliana]
 gb|AEC07141.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=104

 Score =   153 bits (387),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 86/104 (83%), Gaps = 7/104 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MA+ R  +KL QTA+LKQILKRCSSL K   YD      DVPKGHFPVYVGE RSRY+VP
Sbjct  1    MAVKRS-SKLTQTAMLKQILKRCSSLAKNQCYDEDGLPVDVPKGHFPVYVGEKRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            ISFLTHP+F+ LL++AEEEFGF+HDMG+TIPCEEV FRSLT M+
Sbjct  60   ISFLTHPKFKSLLQQAEEEFGFNHDMGLTIPCEEVVFRSLTSMI  103



>ref|XP_009628641.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=116

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 8/105 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  KL Q AVLKQI+KRCSSLGKK  Y+D       VPKGHF VYVGENR+RY+V
Sbjct  1    MAI-RKSNKLPQAAVLKQIMKRCSSLGKKQCYNDEAHLPIDVPKGHFAVYVGENRTRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PISFL H EFQCLL+ AEEEFGFDHDMGITIPCEEV FRSLT ++
Sbjct  60   PISFLNHLEFQCLLQCAEEEFGFDHDMGITIPCEEVVFRSLTSII  104



>ref|XP_004230997.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=105

 Score =   153 bits (386),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 85/106 (80%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD-------DVPKGHFPVYVGENRSRYVV  362
            MAI RK  KL Q  +LKQI+K+CSSL KK  YD       DVPKGHF VYVGENRSRY+V
Sbjct  1    MAI-RKSNKLPQVVLLKQIMKKCSSLIKKYDYDSEDRLPIDVPKGHFAVYVGENRSRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFL+HPEFQCLLR AEEEFGFDHDMGITIPCEE  F+SLT +LR
Sbjct  60   PISFLSHPEFQCLLRCAEEEFGFDHDMGITIPCEEFVFQSLTSVLR  105



>ref|XP_006295292.1| hypothetical protein CARUB_v10024381mg [Capsella rubella]
 gb|EOA28190.1| hypothetical protein CARUB_v10024381mg [Capsella rubella]
Length=104

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 85/105 (81%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MAI R  +KLAQ A+LKQILKRCSSL K   YD      DVPKGHF VYVGE RSRY+VP
Sbjct  1    MAIKRS-SKLAQAAMLKQILKRCSSLAKNQCYDEDGLPVDVPKGHFAVYVGEKRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFLTHP+F+ LL++AEEEFGF HDMG+TIPCEEV FRSLT M+R
Sbjct  60   ISFLTHPKFKSLLQQAEEEFGFSHDMGLTIPCEEVVFRSLTSMIR  104



>ref|XP_010028665.1| PREDICTED: auxin-induced protein 15A [Eucalyptus grandis]
 gb|KCW55436.1| hypothetical protein EUGRSUZ_I01338 [Eucalyptus grandis]
Length=107

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 85/104 (82%), Gaps = 9/104 (9%)
 Frame = -3

Query  508  RKPAKLAQTAVLKQILKRCSSLGKK--NGYD-------DVPKGHFPVYVGENRSRYVVPI  356
            +K  KL Q AVL+QIL+RCSSLG++   G+D       DVPKGHF VYVGENR+RY+VPI
Sbjct  4    KKSHKLPQPAVLRQILRRCSSLGRRTNGGFDEEDGLPLDVPKGHFAVYVGENRARYIVPI  63

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            S LT PEFQCLLRRAEEEFGFDHDMG+TIPCEEV FRSLT M+R
Sbjct  64   SLLTRPEFQCLLRRAEEEFGFDHDMGLTIPCEEVVFRSLTSMIR  107



>ref|XP_010416863.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=105

 Score =   152 bits (385),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 86/104 (83%), Gaps = 7/104 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MAI R  +KLAQTA+LKQILKRCSSL K   YD      DVPKGHF VYVGE RSRY+VP
Sbjct  1    MAIKRS-SKLAQTAMLKQILKRCSSLAKNQCYDEDGLPVDVPKGHFAVYVGEKRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            ISFLTHP+F+ LL++AEEEFGF+HDMG+TIPCEEV FRSLT M+
Sbjct  60   ISFLTHPKFKSLLQQAEEEFGFNHDMGLTIPCEEVVFRSLTSMI  103



>ref|XP_009759018.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=105

 Score =   152 bits (384),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 85/106 (80%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  KL+Q AVLKQILKRCSSL KK+ YDD       VPKG+F VYVG+NR+RY+V
Sbjct  1    MAI-RKSNKLSQAAVLKQILKRCSSLEKKHDYDDEDGLPIDVPKGYFAVYVGKNRTRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFL HPEFQC L  AEEEFGFD DMGITIPCEEV FRSLT MLR
Sbjct  60   PISFLIHPEFQCRLHCAEEEFGFDDDMGITIPCEEVVFRSLTSMLR  105



>ref|XP_009128112.1| PREDICTED: auxin-induced protein 15A-like [Brassica rapa]
 emb|CDY39041.1| BnaA02g17300D [Brassica napus]
Length=108

 Score =   152 bits (384),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 86/106 (81%), Gaps = 10/106 (9%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK--NGYD--------DVPKGHFPVYVGENRSRYVV  362
            M+K +KL QTA++KQILKRCSSLGK+  N Y         DVPKGHF VYVGENR RYVV
Sbjct  3    MKKTSKLTQTAMIKQILKRCSSLGKRQSNVYSEDENGQPLDVPKGHFVVYVGENRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFLT PEFQ LL++AEEEFGF+HDMG+TIPC+EV FRSLT MLR
Sbjct  63   PISFLTRPEFQLLLQQAEEEFGFEHDMGLTIPCKEVVFRSLTSMLR  108



>ref|XP_010539864.1| PREDICTED: auxin-induced protein 15A [Tarenaya hassleriana]
Length=109

 Score =   152 bits (384),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 85/109 (78%), Gaps = 10/109 (9%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKK--NGYD--------DVPKGHFPVYVGENRSR  371
            MAI +  +KL Q A++KQILKRCSS GKK  NGY+        DVPKGHF VYVGENR R
Sbjct  1    MAIRKSSSKLTQKAMIKQILKRCSSFGKKQGNGYNSDEHEHPLDVPKGHFVVYVGENRVR  60

Query  370  YVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            YVVPISFLT PEFQ LL++AEEEFGF HDMG+ IPCEEV FRSLT MLR
Sbjct  61   YVVPISFLTRPEFQVLLQQAEEEFGFAHDMGLIIPCEEVVFRSLTSMLR  109



>ref|XP_006590723.1| PREDICTED: auxin-induced protein 15A-like [Glycine max]
 gb|KHN41903.1| Auxin-induced protein 15A [Glycine soja]
Length=104

 Score =   152 bits (383),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 85/105 (81%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGY------DDVPKGHFPVYVGENRSRYVVP  359
            MAI +K  KL Q  VLKQI+KRCSS GKK  Y      DDVPKGHF VYVGENR+RY++P
Sbjct  1    MAI-KKSNKLPQAIVLKQIVKRCSSFGKKQTYNEEGLPDDVPKGHFAVYVGENRTRYIIP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS+L HP+FQ LL+RAEEEFGF+HDMG+TIPC+EVAF SLT M+R
Sbjct  60   ISWLAHPQFQILLQRAEEEFGFNHDMGLTIPCDEVAFESLTSMMR  104



>ref|XP_010061037.1| PREDICTED: auxin-induced protein 15A [Eucalyptus grandis]
Length=108

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 89/109 (82%), Gaps = 11/109 (10%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKN--GYD--------DVPKGHFPVYVGENRSR  371
            MAI +KP KL QTAVLKQILKRCSSLG+++  GY+        DVPKGHF VYVGENR+R
Sbjct  1    MAI-KKPNKLPQTAVLKQILKRCSSLGRRSSQGYEQEGGGFPLDVPKGHFVVYVGENRTR  59

Query  370  YVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            Y+VPISFLT PEFQ LL++AEEEFGFDHDMG+TIPCEE  F+SLT  LR
Sbjct  60   YIVPISFLTRPEFQSLLQQAEEEFGFDHDMGLTIPCEEDVFQSLTSTLR  108



>gb|KFK30111.1| hypothetical protein AALP_AA7G218300 [Arabis alpina]
Length=93

 Score =   151 bits (381),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 82/93 (88%), Gaps = 8/93 (9%)
 Frame = -3

Query  478  VLKQILKRCSSLGKKNG--YD------DVPKGHFPVYVGENRSRYVVPISFLTHPEFQCL  323
            +LKQI+KRCSSLGKKNG  YD      DVPKGHFPVYVGENRSRY+VPISFLTHPEFQ L
Sbjct  1    MLKQIMKRCSSLGKKNGGGYDEDCLPLDVPKGHFPVYVGENRSRYIVPISFLTHPEFQSL  60

Query  322  LRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            LRRAEEEFGFDHDMG+TIPC+E+ F++LT M+R
Sbjct  61   LRRAEEEFGFDHDMGLTIPCDELVFQTLTSMIR  93



>ref|XP_006303028.1| hypothetical protein CARUB_v10021184mg [Capsella rubella]
 gb|EOA35926.1| hypothetical protein CARUB_v10021184mg [Capsella rubella]
Length=109

 Score =   151 bits (382),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 85/107 (79%), Gaps = 11/107 (10%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK---------NGYD-DVPKGHFPVYVGENRSRYVV  362
            M+K  KL QTA++KQILKRCSSLGKK         NG   DVPKGHF VYVG+NR RYVV
Sbjct  3    MKKANKLTQTAMIKQILKRCSSLGKKQSNVYSEDVNGSTLDVPKGHFVVYVGQNRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLT-EMLR  224
            PISFLT PEFQ LL++AEEEFGFDHDMG+TIPCEEV FRSLT  MLR
Sbjct  63   PISFLTRPEFQLLLQQAEEEFGFDHDMGLTIPCEEVVFRSLTSSMLR  109



>ref|XP_010416447.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
 ref|XP_010471671.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=109

 Score =   151 bits (382),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 85/107 (79%), Gaps = 11/107 (10%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK--NGYD--------DVPKGHFPVYVGENRSRYVV  362
            M+K  KL QTA++KQILKRCSSLGKK  N Y         DVPKGHF VYVGENR RYVV
Sbjct  3    MKKANKLTQTAMIKQILKRCSSLGKKQSNVYSEDENGSPLDVPKGHFVVYVGENRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL-TEMLR  224
            PISFLT PEFQ LL++AEEEFGFDHDMG+TIPCEEV FRSL T MLR
Sbjct  63   PISFLTRPEFQLLLQQAEEEFGFDHDMGLTIPCEEVVFRSLTTSMLR  109



>ref|XP_010428583.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=109

 Score =   151 bits (382),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 85/107 (79%), Gaps = 11/107 (10%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK--NGYD--------DVPKGHFPVYVGENRSRYVV  362
            M+K  KL QTA++KQILKRCSSLGKK  N Y         DVPKGHF VYVGENR RYVV
Sbjct  3    MKKANKLTQTAMIKQILKRCSSLGKKQNNVYSEDENGSPLDVPKGHFVVYVGENRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL-TEMLR  224
            PISFLT PEFQ LL++AEEEFGFDHDMG+TIPCEEV FRSL T MLR
Sbjct  63   PISFLTRPEFQLLLQQAEEEFGFDHDMGLTIPCEEVVFRSLTTSMLR  109



>emb|CDY47511.1| BnaAnng09090D [Brassica napus]
Length=108

 Score =   151 bits (382),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 84/105 (80%), Gaps = 10/105 (10%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK---------NGYD-DVPKGHFPVYVGENRSRYVV  362
            M+K  KL QTA++KQILKRCSSLGKK         NG+  DVPKGHF VYVGENR RYVV
Sbjct  3    MKKANKLTQTAMIKQILKRCSSLGKKQSNVYSEDENGHPLDVPKGHFVVYVGENRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PISFLT PEFQ LL++AEEEFGFDHDMG+TIPC+E  FRSLT ML
Sbjct  63   PISFLTRPEFQLLLQQAEEEFGFDHDMGLTIPCDEAVFRSLTSML  107



>ref|XP_008791264.1| PREDICTED: auxin-induced protein 15A-like [Phoenix dactylifera]
Length=110

 Score =   151 bits (381),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 84/108 (78%), Gaps = 12/108 (11%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGY------------DDVPKGHFPVYVGENRSRY  368
            +RK  KL+Q  VLKQILKRCSSLG+K G             DDVPKGHF VYVGENRSR+
Sbjct  3    LRKHNKLSQAMVLKQILKRCSSLGRKQGLGGGGGGEEEGLPDDVPKGHFAVYVGENRSRF  62

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +VPIS+LTHPEFQ LLR+AEEEFGF HDMG+TIPCEEV FRSLT  LR
Sbjct  63   IVPISYLTHPEFQSLLRQAEEEFGFGHDMGLTIPCEEVVFRSLTSSLR  110



>ref|XP_009106208.1| PREDICTED: auxin-induced protein 15A-like [Brassica rapa]
Length=108

 Score =   151 bits (381),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 84/105 (80%), Gaps = 10/105 (10%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK---------NGYD-DVPKGHFPVYVGENRSRYVV  362
            M+K  KL QTA++KQILKRCSSLGKK         NG+  DVPKGHF VYVGENR RYVV
Sbjct  3    MKKANKLTQTAMIKQILKRCSSLGKKHSNVYSEDENGHPLDVPKGHFVVYVGENRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PISFLT PEFQ LL++AEEEFGFDHDMG+TIPC+E  FRSLT ML
Sbjct  63   PISFLTRPEFQLLLQQAEEEFGFDHDMGLTIPCDEAVFRSLTSML  107



>ref|XP_007157926.1| hypothetical protein PHAVU_002G109600g [Phaseolus vulgaris]
 gb|ESW29920.1| hypothetical protein PHAVU_002G109600g [Phaseolus vulgaris]
Length=104

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 84/105 (80%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGY------DDVPKGHFPVYVGENRSRYVVP  359
            MAI RK  KL Q  VLKQI+KRCSS GKK  Y      DDVPKGHF VYVGENRSRY++P
Sbjct  1    MAI-RKSNKLPQAIVLKQIVKRCSSFGKKQTYNEEGLPDDVPKGHFAVYVGENRSRYIIP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS+L +P+FQ LL+RAEEEFGF+HDMG+TIPC+EV F SLT M+R
Sbjct  60   ISWLAYPQFQSLLQRAEEEFGFNHDMGLTIPCDEVVFESLTSMMR  104



>emb|CDX73181.1| BnaC06g36290D [Brassica napus]
Length=108

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 84/105 (80%), Gaps = 10/105 (10%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK---------NGYD-DVPKGHFPVYVGENRSRYVV  362
            M+K  KL QTA++KQILKRCSSLGKK         NG+  DVPKGHF VYVGENR RYVV
Sbjct  3    MKKANKLTQTAMIKQILKRCSSLGKKQSNVCSEDENGHPLDVPKGHFVVYVGENRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PISFLT PEFQ LL++AEEEFGFDHDMG+TIPC+E  FRSLT ML
Sbjct  63   PISFLTRPEFQLLLQQAEEEFGFDHDMGLTIPCDEAVFRSLTSML  107



>ref|XP_010429019.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=105

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 85/104 (82%), Gaps = 7/104 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MAI R  +KLAQTA+LKQILKRCSSL K   YD      DVPKGHF VYVGE RSRY+VP
Sbjct  1    MAIKRS-SKLAQTAMLKQILKRCSSLAKNQCYDEDGLPVDVPKGHFAVYVGEKRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            ISFL HP+F+ LL++AEEEFGF+HDMG+TIPCEEV FRSLT M+
Sbjct  60   ISFLNHPKFKSLLQQAEEEFGFNHDMGLTIPCEEVVFRSLTSMI  103



>ref|XP_011083512.1| PREDICTED: auxin-induced protein 15A-like [Sesamum indicum]
Length=106

 Score =   150 bits (379),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 83/104 (80%), Gaps = 8/104 (8%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK-NGYD-------DVPKGHFPVYVGENRSRYVVPI  356
            M K  KL+Q AV+KQI+KRCSSLGKK  GY+       DVPKGHF VYVGENRSRY++PI
Sbjct  3    MTKSNKLSQKAVIKQIMKRCSSLGKKQGGYENDEGLPLDVPKGHFVVYVGENRSRYILPI  62

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            S LT PEFQ LLRRAEEEFGFDHDMG+TIPCE+  F SLT MLR
Sbjct  63   SILTRPEFQTLLRRAEEEFGFDHDMGLTIPCEQHVFESLTSMLR  106



>ref|XP_009117430.1| PREDICTED: auxin-induced protein 15A [Brassica rapa]
 emb|CDY13831.1| BnaA09g43330D [Brassica napus]
 emb|CDX82007.1| BnaC08g35940D [Brassica napus]
Length=104

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 6/103 (6%)
 Frame = -3

Query  514  IMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPIS  353
            + ++  KL QTA+LKQILKRCSSL K   YD      DVPKGHF VYVGE RSRY+VPIS
Sbjct  2    VAKRSPKLTQTAMLKQILKRCSSLAKNQCYDEDGLPVDVPKGHFVVYVGEKRSRYIVPIS  61

Query  352  FLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            FLTHP+F+ LL++AEEEFGF HDMG+TIPCEEV FRSLT M+R
Sbjct  62   FLTHPKFKSLLQQAEEEFGFKHDMGLTIPCEEVVFRSLTSMIR  104



>ref|XP_006390291.1| hypothetical protein EUTSA_v10019345mg [Eutrema salsugineum]
 gb|ESQ27577.1| hypothetical protein EUTSA_v10019345mg [Eutrema salsugineum]
Length=109

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 87/107 (81%), Gaps = 11/107 (10%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK---------NGYD-DVPKGHFPVYVGENRSRYVV  362
            ++K +KL QTA++KQIL+RCSSLGKK         NG+  DVPKGHF VYVGENR RYVV
Sbjct  3    LKKASKLTQTAMIKQILRRCSSLGKKQSNVYSEDENGHPLDVPKGHFVVYVGENRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLT-EMLR  224
            PISFLT PEFQ LL++AEEEFGFDHDMG+TIPCEEV FRSLT  MLR
Sbjct  63   PISFLTRPEFQLLLQQAEEEFGFDHDMGLTIPCEEVVFRSLTSSMLR  109



>ref|XP_004230998.2| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=122

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 84/106 (79%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDDV-------PKGHFPVYVGENRSRYVV  362
            MAI R   KL+Q AVLKQILKRC  LGKK GYDDV       PK HF VYVGENR+RY+V
Sbjct  18   MAI-RISNKLSQAAVLKQILKRCLILGKKQGYDDVHHLPIDVPKKHFAVYVGENRTRYIV  76

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PISFL+HP FQCLL+ AEEEFGFDH+MGITIPCEEV F +LT MLR
Sbjct  77   PISFLSHPLFQCLLQCAEEEFGFDHNMGITIPCEEVVFLALTSMLR  122



>ref|XP_006404561.1| hypothetical protein EUTSA_v10000385mg [Eutrema salsugineum]
 gb|ESQ46014.1| hypothetical protein EUTSA_v10000385mg [Eutrema salsugineum]
Length=104

 Score =   149 bits (376),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 85/105 (81%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MA+ R  +KL QTA++KQILKRCSSL K   YD      DVPKGHF VYVGE RSRY+VP
Sbjct  1    MAVKRS-SKLTQTAMVKQILKRCSSLAKTQCYDEDGLPLDVPKGHFVVYVGEKRSRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ISFL HP+F+ LL++AEEEFGF+HDMG+TIPCEEV FRSLT MLR
Sbjct  60   ISFLNHPKFKNLLQQAEEEFGFNHDMGLTIPCEEVVFRSLTSMLR  104



>ref|XP_004500950.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Cicer 
arietinum]
Length=99

 Score =   149 bits (376),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGYD-DVPKGHFPVYVGENRSRYVVPISFLTHPE  335
            +RK  KL QT ++KQILKRCSSLGKK+G   DVPKGHF VYVGENRSRY+VPISFL+ PE
Sbjct  3    LRKSTKLPQTPLIKQILKRCSSLGKKHGLRLDVPKGHFVVYVGENRSRYIVPISFLSRPE  62

Query  334  FQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            FQ LL +AEEEFGFDHDMG+TIPC++  F SLT MLR
Sbjct  63   FQNLLHKAEEEFGFDHDMGLTIPCDQHVFESLTSMLR  99



>ref|XP_006282761.1| hypothetical protein CARUB_v10006088mg [Capsella rubella]
 ref|XP_010431836.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
 ref|XP_010436982.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
 ref|XP_010446401.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
 gb|EOA15659.1| hypothetical protein CARUB_v10006088mg [Capsella rubella]
Length=105

 Score =   149 bits (376),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 86/106 (81%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MA+ R  +KL QTA+LKQILKRCSSLGKK  YD      DVPKGHFPVYVGE R+RY+VP
Sbjct  1    MAVKRS-SKLTQTAMLKQILKRCSSLGKKQCYDEEGLPLDVPKGHFPVYVGEKRTRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDM-GITIPCEEVAFRSLTEMLR  224
            ISFLTHPEF  LL++AEEEFGF HDM G+TIPCEEV F SLT M+R
Sbjct  60   ISFLTHPEFLILLQQAEEEFGFHHDMGGLTIPCEEVVFLSLTSMIR  105



>ref|NP_001235483.1| uncharacterized protein LOC100305700 [Glycine max]
 ref|XP_003527705.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Glycine 
max]
 gb|ACU13520.1| unknown [Glycine max]
 gb|KHN09098.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
 gb|KHN45915.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=100

 Score =   149 bits (375),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 83/98 (85%), Gaps = 2/98 (2%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKN--GYDDVPKGHFPVYVGENRSRYVVPISFLTHP  338
            +RK +KL QTA++KQILKRCSSLG+K+  G  DVPKGHF VYVGENRSRY+VPISFL+ P
Sbjct  3    LRKSSKLPQTALIKQILKRCSSLGRKDDQGLLDVPKGHFVVYVGENRSRYIVPISFLSRP  62

Query  337  EFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            EFQ LL +AEEEFGFDH+ G+TIPCEE  F SLT MLR
Sbjct  63   EFQTLLHQAEEEFGFDHEKGLTIPCEEDVFESLTSMLR  100



>ref|XP_004147005.1| PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]
Length=109

 Score =   149 bits (376),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 89/110 (81%), Gaps = 12/110 (11%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKK--NG-YD-------DVPKGHFPVYVGENRSR  371
            MAI+ K  KL Q+ VLKQILKRCSSLGKK  NG YD       DVPKGHF VYVGENRSR
Sbjct  1    MAIL-KGNKLPQSTVLKQILKRCSSLGKKSNNGAYDADEELPLDVPKGHFAVYVGENRSR  59

Query  370  YVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLT-EMLR  224
            ++VPISFLTHPEFQCLLR+AEEEFGFDH MG+TIPC+E  FRSLT  MLR
Sbjct  60   FIVPISFLTHPEFQCLLRQAEEEFGFDHYMGLTIPCQEHVFRSLTSSMLR  109



>ref|NP_195597.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 ref|XP_002866820.1| hypothetical protein ARALYDRAFT_912336 [Arabidopsis lyrata subsp. 
lyrata]
 emb|CAB38620.1| putative auxin-induced protein [Arabidopsis thaliana]
 emb|CAB80549.1| putative auxin-induced protein [Arabidopsis thaliana]
 gb|AAS49069.1| At4g38860 [Arabidopsis thaliana]
 dbj|BAD93936.1| putative auxin-induced protein [Arabidopsis thaliana]
 dbj|BAF02196.1| putative auxin-induced protein [Arabidopsis thaliana]
 gb|EFH43079.1| hypothetical protein ARALYDRAFT_912336 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE86984.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=105

 Score =   149 bits (376),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 86/106 (81%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MA+ R  +KL QTA+LKQILKRCSSLGKK  YD      DVPKGHFPVYVGE R+RY+VP
Sbjct  1    MAVKRS-SKLTQTAMLKQILKRCSSLGKKQCYDEEGLPLDVPKGHFPVYVGEKRTRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDM-GITIPCEEVAFRSLTEMLR  224
            ISFLTHPEF  LL++AEEEFGF HDM G+TIPCEEV F SLT M+R
Sbjct  60   ISFLTHPEFLILLQQAEEEFGFRHDMGGLTIPCEEVVFLSLTSMIR  105



>ref|XP_002300717.1| hypothetical protein POPTR_0002s02590g [Populus trichocarpa]
 ref|XP_011028984.1| PREDICTED: auxin-induced protein 15A-like [Populus euphratica]
 gb|EEE79990.1| hypothetical protein POPTR_0002s02590g [Populus trichocarpa]
Length=104

 Score =   149 bits (376),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 83/101 (82%), Gaps = 8/101 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  KL QTAV+KQILKRCSSLGKK GY D       VPKGHF VYVGENRSRY+V
Sbjct  1    MAI-RKSNKLPQTAVIKQILKRCSSLGKKQGYHDQEGLPLDVPKGHFVVYVGENRSRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL  239
            PIS L+ PEFQ LL++AEEEFGFDHDMG+TIPCEEV F+S+
Sbjct  60   PISILSRPEFQTLLQQAEEEFGFDHDMGLTIPCEEVVFQSI  100



>ref|XP_008457621.1| PREDICTED: auxin-induced protein 15A [Cucumis melo]
Length=109

 Score =   149 bits (376),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 88/110 (80%), Gaps = 12/110 (11%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKK--NG-YD-------DVPKGHFPVYVGENRSR  371
            MAI+ K  KL Q  VLKQILKRCSSLGKK  NG YD       DVPKGHF VYVGENRSR
Sbjct  1    MAIL-KVNKLPQPTVLKQILKRCSSLGKKSNNGAYDADEELPLDVPKGHFAVYVGENRSR  59

Query  370  YVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLT-EMLR  224
            Y+VPISFLTHPEFQCLLR+AEEEFGFDH MG+TIPC+E  FRSLT  MLR
Sbjct  60   YIVPISFLTHPEFQCLLRQAEEEFGFDHYMGLTIPCQEHVFRSLTSSMLR  109



>ref|XP_010029694.1| PREDICTED: auxin-induced protein 15A-like [Eucalyptus grandis]
 gb|KCW56654.1| hypothetical protein EUGRSUZ_I02358 [Eucalyptus grandis]
Length=109

 Score =   149 bits (375),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 11/107 (10%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK--NGYD---------DVPKGHFPVYVGENRSRYV  365
            M+K  KL QTA +KQILK+CSSLGKK  NGY+         DVP+GHF VYVGENRSRY+
Sbjct  3    MKKSNKLPQTAAIKQILKKCSSLGKKSSNGYNSNEEAGLPEDVPRGHFVVYVGENRSRYI  62

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPIS+L HP+FQ LL+RAE+E+GF+HDMGITIPCEE  F+SL  M+R
Sbjct  63   VPISWLDHPKFQGLLQRAEDEYGFNHDMGITIPCEEAVFQSLASMIR  109



>ref|XP_009104700.1| PREDICTED: auxin-induced protein 15A-like [Brassica rapa]
 emb|CDX68122.1| BnaA07g21620D [Brassica napus]
Length=108

 Score =   149 bits (375),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 84/105 (80%), Gaps = 10/105 (10%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK---------NGYD-DVPKGHFPVYVGENRSRYVV  362
            M+K  KL QTA++KQILKRCSSLGKK         NG+  DVPKGHF VYVGENR RYVV
Sbjct  3    MKKANKLTQTAMIKQILKRCSSLGKKQSNEYSEDENGHPLDVPKGHFVVYVGENRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PIS LT PEFQ LL++AEEEFGFDH+MG+TIPCEEV F+SLT ML
Sbjct  63   PISLLTRPEFQLLLQQAEEEFGFDHEMGLTIPCEEVVFQSLTSML  107



>ref|XP_010934541.1| PREDICTED: auxin-induced protein 15A-like [Elaeis guineensis]
Length=108

 Score =   149 bits (375),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 84/106 (79%), Gaps = 10/106 (9%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGY----------DDVPKGHFPVYVGENRSRYVV  362
            +RK  KL+QT VLKQILKRCSSLG+K G           DDVPKGHF VYVGENRSR++V
Sbjct  3    LRKHNKLSQTMVLKQILKRCSSLGRKQGLGGGGEEEGLPDDVPKGHFAVYVGENRSRFIV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PIS+L+HPEFQ LLR+AEEEFGF H MG+TIPCEEV FRSLT  LR
Sbjct  63   PISYLSHPEFQRLLRQAEEEFGFRHHMGLTIPCEEVVFRSLTSSLR  108



>gb|KHN36041.1| Auxin-induced protein 15A [Glycine soja]
Length=104

 Score =   148 bits (374),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 83/105 (79%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGY------DDVPKGHFPVYVGENRSRYVVP  359
            MAI +K  KL Q  VLKQI+KRCSS GKK  Y      DDVPKGHF VYVG+NR+RY++P
Sbjct  1    MAI-KKSNKLPQAVVLKQIVKRCSSFGKKQTYNEEGLPDDVPKGHFAVYVGDNRTRYIIP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS+L  P+FQ LL+RAEEEFGF HDMG+TIPC+EVAF SLT M+R
Sbjct  60   ISWLAQPQFQSLLQRAEEEFGFTHDMGLTIPCDEVAFESLTSMMR  104



>ref|XP_009382023.1| PREDICTED: auxin-induced protein 15A-like [Musa acuminata subsp. 
malaccensis]
Length=103

 Score =   148 bits (373),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 83/104 (80%), Gaps = 6/104 (6%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD-----DVPKGHFPVYVGENRSRYVVPI  356
            MAI  K  KL Q A +KQ+LKRCSSLG+K G D     DVPKGHF VYVGE RSR++VPI
Sbjct  1    MAIG-KGNKLPQAAAIKQMLKRCSSLGRKQGLDEQLPGDVPKGHFAVYVGEKRSRFIVPI  59

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            S+L  PEFQ LLR+AEEEFGFDHDMG+TIPCEEV FRSLT +LR
Sbjct  60   SYLKRPEFQSLLRQAEEEFGFDHDMGLTIPCEEVVFRSLTSVLR  103



>gb|KGN61863.1| hypothetical protein Csa_2G258100 [Cucumis sativus]
Length=181

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 89/110 (81%), Gaps = 12/110 (11%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKK--NG-YD-------DVPKGHFPVYVGENRSR  371
            MAI+ K  KL Q+ VLKQILKRCSSLGKK  NG YD       DVPKGHF VYVGENRSR
Sbjct  73   MAIL-KGNKLPQSTVLKQILKRCSSLGKKSNNGAYDADEELPLDVPKGHFAVYVGENRSR  131

Query  370  YVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLT-EMLR  224
            ++VPISFLTHPEFQCLLR+AEEEFGFDH MG+TIPC+E  FRSLT  MLR
Sbjct  132  FIVPISFLTHPEFQCLLRQAEEEFGFDHYMGLTIPCQEHVFRSLTSSMLR  181



>gb|KFK40069.1| hypothetical protein AALP_AA3G326200 [Arabis alpina]
Length=109

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 89/109 (82%), Gaps = 10/109 (9%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD----------DVPKGHFPVYVGENRSR  371
            MAI++K  KLAQTA+LKQILKRCSSLGKKNG            DVPKGHFPVYVG  RSR
Sbjct  1    MAILKKSTKLAQTAMLKQILKRCSSLGKKNGGGGGYEEDDLPLDVPKGHFPVYVGHKRSR  60

Query  370  YVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            Y+VPISFLT+ +FQCLLRRAEEEFGFDHDMG+TIPC+E+ F+ LT M+R
Sbjct  61   YIVPISFLTNLDFQCLLRRAEEEFGFDHDMGLTIPCDELFFQDLTSMIR  109



>ref|XP_006411676.1| hypothetical protein EUTSA_v10026642mg [Eutrema salsugineum]
 gb|ESQ53129.1| hypothetical protein EUTSA_v10026642mg [Eutrema salsugineum]
Length=105

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 86/106 (81%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MA+ R  +KL QTA+LKQILKRCSSLGKK  YD      DVPKGHFPVYVGE R+RY+VP
Sbjct  1    MAVKRS-SKLTQTAMLKQILKRCSSLGKKQCYDEEGLPLDVPKGHFPVYVGEKRTRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDM-GITIPCEEVAFRSLTEMLR  224
            ISFL+HPEF  LL++AEEEFGF HDM G+TIPCEEV F SLT M+R
Sbjct  60   ISFLSHPEFLILLQQAEEEFGFHHDMGGLTIPCEEVVFLSLTSMIR  105



>ref|XP_009628642.1| PREDICTED: auxin-induced protein X15-like [Nicotiana tomentosiformis]
Length=106

 Score =   147 bits (372),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 82/99 (83%), Gaps = 8/99 (8%)
 Frame = -3

Query  496  KLAQTAVLKQILKRCSSLGKKNGYD--------DVPKGHFPVYVGENRSRYVVPISFLTH  341
            K+ Q AVLKQILK+CSSLGKK+ +D        DVPKGHF VYVGENR+RYVVPISFLT+
Sbjct  8    KIEQAAVLKQILKQCSSLGKKHSHDNEDYCLPIDVPKGHFAVYVGENRTRYVVPISFLTY  67

Query  340  PEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PEF+C LR AEEEFGFDHDMGITIPCEE+ FRSL  MLR
Sbjct  68   PEFRCRLRCAEEEFGFDHDMGITIPCEEMIFRSLIFMLR  106



>ref|XP_009627643.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=108

 Score =   147 bits (372),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 88/109 (81%), Gaps = 11/109 (10%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG--YD-------DVPKGHFPVYVGENRSRY  368
            MAI RK  KL+QTA+LKQILKRCSSLGKKNG  +D       DVPKGHF VYVGENR+RY
Sbjct  1    MAI-RKSNKLSQTAMLKQILKRCSSLGKKNGSYHDEQLGLPLDVPKGHFVVYVGENRTRY  59

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLT-EMLR  224
            +VPIS L+ PEF+ LL+RAEEEFGFDHDMG+TIPC+E  F SLT  MLR
Sbjct  60   IVPISILSRPEFRSLLQRAEEEFGFDHDMGLTIPCDEDVFESLTSSMLR  108



>ref|XP_002869044.1| hypothetical protein ARALYDRAFT_491020 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45303.1| hypothetical protein ARALYDRAFT_491020 [Arabidopsis lyrata subsp. 
lyrata]
Length=104

 Score =   147 bits (372),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (82%), Gaps = 5/104 (5%)
 Frame = -3

Query  520  MAIMR-KPAKLAQTAVLKQILKRCSSLGKKNG----YDDVPKGHFPVYVGENRSRYVVPI  356
            MAI +   A L+Q A LKQILKRCSSLGKKN     ++DVPKGHFPVYVG++RSRYVVPI
Sbjct  1    MAIKKSNKAALSQAASLKQILKRCSSLGKKNQGNCYFNDVPKGHFPVYVGQHRSRYVVPI  60

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            S+L HPEFQ LL+ AEEEFGF+H+MG+TIPC+EV FRSL  M R
Sbjct  61   SWLDHPEFQSLLQLAEEEFGFEHEMGLTIPCDEVIFRSLISMFR  104



>ref|XP_009391842.1| PREDICTED: auxin-induced protein 15A-like [Musa acuminata subsp. 
malaccensis]
Length=102

 Score =   147 bits (370),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 86/103 (83%), Gaps = 5/103 (5%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD----DVPKGHFPVYVGENRSRYVVPIS  353
            MA+ +K  KLAQTAVLKQILKRCSSLG++   +    DVP+GHF VYVG+NRSRY+VPIS
Sbjct  1    MAV-KKQNKLAQTAVLKQILKRCSSLGREEKEEGPPVDVPRGHFVVYVGKNRSRYIVPIS  59

Query  352  FLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +L HPEFQ LLR++EEEFGF H MG+TIPC+EVAFRSLT  LR
Sbjct  60   YLDHPEFQSLLRQSEEEFGFKHHMGLTIPCDEVAFRSLTSSLR  102



>ref|XP_009788456.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=108

 Score =   147 bits (370),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 85/104 (82%), Gaps = 10/104 (10%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG-YDD--------VPKGHFPVYVGENRSRY  368
            MAI RK  KL+QTA+LKQI+KRCSSLGKKNG Y+D        VPKGHF VYVGENR+RY
Sbjct  1    MAI-RKSNKLSQTAMLKQIMKRCSSLGKKNGSYNDEQLGLPLDVPKGHFVVYVGENRTRY  59

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLT  236
            +VPIS L+ PEF+ LL+RAEEEFGFDHDMG+TIPC+E  F SLT
Sbjct  60   IVPISILSRPEFRSLLQRAEEEFGFDHDMGLTIPCDEDVFESLT  103



>ref|XP_002307708.1| hypothetical protein POPTR_0005s25840g [Populus trichocarpa]
 ref|XP_011045117.1| PREDICTED: auxin-induced protein 15A [Populus euphratica]
 gb|EEE94704.1| hypothetical protein POPTR_0005s25840g [Populus trichocarpa]
Length=104

 Score =   147 bits (370),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 83/101 (82%), Gaps = 8/101 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  +L QTAV++QILKRCSSLGKK GY D       VPKGHF VYVGENRSRY+V
Sbjct  1    MAI-RKSNRLPQTAVIRQILKRCSSLGKKQGYHDQEGLPLDVPKGHFVVYVGENRSRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL  239
            PIS L+ PEFQ LL++AEEEFGFDHDMG+TIPCEEV F+S+
Sbjct  60   PISILSSPEFQTLLQQAEEEFGFDHDMGLTIPCEEVVFQSI  100



>ref|XP_006573558.1| PREDICTED: uncharacterized protein LOC100776099 [Glycine max]
Length=151

 Score =   148 bits (373),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 83/105 (79%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGY------DDVPKGHFPVYVGENRSRYVVP  359
            MAI +K  KL Q  VLKQI+KRCSS GKK  Y      DDVPKGHF VYVG+NR+RY++P
Sbjct  48   MAI-KKSNKLPQAVVLKQIVKRCSSFGKKQTYNEEGLPDDVPKGHFAVYVGDNRTRYIIP  106

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS+L  P+FQ LL+RAEEEFGF HDMG+TIPC+EVAF SLT M+R
Sbjct  107  ISWLAQPQFQSLLQRAEEEFGFTHDMGLTIPCDEVAFESLTSMMR  151



>ref|XP_004512127.1| PREDICTED: auxin-induced protein 15A-like [Cicer arietinum]
Length=104

 Score =   146 bits (369),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 84/105 (80%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGY------DDVPKGHFPVYVGENRSRYVVP  359
            MAI +K  KL QT V+KQILKRCSS GK+  Y      +DVPKGHF VYVGENR+RY++P
Sbjct  1    MAI-KKSNKLPQTEVIKQILKRCSSFGKRQSYYEEGLPEDVPKGHFAVYVGENRTRYIIP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS+L HP+FQ LL+RAEEEFGF+HDMG+TIPC+EV F SL  ++R
Sbjct  60   ISWLAHPQFQSLLQRAEEEFGFNHDMGLTIPCDEVVFESLISLMR  104



>ref|XP_006282477.1| hypothetical protein CARUB_v10006094mg [Capsella rubella]
 gb|EOA15375.1| hypothetical protein CARUB_v10006094mg [Capsella rubella]
Length=104

 Score =   146 bits (369),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 84/104 (81%), Gaps = 5/104 (5%)
 Frame = -3

Query  520  MAIMR-KPAKLAQTAVLKQILKRCSSLGKKNG----YDDVPKGHFPVYVGENRSRYVVPI  356
            MAI +   A L+Q A LKQILKRCSSLGKKN     ++DVPKGHFPVYVG++RSRYVVPI
Sbjct  1    MAIKKTNKAALSQAATLKQILKRCSSLGKKNQGNCYFNDVPKGHFPVYVGQHRSRYVVPI  60

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            S+L H EFQ LL+ AEEEFGF+H+MGITIPC+EV FRSL  M R
Sbjct  61   SWLDHHEFQTLLQLAEEEFGFEHEMGITIPCDEVVFRSLISMFR  104



>ref|XP_006359707.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like, partial 
[Solanum tuberosum]
Length=115

 Score =   147 bits (370),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 81/99 (82%), Gaps = 3/99 (3%)
 Frame = -3

Query  514  IMRKPAKLAQTAVLKQILKRCSSLGKKNGY---DDVPKGHFPVYVGENRSRYVVPISFLT  344
            I  K AKL Q  +LKQILK+CSSL KKN      DVPKGHF VYVG+NR+RY+VPISFLT
Sbjct  16   IHTKMAKLPQVVLLKQILKKCSSLSKKNEVHFPTDVPKGHFAVYVGKNRTRYIVPISFLT  75

Query  343  HPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            +PEFQCLLR AEEEFGF+HDMGITIPCEE  F+SLT +L
Sbjct  76   NPEFQCLLRCAEEEFGFNHDMGITIPCEEFIFQSLTSIL  114



>ref|XP_009101924.1| PREDICTED: auxin-induced protein 15A-like [Brassica rapa]
 emb|CDY22408.1| BnaA06g37300D [Brassica napus]
 emb|CDX72733.1| BnaC07g47550D [Brassica napus]
Length=104

 Score =   146 bits (368),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 83/101 (82%), Gaps = 6/101 (6%)
 Frame = -3

Query  508  RKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISFL  347
            ++ +KL QTA+LKQI+KRCSSLGKK  YD      DVPKGHFPVYVGENR+RY+VPI+FL
Sbjct  4    KRSSKLTQTAMLKQIIKRCSSLGKKQCYDEEGLPLDVPKGHFPVYVGENRTRYIVPITFL  63

Query  346  THPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +HPEF  LL++AEEEFGF H  G+TIPCEEV F SLT M+R
Sbjct  64   SHPEFLILLQQAEEEFGFHHMGGLTIPCEEVVFLSLTSMIR  104



>emb|CDX85905.1| BnaC06g22290D [Brassica napus]
Length=108

 Score =   146 bits (368),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 83/105 (79%), Gaps = 10/105 (10%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK---------NGYD-DVPKGHFPVYVGENRSRYVV  362
            M+K  KL QTA++KQILKRCSSLGKK         NG+  DVPKGHF VYVGENR RYVV
Sbjct  3    MKKANKLTQTAMIKQILKRCSSLGKKQSNEYSEDENGHPLDVPKGHFVVYVGENRVRYVV  62

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PI  LT PEFQ LL++AEEEFGFDH+MG+TIPCEEV F+SLT ML
Sbjct  63   PILLLTRPEFQLLLQQAEEEFGFDHEMGLTIPCEEVVFQSLTSML  107



>ref|XP_010446822.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=104

 Score =   146 bits (368),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 84/104 (81%), Gaps = 5/104 (5%)
 Frame = -3

Query  520  MAIMR-KPAKLAQTAVLKQILKRCSSLGKKNG----YDDVPKGHFPVYVGENRSRYVVPI  356
            MAI +   A L+Q A LKQILKRCSSLGKKN     ++DVPKGHFPVYVG++RSRYVVPI
Sbjct  1    MAIKKSNKAALSQAASLKQILKRCSSLGKKNQGNCYFNDVPKGHFPVYVGQHRSRYVVPI  60

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            S+L H EFQ LL+ AEEEFGF+H+MGITIPC+EV FRSL  M R
Sbjct  61   SWLDHHEFQTLLQLAEEEFGFEHEMGITIPCDEVVFRSLISMFR  104



>ref|XP_004287824.1| PREDICTED: auxin-induced protein 15A-like [Fragaria vesca subsp. 
vesca]
Length=111

 Score =   146 bits (368),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 82/108 (76%), Gaps = 12/108 (11%)
 Frame = -3

Query  520  MAIMRKPAK-----LAQTAVLKQILKRCSSLGKKNGY-------DDVPKGHFPVYVGENR  377
            MAI++K        L QT  LKQILKRCSS GKKN         DDVPKGHF VYVGENR
Sbjct  1    MAIIKKSLSNKALLLPQTTALKQILKRCSSFGKKNNVYNESGLPDDVPKGHFAVYVGENR  60

Query  376  SRYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTE  233
            SRY++PIS+L HPEFQ LL+RAEEE+GF+HDMG+TIPCEEV FRSL +
Sbjct  61   SRYIIPISWLGHPEFQSLLQRAEEEYGFNHDMGLTIPCEEVVFRSLID  108



>ref|XP_006412024.1| hypothetical protein EUTSA_v10026647mg [Eutrema salsugineum]
 gb|ESQ53477.1| hypothetical protein EUTSA_v10026647mg [Eutrema salsugineum]
Length=104

 Score =   145 bits (367),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 86/105 (82%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLA--QTAVLKQILKRCSSLGKKNG----YDDVPKGHFPVYVGENRSRYVVP  359
            MAI RK  K+A  Q A +K+ILKRCSSLGKKN     ++DVPKGHFPVYVG++RSRYV+P
Sbjct  1    MAI-RKSNKVAASQAASIKKILKRCSSLGKKNQGNCYFNDVPKGHFPVYVGQHRSRYVIP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS+L HPEFQ LL+ AEEEFGF+HDMG+TIPC+EV FRSL  M R
Sbjct  60   ISWLAHPEFQTLLQLAEEEFGFEHDMGLTIPCDEVVFRSLISMFR  104



>ref|XP_004238342.1| PREDICTED: auxin-induced protein 15A [Solanum lycopersicum]
Length=108

 Score =   146 bits (368),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 86/109 (79%), Gaps = 11/109 (10%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD---------VPKGHFPVYVGENRSRY  368
            MAI RK  KL+Q A+LKQILKRCSSLGKKNGY D         VPKGHF VYVGENR+RY
Sbjct  1    MAI-RKSNKLSQRAMLKQILKRCSSLGKKNGYQDEQQGGLPMDVPKGHFVVYVGENRTRY  59

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLT-EMLR  224
            +VPIS L+ PEF+ LL++AEEEFGFDHDMG+TIPC+E  F SLT  MLR
Sbjct  60   IVPISILSRPEFRALLQQAEEEFGFDHDMGLTIPCKEDFFESLTSSMLR  108



>ref|XP_009134559.1| PREDICTED: auxin-induced protein 15A-like [Brassica rapa]
 emb|CDY41947.1| BnaA01g05190D [Brassica napus]
Length=105

 Score =   145 bits (367),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 86/106 (81%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MA+ R  +K+ QTA+LKQILKRCSSLGKK  YD      DVPKGHFPVYVGE R+RY+VP
Sbjct  1    MAVKRS-SKVTQTAMLKQILKRCSSLGKKQCYDEEGLPLDVPKGHFPVYVGEKRTRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDM-GITIPCEEVAFRSLTEMLR  224
            I+FL+HPEF  LL++AEEEFGF HDM G+TIPCEEV F SLT M+R
Sbjct  60   ITFLSHPEFLILLQQAEEEFGFHHDMGGLTIPCEEVVFLSLTSMIR  105



>gb|KEH36239.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
Length=106

 Score =   145 bits (367),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 84/107 (79%), Gaps = 9/107 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKN-GYDD-------VPKGHFPVYVGENRSRYV  365
            MAI RK  KL QTA++KQILKRCSSLGKK  GY D       VPKGHF VYVGENRSRY+
Sbjct  1    MAI-RKSTKLPQTALIKQILKRCSSLGKKQQGYVDHHGLRLDVPKGHFVVYVGENRSRYI  59

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPI+FL+ PEFQ LL +AEEEFGFDHDMG+TIPC +  F SLT MLR
Sbjct  60   VPIAFLSRPEFQNLLHQAEEEFGFDHDMGLTIPCNQDVFESLTSMLR  106



>emb|CDY47053.1| BnaAnng08410D [Brassica napus]
Length=99

 Score =   145 bits (365),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -3

Query  514  IMRKPAKLA--QTAVLKQILKRCSSLGKKNGYDDVPKGHFPVYVGENRSRYVVPISFLTH  341
            + +K  K++  Q A LK+ILKRCSSLGKKN  +DVPKGHFPVYVG++RSRYVVPIS+L H
Sbjct  2    VTKKSNKVSACQAASLKKILKRCSSLGKKNQGNDVPKGHFPVYVGQHRSRYVVPISWLAH  61

Query  340  PEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PEFQ LL+ AEEEFGF+HDMG+TIPC+EV F+SL  M 
Sbjct  62   PEFQSLLQLAEEEFGFEHDMGLTIPCDEVVFQSLISMF  99



>ref|NP_195334.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 gb|AAG40017.1|AF324666_1 AT4g36110 [Arabidopsis thaliana]
 gb|AAG42911.1|AF327530_1 putative auxin-induced protein [Arabidopsis thaliana]
 gb|AAK15571.1|AF349524_1 putative auxin-induced protein [Arabidopsis thaliana]
 emb|CAA18505.1| putative auxin-induced protein [Arabidopsis thaliana]
 emb|CAB81520.1| putative auxin-induced protein [Arabidopsis thaliana]
 gb|AAL57691.1| AT4g36110/T19K4_240 [Arabidopsis thaliana]
 gb|AAM10370.1| AT4g36110/T19K4_240 [Arabidopsis thaliana]
 gb|AEE86621.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=104

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 84/104 (81%), Gaps = 5/104 (5%)
 Frame = -3

Query  520  MAIMR-KPAKLAQTAVLKQILKRCSSLGKKNG----YDDVPKGHFPVYVGENRSRYVVPI  356
            MAI +   A L+Q A LKQILKRCSSLGKKN     ++DVPKGHFPVYVG++RSRYVVPI
Sbjct  1    MAIKKSNKAALSQAASLKQILKRCSSLGKKNQGNCYFNDVPKGHFPVYVGQHRSRYVVPI  60

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            S+L H EFQ LL+ AEEEFGF+H+MG+TIPC+EV FRSL  M R
Sbjct  61   SWLDHHEFQSLLQLAEEEFGFEHEMGLTIPCDEVVFRSLISMFR  104



>gb|KFK30480.1| hypothetical protein AALP_AA7G266200 [Arabis alpina]
Length=105

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 85/106 (80%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MA+ R  +K+ QTA+LKQILKRCSSLGKK  YD      DVPKGHFPVYVGE R+RY+VP
Sbjct  1    MAVKRS-SKMTQTAMLKQILKRCSSLGKKQCYDEEGLPLDVPKGHFPVYVGEKRTRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDM-GITIPCEEVAFRSLTEMLR  224
            ISFL+HPEF  LL++AEEEFGF HDM G+TIPCEEV F SL  M+R
Sbjct  60   ISFLSHPEFLILLQQAEEEFGFRHDMGGLTIPCEEVVFLSLISMIR  105



>ref|XP_003629338.1| Auxin-induced protein 6B [Medicago truncatula]
 gb|ACJ84173.1| unknown [Medicago truncatula]
 gb|AET03814.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
 gb|AFK40934.1| unknown [Medicago truncatula]
Length=105

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 86/106 (81%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQ-TAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVV  362
            MAI RK  KL Q   ++KQILKRCSS GKKNGY+      DVPKGHF VYVGENR+RY+V
Sbjct  1    MAI-RKSNKLPQPDVIIKQILKRCSSFGKKNGYNEESLPEDVPKGHFVVYVGENRTRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PIS+L HP+FQ LL+RAEEEFGF+HDMG+TIPC+EVAF  LT ++R
Sbjct  60   PISWLPHPQFQRLLQRAEEEFGFNHDMGLTIPCDEVAFEFLTSLIR  105



>ref|XP_010667387.1| PREDICTED: auxin-induced protein 15A-like [Beta vulgaris subsp. 
vulgaris]
Length=106

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 83/105 (79%), Gaps = 8/105 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGY-------DDVPKGHFPVYVGENRSRYVV  362
            MAI RK AK+ QTAVLKQILKRCSSLGKK GY       DDVPKGHF VYVG NR+RY+V
Sbjct  1    MAI-RKSAKMPQTAVLKQILKRCSSLGKKQGYQQENEFPDDVPKGHFAVYVGVNRTRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PIS L+ PEFQ LL ++EEEFGF H+MG+TIPC+E  F SLT ML
Sbjct  60   PISLLSRPEFQSLLHQSEEEFGFCHEMGLTIPCDEHVFESLTSML  104



>emb|CDY42589.1| BnaC01g00010D [Brassica napus]
Length=105

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 86/106 (81%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MA+ ++ +K+ QTA+LKQILKRCSSLGKK  YD      DVPKGHFPVYVGE R RY+VP
Sbjct  1    MAV-KRSSKVTQTAMLKQILKRCSSLGKKQCYDEEGLSLDVPKGHFPVYVGEKRMRYIVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDM-GITIPCEEVAFRSLTEMLR  224
            I+FL+HPEF  LL++AEEEFGF HDM G+TIPCEEV F SLT M+R
Sbjct  60   ITFLSHPEFLILLQQAEEEFGFHHDMGGLTIPCEEVVFLSLTSMIR  105



>ref|XP_009109257.1| PREDICTED: auxin-induced protein 15A-like [Brassica rapa]
 emb|CDY24829.1| BnaA08g14810D [Brassica napus]
Length=104

 Score =   144 bits (364),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 83/102 (81%), Gaps = 6/102 (6%)
 Frame = -3

Query  511  MRKPAKLA--QTAVLKQILKRCSSLGKKNG----YDDVPKGHFPVYVGENRSRYVVPISF  350
            ++K  K+A  Q A LK+ILKRCSSLGKKN     ++DVPKGHFPVYVG+ RSRYVVPIS+
Sbjct  3    LKKSNKVAASQAASLKKILKRCSSLGKKNQSNCYFNDVPKGHFPVYVGQQRSRYVVPISW  62

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            L HPEFQ LL+ AEEEFGF+HDMG+TIPC+EV F+SL  M R
Sbjct  63   LDHPEFQTLLQLAEEEFGFEHDMGLTIPCDEVVFQSLISMFR  104



>ref|XP_009788457.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=109

 Score =   144 bits (364),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 84/103 (82%), Gaps = 10/103 (10%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG-YDD--------VPKGHFPVYVGENRSRY  368
            MAI RK  KL+QTA+LKQI+KRCSSLGKKNG Y+D        VPKGHF VYVGENR+RY
Sbjct  1    MAI-RKSNKLSQTAMLKQIMKRCSSLGKKNGSYNDEQLGLPLDVPKGHFVVYVGENRTRY  59

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL  239
            +VPIS L+ PEF+ LL+RAEEEFGFDHDMG+TIPC+E  F SL
Sbjct  60   IVPISILSRPEFRSLLQRAEEEFGFDHDMGLTIPCDEDVFESL  102



>ref|XP_003612148.1| Auxin-induced protein 6B [Medicago truncatula]
 gb|AES95106.1| SAUR-like auxin-responsive family protein [Medicago truncatula]
 gb|AFK43518.1| unknown [Medicago truncatula]
Length=104

 Score =   144 bits (364),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 84/105 (80%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVP  359
            MAI +K  KL Q  V+KQI+KRCSS GK+  Y+      DVPKGHF VYVGENR+RY++P
Sbjct  1    MAI-KKSNKLPQAEVIKQIVKRCSSFGKRQSYNEEGLPEDVPKGHFVVYVGENRTRYIIP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS+L HP+FQ LL+RAE+EFGF+HDMG+TIPC+EV F SLT M+R
Sbjct  60   ISWLAHPQFQSLLQRAEDEFGFNHDMGLTIPCDEVFFESLTSMMR  104



>emb|CDY08909.1| BnaC08g11390D [Brassica napus]
Length=104

 Score =   144 bits (364),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 83/102 (81%), Gaps = 6/102 (6%)
 Frame = -3

Query  511  MRKPAKLA--QTAVLKQILKRCSSLGKKNG----YDDVPKGHFPVYVGENRSRYVVPISF  350
            ++K  K+A  Q A LK+ILKRCSSLGKKN     ++DVPKGHFPVYVG+ RSRYVVPIS+
Sbjct  3    LKKSNKVAASQAAYLKKILKRCSSLGKKNQSNCYFNDVPKGHFPVYVGQQRSRYVVPISW  62

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            L HPEFQ LL+ AEEEFGF+HDMG+TIPC+EV F+SL  M R
Sbjct  63   LDHPEFQTLLQLAEEEFGFEHDMGLTIPCDEVVFQSLISMFR  104



>ref|XP_007136080.1| hypothetical protein PHAVU_009G015900g [Phaseolus vulgaris]
 gb|ESW08074.1| hypothetical protein PHAVU_009G015900g [Phaseolus vulgaris]
Length=101

 Score =   144 bits (363),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 3/98 (3%)
 Frame = -3

Query  508  RKPAKLAQTAVLKQILKRCSSLGKKNGYD---DVPKGHFPVYVGENRSRYVVPISFLTHP  338
            RK  KL Q A++KQILKRCSSLG+K+ +    DVPKGHF VYVGENRSRY+VPISFL+ P
Sbjct  4    RKSGKLPQAALIKQILKRCSSLGRKDDHGLRLDVPKGHFVVYVGENRSRYIVPISFLSRP  63

Query  337  EFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            EFQ LL +AEEEFGFDH+ G+TIPCEE  F SLT MLR
Sbjct  64   EFQTLLHQAEEEFGFDHEKGLTIPCEEDVFESLTSMLR  101



>ref|XP_010467599.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=105

 Score =   144 bits (363),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 83/105 (79%), Gaps = 6/105 (6%)
 Frame = -3

Query  520  MAIMRKP-AKLAQTAVLKQILKRCSSLGK-KNGYDD----VPKGHFPVYVGENRSRYVVP  359
            MAI R   A L+QTA +KQ++KRCSSL K KN  DD    VPKGHFPVYVG+NRSRY+VP
Sbjct  1    MAIKRSSKATLSQTASIKQMVKRCSSLRKMKNQEDDLPQDVPKGHFPVYVGQNRSRYIVP  60

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS+L H EFQ LLR AEEEFGFDHDMGIT+PC+EV FRSL  M R
Sbjct  61   ISWLDHSEFQTLLRLAEEEFGFDHDMGITLPCDEVFFRSLISMFR  105



>ref|XP_009138408.1| PREDICTED: auxin-induced protein 15A-like [Brassica rapa]
Length=99

 Score =   144 bits (363),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 81/98 (83%), Gaps = 2/98 (2%)
 Frame = -3

Query  514  IMRKPAKLA--QTAVLKQILKRCSSLGKKNGYDDVPKGHFPVYVGENRSRYVVPISFLTH  341
            + +K  K++  Q A LK+ILKRCSSLGKKN  +DVPKGHFPVYVG+ RSRYVVPIS+L H
Sbjct  2    VTKKSNKVSACQAASLKKILKRCSSLGKKNQGNDVPKGHFPVYVGQYRSRYVVPISWLAH  61

Query  340  PEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PEFQ LL+ AEEEFGF+HDMG+TIPC+EV F+SL  M 
Sbjct  62   PEFQSLLQLAEEEFGFEHDMGLTIPCDEVVFQSLISMF  99



>gb|AFK33343.1| unknown [Lotus japonicus]
Length=106

 Score =   144 bits (363),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 85/107 (79%), Gaps = 9/107 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD--------DVPKGHFPVYVGENRSRYV  365
            MA+ RK +K  Q  V+KQIL+RCSS GKK GY+        DVPKGHFPVYVGENR+RY+
Sbjct  1    MAV-RKSSKKPQAEVIKQILRRCSSFGKKQGYNNEEGHLPEDVPKGHFPVYVGENRTRYI  59

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPIS+L HP+FQ LLR+AEEEFGF+HDMG+TIPC+E+ F+  T ++R
Sbjct  60   VPISWLGHPQFQSLLRKAEEEFGFNHDMGLTIPCDELDFQYRTSLIR  106



>ref|XP_004509350.1| PREDICTED: auxin-induced protein 15A-like [Cicer arietinum]
Length=105

 Score =   144 bits (363),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 83/103 (81%), Gaps = 7/103 (7%)
 Frame = -3

Query  511  MRKPAKLAQ-TAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPIS  353
            +RK  KL Q   ++KQI+KRCSS GKKNGY+      DVPKGHF VYVGENR+RY+VPIS
Sbjct  3    IRKSNKLPQPDVIIKQIVKRCSSFGKKNGYNEEGLPEDVPKGHFVVYVGENRTRYIVPIS  62

Query  352  FLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +L HP+FQ LL+RAEEEFGF+HDMG+TIPC+EV F  LT M+R
Sbjct  63   WLPHPQFQTLLQRAEEEFGFNHDMGLTIPCDEVVFEFLTSMIR  105



>gb|KFK44112.1| hypothetical protein AALP_AA1G217300 [Arabis alpina]
Length=112

 Score =   144 bits (362),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 86/113 (76%), Gaps = 16/113 (14%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD--------------DVPKGHFPVYVGE  383
            MAI+ + +KL QT ++KQILKRCSSLGKK   +              DVPKGHF VYVGE
Sbjct  1    MAIINR-SKLTQTTMIKQILKRCSSLGKKQNSEYNDKHEHDGDYLPLDVPKGHFVVYVGE  59

Query  382  NRSRYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL-TEML  227
            NR RYV+PISFLT PEFQ LL++AEEEFGFDHDMG+TIPCEEVAF+SL T ML
Sbjct  60   NRVRYVLPISFLTRPEFQVLLQQAEEEFGFDHDMGLTIPCEEVAFKSLVTSML  112



>gb|KFK41735.1| hypothetical protein AALP_AA2G165700 [Arabis alpina]
Length=106

 Score =   143 bits (361),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 84/107 (79%), Gaps = 9/107 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD--------DVPKGHFPVYVGENRSRYV  365
            MA+ R  +KL QTA+LKQI+K+CSSL KK  Y+        DVPKGHF VYVGE RSRY+
Sbjct  1    MAVKR-SSKLTQTAMLKQIIKKCSSLAKKQWYEYDEDGLPVDVPKGHFAVYVGEKRSRYI  59

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPISFL HP+F+ LL++AEEEFGF+HDMG+TIPCEE  F SLT M+R
Sbjct  60   VPISFLAHPKFKGLLQKAEEEFGFNHDMGLTIPCEEDVFLSLTSMIR  106



>ref|XP_010489444.1| PREDICTED: auxin-induced protein 15A [Camelina sativa]
Length=105

 Score =   143 bits (361),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 83/105 (79%), Gaps = 6/105 (6%)
 Frame = -3

Query  520  MAIMRKP-AKLAQTAVLKQILKRCSSLGK-KNGYDD----VPKGHFPVYVGENRSRYVVP  359
            MAI R   A L+Q A +KQ++KRCSSL K KN  DD    VPKGHFPVYVG+NRSRY+VP
Sbjct  1    MAIKRSSKATLSQKASIKQMVKRCSSLRKMKNQEDDLPQDVPKGHFPVYVGQNRSRYIVP  60

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS+L H EFQ LLRRAEEEFGF+HDMGIT+PC+EV FRSL  M R
Sbjct  61   ISWLDHSEFQTLLRRAEEEFGFNHDMGITLPCDEVFFRSLISMFR  105



>ref|XP_010315342.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=96

 Score =   143 bits (360),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 80/95 (84%), Gaps = 3/95 (3%)
 Frame = -3

Query  499  AKLAQTAVLKQILKRCSSLGKKNGYD---DVPKGHFPVYVGENRSRYVVPISFLTHPEFQ  329
            AKL Q  +LKQILK+CSSL KK+      DVPKGHF VYVG+NR+RY+VPISFLT+PEFQ
Sbjct  2    AKLPQVVLLKQILKKCSSLSKKHEVHFPIDVPKGHFAVYVGKNRTRYIVPISFLTNPEFQ  61

Query  328  CLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            CLLR AEEEFGF+HDMGITIPCEE  F+SLT +LR
Sbjct  62   CLLRCAEEEFGFNHDMGITIPCEEFIFQSLTSILR  96



>ref|XP_010437379.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=104

 Score =   143 bits (361),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 84/104 (81%), Gaps = 5/104 (5%)
 Frame = -3

Query  520  MAIMR-KPAKLAQTAVLKQILKRCSSLGKKNG----YDDVPKGHFPVYVGENRSRYVVPI  356
            MAI +   A ++Q A LKQILKRCSSLGKKN     ++DVPKGHFPVYVG++RSRYVVPI
Sbjct  1    MAIKKSNKAAVSQAASLKQILKRCSSLGKKNQGNCYFNDVPKGHFPVYVGQHRSRYVVPI  60

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            S+L H EFQ LL+ AEEEFGF+H+MGITIPC+EV FRSL  M R
Sbjct  61   SWLDHHEFQTLLQLAEEEFGFEHEMGITIPCDEVVFRSLIFMFR  104



>ref|XP_010432200.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=104

 Score =   143 bits (360),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 5/104 (5%)
 Frame = -3

Query  520  MAIMR-KPAKLAQTAVLKQILKRCSSLGKKNG----YDDVPKGHFPVYVGENRSRYVVPI  356
            MAI +   A ++Q A LK+ILKRCSSLGKKN     ++DVPKGHFPVYVG++RSRYVVPI
Sbjct  1    MAIKKSNKAAVSQAASLKKILKRCSSLGKKNQGNCYFNDVPKGHFPVYVGQHRSRYVVPI  60

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            S+L H EFQ LL+ AEEEFGF+H+MGITIPC+EV FRSL  M R
Sbjct  61   SWLDHHEFQTLLQLAEEEFGFEHEMGITIPCDEVVFRSLISMFR  104



>gb|AFK47147.1| unknown [Lotus japonicus]
Length=105

 Score =   143 bits (360),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 83/108 (77%), Gaps = 12/108 (11%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG-----YD---DVPKGHFPVYVGENRSRYV  365
            MAI RK +       LKQILKRCSSLGKKNG     Y    DVPKGHF VYVG+ RSRY+
Sbjct  1    MAIQRKSSNKLH---LKQILKRCSSLGKKNGGYVDDYGLPLDVPKGHFAVYVGQKRSRYI  57

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLT-EMLR  224
            VPIS L+HP+FQ LLR+AEEEFGFDHDMG+TIPCEEV FRSLT  MLR
Sbjct  58   VPISLLSHPQFQSLLRQAEEEFGFDHDMGLTIPCEEVVFRSLTSSMLR  105



>ref|XP_010531081.1| PREDICTED: auxin-induced protein 15A [Tarenaya hassleriana]
Length=103

 Score =   143 bits (360),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 80/101 (79%), Gaps = 5/101 (5%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGY-----DDVPKGHFPVYVGENRSRYVVPISFL  347
            +RK ++ +Q   L+QILKRCSSLGKKN       DDVPKGHFPVYVGE+RSRY+VPI +L
Sbjct  3    IRKSSRASQATTLRQILKRCSSLGKKNQGCDHLPDDVPKGHFPVYVGESRSRYIVPIPWL  62

Query  346  THPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
             HP+FQ LL+ AEEEFGFDHDM +TIPCEEV F+SL  M R
Sbjct  63   AHPQFQTLLQLAEEEFGFDHDMVLTIPCEEVVFQSLISMFR  103



>ref|XP_009588624.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=109

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 81/106 (76%), Gaps = 2/106 (2%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGK-KNGY-DDVPKGHFPVYVGENRSRYVVPISFL  347
            MA+ +      QTA  KQI+K CSS GK +NGY  DVPKGHF VYVGENRSRY++PIS+L
Sbjct  1    MALKKSSRHFTQTAAFKQIMKGCSSFGKNENGYPQDVPKGHFVVYVGENRSRYIIPISWL  60

Query  346  THPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR*KLRR  209
            THPEFQ LL+RAEEEFGF+HDMG+TIPC+E  F SL  M R K  R
Sbjct  61   THPEFQSLLQRAEEEFGFNHDMGLTIPCDEEDFCSLISMFRLKTLR  106



>ref|XP_006304311.1| hypothetical protein CARUB_v10010680mg [Capsella rubella]
 gb|EOA37209.1| hypothetical protein CARUB_v10010680mg [Capsella rubella]
Length=118

 Score =   142 bits (358),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 86/115 (75%), Gaps = 17/115 (15%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGY---------------DDVPKGHFPVYVG  386
            MAIM + +KL QT ++KQILKRC+SLGKK                   DVPKGHF VYVG
Sbjct  1    MAIMNR-SKLTQTTMIKQILKRCASLGKKQSSGEYNEEHEHDGDSLPQDVPKGHFVVYVG  59

Query  385  ENRSRYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL-TEMLR  224
            ENR RYV+PISFLT PEFQ LL++AEEEFGFDH+MG+TIPCEEVAF+SL T ML+
Sbjct  60   ENRVRYVLPISFLTRPEFQLLLQQAEEEFGFDHNMGLTIPCEEVAFKSLITSMLQ  114



>gb|KHN34296.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=106

 Score =   142 bits (357),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 84/107 (79%), Gaps = 9/107 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKN-GYD-------DVPKGHFPVYVGENRSRYV  365
            MAI +K  KL Q  V+KQI++RCSS GKK  GY+       DVPKGHF VYVGENR+RY+
Sbjct  1    MAI-KKSNKLPQADVIKQIVRRCSSFGKKQQGYNEEGGLPEDVPKGHFAVYVGENRTRYI  59

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPIS+L HP+FQ LL+RAEEEFGF+HDMG+TIPC+EV F  LT M+R
Sbjct  60   VPISWLAHPQFQSLLQRAEEEFGFNHDMGLTIPCDEVVFEFLTSMIR  106



>ref|NP_001238664.1| uncharacterized protein LOC100500218 [Glycine max]
 gb|ACU15218.1| unknown [Glycine max]
Length=106

 Score =   141 bits (356),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 84/107 (79%), Gaps = 9/107 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKN-GYD-------DVPKGHFPVYVGENRSRYV  365
            MAI +K  KL Q  V+KQI++RCSS GKK  GY+       DVPKGHF VYVGENR+RY+
Sbjct  1    MAI-KKSNKLPQADVIKQIVRRCSSFGKKQRGYNEEGGLPEDVPKGHFAVYVGENRTRYI  59

Query  364  VPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            VPIS+L HP+FQ LL+RAEEEFGF+HDMG+TIPC+EV F  LT M+R
Sbjct  60   VPISWLAHPQFQSLLQRAEEEFGFNHDMGLTIPCDEVVFEFLTSMIR  106



>ref|NP_001236795.1| uncharacterized protein LOC100527235 [Glycine max]
 gb|ACU16289.1| unknown [Glycine max]
 gb|KHN00486.1| Indole-3-acetic acid-induced protein ARG7 [Glycine soja]
Length=107

 Score =   141 bits (356),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 84/108 (78%), Gaps = 10/108 (9%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKN--GYD-------DVPKGHFPVYVGENRSRY  368
            MAI +K  KL Q  V+KQI++RCSS GKK   GY+       DVPKGHF VYVGENR+RY
Sbjct  1    MAI-KKSNKLPQADVIKQIVRRCSSFGKKQQQGYNEEGGLPEDVPKGHFAVYVGENRTRY  59

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +VPIS+L HP+FQ LL+RAEEEFGF+HDMG+TIPC+EV F  LT M+R
Sbjct  60   IVPISWLAHPQFQSLLQRAEEEFGFNHDMGLTIPCDEVVFEFLTSMIR  107



>ref|XP_006359709.1| PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]
Length=110

 Score =   141 bits (356),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 83/109 (76%), Gaps = 11/109 (10%)
 Frame = -3

Query  520  MAIMRKPA-KLAQTAVLKQILKRCSSLGKK-NGYD---------DVPKGHFPVYVGENRS  374
            MAI RK   KL Q AVLKQI+KRC SLGKK NGY          DVPK HF VYVGE+++
Sbjct  1    MAITRKSNYKLPQVAVLKQIMKRCWSLGKKLNGYKYNDKDYTPIDVPKEHFVVYVGEDKT  60

Query  373  RYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            RY+VPI FL+HPEFQCLLR AEEEFGFDHD GITIPCEE  F+SLT M+
Sbjct  61   RYIVPIFFLSHPEFQCLLRCAEEEFGFDHDKGITIPCEEFIFQSLTSMI  109



>ref|XP_006342031.1| PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Solanum 
tuberosum]
Length=108

 Score =   141 bits (355),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 85/109 (78%), Gaps = 11/109 (10%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD---------VPKGHFPVYVGENRSRY  368
            MAI  K  KL+Q A+LKQILKRCSS+GKKNGY D         VP+GHF VYVG+NR+RY
Sbjct  1    MAI-GKSNKLSQRAMLKQILKRCSSIGKKNGYQDEQQGGLPMDVPRGHFVVYVGKNRTRY  59

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLT-EMLR  224
            +VPIS L+ PEF+ LL+RAEEEFGFDHDMG+TIPC+E  F SLT  MLR
Sbjct  60   IVPISILSRPEFRVLLQRAEEEFGFDHDMGLTIPCDEDFFESLTSSMLR  108



>gb|AAG14455.1|AF283707_1 auxin-induced protein TGSAUR21 [Tulipa gesneriana]
Length=107

 Score =   140 bits (354),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 9/104 (9%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGY---------DDVPKGHFPVYVGENRSRYVVP  359
            +RK + L Q AV++ ILKRCSS G+KNG           DVPKGHF VY+GE RSR++VP
Sbjct  3    VRKSSNLPQAAVIRHILKRCSSFGRKNGACSDKGHSLPLDVPKGHFAVYIGEKRSRFIVP  62

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            IS L HPEFQ LLR AEEEFGFD+DMG+TIPCEEV FRSLT +L
Sbjct  63   ISLLAHPEFQSLLRAAEEEFGFDNDMGLTIPCEEVVFRSLTAVL  106



>ref|XP_009605446.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=101

 Score =   140 bits (353),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGK-KNGY-DDVPKGHFPVYVGENRSRYVVPISFL  347
            MA+ +      QTA  KQI+KRCSS GK +NGY +DVPKGHF VYVGENRSRY++PIS+L
Sbjct  1    MALKKSSKHFTQTAAFKQIMKRCSSFGKNENGYPEDVPKGHFVVYVGENRSRYIIPISWL  60

Query  346  THPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
             HPEFQ LL+RAEEEFGF+HD G+TIPC+E  F SL  M R
Sbjct  61   IHPEFQSLLQRAEEEFGFNHDTGLTIPCDEEDFCSLISMFR  101



>emb|CDY44482.1| BnaC07g15580D [Brassica napus]
Length=113

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 80/108 (74%), Gaps = 14/108 (13%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKK--NGYDD------------VPKGHFPVYVGE  383
            MAI  +  KL QT ++KQILKRCSSLGKK  N Y D            VPKGHF VYVG+
Sbjct  1    MAIKIRTTKLTQTTIIKQILKRCSSLGKKQTNEYKDEQELDGEFLPLDVPKGHFVVYVGK  60

Query  382  NRSRYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL  239
             R RYV+PISFLT PEFQ LL++AEEEFGFDHDMG+TIPCEEVAF SL
Sbjct  61   TRVRYVLPISFLTRPEFQLLLQQAEEEFGFDHDMGLTIPCEEVAFDSL  108



>ref|XP_009774610.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=103

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 83/103 (81%), Gaps = 4/103 (4%)
 Frame = -3

Query  520  MAIMRKPAK-LAQTAVLKQILKRCSSLGK--KNGY-DDVPKGHFPVYVGENRSRYVVPIS  353
            MA+++K +K + QTA LKQILK+CSS GK  +NG   DVPKGHF VYVGENRSRY++PIS
Sbjct  1    MALIKKTSKHITQTAALKQILKKCSSFGKNIENGLPHDVPKGHFVVYVGENRSRYIIPIS  60

Query  352  FLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +LTHP FQ LL+RAEEEFGF HD+GITIPC+E  F SL  M R
Sbjct  61   WLTHPRFQSLLQRAEEEFGFSHDLGITIPCDEDDFCSLISMFR  103



>ref|XP_004134870.1| PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]
Length=107

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 83/106 (78%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKK-NGYD------DVPKGHFPVYVGENRSRYVV  362
            MAI +K   L  +A  + ILKRCSS GK+ NG +      DVPKGHF VYVGENRSRY+V
Sbjct  1    MAI-KKANLLQPSASFRHILKRCSSFGKRTNGCNEDGLPEDVPKGHFAVYVGENRSRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PIS+L HP+FQ LL+RAEEEFGF+HDMGITIPCEEV FRSLT M++
Sbjct  60   PISWLAHPQFQSLLQRAEEEFGFNHDMGITIPCEEVVFRSLTSMIK  105



>ref|XP_008440807.1| PREDICTED: auxin-induced protein 15A [Cucumis melo]
Length=107

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 83/106 (78%), Gaps = 8/106 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKK-NGYD------DVPKGHFPVYVGENRSRYVV  362
            MAI +K   L  +A  + ILKRCSS GK+ NG +      DVPKGHF VYVGENRSRY+V
Sbjct  1    MAI-KKANLLQPSASFRHILKRCSSFGKRTNGCNEDGLPEDVPKGHFAVYVGENRSRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PIS+L HP+FQ LL+RAEEEFGF+HDMGITIPCEEV FRSLT M++
Sbjct  60   PISWLAHPQFQSLLQRAEEEFGFNHDMGITIPCEEVVFRSLTSMIK  105



>ref|XP_009615597.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=105

 Score =   139 bits (351),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 80/105 (76%), Gaps = 8/105 (8%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYDD-------VPKGHFPVYVGENRSRYVV  362
            MAI RK  KL Q AVLKQI+K CSSLG+K  Y+D       VPKGHF VYVGENR+RY+V
Sbjct  1    MAI-RKLNKLPQAAVLKQIMKMCSSLGRKQCYNDEDHLPIDVPKGHFAVYVGENRTRYIV  59

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PISFL H EFQ LL+ AEEEFGFDHDMG TIPC EV  RSLT ML
Sbjct  60   PISFLNHHEFQYLLQCAEEEFGFDHDMGNTIPCGEVVLRSLTSML  104



>ref|NP_173411.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
 gb|AAG12564.1|AC007797_24 Similar to auxin-induced proteins [Arabidopsis thaliana]
 dbj|BAC42543.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42954.1| At1g19830 [Arabidopsis thaliana]
 gb|AEE29902.1| SAUR-like auxin-responsive protein [Arabidopsis thaliana]
Length=117

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 86/114 (75%), Gaps = 16/114 (14%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD--------------DVPKGHFPVYVGE  383
            MAI+ + +KL QT ++KQILKRCSSLGKK   +              DVPKGHF VYVG 
Sbjct  1    MAIINR-SKLTQTTMIKQILKRCSSLGKKQSSEYNDTHEHDGDSLPLDVPKGHFVVYVGG  59

Query  382  NRSRYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL-TEMLR  224
            NR RYV+PISFLT PEFQ LL++AEEEFGFDH+MG+TIPCEEVAF+SL T ML+
Sbjct  60   NRVRYVLPISFLTRPEFQLLLQQAEEEFGFDHNMGLTIPCEEVAFKSLITSMLQ  113



>ref|XP_007156154.1| hypothetical protein PHAVU_003G262800g [Phaseolus vulgaris]
 gb|ESW28148.1| hypothetical protein PHAVU_003G262800g [Phaseolus vulgaris]
Length=101

 Score =   139 bits (350),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 78/97 (80%), Gaps = 6/97 (6%)
 Frame = -3

Query  496  KLAQTAVLKQILKRCSSLGKKNGYD------DVPKGHFPVYVGENRSRYVVPISFLTHPE  335
            K  Q  V+KQI++RCSS GKK GY+      DVPKGHF VYVGENR+RY+VPIS+L HP+
Sbjct  5    KSNQAEVVKQIVRRCSSFGKKQGYNEEGLPEDVPKGHFAVYVGENRTRYIVPISWLPHPQ  64

Query  334  FQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            FQ LL+RAEEEFGF+HDMG+TIPC+E+ F  LT M+R
Sbjct  65   FQTLLQRAEEEFGFNHDMGLTIPCDELVFEFLTSMIR  101



>emb|CDX72576.1| BnaC07g45980D [Brassica napus]
Length=99

 Score =   139 bits (349),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 80/98 (82%), Gaps = 2/98 (2%)
 Frame = -3

Query  514  IMRKPAKLA--QTAVLKQILKRCSSLGKKNGYDDVPKGHFPVYVGENRSRYVVPISFLTH  341
            + +K  K++  Q A LK+ILKR S LGKKN  +DVPKGHFPVYVG++RSRYVVPIS+L H
Sbjct  2    VTKKSNKVSACQAASLKKILKRYSILGKKNQGNDVPKGHFPVYVGQHRSRYVVPISWLAH  61

Query  340  PEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            PEFQ LL+ AEEEFGF+HDMG+TIPC+EV F+SL  M 
Sbjct  62   PEFQSLLQLAEEEFGFEHDMGLTIPCDEVVFQSLISMF  99



>ref|XP_009772515.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
 ref|XP_009772523.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=101

 Score =   139 bits (349),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 78/101 (77%), Gaps = 2/101 (2%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGK-KNGY-DDVPKGHFPVYVGENRSRYVVPISFL  347
            MA+ +      QTA  KQI+KRCS  GK +NGY  DVPKGHF VYVGENRSRY++PIS+L
Sbjct  1    MALKKSSKHFTQTAAFKQIMKRCSRFGKNENGYPQDVPKGHFVVYVGENRSRYIIPISWL  60

Query  346  THPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            THPEFQ LL+RAEEEFGF+HDMG+ IPC+E  F S+  M R
Sbjct  61   THPEFQSLLQRAEEEFGFNHDMGLAIPCDEDDFCSVISMFR  101



>gb|EYU38835.1| hypothetical protein MIMGU_mgv1a025368mg [Erythranthe guttata]
Length=114

 Score =   139 bits (350),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 83/113 (73%), Gaps = 14/113 (12%)
 Frame = -3

Query  520  MAIMR-KPAKLAQTAVLKQILKRCSSLGKKNGYD-------------DVPKGHFPVYVGE  383
            MAI +    KL+Q A++KQI+KRCSSLGKKNG               DVPKGHF VYVGE
Sbjct  1    MAIRKYSGGKLSQKAMIKQIMKRCSSLGKKNGGGGYDDGGSEQGLPVDVPKGHFVVYVGE  60

Query  382  NRSRYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            NR+RY+VPIS L  PEF  LLRRAEEEFGFDHDMG+TIPC+E  F+SLT ML+
Sbjct  61   NRTRYIVPISILNMPEFLSLLRRAEEEFGFDHDMGLTIPCDEEIFQSLTSMLK  113



>ref|XP_004144828.1| PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]
 gb|KGN43196.1| hypothetical protein Csa_7G008430 [Cucumis sativus]
Length=99

 Score =   138 bits (348),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 75/97 (77%), Gaps = 7/97 (7%)
 Frame = -3

Query  493  LAQTAVLKQILKRCSSLGKKN-------GYDDVPKGHFPVYVGENRSRYVVPISFLTHPE  335
            + +   LKQI+KRCSSLG+K         YD VPKGHF VYVG+NRSRYVVPIS LTHP+
Sbjct  3    IPKPTALKQIVKRCSSLGRKQDPTATPPAYDGVPKGHFAVYVGQNRSRYVVPISLLTHPD  62

Query  334  FQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            FQCLLR AEEEFGF H MG+TIPCEEV FRSLT  L+
Sbjct  63   FQCLLRLAEEEFGFRHHMGLTIPCEEVVFRSLTAALK  99



>ref|XP_009147025.1| PREDICTED: auxin-induced protein 15A-like [Brassica rapa]
 emb|CDX75553.1| BnaA01g01490D [Brassica napus]
 emb|CDX69199.1| BnaC01g02540D [Brassica napus]
Length=104

 Score =   138 bits (348),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 83/105 (79%), Gaps = 7/105 (7%)
 Frame = -3

Query  520  MAIMRKPAKLA--QTAVLKQILKRCSSLGKKNG----YDDVPKGHFPVYVGENRSRYVVP  359
            MAI +K  K+A  Q A +K++LKRCSSLGKKN     + DVPKGHFPVYVG+ RSRYVVP
Sbjct  1    MAI-KKSNKVAASQAATIKKLLKRCSSLGKKNQGNCYFSDVPKGHFPVYVGQQRSRYVVP  59

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            I++L HPEFQ LL+ AEEEFGF+H+MG+TIPC+E  F+SL  M R
Sbjct  60   IAWLAHPEFQTLLQLAEEEFGFEHEMGLTIPCDEAVFQSLISMFR  104



>gb|AAG14456.1|AF283708_1 auxin-induced protein TGSAUR22 [Tulipa gesneriana]
Length=107

 Score =   138 bits (348),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 83/107 (78%), Gaps = 10/107 (9%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNG-YD--------DVPKGHFPVYVGENRSRY  368
            MA+ + P K+++ A +KQILKRCSS+G+K+G Y         DVPKGHF +YV E RSR+
Sbjct  1    MAVKKSP-KISEAAAIKQILKRCSSIGRKHGAYSEENYCLPLDVPKGHFAIYVSEKRSRF  59

Query  367  VVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            VVPIS L HPEFQ LLR A+EEFGFDHDMG+TIPCEE+ F+SLT +L
Sbjct  60   VVPISLLAHPEFQSLLRDAQEEFGFDHDMGLTIPCEEIVFKSLTAVL  106



>ref|XP_006416461.1| hypothetical protein EUTSA_v10009412mg [Eutrema salsugineum]
 gb|ESQ34814.1| hypothetical protein EUTSA_v10009412mg [Eutrema salsugineum]
Length=117

 Score =   139 bits (349),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 84/114 (74%), Gaps = 16/114 (14%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD--------------DVPKGHFPVYVGE  383
            MAI  +  KL QT ++KQILKRCSSLGKK   +              DVPKGHF VYVGE
Sbjct  1    MAIKNR-TKLPQTTMIKQILKRCSSLGKKQSSEYNDEHDQDGEYLPLDVPKGHFVVYVGE  59

Query  382  NRSRYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL-TEMLR  224
            +R RYV+PISFLT  EFQ LL++AEEEFGFDHDMG+TIPCEEVAF+SL T MLR
Sbjct  60   SRVRYVLPISFLTRAEFQLLLQQAEEEFGFDHDMGLTIPCEEVAFKSLVTSMLR  113



>ref|XP_004170990.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 15A-like 
[Cucumis sativus]
Length=98

 Score =   138 bits (347),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 75/96 (78%), Gaps = 6/96 (6%)
 Frame = -3

Query  493  LAQTAVLKQILKRCSSLGKKNG------YDDVPKGHFPVYVGENRSRYVVPISFLTHPEF  332
            + +   LKQI+KRCSSLG+K        YD VPKGHF VYVG+NRSRYVVPIS LTHP+F
Sbjct  3    IPKPTALKQIVKRCSSLGRKQDPTATPRYDGVPKGHFAVYVGQNRSRYVVPISLLTHPDF  62

Query  331  QCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            QCLLR AEEEFGF H MG+TIPCEEV FRSLT  L+
Sbjct  63   QCLLRLAEEEFGFRHHMGLTIPCEEVVFRSLTAALK  98



>ref|XP_002890355.1| hypothetical protein ARALYDRAFT_472207 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66614.1| hypothetical protein ARALYDRAFT_472207 [Arabidopsis lyrata subsp. 
lyrata]
Length=117

 Score =   138 bits (348),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 86/114 (75%), Gaps = 16/114 (14%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD--------------DVPKGHFPVYVGE  383
            MAI+ + +KL QT ++KQILKRCSSLGKK   +              DVPKGHF VYVG 
Sbjct  1    MAIINR-SKLTQTTMIKQILKRCSSLGKKQSSEYNDEHEHAGDSLPLDVPKGHFVVYVGG  59

Query  382  NRSRYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL-TEMLR  224
            NR RYV+PISFLT PEFQ LL++AEEEFGF+H+MG+TIPCEEVAF+SL T ML+
Sbjct  60   NRVRYVLPISFLTRPEFQLLLQQAEEEFGFEHNMGLTIPCEEVAFKSLITSMLQ  113



>ref|XP_008448019.1| PREDICTED: auxin-induced protein 15A-like [Cucumis melo]
Length=99

 Score =   138 bits (347),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 73/91 (80%), Gaps = 7/91 (8%)
 Frame = -3

Query  475  LKQILKRCSSLGKKN-------GYDDVPKGHFPVYVGENRSRYVVPISFLTHPEFQCLLR  317
            LKQI+KRCSSLG+K         YD VPKGHF VYVG+NRSRYVVPIS LTHP+FQCLLR
Sbjct  9    LKQIVKRCSSLGRKQDPTSTPPAYDGVPKGHFAVYVGQNRSRYVVPISLLTHPDFQCLLR  68

Query  316  RAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
             AEEEFGF H MG+TIPCEEV FRSLT  L+
Sbjct  69   LAEEEFGFRHHMGLTIPCEEVVFRSLTAALK  99



>ref|XP_004234539.1| PREDICTED: auxin-induced protein 15A [Solanum lycopersicum]
Length=99

 Score =   137 bits (345),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 79/99 (80%), Gaps = 2/99 (2%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGK-KNGYD-DVPKGHFPVYVGENRSRYVVPISFL  347
            MA+ +    + Q+  LKQILKRCSS GK +NG   DVPKGHF VYVGENRSRY++PIS+L
Sbjct  1    MALKKSSKHITQSIALKQILKRCSSFGKNENGLPYDVPKGHFVVYVGENRSRYIIPISWL  60

Query  346  THPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEM  230
            THPEFQ LL+RAEEEFGF+HDMG+TIPC+E  F SL  M
Sbjct  61   THPEFQTLLQRAEEEFGFNHDMGLTIPCDEEDFCSLMSM  99



>ref|XP_009416593.1| PREDICTED: auxin-induced protein 15A-like [Musa acuminata subsp. 
malaccensis]
Length=99

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = -3

Query  514  IMRKPAKLAQTAVLKQILKRCSSLGKKNGYD-DVPKGHFPVYVGENRSRYVVPISFLTHP  338
            +++K +KL QT VLKQ+LKRCSS G+  G   DVPKGHF VYVG NRSR++VPIS+L HP
Sbjct  2    VVKKQSKLVQTQVLKQMLKRCSSSGRGKGPPVDVPKGHFVVYVGTNRSRFIVPISYLDHP  61

Query  337  EFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +FQ LLR+AEEEFGF H MG+TIPC+E  FRSLT  L+
Sbjct  62   QFQGLLRQAEEEFGFHHHMGLTIPCDETVFRSLTSALK  99



>ref|XP_009610455.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=103

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 80/103 (78%), Gaps = 4/103 (4%)
 Frame = -3

Query  520  MAIMRKPAK-LAQTAVLKQILKRCSSLGKKNGYD---DVPKGHFPVYVGENRSRYVVPIS  353
            MA+++K +K + QTA LKQILK+CSS GK    D   DVPKGHF VYVGEN SRY++ IS
Sbjct  1    MALIKKTSKHITQTAALKQILKKCSSFGKNIETDLPHDVPKGHFVVYVGENMSRYIISIS  60

Query  352  FLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +LTHP FQ LL+RAEEEFGF HD+GITIPC+E  F SL  MLR
Sbjct  61   WLTHPRFQSLLQRAEEEFGFSHDLGITIPCDEDNFCSLISMLR  103



>gb|AAM12780.1| auxin-induced SAUR-like protein [Capsicum annuum]
Length=101

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGK-KNGY-DDVPKGHFPVYVGENRSRYVVPISFL  347
            M + +    + Q+  LKQILKRCSS GK +NG   DVPKGHF VYVGENRSRY++PIS+L
Sbjct  1    MGLKKSNKHITQSVALKQILKRCSSFGKNENGLPHDVPKGHFVVYVGENRSRYIIPISWL  60

Query  346  THPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            THPEFQ LL+RAEEEFGF+HDMG+TIPC+E  F SL  + R
Sbjct  61   THPEFQSLLQRAEEEFGFNHDMGLTIPCDEEDFCSLMSIFR  101



>ref|XP_006298850.1| hypothetical protein CARUB_v10014976mg [Capsella rubella]
 gb|EOA31748.1| hypothetical protein CARUB_v10014976mg [Capsella rubella]
Length=106

 Score =   137 bits (344),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 79/106 (75%), Gaps = 7/106 (7%)
 Frame = -3

Query  520  MAIMRKP-AKLAQTAVLKQILKRCSSLGKKNGYDD------VPKGHFPVYVGENRSRYVV  362
            MAI R   A  +Q A +KQ++KRCSSL K    DD      VPKGHFPVYVG+NRSRY+V
Sbjct  1    MAIKRSSKATSSQAASIKQMVKRCSSLRKMRNQDDDGLPQDVPKGHFPVYVGQNRSRYIV  60

Query  361  PISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            PIS+L H EFQ LL+ AEEE+GFDHDMGIT+PC+EV FRSL  M R
Sbjct  61   PISWLDHSEFQTLLQLAEEEYGFDHDMGITLPCDEVFFRSLISMFR  106



>ref|XP_006343372.1| PREDICTED: auxin-induced protein X10A-like [Solanum tuberosum]
Length=100

 Score =   136 bits (343),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 79/100 (79%), Gaps = 2/100 (2%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGK-KNGY-DDVPKGHFPVYVGENRSRYVVPISFL  347
            MA+ +    + Q+  LKQILKRCSS GK +NG   DVPKGHF VYVGENRSR+++PIS+L
Sbjct  1    MALKKSSKHITQSVALKQILKRCSSFGKNENGLPHDVPKGHFVVYVGENRSRHIIPISWL  60

Query  346  THPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            THPEFQ LL+RAEEEFGF+HDMG+TIPC+E  F SL  M 
Sbjct  61   THPEFQSLLQRAEEEFGFNHDMGLTIPCDEEDFCSLMSMF  100



>ref|XP_009764004.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana sylvestris]
Length=101

 Score =   136 bits (343),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 80/101 (79%), Gaps = 2/101 (2%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGK-KNGY-DDVPKGHFPVYVGENRSRYVVPISFL  347
            M + +   +  QTA LKQI+KRCSS GK +NG+  DVPKGHF VYVGENRSRY++PIS+L
Sbjct  1    MGLKKTSKQSTQTAALKQIIKRCSSFGKNENGFPHDVPKGHFVVYVGENRSRYIIPISWL  60

Query  346  THPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            ++PEFQ LL+RAEEEFGF H+MGITIPC+E  F SL  M R
Sbjct  61   SYPEFQNLLQRAEEEFGFSHEMGITIPCDEDDFCSLISMFR  101



>ref|XP_006340725.1| PREDICTED: auxin-induced protein X10A-like [Solanum tuberosum]
Length=101

 Score =   136 bits (342),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGK-KNGY-DDVPKGHFPVYVGENRSRYVVPISFL  347
            M + +  +   QTA LKQ++KRCSS GK +NG+  DVPKGHF VYVGENRSRY++PIS+L
Sbjct  1    MGLKKTSSSKQQTAALKQLIKRCSSFGKNENGFPHDVPKGHFVVYVGENRSRYIIPISWL  60

Query  346  THPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            T+P+FQ LL+RAEEEFGF HDMGITIPC E  F SL  M R
Sbjct  61   TYPQFQNLLQRAEEEFGFSHDMGITIPCHEHDFCSLISMFR  101



>ref|XP_010413202.1| PREDICTED: auxin-induced protein 15A-like [Camelina sativa]
Length=105

 Score =   136 bits (342),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 81/105 (77%), Gaps = 6/105 (6%)
 Frame = -3

Query  520  MAIMRKP-AKLAQTAVLKQILKRCSSLGK-KNGYDD----VPKGHFPVYVGENRSRYVVP  359
            MAI R   A L+QT  +KQ++KRCS+L K KN  DD    VPKGHFPVYVG+NRSRY+VP
Sbjct  1    MAIKRSSKATLSQTVSIKQMVKRCSNLRKMKNQEDDLPQDVPKGHFPVYVGQNRSRYIVP  60

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            IS+L H EFQ LLR AEEEFGF+H MGIT+PC+EV FRSL  M R
Sbjct  61   ISWLDHSEFQTLLRLAEEEFGFNHVMGITLPCDEVFFRSLISMFR  105



>ref|XP_009407865.1| PREDICTED: auxin-induced protein 15A-like [Musa acuminata subsp. 
malaccensis]
Length=103

 Score =   135 bits (341),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 81/102 (79%), Gaps = 5/102 (5%)
 Frame = -3

Query  514  IMRKPAKLAQTAVLKQILKRCSSLGKKNGYD-----DVPKGHFPVYVGENRSRYVVPISF  350
            +++K  K  QTAVL+QIL+RCS  G++   +     DVPKGHF VYVG+NRSR++VPIS+
Sbjct  2    VIKKQNKPPQTAVLRQILRRCSGSGREKEEEEGLPVDVPKGHFVVYVGKNRSRFIVPISY  61

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            L HPEFQ LLR+AEEEFGF+H MG+TIPC+EV FRSLT  LR
Sbjct  62   LDHPEFQALLRQAEEEFGFEHHMGLTIPCDEVVFRSLTSALR  103



>ref|XP_006842411.1| hypothetical protein AMTR_s00204p00035590 [Amborella trichopoda]
 gb|ERN04086.1| hypothetical protein AMTR_s00204p00035590 [Amborella trichopoda]
Length=112

 Score =   136 bits (342),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 81/111 (73%), Gaps = 14/111 (13%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSS-LGKKNG------------YDDVPKGHFPVYVGEN  380
            MA+ RK  KL QTA LKQILKRCSS LG+K              Y DVPKGHFPVYVGE 
Sbjct  1    MAV-RKGTKLPQTAGLKQILKRCSSSLGRKQRPDSDESSGEFGFYGDVPKGHFPVYVGEK  59

Query  379  RSRYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            R R+VVPIS L  P+FQ LL+RAEEEFGFDHDMGITIPCEE+ FRSLT  +
Sbjct  60   RIRFVVPISCLNDPQFQSLLQRAEEEFGFDHDMGITIPCEEMVFRSLTSSI  110



>ref|XP_006830480.1| hypothetical protein AMTR_s00245p00017720 [Amborella trichopoda]
 gb|ERM97896.1| hypothetical protein AMTR_s00245p00017720 [Amborella trichopoda]
Length=112

 Score =   136 bits (342),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 81/111 (73%), Gaps = 14/111 (13%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSS-LGKKNG------------YDDVPKGHFPVYVGEN  380
            MA+ RK  KL QTA LKQILKRCSS LG+K              Y DVPKGHFPVYVGE 
Sbjct  1    MAV-RKGTKLPQTAGLKQILKRCSSSLGRKQRPDSDENSGEFGFYGDVPKGHFPVYVGEK  59

Query  379  RSRYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            R R+VVPIS L  P+FQ LL+RAEEEFGFDHDMGITIPCEE+ FRSLT  +
Sbjct  60   RIRFVVPISCLNDPQFQSLLQRAEEEFGFDHDMGITIPCEEMVFRSLTSSI  110



>ref|XP_004232480.1| PREDICTED: auxin-induced protein 15A-like [Solanum lycopersicum]
Length=102

 Score =   135 bits (340),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 78/102 (76%), Gaps = 3/102 (3%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKK--NGY-DDVPKGHFPVYVGENRSRYVVPISF  350
            M + +  +   QTA LKQ++KRCSS GK   NG+  DVPKGHF VYVGENRSRY++PIS+
Sbjct  1    MGLKKTSSSKQQTAALKQMIKRCSSFGKNENNGFPHDVPKGHFVVYVGENRSRYIIPISW  60

Query  349  LTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            LT+P+FQ LL+RAEEEFGF HDMGITIPC E  F SL  M R
Sbjct  61   LTYPQFQNLLQRAEEEFGFSHDMGITIPCHEHDFCSLISMFR  102



>ref|XP_009411467.1| PREDICTED: auxin-induced protein 15A-like [Musa acuminata subsp. 
malaccensis]
Length=106

 Score =   135 bits (340),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 8/103 (8%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKKNGYD--------DVPKGHFPVYVGENRSRYVVPI  356
            ++K  K+ QTAVLKQILKRCSSLG++   +        DVP+GHF VYVG+NRSR++VPI
Sbjct  3    VKKQNKVGQTAVLKQILKRCSSLGREGKKEEEDEGLPVDVPRGHFVVYVGDNRSRFIVPI  62

Query  355  SFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            S+L  PEFQ LLR+AE+EFGF H MG+TIPC+EVAFRSLT  L
Sbjct  63   SYLARPEFQSLLRQAEDEFGFHHHMGLTIPCDEVAFRSLTSAL  105



>gb|KGN48903.1| hypothetical protein Csa_6G505810 [Cucumis sativus]
Length=94

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 7/90 (8%)
 Frame = -3

Query  472  KQILKRCSSLGKK-NGYD------DVPKGHFPVYVGENRSRYVVPISFLTHPEFQCLLRR  314
            + ILKRCSS GK+ NG +      DVPKGHF VYVGENRSRY+VPIS+L HP+FQ LL+R
Sbjct  3    RHILKRCSSFGKRTNGCNEDGLPEDVPKGHFAVYVGENRSRYIVPISWLAHPQFQSLLQR  62

Query  313  AEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            AEEEFGF+HDMGITIPCEEV FRSLT M++
Sbjct  63   AEEEFGFNHDMGITIPCEEVVFRSLTSMIK  92



>emb|CDY55152.1| BnaC05g50280D [Brassica napus]
Length=113

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 82/112 (73%), Gaps = 14/112 (13%)
 Frame = -3

Query  520  MAIMRKPAK-LAQTAVLKQILKRCSSLGKKNGYD------------DVPKGHFPVYVGEN  380
            MAI    A  L QT ++KQILKRCSSLGKK   +            DVPKGHF VYVGEN
Sbjct  1    MAIKTLTATMLTQTTMIKQILKRCSSLGKKQSSEFNDKHDGQSLPLDVPKGHFVVYVGEN  60

Query  379  RSRYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSL-TEML  227
            R RYV+ ISFLT PEF+ LL++AEEEFGFDHDMG+TIPCEEVAF+S+ T ML
Sbjct  61   RVRYVLHISFLTRPEFKLLLQQAEEEFGFDHDMGLTIPCEEVAFKSIVTSML  112



>ref|XP_004233554.1| PREDICTED: auxin-induced protein 15A [Solanum lycopersicum]
Length=96

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 75/88 (85%), Gaps = 2/88 (2%)
 Frame = -3

Query  496  KLAQTAVLKQILKRCSSLGK-KNGY-DDVPKGHFPVYVGENRSRYVVPISFLTHPEFQCL  323
            K  QTA LKQILK+CSS GK +NG  +DVPKGHF VYVGENRSRY++PIS+LTHP+FQ L
Sbjct  5    KATQTAALKQILKKCSSFGKNENGLPNDVPKGHFVVYVGENRSRYIIPISWLTHPQFQTL  64

Query  322  LRRAEEEFGFDHDMGITIPCEEVAFRSL  239
            L+RAEEEFGF+HDMGITIPC E  F SL
Sbjct  65   LQRAEEEFGFNHDMGITIPCHEHDFCSL  92



>ref|XP_009600970.1| PREDICTED: auxin-induced protein 15A-like [Nicotiana tomentosiformis]
Length=103

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 80/103 (78%), Gaps = 4/103 (4%)
 Frame = -3

Query  520  MAIMRKPAK-LAQTAVLKQILKRCSSLGK--KNGY-DDVPKGHFPVYVGENRSRYVVPIS  353
            MA+++K  K + QTA LKQILK+CSS GK  +NG   DVPKGHF VYVGENRSRY++ IS
Sbjct  1    MALIKKTNKHITQTAALKQILKKCSSFGKNIENGLPHDVPKGHFVVYVGENRSRYIISIS  60

Query  352  FLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            +L HP FQ LL+RAEEEFGF HD+GITIPC+E  F SL  M R
Sbjct  61   WLAHPRFQSLLQRAEEEFGFSHDLGITIPCDEDDFCSLISMFR  103



>gb|KFK40177.1| hypothetical protein AALP_AA3G340300 [Arabis alpina]
Length=106

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 78/110 (71%), Gaps = 15/110 (14%)
 Frame = -3

Query  520  MAIMRKPAKLAQTAVLKQILKRCSSLGKKNGYD-----------DVPKGHFPVYVGENRS  374
            MAI R     +Q   +KQILKRCSSLGKK   +           DVPKGHFPVYVG NR+
Sbjct  1    MAIKRS----SQAGSIKQILKRCSSLGKKKNMNGCYYTDDGLPQDVPKGHFPVYVGPNRT  56

Query  373  RYVVPISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            RY+VPIS+L + EFQ LLR AEEEFGFDHDMGIT+PC+EV FRSL  M R
Sbjct  57   RYIVPISWLDYSEFQTLLRLAEEEFGFDHDMGITLPCDEVFFRSLISMFR  106



>ref|XP_006366565.1| PREDICTED: auxin-induced protein X10A-like [Solanum tuberosum]
Length=96

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 75/88 (85%), Gaps = 2/88 (2%)
 Frame = -3

Query  496  KLAQTAVLKQILKRCSSLGK-KNGY-DDVPKGHFPVYVGENRSRYVVPISFLTHPEFQCL  323
            K  QTA LKQILK+CSS GK +NG  +DVPKGHF VYVGENRSRY++PIS+LTHPEFQ L
Sbjct  5    KATQTATLKQILKKCSSFGKNENGLPNDVPKGHFVVYVGENRSRYIIPISWLTHPEFQSL  64

Query  322  LRRAEEEFGFDHDMGITIPCEEVAFRSL  239
            L+RAEEEFGF+HD+GITIPC E  F SL
Sbjct  65   LQRAEEEFGFNHDLGITIPCHEHDFCSL  92



>ref|XP_011074994.1| PREDICTED: auxin-induced protein 15A-like [Sesamum indicum]
Length=107

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 79/104 (76%), Gaps = 9/104 (9%)
 Frame = -3

Query  511  MRKPAKLAQTAVLKQILKRCSSLGKK-NGYD--------DVPKGHFPVYVGENRSRYVVP  359
            +RK  KL+Q AV+KQI+KRCSSLGK+ +GYD        DVPKGHF VYVGE R    VP
Sbjct  3    IRKHNKLSQKAVIKQIVKRCSSLGKRQHGYDTEEAVLPLDVPKGHFVVYVGEKRREADVP  62

Query  358  ISFLTHPEFQCLLRRAEEEFGFDHDMGITIPCEEVAFRSLTEML  227
            IS+L+ PEFQ LL RAEEEFGFDHDMG+TIPCE+  F SLT ML
Sbjct  63   ISYLSSPEFQNLLHRAEEEFGFDHDMGLTIPCEQEVFDSLTSML  106



>ref|XP_009611984.1| PREDICTED: auxin-induced protein 15A [Nicotiana tomentosiformis]
Length=98

 Score =   134 bits (337),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 76/91 (84%), Gaps = 2/91 (2%)
 Frame = -3

Query  490  AQTAVLKQILKRCSSLGK-KNGY-DDVPKGHFPVYVGENRSRYVVPISFLTHPEFQCLLR  317
             QTA LKQ++KRCSS GK +NG+  DVPKGHF VYVGENRSRY++PIS+LT+PEFQ LL+
Sbjct  8    TQTAALKQMIKRCSSFGKNENGFPHDVPKGHFVVYVGENRSRYIIPISWLTYPEFQSLLQ  67

Query  316  RAEEEFGFDHDMGITIPCEEVAFRSLTEMLR  224
            RAEEEFGF H+MGITIPC+E  F SL  M R
Sbjct  68   RAEEEFGFSHEMGITIPCDEDDFCSLISMFR  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 864235928496