BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19323_g1_i1 len=1880 path=[711:0-289 338:290-521 570:522-536
585:537-581 630:582-709 1127:710-735 4977:736-1815 6057:1816-1847
6057:1848-1879]

Length=1880
                                                                      Score     E

ref|XP_009789611.1|  PREDICTED: barley B recombinant-like protein D     383   7e-125   
ref|XP_009611977.1|  PREDICTED: barley B recombinant-like protein D     381   4e-124   
ref|NP_001275213.1|  barley B recombinant-like protein D-like           360   7e-116   
ref|NP_001266243.1|  GAGA-binding transcriptional activator             359   2e-115   
emb|CDP01919.1|  unnamed protein product                                344   2e-109   
ref|XP_011099810.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       338   2e-107   
gb|EYU20522.1|  hypothetical protein MIMGU_mgv1a010119mg                327   7e-103   
gb|ADV59368.1|  GAGA-binding transcriptional activator                  306   2e-95    
ref|NP_001242458.1|  uncharacterized protein LOC100783502               299   5e-92    
ref|XP_006577804.1|  PREDICTED: uncharacterized protein LOC100783...    299   6e-92    
gb|KHN45906.1|  Protein BASIC PENTACYSTEINE6                            299   8e-92    
ref|XP_002510492.1|  conserved hypothetical protein                     287   3e-87    Ricinus communis
ref|XP_007136066.1|  hypothetical protein PHAVU_009G015000g             285   1e-86    
ref|NP_001268020.1|  GAGA-binding transcriptional activator BBR/B...    284   4e-86    
ref|NP_001266214.1|  GAGA-binding transcriptional activator             283   6e-86    
ref|NP_001275364.1|  protein BASIC PENTACYSTEINE6-like                  283   7e-86    
gb|ADV59381.1|  GAGA-binding transcriptional activator                  281   7e-86    
ref|XP_006581036.1|  PREDICTED: uncharacterized protein LOC100809...    283   1e-85    
ref|XP_010052611.1|  PREDICTED: protein BASIC PENTACYSTEINE6            282   1e-85    
gb|KDP36958.1|  hypothetical protein JCGZ_08249                         282   2e-85    
ref|XP_011083484.1|  PREDICTED: protein BASIC PENTACYSTEINE6            281   3e-85    
ref|XP_009610156.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       280   7e-85    
gb|ABL10371.1|  GAGA-binding transcriptional activator                  280   9e-85    Medicago truncatula
ref|XP_008377168.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       280   1e-84    
ref|XP_004152657.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       280   2e-84    
ref|XP_003589387.1|  GAGA-binding transcriptional activator             279   3e-84    
ref|XP_010670883.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       278   1e-83    
ref|XP_011045135.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       277   1e-83    
ref|XP_007222527.1|  hypothetical protein PRUPE_ppa008316mg             277   2e-83    
gb|KHG09159.1|  basic pentacysteine6 -like protein                      276   3e-83    
ref|NP_001242497.1|  uncharacterized protein LOC100809369               276   5e-83    
ref|XP_006435127.1|  hypothetical protein CICLE_v10001400mg             276   5e-83    
ref|XP_008387967.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       275   1e-82    
emb|CDP07428.1|  unnamed protein product                                275   1e-82    
ref|XP_009337671.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       275   2e-82    
gb|KDO84771.1|  hypothetical protein CISIN_1g018368mg                   275   2e-82    
ref|XP_002306908.1|  hypothetical protein POPTR_0005s25720g             274   2e-82    Populus trichocarpa [western balsam poplar]
ref|XP_006435130.1|  hypothetical protein CICLE_v10001400mg             276   4e-82    
ref|XP_008444782.1|  PREDICTED: protein BASIC PENTACYSTEINE6            273   6e-82    
gb|KDO84770.1|  hypothetical protein CISIN_1g018368mg                   274   6e-82    
ref|XP_006473611.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    273   7e-82    
ref|XP_009803495.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       273   7e-82    
ref|XP_009335373.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       273   7e-82    
ref|XP_007017722.1|  Basic pentacysteine 6                              273   8e-82    
gb|ADV59385.1|  GAGA-binding transcriptional activator                  272   1e-81    
ref|XP_004291398.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       273   2e-81    
ref|XP_010271440.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    271   2e-81    
ref|XP_006473610.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    272   3e-81    
ref|XP_010271438.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    271   3e-81    
ref|XP_009598116.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       271   3e-81    
ref|XP_010105257.1|  hypothetical protein L484_019400                   271   5e-81    
ref|XP_010263912.1|  PREDICTED: protein BASIC PENTACYSTEINE6            268   4e-80    
ref|XP_002301996.2|  hypothetical protein POPTR_0002s02820g             265   8e-79    Populus trichocarpa [western balsam poplar]
ref|XP_011028963.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       264   2e-78    
gb|ADV59345.1|  GAGA-binding transcriptional activator                  263   3e-78    
gb|ADV59370.1|  GAGA-binding transcriptional activator                  262   5e-78    
ref|XP_008221307.1|  PREDICTED: protein BASIC PENTACYSTEINE6            259   1e-76    
gb|ADV59376.1|  GAGA-binding transcriptional activator                  257   1e-76    
ref|XP_002513008.1|  conserved hypothetical protein                     256   9e-76    Ricinus communis
ref|XP_008776335.1|  PREDICTED: barley B recombinant-like protein...    255   2e-75    
ref|XP_010530298.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       256   2e-75    
ref|XP_010908702.1|  PREDICTED: barley B recombinant-like protein...    255   2e-75    
gb|KDP27630.1|  hypothetical protein JCGZ_19635                         255   3e-75    
ref|XP_007042011.1|  GAGA-motif binding transcriptional activator...    253   3e-75    
ref|XP_010539043.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    255   4e-75    
ref|XP_010908697.1|  PREDICTED: barley B recombinant-like protein...    254   4e-75    
ref|XP_010908700.1|  PREDICTED: barley B recombinant-like protein...    254   4e-75    
ref|XP_008776328.1|  PREDICTED: barley B recombinant-like protein...    255   5e-75    
ref|XP_009389696.1|  PREDICTED: barley B recombinant-like protein...    255   5e-75    
ref|XP_010539045.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    254   6e-75    
ref|XP_008236825.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...    254   1e-74    
ref|XP_009389670.1|  PREDICTED: barley B recombinant-like protein...    255   1e-74    
ref|XP_008236826.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...    253   1e-74    
ref|XP_007042009.1|  GAGA-motif binding transcriptional activator...    253   1e-74    
ref|XP_010645040.1|  PREDICTED: GAGA-binding transcriptional acti...    252   1e-74    
emb|CDY70566.1|  BnaC06g42740D                                          254   1e-74    
ref|XP_007201266.1|  hypothetical protein PRUPE_ppa008471mg             253   1e-74    
ref|XP_007201267.1|  hypothetical protein PRUPE_ppa008471mg             253   2e-74    
ref|XP_006402604.1|  hypothetical protein EUTSA_v10006075mg             253   2e-74    
ref|XP_006423509.1|  hypothetical protein CICLE_v10028887mg             252   4e-74    
ref|XP_006487267.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like       251   4e-74    
ref|XP_009398067.1|  PREDICTED: barley B recombinant-like protein D     252   5e-74    
ref|NP_001268018.1|  GAGA-binding transcriptional activator BBR/B...    251   6e-74    
ref|XP_010095680.1|  hypothetical protein L484_012253                   251   6e-74    
gb|ADV59382.1|  GAGA-binding transcriptional activator                  248   1e-73    
dbj|BAB10493.1|  unnamed protein product                                249   1e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004290338.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like       250   2e-73    
ref|NP_001078690.1|  basic pentacysteine 6                              251   2e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004499229.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       250   3e-73    
ref|XP_006280750.1|  hypothetical protein CARUB_v10026720mg             250   4e-73    
ref|NP_568605.1|  basic pentacysteine 6                                 250   4e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010940930.1|  PREDICTED: barley B recombinant-like protein D     249   5e-73    
ref|XP_006280751.1|  hypothetical protein CARUB_v10026720mg             249   5e-73    
ref|XP_009104251.1|  PREDICTED: protein BASIC PENTACYSTEINE6            249   5e-73    
ref|XP_010481981.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    249   8e-73    
ref|XP_010494188.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       248   3e-72    
gb|ADV59404.1|  GAGA-binding transcriptional activator                  248   3e-72    
ref|XP_009378464.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...    245   4e-72    
ref|XP_010442173.1|  PREDICTED: protein BASIC PENTACYSTEINE6            247   5e-72    
gb|ABK96608.1|  unknown                                                 246   6e-72    Populus trichocarpa x Populus deltoides
emb|CDY69457.1|  BnaCnng63620D                                          246   6e-72    
ref|XP_011047142.1|  PREDICTED: protein BASIC PENTACYSTEINE4            246   7e-72    
ref|XP_009378461.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...    244   2e-71    
ref|XP_009378460.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...    245   2e-71    
ref|XP_006379265.1|  hypothetical protein POPTR_0009s12820g             244   3e-71    
ref|XP_009378459.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...    244   4e-71    
emb|CDY41183.1|  BnaA09g38320D                                          243   4e-71    
gb|ADV59373.1|  GAGA-binding transcriptional activator                  240   6e-71    
ref|XP_008382362.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...    241   2e-70    
emb|CDX89057.1|  BnaA04g01290D                                          242   2e-70    
ref|XP_002313754.1|  hypothetical protein POPTR_0009s12820g             241   3e-70    Populus trichocarpa [western balsam poplar]
ref|XP_002305467.1|  hypothetical protein POPTR_0004s17060g             241   4e-70    Populus trichocarpa [western balsam poplar]
gb|EPS70368.1|  hypothetical protein M569_04392                         238   4e-70    
ref|XP_009138860.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    241   4e-70    
ref|XP_003532442.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...    241   4e-70    
ref|XP_008382361.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...    241   6e-70    
ref|XP_009399389.1|  PREDICTED: barley B recombinant-like protein...    241   7e-70    
ref|XP_009138858.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    240   7e-70    
ref|XP_009138854.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    240   7e-70    
ref|XP_008365901.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...    241   8e-70    
ref|XP_004148546.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like       240   1e-69    
gb|ABK93737.1|  unknown                                                 240   1e-69    Populus trichocarpa [western balsam poplar]
ref|XP_004172323.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like       241   1e-69    
ref|XP_011037231.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like       240   1e-69    
ref|XP_008365900.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...    240   1e-69    
ref|XP_009399386.1|  PREDICTED: barley B recombinant-like protein...    240   2e-69    
ref|XP_009379566.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...    238   2e-69    
ref|XP_008448032.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like       239   2e-69    
gb|ABC25623.1|  GAGA-binding transcriptional activator                  240   3e-69    Olimarabidopsis pumila
ref|NP_001141822.1|  BBR/BPC transcription factor                       239   3e-69    Zea mays [maize]
ref|XP_009116705.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    238   3e-69    
ref|XP_010531487.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like       238   3e-69    
ref|XP_009116701.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like...    238   4e-69    
ref|XP_010555253.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like       237   6e-69    
ref|XP_009379565.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...    238   6e-69    
gb|ABG57061.1|  GAGA-binding transcriptional activator                  239   7e-69    Cardamine pratensis [cuckoo flower]
ref|XP_008779943.1|  PREDICTED: barley B recombinant-like protein...    239   8e-69    
ref|XP_006655749.1|  PREDICTED: barley B recombinant-like protein...    238   8e-69    
ref|XP_003525427.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...    238   9e-69    
ref|XP_008779916.1|  PREDICTED: barley B recombinant-like protein...    239   2e-68    
ref|XP_010933934.1|  PREDICTED: barley B recombinant-like protein D     237   4e-68    
ref|XP_002437754.1|  hypothetical protein SORBIDRAFT_10g002020          236   5e-68    Sorghum bicolor [broomcorn]
gb|AGT17153.1|  basic pentacysteine 6                                   236   6e-68    
ref|XP_004964426.1|  PREDICTED: barley B recombinant-like protein...    235   8e-68    
ref|NP_001056691.1|  Os06g0130600                                       235   1e-67    Oryza sativa Japonica Group [Japonica rice]
gb|ADV59380.1|  GAGA-binding transcriptional activator                  234   2e-67    
emb|CDY42683.1|  BnaC04g22230D                                          233   5e-67    
ref|XP_006411681.1|  hypothetical protein EUTSA_v10025867mg             231   1e-66    
emb|CDX71826.1|  BnaC08g30480D                                          231   1e-66    
gb|ABU63288.1|  GAGA-motif binding transcriptional activator            229   2e-66    
gb|ADV59374.1|  GAGA-binding transcriptional activator                  230   3e-66    
ref|XP_008803317.1|  PREDICTED: barley B recombinant-like protein...    231   3e-66    
ref|XP_010919161.1|  PREDICTED: barley B recombinant-like protein D     232   4e-66    
emb|CDX72731.1|  BnaC07g47530D                                          229   4e-66    
gb|ADV59375.1|  GAGA-binding transcriptional activator                  227   5e-66    
gb|ADV59377.1|  GAGA-binding transcriptional activator                  229   6e-66    
emb|CDO96980.1|  unnamed protein product                                230   6e-66    
ref|XP_002880369.1|  ATBPC4/BBR/BPC4/BPC4                               229   7e-66    
ref|XP_008803316.1|  PREDICTED: barley B recombinant-like protein...    233   8e-66    
emb|CDY15905.1|  BnaA04g12060D                                          228   9e-66    
dbj|BAK05756.1|  predicted protein                                      230   1e-65    
dbj|BAK06066.1|  predicted protein                                      229   1e-65    
ref|NP_565503.1|  basic pentacysteine 4                                 228   2e-65    Arabidopsis thaliana [mouse-ear cress]
gb|AAR25824.1|  basic pentacysteine 4                                   228   2e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009140266.1|  PREDICTED: protein BASIC PENTACYSTEINE4            228   2e-65    
ref|XP_008803315.1|  PREDICTED: barley B recombinant-like protein...    232   3e-65    
ref|XP_006294544.1|  hypothetical protein CARUB_v10023579mg             226   9e-65    
ref|XP_010429023.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like       225   2e-64    
ref|XP_010028660.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...    225   3e-64    
ref|XP_010028658.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...    225   4e-64    
ref|XP_006294545.1|  hypothetical protein CARUB_v10023579mg             226   4e-64    
ref|XP_010416867.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like       224   6e-64    
gb|EMS63619.1|  hypothetical protein TRIUR3_11677                       226   1e-63    
ref|XP_004503784.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...    224   1e-63    
gb|AET05031.2|  GAGA-binding transcriptional activator BBR/BPC6-l...    223   1e-63    
ref|XP_009804621.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like       223   2e-63    
ref|XP_010431840.1|  PREDICTED: LOW QUALITY PROTEIN: protein BASI...    222   3e-63    
ref|XP_007159983.1|  hypothetical protein PHAVU_002G283200g             222   4e-63    
ref|XP_011088552.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...    222   5e-63    
ref|XP_010472104.1|  PREDICTED: protein BASIC PENTACYSTEINE4            221   6e-63    
ref|XP_003630555.1|  GAGA-binding transcriptional activator BBR/B...    223   6e-63    
gb|KHG11898.1|  basic pentacysteine4 -like protein                      222   6e-63    
ref|XP_011088547.1|  PREDICTED: protein BASIC PENTACYSTEINE4 isof...    221   7e-63    
ref|XP_003557130.1|  PREDICTED: barley B recombinant-like protein D     221   1e-62    
ref|NP_001274818.1|  protein BASIC PENTACYSTEINE4-like                  219   6e-62    
gb|ABU63289.1|  GAGA-motif binding transcriptional activator            219   7e-62    
gb|ABU63290.1|  GAGA-motif binding transcriptional activator            218   7e-62    
ref|XP_002865511.1|  GAGA-binding transcriptional activator             219   1e-61    
ref|XP_010444881.1|  PREDICTED: protein BASIC PENTACYSTEINE5-like       217   1e-61    
ref|NP_195602.5|  basic pentacysteine 5                                 216   1e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004230934.1|  PREDICTED: protein BASIC PENTACYSTEINE5-like       218   2e-61    
ref|XP_006359607.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like       218   2e-61    
ref|NP_001190957.1|  basic pentacysteine 5                              217   2e-61    
emb|CDY22406.1|  BnaA06g37280D                                          216   2e-61    
gb|ADV59402.1|  GAGA-binding transcriptional activator                  218   2e-61    
gb|EAY99518.1|  hypothetical protein OsI_21488                          215   8e-61    Oryza sativa Indica Group [Indian rice]
gb|ABR17349.1|  unknown                                                 216   8e-61    Picea sitchensis
gb|ADV59364.1|  GAGA-binding transcriptional activator                  216   8e-61    
emb|CDY70283.1|  BnaCnng67580D                                          215   1e-60    
ref|XP_009627338.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...    215   2e-60    
ref|XP_009101921.1|  PREDICTED: protein BASIC PENTACYSTEINE5-like       212   8e-60    
ref|XP_010667727.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like       211   4e-59    
ref|NP_001078691.1|  basic pentacysteine 6                              206   1e-57    Arabidopsis thaliana [mouse-ear cress]
gb|ADV59358.1|  GAGA-binding transcriptional activator                  206   3e-57    
ref|XP_006404565.1|  hypothetical protein EUTSA_v10000273mg             200   4e-55    
ref|XP_009109516.1|  PREDICTED: protein BASIC PENTACYSTEINE5-like       196   1e-53    
emb|CDY12110.1|  BnaC03g60260D                                          194   4e-53    
ref|XP_009418729.1|  PREDICTED: barley B recombinant-like protein D     196   5e-53    
gb|ADE76107.1|  unknown                                                 192   4e-52    
gb|EYU36766.1|  hypothetical protein MIMGU_mgv1a0134691mg               187   8e-52    
gb|EAZ35708.1|  hypothetical protein OsJ_19997                          190   2e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009137623.1|  PREDICTED: protein BASIC PENTACYSTEINE5-like       188   7e-51    
emb|CBI19814.3|  unnamed protein product                                182   2e-50    
emb|CDY42593.1|  BnaC01g00050D                                          186   3e-50    
emb|CBI37978.3|  unnamed protein product                                183   1e-49    
emb|CDY41951.1|  BnaA01g05230D                                          184   4e-49    
ref|XP_009627340.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like...    183   4e-49    
ref|XP_006852992.1|  hypothetical protein AMTR_s00185p00053620          175   1e-48    
gb|ADV59362.1|  GAGA-binding transcriptional activator                  180   3e-47    
ref|XP_010497662.1|  PREDICTED: protein BASIC PENTACYSTEINE6-like       172   5e-47    
ref|XP_002868871.1|  hypothetical protein ARALYDRAFT_327841             178   1e-45    
gb|EYU36767.1|  hypothetical protein MIMGU_mgv1a022586mg                175   2e-45    
gb|AFX95922.1|  GAGA-binding transcriptional activator                  166   3e-45    
gb|AFG52200.1|  hypothetical protein 0_6008_01                          162   1e-43    
emb|CAB38811.1|  putative protein                                       172   1e-43    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006844102.1|  hypothetical protein AMTR_s00006p00254090          169   3e-43    
gb|EYU40418.1|  hypothetical protein MIMGU_mgv1a012572mg                165   5e-43    
ref|XP_010244189.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       164   3e-42    
emb|CDP05467.1|  unnamed protein product                                162   1e-41    
ref|XP_010069462.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       162   1e-41    
ref|NP_001266117.1|  GAGA-binding transcriptional activator             161   4e-41    
ref|NP_001275629.1|  protein BASIC PENTACYSTEINE2-like                  160   4e-41    
ref|XP_010554370.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       160   4e-41    
gb|KDP38181.1|  hypothetical protein JCGZ_04824                         160   5e-41    
ref|XP_006374227.1|  GAGA-binding family protein                        159   6e-41    
ref|XP_011021717.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       160   6e-41    
ref|XP_011000745.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       160   6e-41    
ref|XP_008220956.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       159   1e-40    
ref|XP_006374225.1|  GAGA-binding family protein                        159   1e-40    
gb|ADV59349.1|  GAGA-binding transcriptional activator                  159   1e-40    
ref|XP_010271107.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       159   1e-40    
ref|XP_006391183.1|  hypothetical protein EUTSA_v10018977mg             159   1e-40    
ref|XP_009762917.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       159   2e-40    
ref|NP_001268137.1|  GAGA-binding transcriptional activator BBR/B...    159   2e-40    
ref|XP_010415406.1|  PREDICTED: protein BASIC PENTACYSTEINE3-like       159   2e-40    
ref|XP_009608500.1|  PREDICTED: protein BASIC PENTACYSTEINE2            159   2e-40    
gb|ADV59351.1|  GAGA-binding transcriptional activator                  159   2e-40    
ref|XP_010917292.1|  PREDICTED: protein Barley B recombinant-like       158   2e-40    
ref|XP_008806632.1|  PREDICTED: protein Barley B recombinant-like       158   2e-40    
ref|XP_011035535.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       159   2e-40    
emb|CDX81661.1|  BnaC08g39400D                                          155   2e-40    
ref|XP_010470742.1|  PREDICTED: protein BASIC PENTACYSTEINE3-like...    158   2e-40    
ref|XP_011035532.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       159   2e-40    
gb|ADV59378.1|  GAGA-binding transcriptional activator                  159   2e-40    
ref|XP_010511770.1|  PREDICTED: protein BASIC PENTACYSTEINE3-like       158   3e-40    
ref|XP_008389141.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       158   3e-40    
ref|XP_004513327.1|  PREDICTED: protein BASIC PENTACYSTEINE1-like...    159   3e-40    
ref|NP_001268116.1|  protein BASIC PENTACYSTEINE1-like                  158   3e-40    
ref|XP_010932507.1|  PREDICTED: barley B recombinant-like protein A     157   4e-40    
emb|CBI26774.3|  unnamed protein product                                159   4e-40    
gb|ADV59372.1|  GAGA-binding transcriptional activator                  158   4e-40    
ref|XP_002314755.1|  hypothetical protein POPTR_0010s11180g             158   4e-40    Populus trichocarpa [western balsam poplar]
ref|XP_009148852.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    157   5e-40    
gb|ABV53916.1|  GAGA-motif binding transcriptional activator            157   5e-40    Populus trichocarpa [western balsam poplar]
ref|XP_010665717.1|  PREDICTED: protein BASIC PENTACYSTEINE1-like       157   5e-40    
ref|XP_010066541.1|  PREDICTED: protein BASIC PENTACYSTEINE2            157   6e-40    
ref|XP_010470741.1|  PREDICTED: protein BASIC PENTACYSTEINE3-like...    158   6e-40    
ref|XP_006301584.1|  hypothetical protein CARUB_v10022023mg             157   6e-40    
emb|CDY52034.1|  BnaA08g31470D                                          157   7e-40    
ref|XP_009148851.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    157   7e-40    
emb|CAN76692.1|  hypothetical protein VITISV_020594                     159   8e-40    Vitis vinifera
ref|XP_009351604.1|  PREDICTED: protein BASIC PENTACYSTEINE2            157   9e-40    
gb|KDO40586.1|  hypothetical protein CISIN_1g022806mg                   157   1e-39    
ref|XP_006492290.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       157   1e-39    
ref|XP_002318319.1|  GAGA-binding family protein                        157   1e-39    Populus trichocarpa [western balsam poplar]
ref|XP_008348742.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    156   1e-39    
ref|XP_002521909.1|  conserved hypothetical protein                     157   1e-39    Ricinus communis
ref|NP_001236213.1|  GAGA-binding protein                               156   1e-39    
ref|XP_010105533.1|  hypothetical protein L484_019276                   156   1e-39    
ref|XP_010554362.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    156   1e-39    
ref|XP_008348741.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    157   1e-39    
ref|XP_011073162.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       157   1e-39    
ref|XP_011070518.1|  PREDICTED: protein BASIC PENTACYSTEINE1-like       156   1e-39    
emb|CAN69256.1|  hypothetical protein VITISV_038800                     159   2e-39    
ref|XP_011083223.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       157   2e-39    
emb|CDX84017.1|  BnaC08g16280D                                          156   2e-39    
ref|XP_007222357.1|  hypothetical protein PRUPE_ppa009765mg             156   2e-39    
ref|XP_010554354.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    156   2e-39    
emb|CDY41096.1|  BnaC05g10870D                                          162   2e-39    
ref|NP_176979.2|  basic pentacysteine 3                                 155   2e-39    
sp|Q9C9X6.1|BPC3_ARATH  RecName: Full=Protein BASIC PENTACYSTEINE...    155   2e-39    
ref|XP_009117886.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    156   2e-39    
emb|CDY45280.1|  BnaA06g09500D                                          162   2e-39    
emb|CDY33750.1|  BnaA09g45560D                                          155   2e-39    
ref|XP_009127598.1|  PREDICTED: protein BASIC PENTACYSTEINE3            155   2e-39    
ref|XP_009381005.1|  PREDICTED: protein Barley B recombinant-like       155   2e-39    
ref|NP_001241447.1|  uncharacterized protein LOC100784091               155   2e-39    
ref|XP_009350908.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       155   2e-39    
ref|XP_006291627.1|  hypothetical protein CARUB_v10017779mg             155   2e-39    
gb|AFK38900.1|  unknown                                                 155   3e-39    
ref|XP_010502189.1|  PREDICTED: protein BASIC PENTACYSTEINE1            155   3e-39    
ref|XP_009117885.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    155   3e-39    
ref|XP_010502201.1|  PREDICTED: protein BASIC PENTACYSTEINE1-like       155   3e-39    
gb|ADV59371.1|  GAGA-binding transcriptional activator                  154   3e-39    
ref|XP_002312486.1|  hypothetical protein POPTR_0008s13960g             155   4e-39    
ref|XP_010513934.1|  PREDICTED: protein BASIC PENTACYSTEINE1-like...    155   4e-39    
ref|XP_007152627.1|  hypothetical protein PHAVU_004G146000g             155   4e-39    
gb|AFK44124.1|  unknown                                                 155   5e-39    
gb|ADV59401.1|  GAGA-binding transcriptional activator                  155   5e-39    
ref|XP_006448067.1|  hypothetical protein CICLE_v10015354mg             158   5e-39    
ref|XP_009110522.1|  PREDICTED: protein BASIC PENTACYSTEINE2 isof...    154   6e-39    
gb|AAM66000.1|  unknown                                                 155   6e-39    
ref|NP_565279.1|  basic pentacysteine1                                  154   6e-39    
gb|AAR28441.1|  basic pentacysteine 1                                   154   6e-39    
ref|XP_011024800.1|  PREDICTED: protein BASIC PENTACYSTEINE2            154   6e-39    
ref|XP_009390341.1|  PREDICTED: protein Barley B recombinant-like       154   6e-39    
ref|XP_008789230.1|  PREDICTED: protein Barley B recombinant            154   6e-39    
ref|XP_002876786.1|  basic pentacysteine 1                              154   7e-39    
emb|CDY12692.1|  BnaA02g13600D                                          155   8e-39    
gb|ADV59367.1|  GAGA-binding transcriptional activator                  154   8e-39    
gb|ABR18188.1|  unknown                                                 155   9e-39    
ref|XP_007045434.1|  Basic pentacysteine 2 isoform 1                    154   1e-38    
gb|EPS67042.1|  hypothetical protein M569_07733                         154   1e-38    
ref|XP_006585066.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    154   1e-38    
ref|XP_009110521.1|  PREDICTED: protein BASIC PENTACYSTEINE2 isof...    154   1e-38    
gb|ADV59355.1|  GAGA-binding transcriptional activator                  154   1e-38    
ref|XP_002318318.2|  GAGA-binding family protein                        154   1e-38    
ref|XP_007158817.1|  hypothetical protein PHAVU_002G184500g             155   1e-38    
gb|ADV59399.1|  GAGA-binding transcriptional activator                  154   1e-38    
gb|KHN25966.1|  Protein BASIC PENTACYSTEINE1                            154   1e-38    
ref|NP_001239724.1|  uncharacterized protein LOC100814354               153   1e-38    
emb|CDX81472.1|  BnaC02g17760D                                          153   1e-38    
ref|XP_003534122.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    153   2e-38    
gb|EYU30217.1|  hypothetical protein MIMGU_mgv1a011258mg                153   2e-38    
ref|XP_009407458.1|  PREDICTED: protein BASIC PENTACYSTEINE7            152   2e-38    
ref|XP_010496390.1|  PREDICTED: protein BASIC PENTACYSTEINE2 isof...    153   2e-38    
gb|ABC25617.1|  GAGA-binding transcriptional activator                  153   2e-38    
ref|XP_002887156.1|  hypothetical protein ARALYDRAFT_475908             152   2e-38    
gb|ABG57060.1|  GAGA-binding transcriptional activator                  152   3e-38    
ref|XP_006416987.1|  hypothetical protein EUTSA_v10008428mg             152   3e-38    
ref|XP_011000743.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       153   3e-38    
ref|NP_563955.1|  basic pentacysteine 2                                 152   3e-38    
ref|XP_002890070.1|  GAGA-binding transcriptional activator             152   3e-38    
gb|ABC25621.1|  GAGA-binding transcriptional activator                  152   3e-38    
ref|XP_004150151.1|  PREDICTED: protein BASIC PENTACYSTEINE1-like       152   3e-38    
ref|XP_004173241.1|  PREDICTED: protein BASIC PENTACYSTEINE1-like       152   3e-38    
ref|XP_010476533.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    153   3e-38    
ref|XP_008466899.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    152   3e-38    
ref|XP_006305511.1|  hypothetical protein CARUB_v10009978mg             152   3e-38    
gb|ABG57059.1|  GAGA-binding transcriptional activator                  152   3e-38    
gb|KFK43691.1|  hypothetical protein AALP_AA1G160600                    152   4e-38    
gb|AFK41866.1|  unknown                                                 152   4e-38    
ref|XP_010476532.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    153   4e-38    
gb|ADV59359.1|  GAGA-binding transcriptional activator                  152   4e-38    
ref|XP_010458978.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       152   4e-38    
ref|XP_004297808.1|  PREDICTED: protein BASIC PENTACYSTEINE1-like       152   4e-38    
ref|XP_003528993.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    152   5e-38    
gb|ACL52874.1|  unknown                                                 149   5e-38    
ref|XP_009404152.1|  PREDICTED: protein Barley B recombinant-like       152   7e-38    
ref|XP_008466895.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    152   9e-38    
ref|XP_008466905.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       151   1e-37    
ref|XP_008787890.1|  PREDICTED: protein Barley B recombinant-like       150   1e-37    
ref|XP_004150150.1|  PREDICTED: protein BASIC PENTACYSTEINE1-like       150   1e-37    
ref|XP_006661609.1|  PREDICTED: barley B recombinant-like protein...    152   1e-37    
ref|XP_010939970.1|  PREDICTED: protein Barley B recombinant-like       150   2e-37    
ref|XP_006410714.1|  hypothetical protein EUTSA_v10017196mg             149   2e-37    
ref|XP_006661604.1|  PREDICTED: barley B recombinant-like protein...    151   2e-37    
ref|XP_009402129.1|  PREDICTED: protein Barley B recombinant-like       150   2e-37    
emb|CDO98634.1|  unnamed protein product                                150   3e-37    
ref|XP_004985070.1|  PREDICTED: protein Barley B recombinant-like...    152   3e-37    
ref|XP_010276763.1|  PREDICTED: protein BASIC PENTACYSTEINE7-like       150   3e-37    
ref|XP_010677416.1|  PREDICTED: protein BASIC PENTACYSTEINE7            148   3e-37    
gb|ADV59369.1|  GAGA-binding transcriptional activator                  150   3e-37    
ref|XP_009388747.1|  PREDICTED: protein Barley B recombinant            150   3e-37    
gb|EEC66475.1|  hypothetical protein OsI_32561                          151   4e-37    
ref|NP_001064048.1|  Os10g0114500                                       150   5e-37    
gb|EEC66474.1|  hypothetical protein OsI_32559                          150   6e-37    
gb|ADV59379.1|  GAGA-binding transcriptional activator                  148   7e-37    
ref|XP_009382984.1|  PREDICTED: protein Barley B recombinant-like       149   8e-37    
gb|EYU24500.1|  hypothetical protein MIMGU_mgv1a010418mg                149   8e-37    
ref|XP_009133026.1|  PREDICTED: protein BASIC PENTACYSTEINE7            147   9e-37    
ref|XP_010527829.1|  PREDICTED: protein BASIC PENTACYSTEINE2            148   9e-37    
ref|XP_009417669.1|  PREDICTED: protein Barley B recombinant-like       148   9e-37    
ref|XP_006347363.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    149   1e-36    
ref|NP_850249.1|  basic pentacysteine 7                                 146   1e-36    
gb|ADQ43182.1|  BPC1                                                    148   1e-36    
sp|Q8GUC3.1|BBR_HORVU  RecName: Full=Protein Barley B recombinant...    150   1e-36    
ref|NP_001176008.1|  Os10g0115200                                       150   1e-36    
ref|NP_001266122.1|  GAGA-binding transcriptional activator             149   1e-36    
gb|EMT03273.1|  hypothetical protein F775_06914                         149   1e-36    
ref|NP_181098.2|  basic pentacysteine 7                                 147   2e-36    
ref|XP_011018447.1|  PREDICTED: protein BASIC PENTACYSTEINE7-like       146   2e-36    
ref|XP_002436565.1|  hypothetical protein SORBIDRAFT_10g004880          149   2e-36    
ref|XP_002461878.1|  hypothetical protein SORBIDRAFT_02g009750          149   2e-36    
ref|XP_006849467.1|  hypothetical protein AMTR_s00024p00090860          149   2e-36    
emb|CDX79604.1|  BnaC03g19400D                                          147   2e-36    
ref|XP_007040772.1|  Basic pentacysteine 7, putative                    146   2e-36    
gb|KDP40429.1|  hypothetical protein JCGZ_03844                         145   2e-36    
ref|XP_010538354.1|  PREDICTED: protein BASIC PENTACYSTEINE7            145   3e-36    
ref|XP_010261624.1|  PREDICTED: protein BASIC PENTACYSTEINE7-like...    147   3e-36    
ref|XP_010936843.1|  PREDICTED: protein Barley B recombinant            147   3e-36    
ref|NP_001149863.1|  GAGA-binding protein                               149   3e-36    
ref|XP_008788600.1|  PREDICTED: protein BASIC PENTACYSTEINE7 isof...    146   3e-36    
ref|XP_010056207.1|  PREDICTED: protein BASIC PENTACYSTEINE7            145   4e-36    
ref|XP_010920037.1|  PREDICTED: protein BASIC PENTACYSTEINE7 isof...    145   4e-36    
ref|XP_010509600.1|  PREDICTED: protein BASIC PENTACYSTEINE7-like       145   5e-36    
ref|XP_002879557.1|  GAGA-binding transcriptional activator             144   5e-36    
gb|KHN28889.1|  Protein BASIC PENTACYSTEINE1                            146   5e-36    
gb|ABU50826.1|  GAGA-binding transcriptional activator                  144   6e-36    
ref|XP_006294940.1|  hypothetical protein CARUB_v10023994mg             144   7e-36    
ref|XP_009761371.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like       146   9e-36    
tpg|DAA48158.1|  TPA: GAGA-binding protein                              149   1e-35    
ref|XP_010261623.1|  PREDICTED: protein BASIC PENTACYSTEINE2-like...    146   1e-35    
ref|XP_004956022.1|  PREDICTED: protein Barley B recombinant-like       147   1e-35    
ref|XP_008788595.1|  PREDICTED: protein BASIC PENTACYSTEINE7 isof...    145   1e-35    
ref|NP_001152265.1|  GAGA-binding protein                               146   1e-35    
ref|XP_010920033.1|  PREDICTED: protein BASIC PENTACYSTEINE7 isof...    145   2e-35    
ref|XP_002969772.1|  hypothetical protein SELMODRAFT_440949             144   2e-35    
emb|CDY65763.1|  BnaA03g56400D                                          144   2e-35    
ref|XP_008798184.1|  PREDICTED: protein Barley B recombinant            145   2e-35    
ref|XP_010516733.1|  PREDICTED: protein BASIC PENTACYSTEINE7-like       143   2e-35    
ref|NP_001130079.1|  uncharacterized protein LOC100191172               146   2e-35    
gb|ADV59347.1|  GAGA-binding transcriptional activator                  142   3e-35    
ref|XP_006368324.1|  hypothetical protein POPTR_0001s01620g             142   3e-35    
ref|XP_003573749.1|  PREDICTED: barley B recombinant-like protein A     145   4e-35    
ref|XP_002993293.1|  hypothetical protein SELMODRAFT_449089             142   1e-34    
ref|XP_003573748.1|  PREDICTED: barley B recombinant-like protein A     144   1e-34    
gb|KHG26830.1|  basic pentacysteine7 -like protein                      140   3e-34    
ref|XP_002461879.1|  hypothetical protein SORBIDRAFT_02g009770          139   5e-34    
ref|XP_002519003.1|  conserved hypothetical protein                     137   2e-33    
gb|ABU50827.1|  GAGA-binding transcriptional activator                  137   3e-33    
sp|Q7XH85.2|BBRC_ORYSJ  RecName: Full=Barley B recombinant-like p...    138   6e-33    
emb|CDP11725.1|  unnamed protein product                                136   7e-33    
ref|NP_001064049.1|  Os10g0115500                                       137   2e-32    
ref|XP_009613159.1|  PREDICTED: protein BASIC PENTACYSTEINE7-like...    131   3e-31    
ref|XP_006352921.1|  PREDICTED: protein BASIC PENTACYSTEINE7-like       131   3e-31    
ref|XP_009613158.1|  PREDICTED: protein BASIC PENTACYSTEINE7-like...    132   6e-31    
ref|NP_001266119.1|  GAGA-binding transcriptional activator             128   4e-30    
ref|XP_011028087.1|  PREDICTED: LOW QUALITY PROTEIN: protein BASI...    129   8e-30    
ref|XP_010518926.1|  PREDICTED: protein BASIC PENTACYSTEINE7-like       124   5e-29    
ref|XP_002318494.2|  hypothetical protein POPTR_0012s03760g             117   1e-26    
gb|ADV59357.1|  GAGA-binding transcriptional activator                  112   1e-23    
emb|CBI19813.3|  unnamed protein product                              94.7    2e-19    
gb|EYU21873.1|  hypothetical protein MIMGU_mgv1a0218291mg             93.2    2e-18    
ref|XP_002278754.1|  PREDICTED: protein BASIC PENTACYSTEINE6 isof...  86.7    2e-16    
ref|XP_003634376.1|  PREDICTED: protein BASIC PENTACYSTEINE6 isof...  86.7    2e-16    
ref|XP_010664774.1|  PREDICTED: protein BASIC PENTACYSTEINE6 isof...  87.0    2e-16    
ref|XP_010664775.1|  PREDICTED: protein BASIC PENTACYSTEINE6 isof...  86.7    2e-16    
ref|XP_010664772.1|  PREDICTED: protein BASIC PENTACYSTEINE6 isof...  87.0    2e-16    
ref|XP_006852993.1|  hypothetical protein AMTR_s00185p00053640        84.7    5e-15    
emb|CDX82011.1|  BnaC08g35900D                                        84.0    7e-15    
ref|XP_002886676.1|  hypothetical protein ARALYDRAFT_893630           79.0    3e-14    
ref|XP_006374224.1|  hypothetical protein POPTR_0015s05190g           75.9    2e-12    
gb|EYU21872.1|  hypothetical protein MIMGU_mgv1a0218292mg             72.8    3e-12    
ref|XP_010526572.1|  PREDICTED: protein BASIC PENTACYSTEINE4-like     70.5    5e-10    
ref|XP_006385685.1|  hypothetical protein POPTR_0003s09840g           69.3    5e-10    
ref|XP_006395828.1|  hypothetical protein EUTSA_v10005342mg           57.8    4e-06    
gb|EOS76789.1|  hypothetical protein C819_01404                       57.0    2e-05    
gb|AFB34871.1|  hypothetical protein UMN_6093_01                      52.4    1e-04    
ref|XP_006387778.1|  hypothetical protein POPTR_0589s002002g          49.3    6e-04    



>ref|XP_009789611.1| PREDICTED: barley B recombinant-like protein D [Nicotiana sylvestris]
 gb|ADV59384.1| GAGA-binding transcriptional activator [Nicotiana tabacum]
Length=301

 Score =   383 bits (984),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 198/308 (64%), Positives = 234/308 (76%), Gaps = 16/308 (5%)
 Frame = +2

Query  584   DQNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERD  763
             D NN TI+TYMAIMAERDAAI ERNMAL+ERKRA AERDMAMLQRDAA+AERN A++ERD
Sbjct  3     DHNNFTIKTYMAIMAERDAAIRERNMALEERKRAFAERDMAMLQRDAALAERNAAIQERD  62

Query  764   NAISALKLRESSMNDEDIVSKSPG------AEHIHYQQEMHEMISAAAYDPTENLTNDPF  925
             +AI+AL+L ESS+ND ++V  SPG      A+HI+ QQ+MH+ I+ AA+  TE+ T    
Sbjct  63    DAIAALRLGESSINDNNVVPDSPGNDTETGAKHIYNQQQMHKTIAEAAHGSTEDPTAGYL  122

Query  926   NVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTF-DDWDDGN  1102
               TD +   A NP+KVR+PKES+  K +K+ R  K        L+ Q +ST  DDW   N
Sbjct  123   KGTDTS--EAKNPKKVRRPKESRHNKQAKIPRQGKIGAES---LNMQVISTSSDDWV--N  175

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
               E    SD+E D  L +W ++ GL Q+N D SAMPVPVCSCTGTPQPCYKWG+GGWQSA
Sbjct  176   LQEL--DSDKEGDMQLTSWKDNLGLNQINFDESAMPVPVCSCTGTPQPCYKWGHGGWQSA  233

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTTISMYPLPQ S+KRYSRVGGRKMS  AFSKLL+RL  +GYDLS PLDLKDHWAKHG
Sbjct  234   CCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLAGQGYDLSVPLDLKDHWAKHG  293

Query  1463  TNRYSTVK  1486
             TNRYST+K
Sbjct  294   TNRYSTLK  301



>ref|XP_009611977.1| PREDICTED: barley B recombinant-like protein D [Nicotiana tomentosiformis]
Length=301

 Score =   381 bits (978),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/308 (64%), Positives = 233/308 (76%), Gaps = 16/308 (5%)
 Frame = +2

Query  584   DQNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERD  763
             D NN TI+TYMAIMAERDAAI ERNMAL+ERKRA AERDMAMLQRDAA+AERN A++ERD
Sbjct  3     DHNNFTIKTYMAIMAERDAAIRERNMALEERKRAFAERDMAMLQRDAALAERNAAIQERD  62

Query  764   NAISALKLRESSMNDEDIVSKSPG------AEHIHYQQEMHEMISAAAYDPTENLTNDPF  925
             +AI+AL+L ESS+ND ++V  SPG      A+HI+ QQ+MH+ I+ AA+  TE+ T    
Sbjct  63    DAIAALRLGESSINDNNVVPDSPGNDTESGAKHIYNQQQMHKTIAEAAHGSTEDPTAGYL  122

Query  926   NVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTF-DDWDDGN  1102
               TD +   A NP+KVR+PKES+  K +K+ R  K        L+   +ST  DDW   N
Sbjct  123   KGTDTS--EAKNPKKVRRPKESRHNKQAKIPRQGKIGAES---LNMHVISTSSDDWV--N  175

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
               E    SD+E D  L +W ++ GL Q+N D SAMPVPVCSCTGTPQPCYKWG+GGWQSA
Sbjct  176   LQEL--DSDKEGDMQLTSWKDNLGLNQINFDESAMPVPVCSCTGTPQPCYKWGHGGWQSA  233

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTTISMYPLPQ S+KRYSRVGGRKMS  AFSKLL+RL  +GYDLS PLDLKDHWAKHG
Sbjct  234   CCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLAGQGYDLSVPLDLKDHWAKHG  293

Query  1463  TNRYSTVK  1486
             TNRYST+K
Sbjct  294   TNRYSTLK  301



>ref|NP_001275213.1| barley B recombinant-like protein D-like [Solanum tuberosum]
 gb|ADV59396.1| GAGA-binding transcriptional activator [Solanum tuberosum]
Length=300

 Score =   360 bits (923),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 190/308 (62%), Positives = 231/308 (75%), Gaps = 17/308 (6%)
 Frame = +2

Query  584   DQNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERD  763
             D NN TI+TYMAIMAERDAAI ERNMAL+ERKRA AERDMAMLQRDAA+AERN  ++ER+
Sbjct  3     DHNNFTIKTYMAIMAERDAAIRERNMALEERKRAFAERDMAMLQRDAALAERNALIQERN  62

Query  764   NAISALKLRESSMNDEDIVSKSPG------AEHIHYQQEMHEMISAAAYDPTENLTNDPF  925
             +AI+AL+L++SS ND ++V  SPG      A+HI+ QQ+M+   + AA+   E+ +    
Sbjct  63    DAIAALRLQDSSTNDNNMVPDSPGNGTESGAKHIYNQQQMYRTTAEAAHGSMEDPSAGYL  122

Query  926   NVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTF-DDWDDGN  1102
               TD +   A  P+KV++PKES+  K +K+ RV K       +LS Q ++T  DDW   N
Sbjct  123   KDTDTS--EAKIPKKVKRPKESRHNKQAKIPRVGKIGTD---NLSMQVIATTSDDW--AN  175

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
               E    SD+E D  L +W ++ G  Q+N D SAMPVPVCSCTGTPQPCYKWG+GGWQSA
Sbjct  176   LQEM--DSDKEGDTQLTSWKDNLGF-QINFDESAMPVPVCSCTGTPQPCYKWGHGGWQSA  232

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTTISMYPLPQ S+KRYSRVGGRKMS  AFSKLL+RL A+GYDLS PLDLKDHWAKHG
Sbjct  233   CCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLAAQGYDLSIPLDLKDHWAKHG  292

Query  1463  TNRYSTVK  1486
             TNRYST+K
Sbjct  293   TNRYSTLK  300



>ref|NP_001266243.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
 gb|ADV59387.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
 gb|ADV59388.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
Length=300

 Score =   359 bits (921),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/308 (62%), Positives = 231/308 (75%), Gaps = 17/308 (6%)
 Frame = +2

Query  584   DQNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERD  763
             D NN TI+TYMAIMAERDAAI ERNMAL+ERKRA AERDMAMLQRDAA+AERN  ++ER+
Sbjct  3     DHNNFTIKTYMAIMAERDAAIRERNMALEERKRAFAERDMAMLQRDAALAERNALIQERN  62

Query  764   NAISALKLRESSMNDEDIVSKSPG------AEHIHYQQEMHEMISAAAYDPTENLTNDPF  925
             +AI+AL+L++SS ND ++V  SPG      A+HI+ QQ+M+   + AA+  TE+      
Sbjct  63    DAIAALRLQDSSTNDNNMVPDSPGNGTESGAKHIYNQQQMYRTTADAAHGSTEDPAAGYL  122

Query  926   NVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTF-DDWDDGN  1102
               TD +   A  P+KV++PKES+  K +K+ RV K        LS Q ++T  DDW   N
Sbjct  123   KDTDTSE--AKIPKKVKRPKESRHNKQAKIPRVGKISTDS---LSMQVIATTSDDW--VN  175

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
               E    SD+E D  L +W ++ GL ++N D SAMPVPVCSCTGTPQPCYKWG+GGWQSA
Sbjct  176   LQEM--DSDKEGDTQLTSWKDNLGL-KINFDDSAMPVPVCSCTGTPQPCYKWGHGGWQSA  232

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTTISMYPLPQ S+KRYSRVGGRKMS  AFSKLL+RL A+GYDLS PLDLKDHWAKHG
Sbjct  233   CCTTTISMYPLPQISNKRYSRVGGRKMSGGAFSKLLNRLAAQGYDLSIPLDLKDHWAKHG  292

Query  1463  TNRYSTVK  1486
             TNRYST+K
Sbjct  293   TNRYSTLK  300



>emb|CDP01919.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   344 bits (882),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 184/308 (60%), Positives = 228/308 (74%), Gaps = 17/308 (6%)
 Frame = +2

Query  584   DQNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERD  763
             D N+ +I+TYMAI AERDAAI ERNMAL+ERKRA +ERDMAMLQRDAAIAERN+A++ERD
Sbjct  26    DHNHFSIKTYMAITAERDAAIQERNMALEERKRAFSERDMAMLQRDAAIAERNSAIQERD  85

Query  764   NAISALKLRESSMND------EDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPF  925
              AI+AL++R+ S+N+      ED V+   G E +HYQ   H M++AA + P + LT++ F
Sbjct  86    EAIAALQIRDCSVNNMLSDSAEDGVAD--GTEDMHYQHMHHAMVNAA-FSPRDILTSETF  142

Query  926   NVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNC  1105
             N      +TA    KVRQPKE K  K+ K  R  KR    +      A S  + W+ G+ 
Sbjct  143   NSAQVASETAK-ATKVRQPKEGKMTKSVKSPRSPKRRAEGMIKPLTPASS--NGWNAGHD  199

Query  1106  GEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSAC  1285
              +     +EE + HL TW ++ GL Q+N D +AMPVPVCSCTGTPQPCYKWGNGGWQSAC
Sbjct  200   LK----REEELEGHLGTWKDNIGLNQINFDETAMPVPVCSCTGTPQPCYKWGNGGWQSAC  255

Query  1286  CTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDL-SAPLDLKDHWAKHG  1462
             CTTT+S+YPLPQ S+KRY+RVGGRKMS SAF+KLL+RL AEG+DL SAPLDLK+HWAKHG
Sbjct  256   CTTTMSVYPLPQVSNKRYTRVGGRKMSGSAFNKLLNRLVAEGHDLYSAPLDLKEHWAKHG  315

Query  1463  TNRYSTVK  1486
             TNRYST+K
Sbjct  316   TNRYSTLK  323



>ref|XP_011099810.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Sesamum indicum]
 ref|XP_011099811.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Sesamum indicum]
Length=296

 Score =   338 bits (866),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 177/308 (57%), Positives = 217/308 (70%), Gaps = 20/308 (6%)
 Frame = +2

Query  584   DQNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERD  763
             D N+ TI+T+MAI AERDAAI ERNMAL+ERKRA AERDMAMLQRDAAIAERN A++ERD
Sbjct  2     DHNHLTIKTFMAITAERDAAIRERNMALEERKRAFAERDMAMLQRDAAIAERNAAIQERD  61

Query  764   NAISALKLRESSMNDEDIVSKS------PGAEHIHYQQEMHEMISAAAYDPTENLTNDPF  925
              AI++L+ RE SMND   +  S       G++ IHYQ ++    S   Y P  +L     
Sbjct  62    EAIASLRFREGSMNDNSTIPDSLGNELESGSKRIHYQHQIR--ASEPEYSPRGSLRGSDI  119

Query  926   NVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVST-FDDWDDGN  1102
                  T ++    R+ RQPK+ K  K SK     +  +   E +S Q  S   + W   N
Sbjct  120   TEASETAKS----RRGRQPKDGKVTKPSK---SPRVGKRMAEGMSKQVNSAPSNGW---N  169

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
               +  ++ +E+ DK + +W ++ GL Q+N D SAMPVPVC+CTG+PQPCY+WGNGGWQSA
Sbjct  170   TQQDFESDEEDLDKQV-SWKDNLGLNQINFDESAMPVPVCTCTGSPQPCYRWGNGGWQSA  228

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTTISMYPLPQ ++KRYSRVGGRKMS SAFSKLL+RL AEGYD SAPLDLKDHWAKHG
Sbjct  229   CCTTTISMYPLPQVANKRYSRVGGRKMSGSAFSKLLNRLAAEGYDFSAPLDLKDHWAKHG  288

Query  1463  TNRYSTVK  1486
             TNRYST+K
Sbjct  289   TNRYSTLK  296



>gb|EYU20522.1| hypothetical protein MIMGU_mgv1a010119mg [Erythranthe guttata]
Length=321

 Score =   327 bits (838),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 217/321 (68%), Gaps = 34/321 (11%)
 Frame = +2

Query  602   IRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISAL  781
             I+T+MAI AERDAAI ERNMAL+ERKRA AERDMAMLQRDAAIAERN+A++ERD AI++L
Sbjct  9     IKTFMAITAERDAAIRERNMALEERKRAFAERDMAMLQRDAAIAERNSAIQERDEAIASL  68

Query  782   KLRESSMN---------DEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENL--------  910
             + RES MN         D  +   S GA  I YQ ++  +   AAY+   N         
Sbjct  69    RFRESPMNHNSTNTNIPDSLVSELSSGARRIQYQDQIRAVSEPAAYNNNNNNNNNSNNSQ  128

Query  911   ------TNDPFNVTDPTPQTA--NNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQ  1066
                   ++D     +   +TA  N PR+ RQ K+ K  K+ ++ + +        +LS Q
Sbjct  129   RGSLRGSSDVSITEEEASETAANNKPRRGRQAKDRKANKSQRVGKRMAE------ELSKQ  182

Query  1067  AVSTFDDWDDGNCGEFV-DASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQ  1243
              ++  +DW + N      D   +E+DK   +W ++ GL Q+N D SAMPVPVC+CTG PQ
Sbjct  183   IIT--NDWSNNNNNSNEHDFESDEEDKQQVSWKDNLGLNQINFDESAMPVPVCTCTGAPQ  240

Query  1244  PCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLS  1423
             PCY+WGNGGWQSACCTT ISMYPLPQ ++KRYSRVGGRKMS SAFSKLL+RL +EGYD S
Sbjct  241   PCYRWGNGGWQSACCTTAISMYPLPQVANKRYSRVGGRKMSGSAFSKLLNRLASEGYDFS  300

Query  1424  APLDLKDHWAKHGTNRYSTVK  1486
             APLDLKDHWAKHGTNRYST+K
Sbjct  301   APLDLKDHWAKHGTNRYSTLK  321



>gb|ADV59368.1| GAGA-binding transcriptional activator [Artemisia annua]
Length=285

 Score =   306 bits (785),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 216/311 (69%), Gaps = 37/311 (12%)
 Frame = +2

Query  584   DQNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERD  763
             D N+ +I+T+MAIMAERDAAI ERN+ALDERKRA AERD+AMLQRDAA+AERN+ ++ERD
Sbjct  2     DHNHLSIKTFMAIMAERDAAIRERNLALDERKRAFAERDLAMLQRDAALAERNSVMQERD  61

Query  764   NAISALKLRESSMNDEDIVSK--------SPGAEHIHYQQEMHEMISAAAYDPTENLTN-  916
              AI+ L+ R + MN E+I+S         S G++     +EM  M     ++  E+  N 
Sbjct  62    EAIATLRFRGNFMN-ENIMSTPEVPENIPSCGSKRGFSDEEMDHM-----FEMPEDSCNK  115

Query  917   -DPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWD  1093
              +P  + D    T   P     PK +KP+K ++ A+  K+   +  D    +V    D+ 
Sbjct  116   REPLKMAD----TYQVP-----PKNTKPRKVTRKAKSPKKGGRKRGD----SVKMKPDF-  161

Query  1094  DGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGW  1273
                 G   ++SD+ Q   L+ W ++ GL QVN D SAMPVPVCSCTG PQPCY+WG+GGW
Sbjct  162   ----GGNDESSDDSQ---LEAWKDELGLNQVNFDESAMPVPVCSCTGAPQPCYRWGSGGW  214

Query  1274  QSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWA  1453
             QSACCTTT+SMYPLPQ ++KRYSRVGGRKMS  AF+KLL+RL++EGYDLS+ LDLKDHWA
Sbjct  215   QSACCTTTMSMYPLPQLANKRYSRVGGRKMSGGAFTKLLTRLSSEGYDLSSQLDLKDHWA  274

Query  1454  KHGTNRYSTVK  1486
             KHGTNRYSTVK
Sbjct  275   KHGTNRYSTVK  285



>ref|NP_001242458.1| uncharacterized protein LOC100783502 [Glycine max]
 gb|ACU18145.1| unknown [Glycine max]
Length=338

 Score =   299 bits (766),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 211/317 (67%), Gaps = 23/317 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERDAAI ERN+A+ E+K A AERDMA +QRDAAIAERN A+ ERDN
Sbjct  28    QHQPSMKQIMAIMAERDAAIQERNLAISEKKAAYAERDMAFMQRDAAIAERNNAILERDN  87

Query  767   AISALKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTND  919
             AI+ L+ RE+S++   + S  PG +      HIH+ QQ++H +  +  A+Y   E  T D
Sbjct  88    AIATLQYRETSLSSGSMPSCPPGCQISRGVKHIHHPQQQVHHIPNMGDASYSTREMHTTD  147

Query  920   PFNVTDPTPQTANNPRKVRQPKESKPKKAS---KLArvvkreeveveDLSWQAVSTFDDW  1090
                   P P  A  PR+ ++PKE  PK AS   K ++  K+ + E EDL+        +W
Sbjct  148   ALPAA-PIPSEAGKPRRAKRPKE--PKSASPNKKTSKPAKKVKKESEDLNKVMFGKSHEW  204

Query  1091  DDGNCGEFVDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
               G   E V+  D+  +K L     D   +D GL QV  D S MP PVCSCTG  + CYK
Sbjct  205   KSGQ--EMVNGGDD-LNKQLTVSKADWKGQDLGLNQVAYDESTMPAPVCSCTGVLRQCYK  261

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQSACCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+D
Sbjct  262   WGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNPVD  321

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LKDHWAKHGTNRY T+K
Sbjct  322   LKDHWAKHGTNRYITIK  338



>ref|XP_006577804.1| PREDICTED: uncharacterized protein LOC100783502 isoform X1 [Glycine 
max]
 ref|XP_006577805.1| PREDICTED: uncharacterized protein LOC100783502 isoform X2 [Glycine 
max]
Length=338

 Score =   299 bits (766),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 211/317 (67%), Gaps = 23/317 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERDAAI ERN+A+ E+K A AERDMA +QRDAAIAERN A+ ERDN
Sbjct  28    QHQPSMKQIMAIMAERDAAIQERNLAISEKKAAYAERDMAFMQRDAAIAERNNAILERDN  87

Query  767   AISALKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTND  919
             AI+ L+ RE+S++   + S  PG +      HIH+ QQ++H +  +  A+Y   E  T D
Sbjct  88    AIATLQYRETSLSSGSMPSCPPGCQISRGVKHIHHPQQQVHHIPNMGDASYSTREMHTTD  147

Query  920   PFNVTDPTPQTANNPRKVRQPKESKPKKAS---KLArvvkreeveveDLSWQAVSTFDDW  1090
                   P P  A  PR+ ++PKE  PK AS   K ++  K+ + E EDL+        +W
Sbjct  148   ALPAA-PIPSEAGKPRRAKRPKE--PKSASPNKKTSKPAKKVKKESEDLNKVMFGKSHEW  204

Query  1091  DDGNCGEFVDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
               G   E V+  D+  +K L     D   +D GL QV  D S MP PVCSCTG  + CYK
Sbjct  205   KSGQ--EMVNGGDD-LNKQLTVSKADWKGQDLGLNQVAYDESTMPAPVCSCTGVLRQCYK  261

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQSACCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+D
Sbjct  262   WGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNPVD  321

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LKDHWAKHGTNRY T+K
Sbjct  322   LKDHWAKHGTNRYITIK  338



>gb|KHN45906.1| Protein BASIC PENTACYSTEINE6 [Glycine soja]
Length=338

 Score =   299 bits (765),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 211/317 (67%), Gaps = 23/317 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERDAAI ERN+A+ E+K A AERDMA +QRDAAIAERN A+ ERDN
Sbjct  28    QHQPSMKQIMAIMAERDAAIQERNLAISEKKAAYAERDMAFMQRDAAIAERNNAILERDN  87

Query  767   AISALKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTND  919
             AI+ L+ RE+S++   + S  PG +      HIH+ QQ++H +  +  A+Y   E  T D
Sbjct  88    AIATLQYRETSLSSGSMPSCPPGCQISRGVKHIHHPQQQVHHIPNMGDASYSTREMHTTD  147

Query  920   PFNVTDPTPQTANNPRKVRQPKESKPKKAS---KLArvvkreeveveDLSWQAVSTFDDW  1090
                   P P  A  PR+ ++PKE  PK AS   K ++  K+ + E EDL+        +W
Sbjct  148   ALPAA-PIPSEAGKPRRAKRPKE--PKSASPNKKTSKPAKKVKKESEDLNKVMFGKSHEW  204

Query  1091  DDGNCGEFVDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
               G   E V+  D+  +K L     D   +D GL QV  D S MP PVCSCTG  + CYK
Sbjct  205   KSGQ--EMVNGGDD-LNKQLTVSKADWKGQDLGLNQVAYDDSTMPAPVCSCTGVLRQCYK  261

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQSACCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+D
Sbjct  262   WGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNPVD  321

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LKDHWAKHGTNRY T+K
Sbjct  322   LKDHWAKHGTNRYITIK  338



>ref|XP_002510492.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52679.1| conserved hypothetical protein [Ricinus communis]
Length=339

 Score =   287 bits (734),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 158/317 (50%), Positives = 211/317 (67%), Gaps = 21/317 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q   +++  MAIMAERDAAI ERNMA+ E+K A+AERDMA LQRD+AIAERN A+ ERDN
Sbjct  27    QAQPSMKQIMAIMAERDAAIHERNMAISEKKAAIAERDMAFLQRDSAIAERNNAIMERDN  86

Query  767   AISALKLRESSMNDEDIVSKSP-------GAEHIHY-QQEMHEM--ISAAAYDPTENLTN  916
             AI+ L+ RE+S+   ++ S  P       G +H+H+ QQ  H M   S A+Y   E  T+
Sbjct  87    AIATLQYRENSIPSGNMPSSCPPGCQISRGVKHMHHPQQHAHHMPHSSEASYSTREMQTS  146

Query  917   DPFNVTDPTPQTANNPRKVRQPKESKPKKASK-LArvvkreeveveDLSWQAVSTFDDWD  1093
             D   ++ P    A  PR+V++ K++K   ++K  ++  ++ + E EDL+        +W 
Sbjct  147   DTLPMS-PVGSEAAKPRRVKRSKDAKMAPSNKKTSKSPRKIKRESEDLNKVMFGKSHEWK  205

Query  1094  DGNCGEFVDASDEEQDKHL------DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
             +G   + +    ++ +K L      D    D GL Q+  D S MP PVCSCTG  + CYK
Sbjct  206   NG---QDMGGGADDLNKQLVVASKSDWKGHDLGLNQIAFDESTMPAPVCSCTGVFRQCYK  262

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQS+CCTTT+SM+PLP   +KR++RVGGRKMS SAFSKLLSRL AEGYDLS+P+D
Sbjct  263   WGNGGWQSSCCTTTLSMHPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEGYDLSSPVD  322

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LK+HWAKHGTNRY T+K
Sbjct  323   LKEHWAKHGTNRYITIK  339



>ref|XP_007136066.1| hypothetical protein PHAVU_009G015000g [Phaseolus vulgaris]
 gb|ESW08060.1| hypothetical protein PHAVU_009G015000g [Phaseolus vulgaris]
Length=337

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 163/317 (51%), Positives = 207/317 (65%), Gaps = 23/317 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERDAAI ERN+A+ E+K A AERDMA LQRDAAIAERN A+ ERDN
Sbjct  27    QHQPSMKQIMAIMAERDAAIQERNLAISEKKAAYAERDMAFLQRDAAIAERNNAILERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTND  919
             A + L+ RE+S++   + S  PG +      HIH+ QQ++H +  +   +Y+  E  T D
Sbjct  87    AFATLQYRETSLSSGSMPSCPPGCQISRGVKHIHHPQQQVHHIPNMGDPSYNTREMHTTD  146

Query  920   PFNVTDPTPQTANNPRKVRQPKESKPKKAS---KLArvvkreeveveDLSWQAVSTFDDW  1090
                   P    A   R+ ++PKE  PK  S   K  +  K+ + E EDL+        +W
Sbjct  147   VLPAA-PITSEAGKSRRAKRPKE--PKSTSPNKKTTKAAKKVKKESEDLNKVMFGKAHEW  203

Query  1091  DDGNCGEFVDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
              +G   E V+  D+  +K L     D   +D GL QV  D S MP PVCSCTG  + CYK
Sbjct  204   KNGQ--EMVNGGDD-LNKQLAVSKADWKGQDLGLNQVAYDESTMPAPVCSCTGVLKQCYK  260

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQSACCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+D
Sbjct  261   WGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNPVD  320

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LKDHWAKHGTNRY T+K
Sbjct  321   LKDHWAKHGTNRYITIK  337



>ref|NP_001268020.1| GAGA-binding transcriptional activator BBR/BPC6-like [Vitis vinifera]
 ref|XP_010664073.1| PREDICTED: GAGA-binding transcriptional activator BBR/BPC6-like 
isoform X1 [Vitis vinifera]
 gb|ACC64529.1| GAGA-binding transcriptional activator BBR/BPC6-like [Vitis vinifera]
 gb|ACC64530.1| GAGA-binding transcriptional activator BBR/BPC6-like [Vitis vinifera]
Length=337

 Score =   284 bits (726),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 156/315 (50%), Positives = 201/315 (64%), Gaps = 19/315 (6%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  T++  MAIMAERD A+ ERN+AL E+K A+AERDMA LQRD AIAERN A+ ERDN
Sbjct  27    QHQPTMKQIMAIMAERDTAVQERNLALSEKKAAVAERDMAFLQRDTAIAERNNAIMERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAE---------HIHYQQEMHEMISAAAYDPTENLTND  919
             AI+ L+ RE+S+N  ++    PG +         H          +S AAY   E    D
Sbjct  87    AIATLQYRENSLNGGNMSPCPPGCQISRGVKHMHHPQPHLHHPTHLSEAAYSAREMHIGD  146

Query  920   PFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkre-eveveDLSWQAVSTFDDWDD  1096
                V+ P    A   R+ ++PKE+KP  ++K A    ++ + E EDL+        +W  
Sbjct  147   ALPVS-PVASEAAKSRRAKRPKEAKPMSSNKKASKPLKKPKREGEDLNKIVFGKSREWKG  205

Query  1097  GNCGEFVDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWG  1261
             G   + + +  ++ +K L     D   +D GL QV  D S MP PVCSCTG  + CYKWG
Sbjct  206   G---QDMSSGGDDLNKQLVVSKSDWKGQDLGLNQVTFDESTMPAPVCSCTGVLRQCYKWG  262

Query  1262  NGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLK  1441
             NGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+DLK
Sbjct  263   NGGWQSSCCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSIPVDLK  322

Query  1442  DHWAKHGTNRYSTVK  1486
             DHWAKHGTNRY T+K
Sbjct  323   DHWAKHGTNRYITIK  337



>ref|NP_001266214.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
 ref|XP_010320046.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320047.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320048.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320049.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320050.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320051.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320052.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320053.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 ref|XP_010320054.1| PREDICTED: GAGA-binding transcriptional activator isoform X1 
[Solanum lycopersicum]
 gb|ADV59391.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
 gb|ADV59392.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
Length=323

 Score =   283 bits (724),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 156/306 (51%), Positives = 199/306 (65%), Gaps = 10/306 (3%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERDAAI ERN+AL E+K ALAERDMA+LQRD+AIAERN A+ ERDN
Sbjct  22    QHQPSMKQIMAIMAERDAAIQERNLALSEKKAALAERDMAILQRDSAIAERNNAIMERDN  81

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTP  946
             A + L+ RE+SM    IV       H          +    Y+P E    +   V+ P P
Sbjct  82    AFATLQYRETSMTAGQIVRGVKHMHHPQQHVHHQPHMGEPTYNPREMHMVEAIPVSQPAP  141

Query  947   QTANNPRKVRQPKESKPKKASK-LArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDA  1123
             + A  PR+ ++ KE K    SK   +  K+ + E EDL+        +W      E V A
Sbjct  142   EPAK-PRRNKRAKEPKAATGSKKTPKASKKVKRETEDLNQTTYGKSPEWKGAQ--EMVGA  198

Query  1124  SDEEQDKHLDT----W-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACC  1288
             SD+  ++ L      W D+D GL QV  D + MPVPVCSCTG  +PCYKWGNGGWQS+CC
Sbjct  199   SDD-LNRQLSVAKPDWKDQDLGLNQVAFDETTMPVPVCSCTGVLRPCYKWGNGGWQSSCC  257

Query  1289  TTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTN  1468
             TT +SMYPLP   +KR++R+GGRKMS SAF+KLLSRL AEG+DLS P+DLK++WAKHGTN
Sbjct  258   TTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEGHDLSNPVDLKNNWAKHGTN  317

Query  1469  RYSTVK  1486
             RY T+K
Sbjct  318   RYITIK  323



>ref|NP_001275364.1| protein BASIC PENTACYSTEINE6-like [Solanum tuberosum]
 ref|XP_006342016.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342018.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X3 [Solanum 
tuberosum]
 gb|ADV59397.1| GAGA-binding transcriptional activator [Solanum tuberosum]
Length=323

 Score =   283 bits (723),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 156/306 (51%), Positives = 200/306 (65%), Gaps = 10/306 (3%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERDAAI ERN+AL E+K ALAERDMA+LQRD+AIAERN A+ ERDN
Sbjct  22    QHQPSMKQIMAIMAERDAAIQERNLALSEKKAALAERDMAILQRDSAIAERNNAIMERDN  81

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTP  946
             AI+ L+ RE++M    IV       H          +    Y+P E    +   V+ P P
Sbjct  82    AIATLQYRENAMTGGQIVRGVKHMHHPQQHVHHQPHMGEPTYNPREMHMVEAIPVSPPAP  141

Query  947   QTANNPRKVRQPKESKPKKASK-LArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDA  1123
             + A  PR+ ++ KE K    SK   +  K+ + E EDL+        +W      E V A
Sbjct  142   EPAK-PRRNKRAKEPKAVTGSKKTPKASKKVKRETEDLNQTTYGKSPEWKGAQ--EMVGA  198

Query  1124  SDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACC  1288
             SD+  ++ L     D  D+D GL QV  D + MPVPVCSCTG  +PCYKWGNGGWQS+CC
Sbjct  199   SDD-LNRQLAVSKPDWKDQDLGLNQVAFDETTMPVPVCSCTGVLRPCYKWGNGGWQSSCC  257

Query  1289  TTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTN  1468
             TT +SMYPLP   +KR++R+GGRKMS SAF+KLLSRL AEG+DLS P+DLK++WAKHGTN
Sbjct  258   TTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEGHDLSNPVDLKNNWAKHGTN  317

Query  1469  RYSTVK  1486
             RY T+K
Sbjct  318   RYITIK  323



>gb|ADV59381.1| GAGA-binding transcriptional activator [Helianthus annuus]
Length=270

 Score =   281 bits (718),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 185/296 (63%), Gaps = 48/296 (16%)
 Frame = +2

Query  584   DQNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERD  763
             D N+ TI+T+MAIMAERDAAI ERN+AL+ERKRA AERDMAMLQRDAA+AERNTA++ERD
Sbjct  2     DHNHFTIKTFMAIMAERDAAIQERNLALEERKRAFAERDMAMLQRDAALAERNTAMQERD  61

Query  764   NAISALKLRESSMNDEDIVSKSPGAEHIHYQ--------QEMHEMISAAAYDPTENLTND  919
              AIS ++ R + +N+  I + S   E+I           +EMH M               
Sbjct  62    EAISTIRFRSNFINENMISTTSEPPENIQNHGSKRGFNDEEMHHMFEI------------  109

Query  920   PFNVTDPTPQTANNPRKV-RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDD  1096
             P +   P P+    PRKV ++ K   P   SK A                      D  +
Sbjct  110   PEDYQLPPPENT-KPRKVPKKTKSQSPHVGSKRA----------------------DVTN  146

Query  1097  GNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQ  1276
              N     D  +   D  L+ W ++ GL QVN D +AMPVPVCSCTG PQPCY+WG+GGWQ
Sbjct  147   VNS----DYEESSSDAQLEAWKDELGLNQVNFDETAMPVPVCSCTGVPQPCYRWGSGGWQ  202

Query  1277  SACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKD  1444
             SACCTTT+SMYPLP  ++KRYSRVGGRKMS  AF+KLL+RL +EGYDLS PLDLKD
Sbjct  203   SACCTTTMSMYPLPLVTNKRYSRVGGRKMSGGAFTKLLTRLASEGYDLSTPLDLKD  258



>ref|XP_006581036.1| PREDICTED: uncharacterized protein LOC100809369 isoform X1 [Glycine 
max]
 ref|XP_006581037.1| PREDICTED: uncharacterized protein LOC100809369 isoform X2 [Glycine 
max]
 ref|XP_006581038.1| PREDICTED: uncharacterized protein LOC100809369 isoform X3 [Glycine 
max]
 ref|XP_006581039.1| PREDICTED: uncharacterized protein LOC100809369 isoform X4 [Glycine 
max]
 ref|XP_006581040.1| PREDICTED: uncharacterized protein LOC100809369 isoform X5 [Glycine 
max]
 ref|XP_006581041.1| PREDICTED: uncharacterized protein LOC100809369 isoform X6 [Glycine 
max]
 ref|XP_006581042.1| PREDICTED: uncharacterized protein LOC100809369 isoform X7 [Glycine 
max]
 gb|KHN09107.1| Protein BASIC PENTACYSTEINE6 [Glycine soja]
Length=337

 Score =   283 bits (723),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 211/318 (66%), Gaps = 26/318 (8%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MA++AERDAAI ERN+A+ E+K A AERDMA +QRDAAIAERN A+ ERDN
Sbjct  28    QHQPSMKQIMAMIAERDAAIQERNLAISEKKAAYAERDMAYMQRDAAIAERNNAMLERDN  87

Query  767   AISALKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTND  919
             AI+ L+ RE+S++   + S  PG +      H+H+ QQ++H +  +  A+Y+  E  T +
Sbjct  88    AIATLQYRETSLSSGSMPSCPPGCQISRGVKHVHHPQQQVHHIPNMGDASYNTREMHTTE  147

Query  920   PFNVTDPTPQTANNPRKVRQPKESKP----KKASKLArvvkreeveveDLSWQAVSTFDD  1087
                   P P      R+ ++PKE K     KK SK ++ VK+E  ++ ++  +A     +
Sbjct  148   VLPAA-PIPSETGKSRRAKRPKEPKSAPPNKKTSKPSKKVKKESEDLNNMFGKA----HE  202

Query  1088  WDDGNCGEFVDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCY  1252
             W  G   E V+  D+  +K L     D   +D GL QV  D S MP PVCSCTG  + CY
Sbjct  203   WKSGQ--EMVNGGDD-LNKQLAVSKADWKGQDLGLNQVAYDESTMPAPVCSCTGVLRQCY  259

Query  1253  KWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPL  1432
             KWGNGGWQSACCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AE +DLS P+
Sbjct  260   KWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAESHDLSNPV  319

Query  1433  DLKDHWAKHGTNRYSTVK  1486
             DLKDHWAKHGTNRY T+K
Sbjct  320   DLKDHWAKHGTNRYITIK  337



>ref|XP_010052611.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Eucalyptus grandis]
 ref|XP_010052612.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Eucalyptus grandis]
 ref|XP_010052613.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Eucalyptus grandis]
 ref|XP_010052615.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Eucalyptus grandis]
 ref|XP_010052616.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Eucalyptus grandis]
 ref|XP_010052617.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Eucalyptus grandis]
 gb|KCW76693.1| hypothetical protein EUGRSUZ_D01054 [Eucalyptus grandis]
 gb|KCW76694.1| hypothetical protein EUGRSUZ_D01054 [Eucalyptus grandis]
Length=323

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 157/311 (50%), Positives = 200/311 (64%), Gaps = 25/311 (8%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M IMAERDAA+ ERN+AL E+K A+AERD+A  QRD AIAERN A  ERDN
Sbjct  27    QHQPSMKQIMGIMAERDAALQERNLALSEKKAAIAERDIAFHQRDMAIAERNNAYLERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTND  919
             AI+ L+ RE+S+   +I S  PG +      H+H+ QQ++H +  +S AAY   +   +D
Sbjct  87    AIATLQYRENSLTSGNISSCPPGCQISRGVKHMHHPQQQVHHVSSMSEAAYGTRDMHPSD  146

Query  920   PFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDG  1099
                ++ P    A   R+ ++ KE+K    SK A    ++     D     ++   + DDG
Sbjct  147   ALPIS-PVASEATRSRQTKRTKEAKAMSTSKKAPKTPKKVKRETD----DLNKLLNGDDG  201

Query  1100  NCGEF-VDASDEEQDKHLDTW-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGW  1273
                 F V  SD         W  +D GL QV  D S MP PVCSCTG  + CYKWGNGGW
Sbjct  202   YNKPFGVPKSD---------WKGQDLGLNQVAFDDSTMPSPVCSCTGIARQCYKWGNGGW  252

Query  1274  QSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWA  1453
             QS+CCTTTISMYPLP   +KR++RVGGRKMS SAF KLLSRL AEGYDLS+P+DLKDHWA
Sbjct  253   QSSCCTTTISMYPLPAVPNKRHARVGGRKMSGSAFGKLLSRLAAEGYDLSSPVDLKDHWA  312

Query  1454  KHGTNRYSTVK  1486
             KHGTNRY T+K
Sbjct  313   KHGTNRYITIK  323



>gb|KDP36958.1| hypothetical protein JCGZ_08249 [Jatropha curcas]
Length=337

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 157/315 (50%), Positives = 203/315 (64%), Gaps = 19/315 (6%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q   +++  MAIMAERDAAI ERNMA+ E+K A+AERDMA +QRDAAIAERN A+ +RD+
Sbjct  27    QAQPSMKQIMAIMAERDAAIHERNMAISEKKAAIAERDMAFIQRDAAIAERNNAILDRDS  86

Query  767   AISALKLRESSMNDEDIVSKSPGAE------HIHYQQEMHEMI---SAAAYDPTENLTND  919
             AI+ L+ RE+S+   ++ S  PG +      H+H+ Q+  + +   S  +Y   E  T+D
Sbjct  87    AIATLQYRENSLTGGNMSSCPPGCQISRGVKHMHHPQQHAQHLPHSSEVSYGTREMQTSD  146

Query  920   PFNVTDPTPQTANNPRKVRQPKESKPKKA----SKLArvvkreeveveDLSWQAVSTFDD  1087
                V+   P+ A    K R+ K SK  KA     K ++  ++ + E EDL+        D
Sbjct  147   TVPVSPVGPEAA----KSRRGKRSKDAKAMPPNKKTSKSPRKVKRESEDLTKVMFGKSHD  202

Query  1088  WDDGN--CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWG  1261
             W +G    G   D + +      D    D GL Q+  D S MP PVCSCTG  + CYKWG
Sbjct  203   WKNGQDLAGGGDDLNKQLVVSKSDWKGNDLGLNQIAFDDSTMPAPVCSCTGVHRQCYKWG  262

Query  1262  NGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLK  1441
             NGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAFSKLLSRL AEGYDLS P+DLK
Sbjct  263   NGGWQSSCCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEGYDLSNPVDLK  322

Query  1442  DHWAKHGTNRYSTVK  1486
             +HWAKHGTNRY T+K
Sbjct  323   EHWAKHGTNRYITIK  337



>ref|XP_011083484.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083485.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083486.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083487.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083488.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083489.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083490.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083491.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083492.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083493.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
 ref|XP_011083494.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Sesamum indicum]
Length=323

 Score =   281 bits (719),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 157/313 (50%), Positives = 206/313 (66%), Gaps = 24/313 (8%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERDAAI ERN+A+ E+K ALAERDMA+LQRD+AIAERN A+ ERDN
Sbjct  22    QHQPSMKQIMAIMAERDAAIQERNLAISEKKAALAERDMAILQRDSAIAERNNAIMERDN  81

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD---  937
             AI+ L+ RE++MN+ +     PG + I +  +        A+    ++    +N  D   
Sbjct  82    AIATLQFRENAMNNSNTSPCPPGCQ-IPHGVKHIHHPQQHAHHHQSHMVEAQYNTRDMHM  140

Query  938   ----PTPQTANNP---RKVRQPKESKPKKA--SKLArvvkreeveveDLSWQAVSTFDDW  1090
                 PT   A  P   R+ ++ KE+KP  A   K ++ +K+ + E EDL+        +W
Sbjct  141   ADTVPTSPVAPEPAKARRAKRTKEAKPATAPTRKPSKSLKKVKREGEDLNKTMFEKPHEW  200

Query  1091  DDGNCGEFVDASDEEQDKHLDTW-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNG  1267
              +G      D S  +QD     W D+D GL QV  D + MPVPVCSCTG  +PCYKWGNG
Sbjct  201   TNG-----PDMSRTKQD-----WKDQDLGLNQVAFDETTMPVPVCSCTGVLRPCYKWGNG  250

Query  1268  GWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDH  1447
             GWQS+CCTT +SMYPLP   +KR++RVGGRKMS SAF+KL+SRL AEG+DLS P+DLKDH
Sbjct  251   GWQSSCCTTNLSMYPLPAVPNKRHARVGGRKMSGSAFNKLISRLAAEGHDLSNPVDLKDH  310

Query  1448  WAKHGTNRYSTVK  1486
             WAKHGTNRY T+K
Sbjct  311   WAKHGTNRYITIK  323



>ref|XP_009610156.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009610157.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009798749.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009798750.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009798751.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 gb|AII99808.1| GAGA-binding transcriptional activator [Nicotiana tabacum]
Length=327

 Score =   280 bits (717),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 159/309 (51%), Positives = 203/309 (66%), Gaps = 12/309 (4%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERDAAI ERN+AL E+K ALAERDMA+LQRD+AIAERN A+ ERDN
Sbjct  22    QHQPSMKQIMAIMAERDAAIQERNLALSEKKAALAERDMAILQRDSAIAERNNAIMERDN  81

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTP  946
             AI+ L+ RESS++    +++       H QQ +H        +PT N  +   N + P  
Sbjct  82    AIATLQYRESSISGGGQIARGVVKHMHHPQQHVHVHHQPHMGEPTYNPRDMHVNESMPVS  141

Query  947   QTANNPRKVRQPKESKPKKA----SKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
               A  P K R+ K +K  KA     K  +  K+ + E EDL+        +W      E 
Sbjct  142   PVAPEPTKPRRNKRAKEPKAMTGSKKTPKASKKVKRETEDLNQTTFGKSQEWKGAQ--EM  199

Query  1115  VDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQS  1279
              DASD+  ++ L     D  D+D GL QV  D + MPVPVCSCTG  +PCYKWGNGGWQS
Sbjct  200   GDASDD-LNRQLAVSKPDWKDQDLGLNQVAFDETTMPVPVCSCTGVLRPCYKWGNGGWQS  258

Query  1280  ACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKH  1459
             +CCTT +SMYPLP   +KR++R+GGRKMS SAF+KLLSRL AEG+DLS P+DLK+HWAKH
Sbjct  259   SCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFTKLLSRLAAEGHDLSNPVDLKNHWAKH  318

Query  1460  GTNRYSTVK  1486
             GTNRY T+K
Sbjct  319   GTNRYITIK  327



>gb|ABL10371.1| GAGA-binding transcriptional activator [Medicago truncatula]
 gb|ABL10372.1| GAGA-binding transcriptional activator [Medicago truncatula]
Length=318

 Score =   280 bits (716),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 202/310 (65%), Gaps = 15/310 (5%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M+IMAERDAAI ERN+AL E+K ALAERDMA LQRD AIAERN AL ERDNAI+ 
Sbjct  10    SMKQIMSIMAERDAAIQERNLALSEKKAALAERDMAFLQRDTAIAERNNALMERDNAIAT  69

Query  779   LKLRESSMNDEDIVSKSPGAE------HIHY--QQEMH-EMISAAAYDPTENLTNDPFNV  931
             L+ RE+++ +  + S  PG +      HIH+  QQ  H   +  ++Y   E  T D    
Sbjct  70    LQFRENALANGGMSSCPPGCQISRGVKHIHHLPQQVNHLPNMGDSSYGTRELHTTDALPA  129

Query  932   TDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGE  1111
                + +    PR+ ++PKESK    +K     ++ + E +DL+    +   + +  +  E
Sbjct  130   APVSLEVGKPPRRAKRPKESKSDSPNKKTPKSRKVKKEGDDLNKTMFANNKELEWKSSEE  189

Query  1112  FVDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQ  1276
              ++  D++ +K L     D   +D  L QV  D S MP P CSCTG  + CYKWGNGGWQ
Sbjct  190   IING-DDDLNKQLAISKADWKPQDLALNQVAYDDSTMPAPACSCTGVLRQCYKWGNGGWQ  248

Query  1277  SACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAK  1456
             SACCTTT+S+YPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+DLKDHWAK
Sbjct  249   SACCTTTLSVYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSHPVDLKDHWAK  308

Query  1457  HGTNRYSTVK  1486
             HGTNRY T+K
Sbjct  309   HGTNRYITIK  318



>ref|XP_008377168.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Malus domestica]
 ref|XP_008377169.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Malus domestica]
 ref|XP_008377170.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Malus domestica]
Length=339

 Score =   280 bits (716),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 153/315 (49%), Positives = 201/315 (64%), Gaps = 17/315 (5%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
              N  +++  MAIM+ERDAAI ERN+A  E+K ALAERDMA LQRDAAIAERN+A+ ERD+
Sbjct  27    HNQPSMKQVMAIMSERDAAIQERNLAFSEKKAALAERDMAFLQRDAAIAERNSAMMERDS  86

Query  767   AISALKLRESSMNDEDIVSKSPGAE-----------HIHYQQEMHEMISAAAYDPTENLT  913
             AI+ L  R++S+N  ++ S  PG +                      ++ A+Y   +  T
Sbjct  87    AIATLHYRDNSLNSGNVSSCPPGCQISRGVKHMHHTQQQQHVHHMPHMNEASYGTRDMHT  146

Query  914   NDPFNVTDPT--PQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDD  1087
             +D   +   T  P  +  P++ R+PK ++P K  K ++  ++ + E EDL+        D
Sbjct  147   SDSITMPPETSAPTKSRQPKRPREPKTTQPNK--KPSKSPRKMKRESEDLNKMTFDKLHD  204

Query  1088  WDDGN--CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWG  1261
             W  G    GE  D + +      D   +D GL QV  D S MP P+CSCTG  + CYKWG
Sbjct  205   WKGGQDMGGEGDDLNKQVVVSKSDWKCQDLGLNQVAYDESTMPAPMCSCTGLLRQCYKWG  264

Query  1262  NGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLK  1441
             NGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRLTAEG+DLS P+DLK
Sbjct  265   NGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLTAEGHDLSNPVDLK  324

Query  1442  DHWAKHGTNRYSTVK  1486
             DHWAKHGTNRY T+K
Sbjct  325   DHWAKHGTNRYITIK  339



>ref|XP_004152657.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Cucumis sativus]
 ref|XP_004165561.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Cucumis sativus]
 gb|KGN62663.1| hypothetical protein Csa_2G365700 [Cucumis sativus]
Length=338

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 210/318 (66%), Gaps = 24/318 (8%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERDAAI ERN+AL E+K ALAERDMA LQRDAAIAERN AL ERDN
Sbjct  27    QHQPSMKQIMAIMAERDAAIQERNLALSEKKAALAERDMAYLQRDAAIAERNNALLERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEM----------ISAAAYDPTENL-T  913
             AI+ L+ RE+S+N+   +S  PG +     + +H            ++   Y+  E L +
Sbjct  87    AIATLQYRENSINNN--LSCPPGCQIARGVKHIHHPQQQHTHHVPHMNENNYNSREMLAS  144

Query  914   NDPFNVTDPTPQTANNPRKVRQPKESK--PKKASKLArvvkreeveveDLSWQAVSTFDD  1087
             NDP   T P    +   R+ ++PKE K  P    K+++  ++ + E EDL+   +    +
Sbjct  145   NDPC-PTSPVASESTKARRNKRPKEGKTVPTPNKKVSKGPRKVKREAEDLNKIMLGKSQE  203

Query  1088  WDDGNCGEFVDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCY  1252
             W DG     + ++ ++ +K L     D   +D GL QV  D S MP P+CSCTG  + CY
Sbjct  204   WKDG---IGIMSAGDDLNKQLVVSKSDWKGQDLGLNQVAFDESTMPAPICSCTGVIRQCY  260

Query  1253  KWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPL  1432
             KWGNGGWQSACCTTT+SMYPLP   +KR++R+GGRKMS SAF+KLLSRL AEG+DLSAP+
Sbjct  261   KWGNGGWQSACCTTTLSMYPLPAVPNKRHARLGGRKMSGSAFNKLLSRLAAEGHDLSAPV  320

Query  1433  DLKDHWAKHGTNRYSTVK  1486
             DLK+HWAKHGTNRY T+K
Sbjct  321   DLKNHWAKHGTNRYITIK  338



>ref|XP_003589387.1| GAGA-binding transcriptional activator [Medicago truncatula]
 gb|AES59638.1| GAGA-binding transcriptional activator BBR/BPC6-like protein 
[Medicago truncatula]
Length=340

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 202/310 (65%), Gaps = 15/310 (5%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M+IMAERDAAI ERN+AL E+K ALAERDMA LQRD AIAERN AL ERDNAI+ 
Sbjct  32    SMKQIMSIMAERDAAIQERNLALSEKKAALAERDMAFLQRDTAIAERNNALMERDNAIAT  91

Query  779   LKLRESSMNDEDIVSKSPGAE------HIHY--QQEMH-EMISAAAYDPTENLTNDPFNV  931
             L+ RE+++ +  + S  PG +      HIH+  QQ  H   +  ++Y   E  T D    
Sbjct  92    LQFRENALANGGMSSCPPGCQISRGVKHIHHLPQQVNHLPNMGDSSYGTRELHTTDALPA  151

Query  932   TDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGE  1111
                + +    PR+ ++PKESK    +K     ++ + E +DL+    +   + +  +  E
Sbjct  152   APVSLEVGKPPRRAKRPKESKSDSPNKKTPKSRKVKKEGDDLNKTMFANNKELEWKSSEE  211

Query  1112  FVDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQ  1276
              ++  D++ +K L     D   +D  L QV  D S MP P CSCTG  + CYKWGNGGWQ
Sbjct  212   IING-DDDLNKQLAISKADWKPQDLALNQVAYDDSTMPAPACSCTGVLRQCYKWGNGGWQ  270

Query  1277  SACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAK  1456
             SACCTTT+S+YPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+DLKDHWAK
Sbjct  271   SACCTTTLSVYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSHPVDLKDHWAK  330

Query  1457  HGTNRYSTVK  1486
             HGTNRY T+K
Sbjct  331   HGTNRYITIK  340



>ref|XP_010670883.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Beta vulgaris subsp. 
vulgaris]
Length=334

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 151/311 (49%), Positives = 204/311 (66%), Gaps = 14/311 (5%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q   +++  M+IMAERDAAI ERNMA++E+ +AL ERD+A++QRD A+ ERN AL ERDN
Sbjct  27    QQPQSMKHIMSIMAERDAAIQERNMAINEKNKALEERDLAIMQRDTAMQERNEALMERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAE------HIHYQQE--MHEMISAAAYDPTENLTNDP  922
             A++AL+ R++S+N     +  PG +      H+H+ Q+   H  +  A+YD  E    D 
Sbjct  87    ALAALQFRQNSINGGGSNTCPPGCQISRGVKHMHHPQQHVQHPHVGEASYDGREVQVPDA  146

Query  923   FNVTDPTPQTANNPRKVRQPKE---SKPKKASKLArvvkreeveveDLSWQAVSTFDDWD  1093
               +T   P++A + RKV++PKE   + P K  K ++  ++ + E EDL+    S   +W 
Sbjct  147   LPLTAVPPESAKS-RKVKRPKEPNATSPNK--KTSKNGRKGKREGEDLNKIMFSKSQEWK  203

Query  1094  DGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGW  1273
                  +  D   +      D    D GL QV  D S MP PVCSCTG  + CYKWGNGGW
Sbjct  204   GMQDMDGSDGYKQLGGPKPDWKGPDLGLNQVAFDESTMPPPVCSCTGVYRQCYKWGNGGW  263

Query  1274  QSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWA  1453
             QS+CCTTT+S+YPLP   +KR++RVGGRKMS SAFSKLLSRL A+G+DLS P+DLKDHWA
Sbjct  264   QSSCCTTTMSVYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAADGHDLSTPVDLKDHWA  323

Query  1454  KHGTNRYSTVK  1486
             KHGTNRY T++
Sbjct  324   KHGTNRYITIR  334



>ref|XP_011045135.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Populus euphratica]
 ref|XP_011045136.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Populus euphratica]
Length=335

 Score =   277 bits (709),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 151/316 (48%), Positives = 195/316 (62%), Gaps = 23/316 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q   +++  M IMAERDAAI E+NMAL E+K A+AERDMA+LQRD+AIAERN AL ERDN
Sbjct  27    QPQPSMKQIMGIMAERDAAIHEKNMALSEKKAAIAERDMALLQRDSAIAERNNALLERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHE-----------MISAAAYDPTENLT  913
             AI+ L+ RE+S    +  S  PG    H  + M             +++  AY   E  T
Sbjct  87    AIATLQYRENSFASANTSSSPPG---YHNSRGMKHMHHQQQHIHLPLMNEGAYGTREMQT  143

Query  914   NDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWD  1093
             +D   ++ P    A  PR+ ++PK++K   A+K       +     +         ++W 
Sbjct  144   SDTVPIS-PVASEAAKPRRGKRPKDTKSTPANKKTSKSAMKVKRESEDLNNMFGKSNEWK  202

Query  1094  DGNCGEFVDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKW  1258
             +G   E ++   +  +K L     D   +D GL QV  D + MP PVCSCTG  + CYKW
Sbjct  203   NG---EDMNGGGDGLNKQLAASKSDWKGQDLGLNQVAFDETTMPAPVCSCTGFFRQCYKW  259

Query  1259  GNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDL  1438
             GNGGWQS+CCTT +SMYPLP   +KR++RVGGRKMS SAFSKLLSRL AEG DLS P+DL
Sbjct  260   GNGGWQSSCCTTALSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEGQDLSNPVDL  319

Query  1439  KDHWAKHGTNRYSTVK  1486
             KDHWAKHGTNRY T+K
Sbjct  320   KDHWAKHGTNRYITIK  335



>ref|XP_007222527.1| hypothetical protein PRUPE_ppa008316mg [Prunus persica]
 gb|EMJ23726.1| hypothetical protein PRUPE_ppa008316mg [Prunus persica]
Length=337

 Score =   277 bits (708),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 203/318 (64%), Gaps = 25/318 (8%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIM ERDAAI ERN+A  E+K AL ERDMA LQRDAAIAERNTA+ ERDN
Sbjct  27    QHQPSMKQIMAIMGERDAAIQERNLAFSEKKAALQERDMAFLQRDAAIAERNTAIMERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAE---------HIHYQQEMHEMISAAAYDPTENLTND  919
             AI+ L+ RE+S+N+ ++ S  PG +         H          ++ A+Y   +  T+D
Sbjct  87    AIANLQYRENSLNNGNVSSCPPGCQISRGVKHMHHPQQHVHHPPHMNEASYGTRDMHTSD  146

Query  920   PFNVTDPTPQTANNPRKVRQPKESKPKKA----SKLArvvkreeveveDLSWQAVSTFDD  1087
                   P P  A+ P K RQPK  +  K      K ++  ++ + E EDL+     TFD 
Sbjct  147   SV----PMPPDASLPTKSRQPKRPREPKTMAPNKKTSKSPRKVKRESEDLN---KMTFDK  199

Query  1088  WDDGNCGEFVDASDEEQDKHL----DTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCY  1252
               +    + +    ++ +KHL      W  +D GL QV  D S MP PVCSCTG  + CY
Sbjct  200   LHEWKGSQDMGGGGDDVNKHLVVSKSDWKCQDLGLNQVAYDESTMPAPVCSCTGILRQCY  259

Query  1253  KWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPL  1432
             KWGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+
Sbjct  260   KWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNPV  319

Query  1433  DLKDHWAKHGTNRYSTVK  1486
             DLKD+WAKHGTNRY T+K
Sbjct  320   DLKDNWAKHGTNRYITIK  337



>gb|KHG09159.1| basic pentacysteine6 -like protein [Gossypium arboreum]
Length=336

 Score =   276 bits (707),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 207/311 (67%), Gaps = 19/311 (6%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  MAIMAERDAAI ERN+AL E+K A+AERDMA LQRDAAIAERN A+ ERDNAI+ 
Sbjct  30    SMKQIMAIMAERDAAIQERNLALSEKKAAIAERDMAFLQRDAAIAERNNAIAERDNAIAN  89

Query  779   LKLRESSMNDEDIVSKSPG------AEHI-HYQQEMHEM--ISAAAYDPTENLTNDPFNV  931
             L+ RE+S+   +I S  PG       +H+ H QQ +H +  IS   Y+  E   +D   V
Sbjct  90    LQYRENSLASGNISSCPPGFHISRGVKHMQHPQQNVHHLPHISEVPYNSREMHASDVLPV  149

Query  932   TDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS-TFDDWDDGNCG  1108
             T  T + A + R+ ++ KE+K   ++K A    ++  +  + S + +S    +W  G   
Sbjct  150   TPGTSEAAKS-RQGKRAKEAKVIASNKKATKPPKKVKQENEDSDKLMSGKSHEWKGG---  205

Query  1109  EFVDASDEEQDKHLDT----W-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGW  1273
             + V  + ++ +K L T    W  +D GL QV  D S M  PVCSCTG  + CYKWGNGGW
Sbjct  206   QDVGGAGDDLNKQLVTTKSDWKGKDLGLNQVVFDDSTMAPPVCSCTGVLRQCYKWGNGGW  265

Query  1274  QSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWA  1453
             QS+CCTT++SMYPLP   +KR++R+GGRKMS SAF+KLL+RL AEGYDLS P+DLK HWA
Sbjct  266   QSSCCTTSLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLTRLAAEGYDLSNPVDLKHHWA  325

Query  1454  KHGTNRYSTVK  1486
             KHGTNRY T+K
Sbjct  326   KHGTNRYITIK  336



>ref|NP_001242497.1| uncharacterized protein LOC100809369 [Glycine max]
 gb|ACU17970.1| unknown [Glycine max]
Length=336

 Score =   276 bits (706),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 158/318 (50%), Positives = 210/318 (66%), Gaps = 27/318 (8%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MA++AERDAAI ERN+A+ E+K A AERDMA +QRDAAIAERN A+ ERD 
Sbjct  28    QHQPSMKQIMAMIAERDAAIQERNLAISEKKAAYAERDMAYMQRDAAIAERNNAMLERD-  86

Query  767   AISALKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTND  919
             AI+ L+ RE+S++   + S  PG +      H+H+ QQ++H +  +  A+Y+  E  T +
Sbjct  87    AIATLQYRETSLSSGSMPSCPPGCQISRGVKHVHHPQQQVHHIPNMGDASYNTREMHTTE  146

Query  920   PFNVTDPTPQTANNPRKVRQPKESKP----KKASKLArvvkreeveveDLSWQAVSTFDD  1087
                   P P      R+ ++PKE K     KK SK ++ VK+E  ++ ++  +A     +
Sbjct  147   VLPAA-PIPSETGKSRRAKRPKEPKSAPPNKKTSKPSKKVKKESEDLNNMFGKA----HE  201

Query  1088  WDDGNCGEFVDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCY  1252
             W  G   E V+  D+  +K L     D   +D GL QV  D S MP PVCSCTG  + CY
Sbjct  202   WKSGQ--EMVNGGDD-LNKQLAVSKADWKGQDLGLNQVAYDESTMPAPVCSCTGVLRQCY  258

Query  1253  KWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPL  1432
             KWGNGGWQSACCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AE +DLS P+
Sbjct  259   KWGNGGWQSACCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAESHDLSNPV  318

Query  1433  DLKDHWAKHGTNRYSTVK  1486
             DLKDHWAKHGTNRY T+K
Sbjct  319   DLKDHWAKHGTNRYITIK  336



>ref|XP_006435127.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 ref|XP_006435128.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 ref|XP_006435129.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 ref|XP_006435131.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 gb|ESR48367.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 gb|ESR48368.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 gb|ESR48369.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 gb|ESR48371.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
Length=335

 Score =   276 bits (705),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 158/317 (50%), Positives = 206/317 (65%), Gaps = 33/317 (10%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M IMAERDAA+ ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERDNAI++
Sbjct  31    SMKQIMTIMAERDAALQERNLAISEKKAAIAERDMAFLQRDTAIAERNNAILERDNAIAS  90

Query  779   LKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTNDPFNV  931
             L+ RE+S+   ++ S  PG +      H+H+ QQ +H++  +S AAY   E  T D   V
Sbjct  91    LQYRENSLGG-NMSSCPPGCQISRGVKHMHHPQQHVHQLHHVSEAAYS-REMHTGDALPV  148

Query  932   TDPTPQTANNPRKVRQPKESK---PKKASKLArvvkreeveveDLS---------WQAVS  1075
             + P    A  PR+ ++ KE K   P K  K A+  ++ + E EDL+         W++V 
Sbjct  149   S-PGASEAAKPRRYKRAKEPKVLSPNK--KTAKSPRKVKRENEDLNKVVFGKPSEWKSVQ  205

Query  1076  TFDDWDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
               D  DD       D + +      D   +  GL QV  D S MP P CSCTG  + CYK
Sbjct  206   DLDGGDD-------DVNKQSTASKSDWKGQVLGLNQVTFDESTMPPPACSCTGVLRQCYK  258

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQSACCTT++SMYPLP   +KR++RVGGRKMS SAF+KLL+RL AEG+DLS P+D
Sbjct  259   WGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEGHDLSHPVD  318

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LKDHWAKHGTNRY T+K
Sbjct  319   LKDHWAKHGTNRYITIK  335



>ref|XP_008387967.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Malus domestica]
Length=340

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 152/318 (48%), Positives = 201/318 (63%), Gaps = 22/318 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
              N  +++  MAIM ERDAAI ERN+A  E+K ALAERDMA LQRDAAIAERN+A+ ERDN
Sbjct  27    HNQPSMKQIMAIMGERDAAIQERNLAFSEKKAALAERDMAFLQRDAAIAERNSAIMERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAE------------HIHYQQEMHEMISAAAYDPTENL  910
             AI+ L+ R++S+N  ++ S  PG +                       ++  +Y   +  
Sbjct  87    AIATLQYRDNSLNSGNVSSCPPGCQISRGVKHVHHTQQQQQHVHHMPHMNEPSYGSRDMH  146

Query  911   TNDPFNVTDP----TPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVST  1078
             T+D  ++T P     P  +  P++ R+PK  +P K  K ++  ++ + E EDL+      
Sbjct  147   TSD--SITMPPDASVPTKSRQPKRPREPKTVQPNK--KPSKSPRKVKRESEDLNKMTFDK  202

Query  1079  FDDWDDG-NCGEFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCY  1252
               DW  G + G   D  +++       W  +D GL QV  D S MP P+CSCTG  + CY
Sbjct  203   LHDWKGGQDMGSGGDDLNKQVVVSKSDWKRQDLGLNQVAYDESTMPAPMCSCTGLLRQCY  262

Query  1253  KWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPL  1432
             KWGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+
Sbjct  263   KWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNPV  322

Query  1433  DLKDHWAKHGTNRYSTVK  1486
             DLKDHWAKHGTNRY T+K
Sbjct  323   DLKDHWAKHGTNRYITIK  340



>emb|CDP07428.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   275 bits (702),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 154/311 (50%), Positives = 198/311 (64%), Gaps = 11/311 (4%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERDAAI ERN+AL E+K ALAERDMA+LQRD+AIAERN A+ ERDN
Sbjct  22    QHQPSMKQIMAIMAERDAAIQERNLALSEKKAALAERDMAILQRDSAIAERNNAIMERDN  81

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAY-----DPTENLTNDPFNV  931
             AI+ L+ RE+S+N  ++    PG +     + MH       +     +P     + P + 
Sbjct  82    AIATLQYRENSINSGNMSPCPPGCQITRGVKHMHHPQQHVHHQPQVNEPPYGSRDMPISD  141

Query  932   TDPTPQTANNPRKVRQPKESKPKKA----SKLArvvkreeveveDLSWQAVSTFDDWDDG  1099
               P       P K R+ K +K  KA     K ++  K+ + E EDL+        +W  G
Sbjct  142   AIPISPGVLEPAKSRRTKRTKDPKAVTSTKKASKSSKKVKREGEDLNKTMFGKSHEWKPG  201

Query  1100  N-CGEFVDASDEEQDKHLDTW-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGW  1273
                G   D  + +       W D+D GL QV  D S MPVPVCSCTG  +PCYKWGNGGW
Sbjct  202   QEVGSGTDDLNRQLGVSKPDWKDQDLGLNQVAFDESTMPVPVCSCTGVLRPCYKWGNGGW  261

Query  1274  QSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWA  1453
             QS+CCTT +SMYPLP   +KR++R+GGRKMS SAF+KLLSRL AEG+DLS P+DLK+HWA
Sbjct  262   QSSCCTTNLSMYPLPAVPNKRHARIGGRKMSGSAFNKLLSRLAAEGHDLSNPVDLKEHWA  321

Query  1454  KHGTNRYSTVK  1486
             KHGTNRY T+K
Sbjct  322   KHGTNRYITIK  332



>ref|XP_009337671.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Pyrus x bretschneideri]
 ref|XP_009337672.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Pyrus x bretschneideri]
 ref|XP_009337673.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Pyrus x bretschneideri]
Length=339

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/315 (48%), Positives = 198/315 (63%), Gaps = 17/315 (5%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
              N  +++  MAIM+ERDAAI ERN+A  E+K ALAERDMA LQRDAAIAERN+A+ ERD+
Sbjct  27    HNQPSMKQVMAIMSERDAAIQERNLAFSEKKAALAERDMAFLQRDAAIAERNSAIMERDS  86

Query  767   AISALKLRESSMNDEDIVSKSPGAE-----------HIHYQQEMHEMISAAAYDPTENLT  913
             AI+ L  R++S+N  +  S  PG +                      ++   Y   +  T
Sbjct  87    AIATLHYRDNSLNSGNGSSCPPGCQISRGVKHMHHMQQQQHVHHMPHMNEPTYGTRDMHT  146

Query  914   NDPFNVTDPT--PQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDD  1087
             +D   +   T  P  +  P++ R+PK ++P K  K ++  ++ + E EDL+        D
Sbjct  147   SDSITMPPETSVPTKSRQPKRPREPKTTQPNK--KPSKSPRKMKRESEDLNKMTFDKLHD  204

Query  1088  WDDGN--CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWG  1261
             W  G    GE  D + +      D   +D GL QV  D S MP P+CSCT   + CYKWG
Sbjct  205   WKGGQDMGGEGDDLNKQVVVSKSDWKGQDLGLNQVAYDESTMPAPMCSCTSLLRQCYKWG  264

Query  1262  NGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLK  1441
             NGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRLTAEG+DLS+P+DLK
Sbjct  265   NGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLTAEGHDLSSPVDLK  324

Query  1442  DHWAKHGTNRYSTVK  1486
             DHWAKHGTNRY T+K
Sbjct  325   DHWAKHGTNRYITIK  339



>gb|KDO84771.1| hypothetical protein CISIN_1g018368mg [Citrus sinensis]
 gb|KDO84772.1| hypothetical protein CISIN_1g018368mg [Citrus sinensis]
Length=335

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 158/317 (50%), Positives = 205/317 (65%), Gaps = 33/317 (10%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M IMAERDAA+ ERN+A  E+K A+AERDMA LQRD AIAERN A+ ERDNAI++
Sbjct  31    SMKQIMTIMAERDAALQERNLATSEKKAAIAERDMAFLQRDTAIAERNNAILERDNAIAS  90

Query  779   LKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTNDPFNV  931
             L+ RE+S+   ++ S  PG +      H+H+ QQ +H++  +S AAY   E  T D   V
Sbjct  91    LQYRENSLGG-NMSSCPPGCQISRGVKHMHHPQQHVHQLHHVSEAAYS-REMHTGDALPV  148

Query  932   TDPTPQTANNPRKVRQPKESK---PKKASKLArvvkreeveveDLS---------WQAVS  1075
             + P    A  PR+ ++ KE K   P K  K A+  ++ + E EDL+         W++V 
Sbjct  149   S-PGASEAAKPRRYKRAKEPKVLSPNK--KTAKSPRKVKRENEDLNKVVFGKPSEWKSVQ  205

Query  1076  TFDDWDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
               D  DD       D + +      D   +  GL QV  D S MP P CSCTG  + CYK
Sbjct  206   DLDGGDD-------DVNKQSTASKSDWKGQVLGLNQVTFDESTMPPPACSCTGVLRQCYK  258

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQSACCTT++SMYPLP   +KR++RVGGRKMS SAF+KLL+RL AEG+DLS P+D
Sbjct  259   WGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEGHDLSHPVD  318

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LKDHWAKHGTNRY T+K
Sbjct  319   LKDHWAKHGTNRYITIK  335



>ref|XP_002306908.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 ref|XP_006383735.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 ref|XP_006383736.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 ref|XP_006383737.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 gb|EEE93904.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 gb|ERP61532.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 gb|ERP61533.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
 gb|ERP61534.1| hypothetical protein POPTR_0005s25720g [Populus trichocarpa]
Length=335

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 150/313 (48%), Positives = 193/313 (62%), Gaps = 17/313 (5%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q   +++  MAIMAERDAAI ERNMAL E+K A+AERDMA LQRD+AIAERN AL ERDN
Sbjct  27    QPQPSMKQIMAIMAERDAAIHERNMALSEKKAAVAERDMAFLQRDSAIAERNNALLERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAEH--------IHYQQEMHEMISAAAYDPTENLTNDP  922
             AI+ L+ RE+S    +  S  PG  +           Q      ++  AY   E  T+D 
Sbjct  87    AIATLQYRENSFASANTSSSPPGYHNSRGVKHMHHQQQHIHLPHMNEGAYGTREMQTSDA  146

Query  923   FNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGN  1102
               ++ P    A  PR+ ++PK+++   ++K       +     +         ++W +G 
Sbjct  147   VPIS-PVASEAAKPRRGKRPKDTQSTPSNKKTSKSPMKVKRESEDLNNMFGKSNEWKNG-  204

Query  1103  CGEFVDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNG  1267
               E ++   +  +K L     D   +D GL QV  D + MP PVCSCTG  + CYKWGNG
Sbjct  205   --EDMNGGGDGLNKQLAASKSDWKGQDLGLNQVAFDETTMPAPVCSCTGFFRQCYKWGNG  262

Query  1268  GWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDH  1447
             GWQS+CCTT +SMYPLP   +KR++RVGGRKMS SAFSKLLSRL AEG DLS P+DLKDH
Sbjct  263   GWQSSCCTTALSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEGQDLSNPVDLKDH  322

Query  1448  WAKHGTNRYSTVK  1486
             WAKHGTNRY T+K
Sbjct  323   WAKHGTNRYITIK  335



>ref|XP_006435130.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
 gb|ESR48370.1| hypothetical protein CICLE_v10001400mg [Citrus clementina]
Length=395

 Score =   276 bits (705),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 158/317 (50%), Positives = 206/317 (65%), Gaps = 33/317 (10%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M IMAERDAA+ ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERDNAI++
Sbjct  91    SMKQIMTIMAERDAALQERNLAISEKKAAIAERDMAFLQRDTAIAERNNAILERDNAIAS  150

Query  779   LKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTNDPFNV  931
             L+ RE+S+   ++ S  PG +      H+H+ QQ +H++  +S AAY   E  T D   V
Sbjct  151   LQYRENSLGG-NMSSCPPGCQISRGVKHMHHPQQHVHQLHHVSEAAYS-REMHTGDALPV  208

Query  932   TDPTPQTANNPRKVRQPKESK---PKKASKLArvvkreeveveDLS---------WQAVS  1075
             + P    A  PR+ ++ KE K   P K  K A+  ++ + E EDL+         W++V 
Sbjct  209   S-PGASEAAKPRRYKRAKEPKVLSPNK--KTAKSPRKVKRENEDLNKVVFGKPSEWKSVQ  265

Query  1076  TFDDWDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
               D  DD       D + +      D   +  GL QV  D S MP P CSCTG  + CYK
Sbjct  266   DLDGGDD-------DVNKQSTASKSDWKGQVLGLNQVTFDESTMPPPACSCTGVLRQCYK  318

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQSACCTT++SMYPLP   +KR++RVGGRKMS SAF+KLL+RL AEG+DLS P+D
Sbjct  319   WGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEGHDLSHPVD  378

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LKDHWAKHGTNRY T+K
Sbjct  379   LKDHWAKHGTNRYITIK  395



>ref|XP_008444782.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Cucumis melo]
Length=338

 Score =   273 bits (698),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 157/317 (50%), Positives = 205/317 (65%), Gaps = 22/317 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERDAAI ERN+AL E+K ALAERDMA LQRDAAIAERN AL ERDN
Sbjct  27    QHQPSMKQIMAIMAERDAAIQERNLALSEKKAALAERDMAYLQRDAAIAERNNALLERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPG---AEHIHYQQEMHEMISAAAYDPTENLTN--DPFNV  931
             AI+ L+ RE+S+N+   +S  PG   A  + +     +  +       EN  N  D    
Sbjct  87    AIATLQYRENSINNN--LSCPPGCQIARGVKHIHHPQQQHTHHVPHMNENNYNSRDMLAS  144

Query  932   TDPTPQT--ANNPRKVRQPKESKPKKA-----SKLArvvkreeveveDLSWQAVSTFDDW  1090
              DP P +  A+   K R+ K +K  K       K+++  ++ + E EDL+   +    +W
Sbjct  145   NDPCPTSPVASESTKARRNKRTKEGKTVTTPNKKVSKGPRKVKREAEDLNKIMLGKSQEW  204

Query  1091  DDGNCGEFVDASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
              DG     + +  ++ +K L     D   +D GL QV  D S MP P+CSCTG  + CYK
Sbjct  205   KDG---IGIMSGGDDLNKQLVVSKSDWKGQDLGLNQVAFDESTMPAPICSCTGVIRQCYK  261

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQSACCTTT+SMYPLP   +KR++R+GGRKMS SAF+KLLSRL AEG+DLS+P+D
Sbjct  262   WGNGGWQSACCTTTLSMYPLPAVPNKRHARLGGRKMSGSAFNKLLSRLAAEGHDLSSPVD  321

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LK+HWAKHGTNRY T+K
Sbjct  322   LKNHWAKHGTNRYITIK  338



>gb|KDO84770.1| hypothetical protein CISIN_1g018368mg [Citrus sinensis]
Length=357

 Score =   274 bits (700),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 158/317 (50%), Positives = 205/317 (65%), Gaps = 33/317 (10%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M IMAERDAA+ ERN+A  E+K A+AERDMA LQRD AIAERN A+ ERDNAI++
Sbjct  53    SMKQIMTIMAERDAALQERNLATSEKKAAIAERDMAFLQRDTAIAERNNAILERDNAIAS  112

Query  779   LKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTNDPFNV  931
             L+ RE+S+   ++ S  PG +      H+H+ QQ +H++  +S AAY   E  T D   V
Sbjct  113   LQYRENSLGG-NMSSCPPGCQISRGVKHMHHPQQHVHQLHHVSEAAYS-REMHTGDALPV  170

Query  932   TDPTPQTANNPRKVRQPKESK---PKKASKLArvvkreeveveDLS---------WQAVS  1075
             + P    A  PR+ ++ KE K   P K  K A+  ++ + E EDL+         W++V 
Sbjct  171   S-PGASEAAKPRRYKRAKEPKVLSPNK--KTAKSPRKVKRENEDLNKVVFGKPSEWKSVQ  227

Query  1076  TFDDWDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
               D  DD       D + +      D   +  GL QV  D S MP P CSCTG  + CYK
Sbjct  228   DLDGGDD-------DVNKQSTASKSDWKGQVLGLNQVTFDESTMPPPACSCTGVLRQCYK  280

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQSACCTT++SMYPLP   +KR++RVGGRKMS SAF+KLL+RL AEG+DLS P+D
Sbjct  281   WGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEGHDLSHPVD  340

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LKDHWAKHGTNRY T+K
Sbjct  341   LKDHWAKHGTNRYITIK  357



>ref|XP_006473611.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Citrus 
sinensis]
 ref|XP_006473612.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X3 [Citrus 
sinensis]
Length=335

 Score =   273 bits (698),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 157/317 (50%), Positives = 205/317 (65%), Gaps = 33/317 (10%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M IMAERDAA+ ERN+A  E+K A+AERDMA LQRD AIAERN A+ ERDNAI++
Sbjct  31    SMKQIMTIMAERDAALQERNLATSEKKAAIAERDMAFLQRDTAIAERNNAILERDNAIAS  90

Query  779   LKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTNDPFNV  931
             L+ RE+S+   ++ S  PG +      H+H+ QQ +H++  +S AAY   E  T D   V
Sbjct  91    LQYRENSLGG-NMSSCPPGCQISRGVKHMHHPQQHVHQLHLVSEAAYS-REMHTGDALPV  148

Query  932   TDPTPQTANNPRKVRQPKESK---PKKASKLArvvkreeveveDLS---------WQAVS  1075
             + P    A  PR+ ++ KE K   P K  K A+  ++ + E EDL+         W++V 
Sbjct  149   S-PGASEAAKPRRYKRAKEPKVLSPNK--KTAKSPRKVKRENEDLNKVVFGKPSEWKSVQ  205

Query  1076  TFDDWDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
               D  DD       D + +      D   +  GL QV  + S MP P CSCTG  + CYK
Sbjct  206   DLDGGDD-------DVNKQSTASKSDWKGQVLGLNQVTFEESTMPPPACSCTGVLRQCYK  258

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQSACCTT++SMYPLP   +KR++RVGGRKMS SAF+KLL+RL AEG+DLS P+D
Sbjct  259   WGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEGHDLSHPVD  318

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LKDHWAKHGTNRY T+K
Sbjct  319   LKDHWAKHGTNRYITIK  335



>ref|XP_009803495.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803496.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803498.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803499.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803500.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803501.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803502.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803503.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803504.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803505.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803506.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
 ref|XP_009803507.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana sylvestris]
Length=333

 Score =   273 bits (697),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 153/317 (48%), Positives = 203/317 (64%), Gaps = 22/317 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIM ERDAAI ERN+AL E++ ALAERDMA+LQRD+AIAERN+A+ ERDN
Sbjct  22    QHQPSMKQIMAIMGERDAAIQERNLALSEKRAALAERDMAILQRDSAIAERNSAIMERDN  81

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD---  937
             AI+ L+ RE+SMN  ++    PG +  H  + MH       + P   L    FN +D   
Sbjct  82    AIATLQYRENSMNSGNMSPCPPGCQIAHEVKHMHHPQLHVHHQP--QLGEPTFNHSDMHM  139

Query  938   -----PTPQTANNPRKVRQPKESKPKKA----SKLArvvkreeveveDLSWQAVSTFDDW  1090
                  P    A    K R+ K SK  KA     + ++  K+ + E EDL+   +    +W
Sbjct  140   SESSIPLSPAAPELTKSRRNKRSKEAKAVTSSKRTSKPSKKVKKEGEDLNKTMLDESQEW  199

Query  1091  DDGNCGEFVDASDEEQDKHLDT----W-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
                N  + +   +++ ++ L      W D+  GL QV+ D S MPVPVCSCTG  +P YK
Sbjct  200   ---NGAQEMGGGNDDVNRQLGVTKTDWKDQGRGLNQVSFDESTMPVPVCSCTGDLRPSYK  256

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQS+CCT  +SMYPLP   +KR++R+GGRKMS SAF+KLLSRL AEG+DLS P+D
Sbjct  257   WGNGGWQSSCCTNNLSMYPLPMLPNKRHARIGGRKMSGSAFTKLLSRLAAEGHDLSNPVD  316

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LKD+WAKHGTNRY T+K
Sbjct  317   LKDNWAKHGTNRYITIK  333



>ref|XP_009335373.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Pyrus x bretschneideri]
 ref|XP_009350033.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Pyrus x bretschneideri]
Length=340

 Score =   273 bits (698),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 201/318 (63%), Gaps = 22/318 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
              N  +++  MAIM ERDAAI ERN+A  E+K ALAERDMA LQRDAAIAERN+A+ ERD+
Sbjct  27    HNQPSMKQIMAIMGERDAAIQERNLAFSEKKAALAERDMAFLQRDAAIAERNSAIMERDS  86

Query  767   AISALKLRESSMNDEDIVSKSPGAE------------HIHYQQEMHEMISAAAYDPTENL  910
             AI+ L+ R++S+N  ++ S  PG +                       ++  +Y   +  
Sbjct  87    AIATLQYRDNSLNSGNVSSCPPGCQISRGVKHVHHTQQQQQHVHHMPHMNEPSYGSRDMH  146

Query  911   TNDPFNVTDP----TPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVST  1078
             T+D  ++T P     P  +  P++ R+PK  +P K  K ++  ++ + E EDL+      
Sbjct  147   TSD--SITMPPDASVPTKSRQPKRPREPKTVQPNK--KPSKSPRKVKRESEDLNKMTFDK  202

Query  1079  FDDWDDG-NCGEFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCY  1252
               DW  G + G   D  +++       W  +D GL QV  D S MP P+CSCTG  + CY
Sbjct  203   LHDWKGGQDMGSGGDDLNKQVVVSKSDWKCQDLGLNQVAYDESTMPAPMCSCTGLLRQCY  262

Query  1253  KWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPL  1432
             KWGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+
Sbjct  263   KWGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNPV  322

Query  1433  DLKDHWAKHGTNRYSTVK  1486
             DLKDHWAKHGTNRY T+K
Sbjct  323   DLKDHWAKHGTNRYITIK  340



>ref|XP_007017722.1| Basic pentacysteine 6 [Theobroma cacao]
 gb|EOY14947.1| Basic pentacysteine 6 [Theobroma cacao]
Length=336

 Score =   273 bits (697),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 157/308 (51%), Positives = 206/308 (67%), Gaps = 13/308 (4%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  MAIMAERDAAI ERN+AL E+K A+AERDMA LQRDAAIAERN+A+ ERDNAI+ 
Sbjct  30    SMKQIMAIMAERDAAIQERNLALSEKKAAIAERDMAFLQRDAAIAERNSAIAERDNAIAN  89

Query  779   LKLRESSMNDEDIVSKSPGAE------HI-HYQQEMHEM--ISAAAYDPTENLTNDPFNV  931
             L+ RE+S+   ++ S  PG +      H+ H QQ +H +  I+ A Y+  E  ++D   V
Sbjct  90    LQYRENSLATGNMPSCPPGCQISRGVKHMQHPQQNVHHLPHINEAPYNSREMHSSDTLPV  149

Query  932   TDPTPQTANNPRKVRQPKESKPKKASKLArv-vkreeveveDLSWQAVSTFDDWDDGNCG  1108
             T  T ++A + ++ ++ KE+K   +SK A   +K+ + E EDL+        +W  G   
Sbjct  150   TPGTSESAKS-KQGKRGKEAKVIASSKKAPKPLKKVKRENEDLNKIMFGKSHEWKGGQDA  208

Query  1109  EFVDASDEEQ--DKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                     +Q      D   +D GL QV  D S M  PVCSCTG  + CYKWGNGGWQS+
Sbjct  209   GGGGDDLNKQLVATKSDWKGQDLGLNQVVFDDSTMAPPVCSCTGVLRQCYKWGNGGWQSS  268

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+SMYPLP   +KR++R+GGRKMS SAF+KLLSRL AEG+DLS P+DLKDHWAKHG
Sbjct  269   CCTTTLSMYPLPAVPNKRHTRIGGRKMSGSAFNKLLSRLAAEGHDLSNPVDLKDHWAKHG  328

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  329   TNRYITIK  336



>gb|ADV59385.1| GAGA-binding transcriptional activator [Nicotiana tabacum]
Length=333

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 204/317 (64%), Gaps = 22/317 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIM ERDAAI ERN+AL E++ ALAERDMA+LQRD+AIAERN+A+ ERDN
Sbjct  22    QHQPSMKQIMAIMGERDAAIQERNLALSEKRAALAERDMAILQRDSAIAERNSAIMERDN  81

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD---  937
             AI+ L+ RE+SMN  ++    PG +  H  + MH       + P   L    FN +D   
Sbjct  82    AIATLQYRENSMNSGNMSPCPPGCQIAHEVKHMHHPQLHVHHQP--QLGEPTFNHSDMHM  139

Query  938   --------PTPQTANNPRKVRQPKESKPKKASK-LArvvkreeveveDLSWQAVSTFDDW  1090
                     P        R+ ++ KE+K   +SK  ++  K+ + E EDL+   +    +W
Sbjct  140   SESSIPLSPAAPELTKSRRNKRSKEAKEVTSSKRTSKPSKKVKKEGEDLNKTMLDESQEW  199

Query  1091  DDGNCGEFVDASDEEQDKHLDT----W-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
                N  + +   +++ ++ L      W D+  GL QV+ D S MPVPVCSCTG  +P YK
Sbjct  200   ---NGAQEMGGGNDDVNRQLGVTKTDWKDQGRGLNQVSFDESTMPVPVCSCTGDLRPSYK  256

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQS+CCT  +SMYPLP   +KR++R+GGRKMS SAF+KLLSRL AEG+DLS P+D
Sbjct  257   WGNGGWQSSCCTNNLSMYPLPMLPNKRHARIGGRKMSGSAFTKLLSRLAAEGHDLSNPVD  316

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LKD+WAKHGTNRY T+K
Sbjct  317   LKDNWAKHGTNRYITIK  333



>ref|XP_004291398.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Fragaria vesca 
subsp. vesca]
Length=380

 Score =   273 bits (698),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/314 (51%), Positives = 208/314 (66%), Gaps = 24/314 (8%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  MA+MAERDAAI ERN+A  E+K ALAERDMA LQRDAAIAERN A+ ERDNAI+ 
Sbjct  73    SMKQIMALMAERDAAIQERNLAFSEKKAALAERDMAFLQRDAAIAERNNAIMERDNAIAT  132

Query  779   LKLRE-SSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTNDPFN  928
             L+ RE SS+   ++ S  PG +      H+H  QQ +H +  ++ A+Y   E  TND   
Sbjct  133   LQYRENSSLTSGNLSSCPPGCQISRGIKHMHNPQQHVHHLPHMNEASYGTREMHTNDSLP  192

Query  929   VTDPTPQTANNPRKVRQPKESK---PKKASKLArvvkreeveveDLSWQAVSTFDDWDDG  1099
             +    P    + R+ ++PKE K   P K  K A+  ++ + E EDL+     TFD   + 
Sbjct  193   LPPDPPPAPKS-RQTKRPKEPKTIPPIK--KPAKSPRKVKRESEDLN---KMTFDRLHEW  246

Query  1100  NCGEFVDASDEEQDKHLDT----WD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGN  1264
               G+ +    E+ +K L      W  +D GL QV  D S MP PVCSCTG  + CYKWGN
Sbjct  247   KGGQEMCVGAEDLNKQLGVSKSDWKCQDLGLNQVAYDDSTMPAPVCSCTGVLRQCYKWGN  306

Query  1265  GGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKD  1444
             GGWQS+CCTTT+S+YPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+DLKD
Sbjct  307   GGWQSSCCTTTMSIYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNPVDLKD  366

Query  1445  HWAKHGTNRYSTVK  1486
             +WAKHGTNRY T+K
Sbjct  367   NWAKHGTNRYITIK  380



>ref|XP_010271440.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Nelumbo 
nucifera]
Length=321

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 164/321 (51%), Positives = 202/321 (63%), Gaps = 33/321 (10%)
 Frame = +2

Query  581   KDQNNSTIRT-YMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             K+ +  T++   MAI AERDAAI ERNMA  E+K ALAERDMA LQRDAAIAERN A+ E
Sbjct  15    KEHHALTVKQQIMAIAAERDAAIQERNMAFSEKKVALAERDMAFLQRDAAIAERNNAIIE  74

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEMISAAAYDPTENLTN  916
             RDNAI+AL+ RES+MN     +  PG E      HIH+ +   H      A   + N++ 
Sbjct  75    RDNAIAALEYRESAMNGSGTPTCPPGCEVPRGMKHIHHPKHGYHPPHLGEAPHHSRNISE  134

Query  917   D-PFNVTDPTPQTANN--PRKVRQP-KESKP---KKASK-LArvvkreeveveDLSWQA-  1069
               P +     P  A N  P +V+ P KESK    KK+SK   +  K+ +   EDL+  A 
Sbjct  135   AFPISAAAAAPVEAFNFNPHRVKAPTKESKAVLFKKSSKWTTKSSKKGKKGGEDLNKHAS  194

Query  1070  --VSTFDDWDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQ  1243
               V+   DW  G   E+                ++ GL QV+ D S MP PVCSCTG  +
Sbjct  195   VAVAKSHDWKSGPESEWKG--------------QELGLNQVSFDESTMPPPVCSCTGVQK  240

Query  1244  PCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLS  1423
              CYKWGNGGWQSACCTTT+SMYPLP   +KR+ RVGGRKMS SAF+KLLSRL A+G+DLS
Sbjct  241   QCYKWGNGGWQSACCTTTLSMYPLPVMPNKRHVRVGGRKMSGSAFNKLLSRLAAQGHDLS  300

Query  1424  APLDLKDHWAKHGTNRYSTVK  1486
              P+DLKDHWAKHGTN+Y T+K
Sbjct  301   TPIDLKDHWAKHGTNQYITIK  321



>ref|XP_006473610.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Citrus 
sinensis]
Length=357

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 157/317 (50%), Positives = 205/317 (65%), Gaps = 33/317 (10%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M IMAERDAA+ ERN+A  E+K A+AERDMA LQRD AIAERN A+ ERDNAI++
Sbjct  53    SMKQIMTIMAERDAALQERNLATSEKKAAIAERDMAFLQRDTAIAERNNAILERDNAIAS  112

Query  779   LKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTNDPFNV  931
             L+ RE+S+   ++ S  PG +      H+H+ QQ +H++  +S AAY   E  T D   V
Sbjct  113   LQYRENSLGG-NMSSCPPGCQISRGVKHMHHPQQHVHQLHLVSEAAYS-REMHTGDALPV  170

Query  932   TDPTPQTANNPRKVRQPKESK---PKKASKLArvvkreeveveDLS---------WQAVS  1075
             + P    A  PR+ ++ KE K   P K  K A+  ++ + E EDL+         W++V 
Sbjct  171   S-PGASEAAKPRRYKRAKEPKVLSPNK--KTAKSPRKVKRENEDLNKVVFGKPSEWKSVQ  227

Query  1076  TFDDWDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
               D  DD       D + +      D   +  GL QV  + S MP P CSCTG  + CYK
Sbjct  228   DLDGGDD-------DVNKQSTASKSDWKGQVLGLNQVTFEESTMPPPACSCTGVLRQCYK  280

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQSACCTT++SMYPLP   +KR++RVGGRKMS SAF+KLL+RL AEG+DLS P+D
Sbjct  281   WGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEGHDLSHPVD  340

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LKDHWAKHGTNRY T+K
Sbjct  341   LKDHWAKHGTNRYITIK  357



>ref|XP_010271438.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271439.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Nelumbo 
nucifera]
Length=322

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 164/321 (51%), Positives = 202/321 (63%), Gaps = 33/321 (10%)
 Frame = +2

Query  581   KDQNNSTIRT-YMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             K+ +  T++   MAI AERDAAI ERNMA  E+K ALAERDMA LQRDAAIAERN A+ E
Sbjct  16    KEHHALTVKQQIMAIAAERDAAIQERNMAFSEKKVALAERDMAFLQRDAAIAERNNAIIE  75

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEMISAAAYDPTENLTN  916
             RDNAI+AL+ RES+MN     +  PG E      HIH+ +   H      A   + N++ 
Sbjct  76    RDNAIAALEYRESAMNGSGTPTCPPGCEVPRGMKHIHHPKHGYHPPHLGEAPHHSRNISE  135

Query  917   D-PFNVTDPTPQTANN--PRKVRQP-KESKP---KKASK-LArvvkreeveveDLSWQA-  1069
               P +     P  A N  P +V+ P KESK    KK+SK   +  K+ +   EDL+  A 
Sbjct  136   AFPISAAAAAPVEAFNFNPHRVKAPTKESKAVLFKKSSKWTTKSSKKGKKGGEDLNKHAS  195

Query  1070  --VSTFDDWDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQ  1243
               V+   DW  G   E+                ++ GL QV+ D S MP PVCSCTG  +
Sbjct  196   VAVAKSHDWKSGPESEWKG--------------QELGLNQVSFDESTMPPPVCSCTGVQK  241

Query  1244  PCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLS  1423
              CYKWGNGGWQSACCTTT+SMYPLP   +KR+ RVGGRKMS SAF+KLLSRL A+G+DLS
Sbjct  242   QCYKWGNGGWQSACCTTTLSMYPLPVMPNKRHVRVGGRKMSGSAFNKLLSRLAAQGHDLS  301

Query  1424  APLDLKDHWAKHGTNRYSTVK  1486
              P+DLKDHWAKHGTN+Y T+K
Sbjct  302   TPIDLKDHWAKHGTNQYITIK  322



>ref|XP_009598116.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598120.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598126.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598131.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598139.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598144.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598150.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598160.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598169.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598173.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
 ref|XP_009598182.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Nicotiana tomentosiformis]
Length=332

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 205/314 (65%), Gaps = 17/314 (5%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERDAAI ERN+AL E++  LAERDMA+LQRD+AIAERN+A+ ERDN
Sbjct  22    QHQPSMKQIMAIMAERDAAIQERNLALSEKRATLAERDMAILQRDSAIAERNSAIMERDN  81

Query  767   AISALKLRESSMNDEDIVSKSPGAE-----HIHYQQEMHEMISAAAYDPTENLTNDPFNV  931
             AI+ L+ +E+SMN  ++    PG +        +  + H        +PT N ++   N 
Sbjct  82    AIATLQYQENSMNSGNMSPCPPGCQIARELKHMHHPQQHVHHQPQLGEPTFNHSDMHMNE  141

Query  932   TDPTPQTANNPRKVRQPKESKPKK----ASKLArvvkreeveveDLSWQAVSTFDDWDDG  1099
             +      A  P K R+ K SK  K    + K ++  K+ + E EDL+   +    +W   
Sbjct  142   SSIQSPAAPEPTKSRRNKRSKEAKLVTSSKKTSKPSKKVKKEGEDLNKSMLDESQEW---  198

Query  1100  NCGEFVDASDEEQDKHLDT----W-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGN  1264
             N  + +   +++ ++ L      W D+D GL QV+ D S MPVPVCSCTG  +PCYKWGN
Sbjct  199   NGAQEMGGGNDDVNRQLGVTKTDWKDQDLGLNQVSFDESTMPVPVCSCTGVLRPCYKWGN  258

Query  1265  GGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKD  1444
             GGWQS+CCT  +SMYPLP   +KR++R+GGRKMS SAF+KLLSRL AEGYDLS P+DLKD
Sbjct  259   GGWQSSCCTNNLSMYPLPTLPNKRHARIGGRKMSGSAFTKLLSRLAAEGYDLSNPVDLKD  318

Query  1445  HWAKHGTNRYSTVK  1486
             +WAKHGTNRY T+K
Sbjct  319   NWAKHGTNRYITIK  332



>ref|XP_010105257.1| hypothetical protein L484_019400 [Morus notabilis]
 gb|EXC04192.1| hypothetical protein L484_019400 [Morus notabilis]
Length=337

 Score =   271 bits (692),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 211/317 (67%), Gaps = 23/317 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MA+MAERDAAI ERN+AL E+K ALAERDMA LQRDAAIAERN A+ ERDN
Sbjct  27    QHQPSMKQIMALMAERDAAIQERNLALAEKKAALAERDMAFLQRDAAIAERNNAIMERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAE------HIHY-QQEMHEM--ISAAAYDPTENLTND  919
             A++ L+ RE+S+++ ++ S  PG +      H+H+ Q   H M  ++  +Y   E  T D
Sbjct  87    AVATLQYRENSLSNGNMSSCPPGCQISRGVKHMHHPQTHAHHMQHVNEGSYATREMNTTD  146

Query  920   PFNVTDPTPQTANNPRKVRQPKESKP----KKASKLArvvkreeveveDLSWQAVSTFDD  1087
                ++ P    A   R+ ++ KE+KP    KKASK     ++ + E EDL+  A     +
Sbjct  147   SLPIS-PDASDAAKSRRGKRMKEAKPVSPNKKASK---PPRKLKRESEDLNKMAFGKAQE  202

Query  1088  WDDGNCGEFVDASDEEQDKHL----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYK  1255
             W  G     V  SD+   + +    D   +D GL QV+ D S MP PVC+CTG  + CYK
Sbjct  203   WKSGQ--GMVGGSDDFNKQLVVSKSDWKGQDLGLNQVSYDESTMPAPVCTCTGVIRQCYK  260

Query  1256  WGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLD  1435
             WGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+D
Sbjct  261   WGNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNPVD  320

Query  1436  LKDHWAKHGTNRYSTVK  1486
             LKDHWAKHGTNRY T+K
Sbjct  321   LKDHWAKHGTNRYITIK  337



>ref|XP_010263912.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263913.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263915.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263916.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263917.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263918.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263919.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263920.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263921.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263922.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263923.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
 ref|XP_010263924.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Nelumbo nucifera]
Length=329

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 157/308 (51%), Positives = 201/308 (65%), Gaps = 21/308 (7%)
 Frame = +2

Query  602   IRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISAL  781
             ++  MA+MAERDAAI ERN+AL E+K ALAERDMA LQRDAAIAERN AL ERDNAI+AL
Sbjct  30    MKQVMALMAERDAAIQERNVALAEKKAALAERDMAFLQRDAAIAERNNALMERDNAIAAL  89

Query  782   KLRESSMNDEDIVSKSPG------AEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPT  943
             + RE++++   + +  PG       +H+H+   + E    A Y   +    + + ++   
Sbjct  90    EYRENALSGSGVPTCPPGCGVPRGTKHVHHLTHLTE----APYHARDMHITEAYPLSS-A  144

Query  944   PQTANNPRKV-RQPKESKPKKASKLArvvkreeveveDLS-WQAVSTFDDWDDGNCGEFV  1117
             P  A+ PR+  R  KESK     +  +   + +   EDL+    V+   DW     G+  
Sbjct  145   PAEAHKPRRAKRTKKESKAVPLKRSQQPSSKGKKGGEDLNKLVTVAKLHDW---RSGQDA  201

Query  1118  DASDEEQDKHL-----DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
             + S E+  K L     D   +D GL QVN D S MPVPVCSCTG  Q CYKWGNGGWQSA
Sbjct  202   NGSGEDLKKQLAVSKPDWKGQDLGLNQVNFDESTMPVPVCSCTGVLQQCYKWGNGGWQSA  261

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLP   +KR++R+GGRKMS SAF+KLLSRL A+G+DLS P+DLKDHWAKHG
Sbjct  262   CCTTTLSSYPLPVMPNKRHARIGGRKMSGSAFTKLLSRLAAQGHDLSTPVDLKDHWAKHG  321

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  322   TNRYVTIK  329



>ref|XP_002301996.2| hypothetical protein POPTR_0002s02820g [Populus trichocarpa]
 gb|EEE81269.2| hypothetical protein POPTR_0002s02820g [Populus trichocarpa]
Length=336

 Score =   265 bits (677),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 190/312 (61%), Gaps = 14/312 (4%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q   +++  MAIMAERDAAI ERNMAL E+K A+AERDMA LQRD+AIAERN AL ERDN
Sbjct  27    QPQPSMKQIMAIMAERDAAIHERNMALSEKKAAIAERDMAFLQRDSAIAERNNALLERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAEH----------IHYQQEMHEMISAAAYDPTENLTN  916
             AI+ L+ RE+S+   ++ +  PG  +                    ++   Y   E  T+
Sbjct  87    AIATLQYRENSLPSGNMTTCPPGFHNSRGVKHMHHQQQQHTHHLPHMNEGPYGTREMQTS  146

Query  917   DPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDD  1096
             D   V+ P       P++ ++PK++K   ++K      R+     D +        +W +
Sbjct  147   DALPVS-PVASEVAKPQRGKRPKDAKATPSNKKTSKSPRKVKRESDDT-DMFGKSHEWKN  204

Query  1097  GNCGEFVDASDEEQ--DKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGG  1270
             G   +       +Q      D   +D GL QV  D + MP PVCSCTG  + CYKWGNGG
Sbjct  205   GQDMDGGGDDPNKQLAASKSDWKGQDLGLNQVAFDETTMPAPVCSCTGVFRQCYKWGNGG  264

Query  1271  WQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHW  1450
             WQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAFSKLLSRL AEG DLS P+DLKDHW
Sbjct  265   WQSSCCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEGQDLSNPVDLKDHW  324

Query  1451  AKHGTNRYSTVK  1486
             AKHGTNRY T+K
Sbjct  325   AKHGTNRYITIK  336



>ref|XP_011028963.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Populus euphratica]
 ref|XP_011028964.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Populus euphratica]
Length=336

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 190/312 (61%), Gaps = 14/312 (4%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q   +++  M IMAERDAAI ERNMAL E+K A+AERDMA LQRD+AIAERN AL ERDN
Sbjct  27    QPQPSMKQIMGIMAERDAAIHERNMALSEKKAAIAERDMAYLQRDSAIAERNNALLERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAEH----------IHYQQEMHEMISAAAYDPTENLTN  916
             AI+ L+ RE+S+   +I +  PG  +                    ++   Y   E  T+
Sbjct  87    AIATLQYRENSLPSGNITTCPPGFNNSRGVKHMHHQQQQHAHHLPHMNEGPYGTREMQTS  146

Query  917   DPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDD  1096
             D   V+ P       P++ ++PK++K   ++K      R+     + +        +W +
Sbjct  147   DAVPVS-PVASEVAKPQRGKRPKDAKATPSNKKTSKSPRKVKRESEDT-NMFGKSHEWKN  204

Query  1097  GNCGEFVDASDEEQ--DKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGG  1270
             G   +       +Q      D   +D GL QV  D + MP PVCSCTG  + CYKWGNGG
Sbjct  205   GQDMDGGGDDPNKQLAASKSDWKGQDLGLNQVAFDETTMPAPVCSCTGVFRQCYKWGNGG  264

Query  1271  WQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHW  1450
             WQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAFSKLLSRL AEG DLS P+DLKDHW
Sbjct  265   WQSSCCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLEAEGQDLSNPVDLKDHW  324

Query  1451  AKHGTNRYSTVK  1486
             AKHGTNRY+T+K
Sbjct  325   AKHGTNRYTTIK  336



>gb|ADV59345.1| GAGA-binding transcriptional activator [Populus trichocarpa]
 gb|ADV59346.1| GAGA-binding transcriptional activator [Populus trichocarpa]
Length=336

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 189/312 (61%), Gaps = 14/312 (4%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q   +++  MAIMAERDAAI ERNMAL E+K A+ ERDMA LQRD+AIAERN AL ERDN
Sbjct  27    QPQPSMKQIMAIMAERDAAIHERNMALSEKKAAITERDMAFLQRDSAIAERNNALLERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAEH----------IHYQQEMHEMISAAAYDPTENLTN  916
             AI+ L+ RE+S+   ++ +  PG  +                    ++   Y   E  T+
Sbjct  87    AIATLQYRENSLPSGNMTTCPPGFHNSRGVKHMHHQQQQHTHHLPHMNEGPYGTREMQTS  146

Query  917   DPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDD  1096
             D   V+ P       P++ ++PK++K   ++K      R+     D +        +W +
Sbjct  147   DALPVS-PVASEVAKPQRGKRPKDAKATPSNKKTSKSPRKVKRESDDT-DMFGKSHEWKN  204

Query  1097  GNCGEFVDASDEEQ--DKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGG  1270
             G   +       +Q      D   +D GL QV  D + MP PVCSCTG  + CYKWGNGG
Sbjct  205   GQDMDGGGDDPNKQLAASKSDWKGQDLGLNQVAFDETTMPAPVCSCTGVFRQCYKWGNGG  264

Query  1271  WQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHW  1450
             WQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAFSKLLSRL AEG DLS P+DLKDHW
Sbjct  265   WQSSCCTTTLSMYPLPAVPNKRHARVGGRKMSGSAFSKLLSRLAAEGQDLSNPVDLKDHW  324

Query  1451  AKHGTNRYSTVK  1486
             AKHGTNRY T+K
Sbjct  325   AKHGTNRYITIK  336



>gb|ADV59370.1| GAGA-binding transcriptional activator [Cichorium intybus]
Length=329

 Score =   262 bits (670),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 205/323 (63%), Gaps = 38/323 (12%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q   +++  M IMAERDAAI ERN+A+ E+K ALAERDMA+LQRD+AIAERNTA+ ERDN
Sbjct  22    QRQPSMKQIMTIMAERDAAIQERNLAISEKKAALAERDMALLQRDSAIAERNTAIMERDN  81

Query  767   AISALKLRESSMNDEDIVSKS--------PGAE------HIHYQQ---EMHEMISAAAYD  895
             AI+ L+ RE+SMN+ +  + S        PG +      H+H+ Q   + H+M       
Sbjct  82    AITTLQYRENSMNNNNNSNNSNNTPAPCPPGCQISRTVKHVHHPQAYLQHHDMGGIGDSI  141

Query  896   PTENLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS  1075
             P             PTP+  +  R+V++ KE+KP  A K +R  K+ ++E + L+     
Sbjct  142   PA-----------SPTPEPKSQSRRVKRVKETKPA-AKKTSRTSKKVKMECDGLN---KG  186

Query  1076  TFDDWDDGNCGEFVDASDEEQDKHLDT-----W-DEDFGLEQVNSDVSAMPVPVCSCTGT  1237
              F++  D N               L+      W D+D GL  +  D + MP+PVCSCTG 
Sbjct  187   MFEEPHDWNKSGDDSGVGGGGVDDLNRGVKPEWKDQDLGLNHIAFDETTMPIPVCSCTGV  246

Query  1238  PQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYD  1417
              +PCYKWGNGGWQS+CCTTT+SM+PLP   +KR++RVGGRKMS S F+KL+SRL AEG+D
Sbjct  247   FRPCYKWGNGGWQSSCCTTTMSMHPLPSLPNKRHARVGGRKMSGSVFNKLISRLAAEGHD  306

Query  1418  LSAPLDLKDHWAKHGTNRYSTVK  1486
             LS P+DLK+HWAKHGTNRY T+K
Sbjct  307   LSNPVDLKEHWAKHGTNRYITIK  329



>ref|XP_008221307.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Prunus mume]
Length=331

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 199/316 (63%), Gaps = 27/316 (9%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERDAA+ ERN+A  E+K AL ERDMA       IAERN+A+ ERDN
Sbjct  27    QHQPSMKQIMAIMAERDAALQERNLAFSEKKAALHERDMAF------IAERNSAIMERDN  80

Query  767   AISALKLRESSMNDEDIVSKSPGAE---------HIHYQQEMHEMISAAAYDPTENLTND  919
             AI+ L+ RE+S+N+ ++ S  PG +         H          ++ A+Y   +  T+D
Sbjct  81    AIATLQYRENSLNNGNVSSCPPGCQISRGVKHMHHPQQHVHHPPHMNEASYGTRDMHTSD  140

Query  920   --PFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWD  1093
               P       P  +  P++ R+PK + P K  K ++  ++ + E EDL+     TFD   
Sbjct  141   SVPMPPDASLPTKSRQPKRPREPKTTAPNK--KTSKSPRKVKRESEDLN---KMTFDKLH  195

Query  1094  DGNCGEFVDASDEEQDKHL----DTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKW  1258
             +    + +    ++ +KHL      W  +D GL QV  D S MP PVCSCTG  + CYKW
Sbjct  196   EWKGSQDMGGGGDDVNKHLVVSKSDWKCQDLGLNQVAYDESTMPAPVCSCTGILRQCYKW  255

Query  1259  GNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDL  1438
             GNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+DL
Sbjct  256   GNGGWQSSCCTTTMSMYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNPVDL  315

Query  1439  KDHWAKHGTNRYSTVK  1486
             KD+WAKHGTNRY T+K
Sbjct  316   KDNWAKHGTNRYITIK  331



>gb|ADV59376.1| GAGA-binding transcriptional activator [Triphysaria pusilla]
Length=279

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 141/306 (46%), Positives = 178/306 (58%), Gaps = 62/306 (20%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M+IMAERDAAI ERN+AL E+K ALAERDMA+LQRD+AI +RN A+ ERDNA + 
Sbjct  26    SMKHIMSIMAERDAAIQERNLALSEKKTALAERDMAILQRDSAINDRNNAIMERDNAFTT  85

Query  779   LKLRESSMNDEDIVSKSPGAE------HIHYQQEMHEMISAAAYDPTENLTNDPFNVTDP  940
             L+ RE+S+N        PG +      HIH+  + H  I    +D  E         T P
Sbjct  86    LQYRETSINSNTPCP--PGCQIGRNVKHIHHPHQTHMSIDMQTFDDDE---------TKP  134

Query  941   TPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVD  1120
               QT    R     K  KP K  K                                    
Sbjct  135   VKQTRRPKRASNSKKGPKPLKKVK------------------------------------  158

Query  1121  ASDEEQDKHLDTW----DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACC  1288
                  Q+  L  W    D++ GL +V  D + MPVPVCSCTG  +PCYKWGNGGWQS+CC
Sbjct  159   -----QENELVAWKAEPDQELGLNRVAYDETMMPVPVCSCTGVMRPCYKWGNGGWQSSCC  213

Query  1289  TTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTN  1468
             TT +S+YPLP   +KR++RVGGRKMS SAF+KL++RL  EGYDLS+P+DLKD+WAKHGTN
Sbjct  214   TTNMSVYPLPAVPNKRHARVGGRKMSGSAFNKLINRLAEEGYDLSSPVDLKDNWAKHGTN  273

Query  1469  RYSTVK  1486
             RY T+K
Sbjct  274   RYITIK  279



>ref|XP_002513008.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49511.1| conserved hypothetical protein [Ricinus communis]
Length=314

 Score =   256 bits (654),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 150/307 (49%), Positives = 193/307 (63%), Gaps = 30/307 (10%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+ +N+ +  +  MAI+AERDAAI ERNMAL E+K AL  RD A+ QR+ A+AER+ AL 
Sbjct  33    KEPSNALVMNKKIMAILAERDAAIQERNMALAEKKEALVARDEALQQREKALAERDKALM  92

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHI-HYQQEMHEMISAAAYDPTENLTNDPFNV  931
             ERDNA++A++ RE++MN         G++ I H     +E+  A A D  E    D F +
Sbjct  93    ERDNALAAIQYRENAMNFPFGNGNQRGSKRIPHPVYNSNEV--AEALDGGEMHITDAFPI  150

Query  932   TDPTPQTANNPRKVRQPKESKP--KKASKLArvvkreeveveDLSWQAVSTFDDWDDGNC  1105
             T    ++   PR+ ++ KE+K    KA+K A+   +      DL+ Q  S      DG  
Sbjct  151   TTVAAESGK-PRQTKRSKENKSVSMKATKSAKKGNKVGE---DLNRQGPS------DGK-  199

Query  1106  GEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSAC  1285
                         K    WD   GL  VN D S MPVPVCSCTG P  CYKWGNGGWQS+C
Sbjct  200   ------------KFKVEWDGQDGLNLVNFDDSTMPVPVCSCTGVPHQCYKWGNGGWQSSC  247

Query  1286  CTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGT  1465
             CTTT+S YPLPQ  +KR++RVGGRKMS S F+KLLSRL +EG+DLS PLDLKD+WA+HGT
Sbjct  248   CTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLASEGHDLSLPLDLKDYWARHGT  307

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  308   NRYITIK  314



>ref|XP_008776335.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008776336.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008776337.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
Length=319

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 155/313 (50%), Positives = 196/313 (63%), Gaps = 31/313 (10%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKL-R  790
             MAIMAERD+AI ERN+A+ E+K ALAERDMA+LQRDAAIAERN A+ ERDNAI+AL+  R
Sbjct  16    MAIMAERDSAIHERNLAISEKKAALAERDMAILQRDAAIAERNNAIMERDNAIAALQYAR  75

Query  791   ESSMNDEDIVSKSPGA-------EHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTP-  946
             E+ MN       SPG        +H+ +     + +S A YD    +     +VT+  P 
Sbjct  76    ETGMNGNGGNGCSPGCTAPTKHHDHLPHVHPSPKQLSDAPYDHERQV-----DVTEAYPI  130

Query  947   ----QTANNPRKVRQPKESKPK---KASKLArvvkreeveveDLSWQ-AVSTF-DDWDDG  1099
                 ++A   +  R  KE+  +            K +    +DL+ Q +++ F  +W   
Sbjct  131   STAVESAKGSKVKRMRKENGVQAIPTKKSSKSPKKNKRSGNDDLNRQVSIAKFHGEWKGQ  190

Query  1100  NCGEFVDASDEEQ---DKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNG  1267
                +  D  D  +    KH   W  +D GL QV+ D S MPVPVCSCTG   PCYKWGNG
Sbjct  191   E--QVSDGGDVNKVPVTKH--QWKGQDLGLNQVSFDESTMPVPVCSCTGKFHPCYKWGNG  246

Query  1268  GWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDH  1447
             GWQS+CCTTT+SMYPLP   +KR++RVGGRKMS  AF KLLSRL AEG+DLS P+DLKDH
Sbjct  247   GWQSSCCTTTLSMYPLPVMPNKRHARVGGRKMSGGAFIKLLSRLAAEGHDLSTPVDLKDH  306

Query  1448  WAKHGTNRYSTVK  1486
             WAKHGTNRY T+K
Sbjct  307   WAKHGTNRYITIK  319



>ref|XP_010530298.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530299.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530300.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530301.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530302.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530303.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530304.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530305.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530309.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530310.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530311.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530312.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530313.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530315.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
 ref|XP_010530316.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Tarenaya hassleriana]
Length=332

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/318 (47%), Positives = 195/318 (61%), Gaps = 30/318 (9%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAI+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERDN
Sbjct  27    QHQPSMKQVMAIIAERDAAIQERNLAISEKKAAIAERDMAFLQRDTAIAERNNAIMERDN  86

Query  767   AISALKLRESSMNDEDIVSKS--PGAE------------HIHYQQEMHEMISAAAYDPTE  904
             A++AL+ RE+SM     +S S  PG +              H        +    Y   E
Sbjct  87    ALAALQYRENSMATAAGMSSSCPPGCQISRGVKHVHHPQQHHMHHHHMTQMGETTYGTRE  146

Query  905   NLTNDPFNVTDPTPQTANNPRKVRQPKESKP----KKASKLArvvkreeveveDLSWQAV  1072
                ND    +      +  P++ ++PKE K     KK SK  R +K+E  ++  + +  V
Sbjct  147   LEPNDTIPTSPAGAAESAKPKRGKRPKEPKATPSNKKGSKNQRKIKKESEDLNKIMF--V  204

Query  1073  STFDDWDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCY  1252
              T D  ++          DE      D   ++ GL QV  D + MP PVCSCTG  + CY
Sbjct  205   KTHDYANE----------DEVGGSKSDWKGQEMGLNQVVYDETTMPPPVCSCTGVLRQCY  254

Query  1253  KWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPL  1432
             KWGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG+DLS P+
Sbjct  255   KWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSNPV  314

Query  1433  DLKDHWAKHGTNRYSTVK  1486
             DLKDHWAKHGTNRY T++
Sbjct  315   DLKDHWAKHGTNRYITIR  332



>ref|XP_010908702.1| PREDICTED: barley B recombinant-like protein D isoform X3 [Elaeis 
guineensis]
 ref|XP_010908703.1| PREDICTED: barley B recombinant-like protein D isoform X3 [Elaeis 
guineensis]
 ref|XP_010908704.1| PREDICTED: barley B recombinant-like protein D isoform X3 [Elaeis 
guineensis]
Length=320

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/312 (48%), Positives = 194/312 (62%), Gaps = 28/312 (9%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKL-R  790
             MAIMAERD+AI ERN+A+ E+K ALAERDMA+LQRDAAI ERN A+  RDNAI+AL+  R
Sbjct  16    MAIMAERDSAIHERNLAISEKKAALAERDMAILQRDAAIMERNNAIMGRDNAIAALQCAR  75

Query  791   ESSMNDEDIVSKSPGA-------EHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQ  949
             E+ +N       SPG        +H+ +       +S A YD    +     ++T+  P 
Sbjct  76    ENGVNGNGGNGCSPGCTTLTKHHDHLPHVHPSPLQLSDAPYDHERQM-----HITEACPI  130

Query  950   TANNPRKVRQPKESKPKKASKL---------ArvvkreeveveDLSWQ-AVSTF-DDW-D  1093
             ++      ++ K  + +K + +             K +    +DLS Q ++S F  +W  
Sbjct  131   SSVVDSVSKRHKTKRMRKENGVQAMPTKKSSKSQKKSKRNGSDDLSKQVSISKFHGEWKG  190

Query  1094  DGNCGEFVDASDEEQDKHLDTW-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGG  1270
              G  G   D +     KH   W  +D GL QV+ D S MPVPVCSCTG   PCYKWGNGG
Sbjct  191   QGQVGSGGDLNKVSMPKH--QWKGQDLGLNQVSFDESTMPVPVCSCTGKFHPCYKWGNGG  248

Query  1271  WQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHW  1450
             WQS+CCTTT+S+YPLP   +KR++RVGGRKMS  AF KLLSRL AEG+DLS P+DLKDHW
Sbjct  249   WQSSCCTTTLSVYPLPVMPNKRHARVGGRKMSGGAFIKLLSRLAAEGHDLSMPVDLKDHW  308

Query  1451  AKHGTNRYSTVK  1486
             AKHGTNRY T+K
Sbjct  309   AKHGTNRYITIK  320



>gb|KDP27630.1| hypothetical protein JCGZ_19635 [Jatropha curcas]
Length=318

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/313 (47%), Positives = 189/313 (60%), Gaps = 40/313 (13%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  MAI+AERD AI ERNMA+ ER+ ALA RD A+ QR+ A+AER+ AL 
Sbjct  35    KEQSNALVMNKKIMAILAERDTAIKERNMAIAERREALAARDEALQQREKALAERDKALM  94

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDP---TENLTNDPF  925
             ERDNA++A++ RE+ MN         G++ I +            Y+P    E L     
Sbjct  95    ERDNALAAIQYRENGMNFPLSNGNQRGSKRIPH----------PLYNPNEVVEALNAGEM  144

Query  926   NVTDPTPQT---ANNPRKVRQPKESKPKKAS--KLArvvkreeveveDLSWQAVSTFDDW  1090
             ++TD  P T   A + ++ RQPK +K  KA   K  +  ++     EDL+ Q V      
Sbjct  145   HITDAFPLTTISAESLKQQRQPKRTKENKAVSMKATKSSRKGNKVGEDLNRQGVP-----  199

Query  1091  DDGNCGEFVDASDEEQDKHLDTWDEDFG-LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNG  1267
                           E  K    WD     L  VN D S MPVPVCSCTG P  CYKWGNG
Sbjct  200   --------------EAKKFKAQWDSHVAALNLVNFDESTMPVPVCSCTGVPHQCYKWGNG  245

Query  1268  GWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDH  1447
             GWQS+CCTTT+S YPLPQ  +KR++RVGGRKMS S F+KLLSRL + G+DLS PLDLKD+
Sbjct  246   GWQSSCCTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLASGGHDLSIPLDLKDY  305

Query  1448  WAKHGTNRYSTVK  1486
             WA+HGTNRY T+K
Sbjct  306   WARHGTNRYITIK  318



>ref|XP_007042011.1| GAGA-motif binding transcriptional activator isoform 3 [Theobroma 
cacao]
 gb|EOX97842.1| GAGA-motif binding transcriptional activator isoform 3 [Theobroma 
cacao]
Length=285

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 146/307 (48%), Positives = 192/307 (63%), Gaps = 34/307 (11%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+QNN+ +  +  M+I+AERDAAI ERN+A+ E+K ALA RD A+ QRD A+AER++AL 
Sbjct  8     KEQNNALVMNKKIMSILAERDAAIRERNIAISEKKEALAARDEALQQRDKALAERDSALM  67

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             +RDNA++ L+ RE++MN         G + +H         +  + D  E L N   +VT
Sbjct  68    DRDNALAVLQYRENAMNFPLGGGIQRGGKRMHP--------TYHSTDVGETL-NSEMHVT  118

Query  935   D--PTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCG  1108
             D  P    A    K R  K +K  KA   ++  ++ +   EDL+ QA +           
Sbjct  119   DALPVSTIACEEGKSRPVKRTKENKAVS-SKSARKVKKVAEDLNRQAGT-----------  166

Query  1109  EFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSAC  1285
                     E  K    W+ +D GL  VN D + MPVPVCSCTG P+ CYKWGNGGWQS+C
Sbjct  167   --------EVKKCKSEWNGQDIGLNMVNFDETTMPVPVCSCTGVPRQCYKWGNGGWQSSC  218

Query  1286  CTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGT  1465
             CTTT+S YPLPQ  +KR++RVGGRKMS S F+KLLSRL AEG DLS PLDLK++WA+HGT
Sbjct  219   CTTTMSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEGQDLSIPLDLKNYWARHGT  278

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  279   NRYITIK  285



>ref|XP_010539043.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539044.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Tarenaya 
hassleriana]
Length=345

 Score =   255 bits (652),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 151/329 (46%), Positives = 194/329 (59%), Gaps = 39/329 (12%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAI+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERDN
Sbjct  27    QHQPSMKQVMAIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAVMERDN  86

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAA----------------AYDP  898
             A+ AL+ RESSM     +S       I +  +                        AY  
Sbjct  87    ALVALQYRESSMVTTATMSSCTAGCQISHGVKHMHHPQQHHHMHHHHHHMTQMGENAYGS  146

Query  899   TENLTNDPFNVTDPTPQTANN--PRKVRQPKESKP-----KKASKLArvvkreeveveDL  1057
              E   ND    T PT  T  +  P++ ++PKE K      KK SK     ++ + E E+L
Sbjct  147   RELEPNDAL-PTSPTGGTMESAKPKRGKRPKEPKTTTSAIKKGSK---NQRKIKKESEEL  202

Query  1058  SWQAVSTFDDWDDGNCGEFVDASDEEQDKHL------DTWDEDFGLEQVNSDVSAMPVPV  1219
                 +             + +  +EE  KH+      D   ++ GL QV  D + MP PV
Sbjct  203   DLDKIMILKTQ------HYQNNDEEEAGKHIGLGSKSDWKGQEMGLNQVVYDETTMPPPV  256

Query  1220  CSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRL  1399
             CSCTG  + CYKWGNGGWQS+CCTTT+SM+PLP   +KR++RVGGRKMS S F+KLLSRL
Sbjct  257   CSCTGVLRQCYKWGNGGWQSSCCTTTLSMHPLPALPNKRHARVGGRKMSGSVFNKLLSRL  316

Query  1400  TAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
              AEG+DLS P+DLKDHWAKHGTNRY T+K
Sbjct  317   AAEGHDLSNPVDLKDHWAKHGTNRYITIK  345



>ref|XP_010908697.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Elaeis 
guineensis]
 ref|XP_010908698.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Elaeis 
guineensis]
 ref|XP_010908699.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Elaeis 
guineensis]
Length=327

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 151/312 (48%), Positives = 194/312 (62%), Gaps = 28/312 (9%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKL-R  790
             MAIMAERD+AI ERN+A+ E+K ALAERDMA+LQRDAAI ERN A+  RDNAI+AL+  R
Sbjct  23    MAIMAERDSAIHERNLAISEKKAALAERDMAILQRDAAIMERNNAIMGRDNAIAALQCAR  82

Query  791   ESSMNDEDIVSKSPGA-------EHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQ  949
             E+ +N       SPG        +H+ +       +S A YD    +     ++T+  P 
Sbjct  83    ENGVNGNGGNGCSPGCTTLTKHHDHLPHVHPSPLQLSDAPYDHERQM-----HITEACPI  137

Query  950   TANNPRKVRQPKESKPKKASKL---------ArvvkreeveveDLSWQ-AVSTF-DDW-D  1093
             ++      ++ K  + +K + +             K +    +DLS Q ++S F  +W  
Sbjct  138   SSVVDSVSKRHKTKRMRKENGVQAMPTKKSSKSQKKSKRNGSDDLSKQVSISKFHGEWKG  197

Query  1094  DGNCGEFVDASDEEQDKHLDTW-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGG  1270
              G  G   D +     KH   W  +D GL QV+ D S MPVPVCSCTG   PCYKWGNGG
Sbjct  198   QGQVGSGGDLNKVSMPKH--QWKGQDLGLNQVSFDESTMPVPVCSCTGKFHPCYKWGNGG  255

Query  1271  WQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHW  1450
             WQS+CCTTT+S+YPLP   +KR++RVGGRKMS  AF KLLSRL AEG+DLS P+DLKDHW
Sbjct  256   WQSSCCTTTLSVYPLPVMPNKRHARVGGRKMSGGAFIKLLSRLAAEGHDLSMPVDLKDHW  315

Query  1451  AKHGTNRYSTVK  1486
             AKHGTNRY T+K
Sbjct  316   AKHGTNRYITIK  327



>ref|XP_010908700.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Elaeis 
guineensis]
 ref|XP_010908701.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Elaeis 
guineensis]
Length=322

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 151/312 (48%), Positives = 194/312 (62%), Gaps = 28/312 (9%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKL-R  790
             MAIMAERD+AI ERN+A+ E+K ALAERDMA+LQRDAAI ERN A+  RDNAI+AL+  R
Sbjct  18    MAIMAERDSAIHERNLAISEKKAALAERDMAILQRDAAIMERNNAIMGRDNAIAALQCAR  77

Query  791   ESSMNDEDIVSKSPGA-------EHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQ  949
             E+ +N       SPG        +H+ +       +S A YD    +     ++T+  P 
Sbjct  78    ENGVNGNGGNGCSPGCTTLTKHHDHLPHVHPSPLQLSDAPYDHERQM-----HITEACPI  132

Query  950   TANNPRKVRQPKESKPKKASKL---------ArvvkreeveveDLSWQ-AVSTF-DDW-D  1093
             ++      ++ K  + +K + +             K +    +DLS Q ++S F  +W  
Sbjct  133   SSVVDSVSKRHKTKRMRKENGVQAMPTKKSSKSQKKSKRNGSDDLSKQVSISKFHGEWKG  192

Query  1094  DGNCGEFVDASDEEQDKHLDTW-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGG  1270
              G  G   D +     KH   W  +D GL QV+ D S MPVPVCSCTG   PCYKWGNGG
Sbjct  193   QGQVGSGGDLNKVSMPKH--QWKGQDLGLNQVSFDESTMPVPVCSCTGKFHPCYKWGNGG  250

Query  1271  WQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHW  1450
             WQS+CCTTT+S+YPLP   +KR++RVGGRKMS  AF KLLSRL AEG+DLS P+DLKDHW
Sbjct  251   WQSSCCTTTLSVYPLPVMPNKRHARVGGRKMSGGAFIKLLSRLAAEGHDLSMPVDLKDHW  310

Query  1451  AKHGTNRYSTVK  1486
             AKHGTNRY T+K
Sbjct  311   AKHGTNRYITIK  322



>ref|XP_008776328.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776329.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776330.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776331.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776332.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776333.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776334.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
Length=343

 Score =   255 bits (651),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 155/313 (50%), Positives = 196/313 (63%), Gaps = 31/313 (10%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKL-R  790
             MAIMAERD+AI ERN+A+ E+K ALAERDMA+LQRDAAIAERN A+ ERDNAI+AL+  R
Sbjct  40    MAIMAERDSAIHERNLAISEKKAALAERDMAILQRDAAIAERNNAIMERDNAIAALQYAR  99

Query  791   ESSMNDEDIVSKSPGA-------EHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTP-  946
             E+ MN       SPG        +H+ +     + +S A YD    +     +VT+  P 
Sbjct  100   ETGMNGNGGNGCSPGCTAPTKHHDHLPHVHPSPKQLSDAPYDHERQV-----DVTEAYPI  154

Query  947   ----QTANNPRKVRQPKESKPK---KASKLArvvkreeveveDLSWQ-AVSTFD-DWDDG  1099
                 ++A   +  R  KE+  +            K +    +DL+ Q +++ F  +W   
Sbjct  155   STAVESAKGSKVKRMRKENGVQAIPTKKSSKSPKKNKRSGNDDLNRQVSIAKFHGEWKGQ  214

Query  1100  NCGEFVDASDEEQ---DKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNG  1267
                +  D  D  +    KH   W  +D GL QV+ D S MPVPVCSCTG   PCYKWGNG
Sbjct  215   E--QVSDGGDVNKVPVTKH--QWKGQDLGLNQVSFDESTMPVPVCSCTGKFHPCYKWGNG  270

Query  1268  GWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDH  1447
             GWQS+CCTTT+SMYPLP   +KR++RVGGRKMS  AF KLLSRL AEG+DLS P+DLKDH
Sbjct  271   GWQSSCCTTTLSMYPLPVMPNKRHARVGGRKMSGGAFIKLLSRLAAEGHDLSTPVDLKDH  330

Query  1448  WAKHGTNRYSTVK  1486
             WAKHGTNRY T+K
Sbjct  331   WAKHGTNRYITIK  343



>ref|XP_009389696.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389702.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389709.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389715.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=346

 Score =   255 bits (651),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 192/319 (60%), Gaps = 23/319 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             + N TI+    +MAER+ A+ ER+MA+ E+K AL ERDMA LQRDAA+AERN+A+ ERDN
Sbjct  32    KENQTIKL---LMAEREKALQERDMAITEKKAALVERDMAYLQRDAAVAERNSAIIERDN  88

Query  767   AISALKL-RESSMNDEDIVS---KSPGAEHIHY------------QQEMHEMISAAAYD-  895
             AI AL+  RE+ M+          S G +HI+             QQ++H+  S    + 
Sbjct  89    AIGALEYARENGMSGNCATGCHLGSHGTKHIYNHQQQHLQHIHSPQQQLHDAPSKQTRET  148

Query  896   PTENLTNDPF-NVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAV  1072
             PT   + D   +VT      A   RK  +   S  KK  K  R  K+   +  +      
Sbjct  149   PTNEASPDSGGSVTGTKFNKAKRSRKESKVLASSSKKMMKAPRRSKKGGSDDLNKQVTIA  208

Query  1073  STFDDWDDGNCGEFVDASDE-EQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPC  1249
              T  +W  G  G   D + +    KH +   +D GL QV+ D + MPVPVCSCTG  Q C
Sbjct  209   RTTGEWR-GEIGVGEDLNKQVSLTKHHEWKSQDLGLNQVSFDDTTMPVPVCSCTGKYQQC  267

Query  1250  YKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAP  1429
             YKWGNGGWQSACCTTT+SMYPLP    KR++RV GRKMS SAF KLLSRL AEGYDLS P
Sbjct  268   YKWGNGGWQSACCTTTLSMYPLPVIPSKRHARVAGRKMSGSAFRKLLSRLAAEGYDLSLP  327

Query  1430  LDLKDHWAKHGTNRYSTVK  1486
             +DLKDHWAKHGTNRY T+K
Sbjct  328   VDLKDHWAKHGTNRYITIK  346



>ref|XP_010539045.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Tarenaya 
hassleriana]
Length=314

 Score =   254 bits (648),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 150/324 (46%), Positives = 191/324 (59%), Gaps = 39/324 (12%)
 Frame = +2

Query  602   IRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISAL  781
             ++  MAI+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERDNA+ AL
Sbjct  1     MKQVMAIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAVMERDNALVAL  60

Query  782   KLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAA----------------AYDPTENLT  913
             + RESSM     +S       I +  +                        AY   E   
Sbjct  61    QYRESSMVTTATMSSCTAGCQISHGVKHMHHPQQHHHMHHHHHHMTQMGENAYGSRELEP  120

Query  914   NDPFNVTDPTPQTANN--PRKVRQPKESKP-----KKASKLArvvkreeveveDLSWQAV  1072
             ND    T PT  T  +  P++ ++PKE K      KK SK     ++ + E E+L    +
Sbjct  121   NDAL-PTSPTGGTMESAKPKRGKRPKEPKTTTSAIKKGSK---NQRKIKKESEELDLDKI  176

Query  1073  STFDDWDDGNCGEFVDASDEEQDKHL------DTWDEDFGLEQVNSDVSAMPVPVCSCTG  1234
                          + +  +EE  KH+      D   ++ GL QV  D + MP PVCSCTG
Sbjct  177   MILKTQ------HYQNNDEEEAGKHIGLGSKSDWKGQEMGLNQVVYDETTMPPPVCSCTG  230

Query  1235  TPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGY  1414
               + CYKWGNGGWQS+CCTTT+SM+PLP   +KR++RVGGRKMS S F+KLLSRL AEG+
Sbjct  231   VLRQCYKWGNGGWQSSCCTTTLSMHPLPALPNKRHARVGGRKMSGSVFNKLLSRLAAEGH  290

Query  1415  DLSAPLDLKDHWAKHGTNRYSTVK  1486
             DLS P+DLKDHWAKHGTNRY T+K
Sbjct  291   DLSNPVDLKDHWAKHGTNRYITIK  314



>ref|XP_008236825.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Prunus mume]
Length=329

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 188/295 (64%), Gaps = 26/295 (9%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+AERDAAI ERN AL E+  ALA RD A+ QRD A+A+R+TA+ ERDNA +AL 
Sbjct  60    KKIMSIIAERDAAIRERNAALSEKNEALAARDEALRQRDEALAQRDTAMMERDNAFAALH  119

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
             +R++++N         GA+ +H+       ++ A Y   +    D F ++  + + A   
Sbjct  120   MRDNAVNFPLGGGVQRGAKRLHHPSNHSVTLAEAHYSTKDMHITDAFPISVISAE-AVKS  178

Query  965   RKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQDK  1144
             R+ ++ KE+K  +ASK        +   EDL+ QA S      DG              K
Sbjct  179   RQTKRAKENKASRASK-----PSRKKVGEDLNRQASS------DG-------------IK  214

Query  1145  HLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQ  1321
             +   WD  D GL  V+ D S MPVPVCSCTG P+ CYKWGNGGWQS+CCTT +SMYPLPQ
Sbjct  215   YKSEWDTHDLGLNLVSFDESTMPVPVCSCTGVPRQCYKWGNGGWQSSCCTTHMSMYPLPQ  274

Query  1322  ASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
               +KR++R+GGRKMS S F++LLSRL A+G+DLS PLDLK++WA+HGTNRY T+K
Sbjct  275   MPNKRHARMGGRKMSGSVFTRLLSRLAADGHDLSIPLDLKEYWARHGTNRYITIK  329



>ref|XP_009389670.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389675.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389682.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009389688.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=367

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 192/319 (60%), Gaps = 23/319 (7%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             + N TI+    +MAER+ A+ ER+MA+ E+K AL ERDMA LQRDAA+AERN+A+ ERDN
Sbjct  53    KENQTIKL---LMAEREKALQERDMAITEKKAALVERDMAYLQRDAAVAERNSAIIERDN  109

Query  767   AISALKL-RESSMNDEDIVS---KSPGAEHIHY------------QQEMHEMISAAAYD-  895
             AI AL+  RE+ M+          S G +HI+             QQ++H+  S    + 
Sbjct  110   AIGALEYARENGMSGNCATGCHLGSHGTKHIYNHQQQHLQHIHSPQQQLHDAPSKQTRET  169

Query  896   PTENLTNDPF-NVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAV  1072
             PT   + D   +VT      A   RK  +   S  KK  K  R  K+   +  +      
Sbjct  170   PTNEASPDSGGSVTGTKFNKAKRSRKESKVLASSSKKMMKAPRRSKKGGSDDLNKQVTIA  229

Query  1073  STFDDWDDGNCGEFVDASDE-EQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPC  1249
              T  +W  G  G   D + +    KH +   +D GL QV+ D + MPVPVCSCTG  Q C
Sbjct  230   RTTGEWR-GEIGVGEDLNKQVSLTKHHEWKSQDLGLNQVSFDDTTMPVPVCSCTGKYQQC  288

Query  1250  YKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAP  1429
             YKWGNGGWQSACCTTT+SMYPLP    KR++RV GRKMS SAF KLLSRL AEGYDLS P
Sbjct  289   YKWGNGGWQSACCTTTLSMYPLPVIPSKRHARVAGRKMSGSAFRKLLSRLAAEGYDLSLP  348

Query  1430  LDLKDHWAKHGTNRYSTVK  1486
             +DLKDHWAKHGTNRY T+K
Sbjct  349   VDLKDHWAKHGTNRYITIK  367



>ref|XP_008236826.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X2 [Prunus mume]
Length=311

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/295 (47%), Positives = 188/295 (64%), Gaps = 26/295 (9%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+AERDAAI ERN AL E+  ALA RD A+ QRD A+A+R+TA+ ERDNA +AL 
Sbjct  42    KKIMSIIAERDAAIRERNAALSEKNEALAARDEALRQRDEALAQRDTAMMERDNAFAALH  101

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
             +R++++N         GA+ +H+       ++ A Y   +    D F ++  + +   + 
Sbjct  102   MRDNAVNFPLGGGVQRGAKRLHHPSNHSVTLAEAHYSTKDMHITDAFPISVISAEAVKS-  160

Query  965   RKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQDK  1144
             R+ ++ KE+K  +ASK        +   EDL+ QA S      DG              K
Sbjct  161   RQTKRAKENKASRASK-----PSRKKVGEDLNRQASS------DG-------------IK  196

Query  1145  HLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQ  1321
             +   WD  D GL  V+ D S MPVPVCSCTG P+ CYKWGNGGWQS+CCTT +SMYPLPQ
Sbjct  197   YKSEWDTHDLGLNLVSFDESTMPVPVCSCTGVPRQCYKWGNGGWQSSCCTTHMSMYPLPQ  256

Query  1322  ASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
               +KR++R+GGRKMS S F++LLSRL A+G+DLS PLDLK++WA+HGTNRY T+K
Sbjct  257   MPNKRHARMGGRKMSGSVFTRLLSRLAADGHDLSIPLDLKEYWARHGTNRYITIK  311



>ref|XP_007042009.1| GAGA-motif binding transcriptional activator isoform 1 [Theobroma 
cacao]
 ref|XP_007042010.1| GAGA-motif binding transcriptional activator isoform 1 [Theobroma 
cacao]
 ref|XP_007042012.1| GAGA-motif binding transcriptional activator isoform 1 [Theobroma 
cacao]
 gb|EOX97840.1| GAGA-motif binding transcriptional activator isoform 1 [Theobroma 
cacao]
 gb|EOX97841.1| GAGA-motif binding transcriptional activator isoform 1 [Theobroma 
cacao]
 gb|EOX97843.1| GAGA-motif binding transcriptional activator isoform 1 [Theobroma 
cacao]
Length=310

 Score =   253 bits (646),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 146/307 (48%), Positives = 192/307 (63%), Gaps = 34/307 (11%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+QNN+ +  +  M+I+AERDAAI ERN+A+ E+K ALA RD A+ QRD A+AER++AL 
Sbjct  33    KEQNNALVMNKKIMSILAERDAAIRERNIAISEKKEALAARDEALQQRDKALAERDSALM  92

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             +RDNA++ L+ RE++MN         G + +H         +  + D  E L N   +VT
Sbjct  93    DRDNALAVLQYRENAMNFPLGGGIQRGGKRMH--------PTYHSTDVGETL-NSEMHVT  143

Query  935   D--PTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCG  1108
             D  P    A    K R  K +K  KA   ++  ++ +   EDL+ QA +           
Sbjct  144   DALPVSTIACEEGKSRPVKRTKENKAVS-SKSARKVKKVAEDLNRQAGT-----------  191

Query  1109  EFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSAC  1285
                     E  K    W+ +D GL  VN D + MPVPVCSCTG P+ CYKWGNGGWQS+C
Sbjct  192   --------EVKKCKSEWNGQDIGLNMVNFDETTMPVPVCSCTGVPRQCYKWGNGGWQSSC  243

Query  1286  CTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGT  1465
             CTTT+S YPLPQ  +KR++RVGGRKMS S F+KLLSRL AEG DLS PLDLK++WA+HGT
Sbjct  244   CTTTMSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEGQDLSIPLDLKNYWARHGT  303

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  304   NRYITIK  310



>ref|XP_010645040.1| PREDICTED: GAGA-binding transcriptional activator BBR/BPC4-like 
isoform X2 [Vitis vinifera]
Length=282

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 146/306 (48%), Positives = 191/306 (62%), Gaps = 35/306 (11%)
 Frame = +2

Query  581   KDQNNSTI-RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             K+QN  T+ +  + I+AERD AI ERN+AL E+K AL ERD A++QRDAAI+ER+ AL E
Sbjct  8     KEQNALTMNKKVVNILAERDNAIRERNIALSEKKAALEERDEALMQRDAAISERDNALLE  67

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD  937
             RDNAI+AL+ RES      ++S   G + + +        +  +Y+  E       ++TD
Sbjct  68    RDNAIAALRYRES------VISIQRGTKRMDHPPNHAANGAEGSYNTRE------VHITD  115

Query  938   PTPQTANNPRKVRQPKESKPKKA--SKLArvvkreeveveDLSWQAVSTFDDWDDGNCGE  1111
               P +      V+  K +K  KA  SK  +  ++ +   EDL+ Q +S      DG    
Sbjct  116   AFPISTIAADSVKSRKRTKENKAVSSKGLKPPRKGKKVNEDLNRQVIS------DG----  165

Query  1112  FVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACC  1288
                       K    WD +D GL  V  D S MPVPVCSCTG P+ CYKWGNGGWQS+CC
Sbjct  166   ---------LKIKSEWDSQDLGLNLVTFDESTMPVPVCSCTGVPRQCYKWGNGGWQSSCC  216

Query  1289  TTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTN  1468
             TTT+S YPLPQ  +KR++R+GGRKMS S F++LLSRL AEG+DLS PLDLKD+WAKHGTN
Sbjct  217   TTTLSSYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAAEGHDLSMPLDLKDYWAKHGTN  276

Query  1469  RYSTVK  1486
             RY  +K
Sbjct  277   RYIIIK  282



>emb|CDY70566.1| BnaC06g42740D [Brassica napus]
Length=339

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 198/330 (60%), Gaps = 42/330 (13%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+I+AERDAAI ERN+A+ ERK A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  22    QHQPSMKQVMSIIAERDAAIQERNLAISERKSAVAERDMAFLQRDTAIAERNNAIMERDS  81

Query  767   AISALKLRESSMNDEDIVSK-----SPGAEHIHYQQEMHE----------MISAAAYDPT  901
             A+SAL+ RE+SM     VS       PG +     + +H            +S  AYD +
Sbjct  82    ALSALQYRENSMATPSAVSNMAAACPPGCQMPRGVKHIHHPQMHHQHHMLQLSDHAYDES  141

Query  902   ENLTNDPFNVTDPTPQTA-------NNPRKVRQPKESKPKKASKLArvvkreeveveDLS  1060
               +   P   T P P+TA          ++V+ PK +    A+K      R+  +  +  
Sbjct  142   REMDGLP---TSPPPETALDSAKPKRGGKRVKDPKATTKTTANKRGPKNPRKVKKENE--  196

Query  1061  WQAVSTFDDWDDGNCGEFVDASDEEQDKHLDT-----W--DEDFGLEQVNSDVSAMPVPV  1219
                    DD       + +D  +EE  K + T     W   E  GL QV  D + MP PV
Sbjct  197   -------DDLTKIMFVKTLDYGEEETSKLVLTGSKSDWKSQEMVGLNQVVYDETTMPPPV  249

Query  1220  CSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRL  1399
             CSCTG  + CYKWGNGGWQS+CCTTTISMYPLP   +KR++RVGGRKMS SAF+KLLSRL
Sbjct  250   CSCTGDLRQCYKWGNGGWQSSCCTTTISMYPLPALPNKRHARVGGRKMSGSAFNKLLSRL  309

Query  1400  TAEG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
              AEG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  310   AAEGHHDLSNPVDLKDHWAKHGTNRYITIK  339



>ref|XP_007201266.1| hypothetical protein PRUPE_ppa008471mg [Prunus persica]
 gb|EMJ02465.1| hypothetical protein PRUPE_ppa008471mg [Prunus persica]
Length=311

 Score =   253 bits (645),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/295 (47%), Positives = 188/295 (64%), Gaps = 26/295 (9%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+AERDAAI ERN AL E+  ALA RD A+ QRD A+A+R+TA+ ERDNA +AL 
Sbjct  42    KKIMSIIAERDAAIRERNAALTEKNEALAARDEALRQRDEALAQRDTAMMERDNAFAALH  101

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
             +R++++N         GA+ +H+       ++ A Y   +    D F ++  + +   + 
Sbjct  102   MRDNAVNFPLGGGVQRGAKRLHHPSNHSVTLAEAHYSTKDMHITDAFPISVISAEAVKS-  160

Query  965   RKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQDK  1144
             R+ ++ KE+K  +ASK        +   EDL+ QA S      DG              K
Sbjct  161   RQTKRAKENKASRASK-----PSRKKVGEDLNRQASS------DG-------------IK  196

Query  1145  HLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQ  1321
             +   WD  D GL  V+ D S MPVPVCSCTG P+ CYKWGNGGWQS+CCTT +SMYPLPQ
Sbjct  197   YKSEWDTHDLGLNLVSFDESTMPVPVCSCTGVPRQCYKWGNGGWQSSCCTTHMSMYPLPQ  256

Query  1322  ASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
               +KR++R+GGRKMS S F++LLSRL A+G+DLS PLDLK++WA+HGTNRY T+K
Sbjct  257   MPNKRHARMGGRKMSGSVFTRLLSRLAADGHDLSIPLDLKEYWARHGTNRYITIK  311



>ref|XP_007201267.1| hypothetical protein PRUPE_ppa008471mg [Prunus persica]
 gb|EMJ02466.1| hypothetical protein PRUPE_ppa008471mg [Prunus persica]
Length=330

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 188/295 (64%), Gaps = 26/295 (9%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+AERDAAI ERN AL E+  ALA RD A+ QRD A+A+R+TA+ ERDNA +AL 
Sbjct  61    KKIMSIIAERDAAIRERNAALTEKNEALAARDEALRQRDEALAQRDTAMMERDNAFAALH  120

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
             +R++++N         GA+ +H+       ++ A Y   +    D F ++  + + A   
Sbjct  121   MRDNAVNFPLGGGVQRGAKRLHHPSNHSVTLAEAHYSTKDMHITDAFPISVISAE-AVKS  179

Query  965   RKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQDK  1144
             R+ ++ KE+K  +ASK        +   EDL+ QA S      DG              K
Sbjct  180   RQTKRAKENKASRASK-----PSRKKVGEDLNRQASS------DG-------------IK  215

Query  1145  HLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQ  1321
             +   WD  D GL  V+ D S MPVPVCSCTG P+ CYKWGNGGWQS+CCTT +SMYPLPQ
Sbjct  216   YKSEWDTHDLGLNLVSFDESTMPVPVCSCTGVPRQCYKWGNGGWQSSCCTTHMSMYPLPQ  275

Query  1322  ASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
               +KR++R+GGRKMS S F++LLSRL A+G+DLS PLDLK++WA+HGTNRY T+K
Sbjct  276   MPNKRHARMGGRKMSGSVFTRLLSRLAADGHDLSIPLDLKEYWARHGTNRYITIK  330



>ref|XP_006402604.1| hypothetical protein EUTSA_v10006075mg [Eutrema salsugineum]
 gb|ESQ44057.1| hypothetical protein EUTSA_v10006075mg [Eutrema salsugineum]
Length=346

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 192/332 (58%), Gaps = 39/332 (12%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  22    QHQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAIMERDS  81

Query  767   AISALKLRESSMNDEDIVSKSPGA--------------------EHIHYQQEMHEMISAA  886
             A++AL+ RE+SM        + GA                     H    Q     +S  
Sbjct  82    ALTALQYRENSMATAAAAVANMGACPPGCQISRGVKHMHHPHMHHHQQQHQHHMPQLSEN  141

Query  887   AYDPTENLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQ  1066
             AY+  E  TND    + PT     + +  R  +   PK  +K A   +  +        Q
Sbjct  142   AYETREMETNDGLPTSPPTGSALESAKPKRGKRVKDPKATTKTAGNKRGPKN-------Q  194

Query  1067  AVSTFDDWDDGNCGEFV----DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMPV  1213
                  +  DD     FV    D  +EE  KH+       W   E  GL QV  D + MP 
Sbjct  195   RKVKKESEDDLTKIMFVKTSHDYGEEEASKHVLIGSKSDWKNQEMVGLNQVVYDETTMPP  254

Query  1214  PVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLS  1393
             PVCSCTG  + CYKWGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLS
Sbjct  255   PVCSCTGVLRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLS  314

Query  1394  RLTAEG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             RL AEG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  315   RLAAEGHHDLSNPVDLKDHWAKHGTNRYITIK  346



>ref|XP_006423509.1| hypothetical protein CICLE_v10028887mg [Citrus clementina]
 ref|XP_006423510.1| hypothetical protein CICLE_v10028887mg [Citrus clementina]
 ref|XP_006423511.1| hypothetical protein CICLE_v10028887mg [Citrus clementina]
 gb|ESR36749.1| hypothetical protein CICLE_v10028887mg [Citrus clementina]
 gb|ESR36750.1| hypothetical protein CICLE_v10028887mg [Citrus clementina]
 gb|ESR36751.1| hypothetical protein CICLE_v10028887mg [Citrus clementina]
Length=311

 Score =   252 bits (643),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 188/307 (61%), Gaps = 32/307 (10%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+ NN+ +  +  MAI+AERDAAI ERN+AL E++ AL  RD A+ +RD A+AER+ AL 
Sbjct  32    KEPNNALVMNKKIMAILAERDAAIRERNIALTEKREALETRDQALEERDKALAERDDALM  91

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
              RD+A++AL+ RE++ N   +     G + +H+        +  + D  E L +   + T
Sbjct  92    ARDSALAALQYREAAANFSSVGGFQRGGKRMHHP-------AYQSGDVPEALNSGDMHAT  144

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
             D  P T         P E+KP +A +        +  V     + V           GE 
Sbjct  145   DAKPITI-------IPSETKPHQAKRAKENKTVTKPSVSPRKVKKV-----------GED  186

Query  1115  VD---ASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSAC  1285
             ++   ASD ++ K    WD   GL  VN D + MPVPVC+CTGTP  CYKWGNGGWQS+C
Sbjct  187   LNKKVASDGKKIK--SEWDSQDGLNLVNFDETTMPVPVCTCTGTPHQCYKWGNGGWQSSC  244

Query  1286  CTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGT  1465
             CTTT+S YPLPQ  +KR++RVGGRKMS S F+KLLSRL AEG+DLS PLDLK+ WAKHGT
Sbjct  245   CTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEGHDLSVPLDLKNFWAKHGT  304

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  305   NRYITIK  311



>ref|XP_006487267.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Citrus sinensis]
 gb|KDO42318.1| hypothetical protein CISIN_1g021524mg [Citrus sinensis]
Length=311

 Score =   251 bits (642),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 188/307 (61%), Gaps = 32/307 (10%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+ NN+ +  +  MAI+AERDAAI ERN+AL E++ AL  RD A+ +RD A+AER+ AL 
Sbjct  32    KEPNNALVMNKKIMAILAERDAAIRERNIALTEKREALETRDQALEERDKALAERDDALM  91

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
              RD+A++AL+ RE++ N   +     G + +H+        +  + D  E L +   + T
Sbjct  92    ARDSALAALQYREAAANFSSVGGFQRGGKRMHHP-------TYQSGDVPEALNSGDMHAT  144

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
             D  P T         P E+KP +A +        +  V     + V           GE 
Sbjct  145   DAKPITI-------IPSETKPHQAKRAKENKIVTKPSVSPRKVKKV-----------GED  186

Query  1115  VD---ASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSAC  1285
             ++   ASD ++ K    WD   GL  VN D + MPVPVC+CTGTP  CYKWGNGGWQS+C
Sbjct  187   LNKKVASDGKKIK--SEWDSQDGLNLVNFDETTMPVPVCTCTGTPHQCYKWGNGGWQSSC  244

Query  1286  CTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGT  1465
             CTTT+S YPLPQ  +KR++RVGGRKMS S F+KLLSRL AEG+DLS PLDLK+ WAKHGT
Sbjct  245   CTTTLSSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEGHDLSVPLDLKNFWAKHGT  304

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  305   NRYITIK  311



>ref|XP_009398067.1| PREDICTED: barley B recombinant-like protein D [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398068.1| PREDICTED: barley B recombinant-like protein D [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398069.1| PREDICTED: barley B recombinant-like protein D [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398070.1| PREDICTED: barley B recombinant-like protein D [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398071.1| PREDICTED: barley B recombinant-like protein D [Musa acuminata 
subsp. malaccensis]
Length=345

 Score =   252 bits (644),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 153/320 (48%), Positives = 192/320 (60%), Gaps = 30/320 (9%)
 Frame = +2

Query  593   NSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAI  772
             N TI+    +MAER+ A+ ER+MA+ E+K ALAERD A LQRDAAIAERN A+ ERD+AI
Sbjct  34    NQTIKL---LMAEREKALQERDMAISEKKAALAERDTAYLQRDAAIAERNNAILERDDAI  90

Query  773   SALKL-RESSMNDEDIVSKSP---GAEHIH-YQQEMHEMISAAAYDPTENLTNDPFNVTD  937
             +AL+  RE+ M++      SP   G ++++ YQQ+  + I AA     + L + P N T 
Sbjct  91    AALEYARENCMSNNCAPGCSPAPCGTKNMYNYQQQHLQHIQAAP----QQLHDAPNNQTR  146

Query  938   PTPQT-----------------ANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQ  1066
              TP++                     RK  + + S  KK +K  R  K+      D    
Sbjct  147   ETPRSEAFHNSGGPETLGKLIKTKRSRKKTEVEASSSKKMTKFPRKSKKGGGNDWDKQVT  206

Query  1067  AVSTFDDWDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQP  1246
                    W  G  G   D +     KH +   +D GL QV  D S+MP PVCSCTG  Q 
Sbjct  207   IARAAGAWR-GEVGVGEDLNKVSSLKHHEWKSQDLGLNQVTFDDSSMPAPVCSCTGRYQQ  265

Query  1247  CYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSA  1426
             CYKWGNGGWQSACCT T+SMYPLP   +KR++RV GRKMS SAF KLLSRL AEG+DLS 
Sbjct  266   CYKWGNGGWQSACCTMTLSMYPLPVLPNKRHARVAGRKMSGSAFRKLLSRLAAEGHDLSL  325

Query  1427  PLDLKDHWAKHGTNRYSTVK  1486
             P+DLKDHWAKHGTNRY T+K
Sbjct  326   PVDLKDHWAKHGTNRYITIK  345



>ref|NP_001268018.1| GAGA-binding transcriptional activator BBR/BPC4-like [Vitis vinifera]
 ref|XP_010645037.1| PREDICTED: GAGA-binding transcriptional activator BBR/BPC4-like 
isoform X1 [Vitis vinifera]
 gb|ACC64527.1| GAGA-binding transcriptional activator BBR/BPC4-like [Vitis vinifera]
 gb|ACC64528.1| GAGA-binding transcriptional activator BBR/BPC4-like [Vitis vinifera]
Length=307

 Score =   251 bits (641),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 146/306 (48%), Positives = 191/306 (62%), Gaps = 35/306 (11%)
 Frame = +2

Query  581   KDQNNSTI-RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             K+QN  T+ +  + I+AERD AI ERN+AL E+K AL ERD A++QRDAAI+ER+ AL E
Sbjct  33    KEQNALTMNKKVVNILAERDNAIRERNIALSEKKAALEERDEALMQRDAAISERDNALLE  92

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD  937
             RDNAI+AL+ RES      ++S   G + + +        +  +Y+  E       ++TD
Sbjct  93    RDNAIAALRYRES------VISIQRGTKRMDHPPNHAANGAEGSYNTRE------VHITD  140

Query  938   PTPQTANNPRKVRQPKESKPKKA--SKLArvvkreeveveDLSWQAVSTFDDWDDGNCGE  1111
               P +      V+  K +K  KA  SK  +  ++ +   EDL+ Q +S      DG    
Sbjct  141   AFPISTIAADSVKSRKRTKENKAVSSKGLKPPRKGKKVNEDLNRQVIS------DG----  190

Query  1112  FVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACC  1288
                       K    WD +D GL  V  D S MPVPVCSCTG P+ CYKWGNGGWQS+CC
Sbjct  191   ---------LKIKSEWDSQDLGLNLVTFDESTMPVPVCSCTGVPRQCYKWGNGGWQSSCC  241

Query  1289  TTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTN  1468
             TTT+S YPLPQ  +KR++R+GGRKMS S F++LLSRL AEG+DLS PLDLKD+WAKHGTN
Sbjct  242   TTTLSSYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAAEGHDLSMPLDLKDYWAKHGTN  301

Query  1469  RYSTVK  1486
             RY  +K
Sbjct  302   RYIIIK  307



>ref|XP_010095680.1| hypothetical protein L484_012253 [Morus notabilis]
 gb|EXB61819.1| hypothetical protein L484_012253 [Morus notabilis]
Length=312

 Score =   251 bits (641),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 138/295 (47%), Positives = 184/295 (62%), Gaps = 25/295 (8%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+AERDAAI ERN+AL E+  ALAERD A+ QRD A+A+R++AL ERDNAI+AL+
Sbjct  42    KKIMSIIAERDAAIRERNVALSEKNEALAERDEALRQRDQALAQRDSALMERDNAIAALQ  101

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
             +R +SMN   +     G + IH+       ++ A Y   E    D F +T  + +     
Sbjct  102   IRNNSMN-MPVSGVQRGVKRIHHPSNHLANMTEATYSSKEMQITDAFPITVISSEAI---  157

Query  965   RKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQDK  1144
              K  Q K +K  KA          +   EDL+ +A S      DG              K
Sbjct  158   -KSGQAKRTKENKAMSSKEPKPPRKKVAEDLNRRASS------DG-------------IK  197

Query  1145  HLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQ  1321
             +   WD +D GL  +  D S+MPVPVCSCTG  + CYKWG+GGWQS+CCTT +SMYPLPQ
Sbjct  198   YRTEWDSQDVGLNLITFDESSMPVPVCSCTGVHRQCYKWGSGGWQSSCCTTNMSMYPLPQ  257

Query  1322  ASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
               +KR++R+GGRKMS   F++LLSRL A+G+DLS PLDL+++WAKHGTNRY T+K
Sbjct  258   IPNKRHARMGGRKMSGGVFTRLLSRLAAQGHDLSIPLDLREYWAKHGTNRYITIK  312



>gb|ADV59382.1| GAGA-binding transcriptional activator [Helianthus annuus]
Length=232

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 167/269 (62%), Gaps = 44/269 (16%)
 Frame = +2

Query  701   MAMLQRDAAIAERNTALEERDNAISALKLRESSMNDEDIVSKSP------GAEHIHYQQE  862
             MAMLQRDAA+AERNTA++ERD AIS ++ R + +N E+++S+ P      G++     +E
Sbjct  1     MAMLQRDAALAERNTAMQERDEAISTIRFRSNFIN-ENMISEPPENIQNHGSKRGFNDEE  59

Query  863   MHEMISAAAYDPTENLTNDPFNVTDPTPQTANNPRKV-RQPKESKPKKASKLArvvkree  1039
             MH M               P +   P P+    PRKV ++ K   P   SK A       
Sbjct  60    MHHMFEI------------PEDYQLPPPENT-KPRKVPKKTKSQSPHVGSKRAD------  100

Query  1040  veveDLSWQAVSTFDDWDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPV  1219
                       V+   + +        D  +   D  L+ W ++ GL QVN D +AMPVPV
Sbjct  101   ----------VTNVTNVNS-------DYEESSSDAQLEAWKDELGLNQVNFDETAMPVPV  143

Query  1220  CSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRL  1399
             CSCTG PQPCY+WG+GGWQSACCTTT+SMYPLP  ++KRYSRVGGRKMS  AF+KLL+RL
Sbjct  144   CSCTGVPQPCYRWGSGGWQSACCTTTMSMYPLPLVTNKRYSRVGGRKMSGGAFTKLLTRL  203

Query  1400  TAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
              +EGYDLS PLDLKDHWAKHGTNRYS +K
Sbjct  204   ASEGYDLSTPLDLKDHWAKHGTNRYSKLK  232



>dbj|BAB10493.1| unnamed protein product [Arabidopsis thaliana]
Length=301

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 191/315 (61%), Gaps = 51/315 (16%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  23    QHQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAIMERDS  82

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTP  946
             A++AL+ RE+SM                        ++A    P  N+  +P N   PT 
Sbjct  83    ALTALQYRENSM------------------------VTA----PAANIEMEP-NDGLPTS  113

Query  947   QTANNPRKVRQPKESK---PKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFV  1117
               A +  +  +PK  K   PK  ++ A   +  +        Q     +  DD N   FV
Sbjct  114   PPAGSTLESAKPKRGKRVNPKATTQTAANKRGPKN-------QRKVKKESEDDLNKIMFV  166

Query  1118  ----DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGN  1264
                 D +DE+  KH+       W   E  GL QV  D + MP PVCSCTG  + CYKWGN
Sbjct  167   KTTHDYTDEDSSKHILIGSKSDWKSQEMVGLNQVVYDETTMPPPVCSCTGVLRQCYKWGN  226

Query  1265  GGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG-YDLSAPLDLK  1441
             GGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG +DLS P+DLK
Sbjct  227   GGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGHHDLSNPVDLK  286

Query  1442  DHWAKHGTNRYSTVK  1486
             DHWAKHGTNRY T+K
Sbjct  287   DHWAKHGTNRYITIK  301



>ref|XP_004290338.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Fragaria vesca 
subsp. vesca]
Length=310

 Score =   250 bits (638),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 142/303 (47%), Positives = 190/303 (63%), Gaps = 42/303 (14%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+AERDAAI ERN A+ E+  ALA RD A+ QRD A ++R+TAL ERDNA +A  
Sbjct  41    KKIMSIIAERDAAIRERNAAISEKNEALAARDEALRQRDEAFSQRDTALMERDNAFAAFH  100

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
             +R++SMN         G++ +HY           ++ P  N+ + P++  D  P T   P
Sbjct  101   IRDNSMNFPLGGGAQRGSKRMHY----------PSHHPV-NMADGPYSTKD-VPITEAFP  148

Query  965   RKV--------RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVD  1120
               V        RQ K SK  KAS+ ++  +++  E  DL+ QA +      DG       
Sbjct  149   ISVLSAEAIKSRQTKRSKQNKASRASKPSRKKVGE--DLNRQAST------DG-------  193

Query  1121  ASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTT  1297
                    K+   WD +D GL  V+ D + MPVPVCSCTG P+ CYKWGNGGWQS+CCTT 
Sbjct  194   ------IKYRSEWDTQDLGLNLVSFDETTMPVPVCSCTGMPRQCYKWGNGGWQSSCCTTN  247

Query  1298  ISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYS  1477
             +SMYPLPQ  +KR++R+GGRKMS S F++LLSRL AEG+DLS PLDLK++WA+HGTNRY 
Sbjct  248   MSMYPLPQMPNKRHARMGGRKMSGSVFTRLLSRLAAEGHDLSVPLDLKEYWARHGTNRYI  307

Query  1478  TVK  1486
             T+K
Sbjct  308   TIK  310



>ref|NP_001078690.1| basic pentacysteine 6 [Arabidopsis thaliana]
 gb|AED94821.1| basic pentacysteine 6 [Arabidopsis thaliana]
Length=338

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 154/330 (47%), Positives = 200/330 (61%), Gaps = 36/330 (11%)
 Frame = +2

Query  581   KDQNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEER  760
             + Q+  +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ER
Sbjct  17    QGQHQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAIMER  76

Query  761   DNAISALKLRESSMNDEDIVSKS---PGAE-------------HIHYQQEMHEMISAAAY  892
             D+A++AL+ RE+SM      + S   PG +             H H+QQ     ++  AY
Sbjct  77    DSALTALQYRENSMVTAPAANMSACPPGCQISRGVKHLHHPHMHHHHQQHHIPQLTENAY  136

Query  893   DPTENLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAV  1072
             +  E   ND    + P   T  +  K ++ K   PK  ++ A   +  +        Q  
Sbjct  137   ETREMEPNDGLPTSPPAGSTLESA-KPKRGKRVNPKATTQTAANKRGPKN-------QRK  188

Query  1073  STFDDWDDGNCGEFV----DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMPVPV  1219
                +  DD N   FV    D +DE+  KH+       W   E  GL QV  D + MP PV
Sbjct  189   VKKESEDDLNKIMFVKTTHDYTDEDSSKHILIGSKSDWKSQEMVGLNQVVYDETTMPPPV  248

Query  1220  CSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRL  1399
             CSCTG  + CYKWGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL
Sbjct  249   CSCTGVLRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRL  308

Query  1400  TAEG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
              AEG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  309   AAEGHHDLSNPVDLKDHWAKHGTNRYITIK  338



>ref|XP_004499229.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Cicer arietinum]
Length=338

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 150/325 (46%), Positives = 192/325 (59%), Gaps = 35/325 (11%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  MAIMAERD AI ERN+AL E+K A         QRD AIAERN AL ERDN
Sbjct  24    QHQPSMKQIMAIMAERDQAIQERNLALSEKKAAXXXXXXXXXQRDTAIAERNNALMERDN  83

Query  767   AI-SALKLRESSMNDEDIVSKSPGAE------HIHY--QQEMH-EMISAAAYDPTENLTN  916
             AI + L+ RE+++ +  ++S  PG +      HIH+  QQ  H   +  ++Y   E  T 
Sbjct  84    AIATTLQFRENALANGGMLSCPPGCQISRGVKHIHHLPQQVNHLPNMGDSSYGTRELHTT  143

Query  917   DPFNVTDPTPQTANNP-RKVRQPKESK--------PKKASKLArvv----kreeveveDL  1057
             +      P P     P R+ ++PKESK        PK   K+ +      K      + L
Sbjct  144   NALPEA-PIPAEVGKPTRRAKRPKESKSVSPNKKTPKTTRKVKKESEDLNKTMFANNKTL  202

Query  1058  SWQAVS-TFDDWDDGNCGEFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCT  1231
              W++     +  DD N    V  +D         W  +D  L QV  D S MP PVCSCT
Sbjct  203   EWKSSQDIMNGGDDLNKQIAVSKAD---------WKPQDLALNQVAYDDSTMPAPVCSCT  253

Query  1232  GTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG  1411
             G  + CYKWGNGGWQSACCTTT+S+YPLP   +KR++R+GGRKMS SAF+KLLSRL AEG
Sbjct  254   GVLRQCYKWGNGGWQSACCTTTLSVYPLPAVPNKRHARIGGRKMSGSAFNKLLSRLAAEG  313

Query  1412  YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  314   HDLSHPVDLKDHWAKHGTNRYITIK  338



>ref|XP_006280750.1| hypothetical protein CARUB_v10026720mg [Capsella rubella]
 gb|EOA13648.1| hypothetical protein CARUB_v10026720mg [Capsella rubella]
Length=339

 Score =   250 bits (638),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 151/331 (46%), Positives = 199/331 (60%), Gaps = 36/331 (11%)
 Frame = +2

Query  581   KDQNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEER  760
             + Q+  +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ER
Sbjct  16    QGQHQPSMKQVMSIIAERDAAIQERNLAISEKKAAIAERDMAFLQRDTAIAERNNAIMER  75

Query  761   DNAISALKLRESSM---NDEDIVSKSPGAEHIHYQQEMHE--------------MISAAA  889
             D+A++AL+ RE+SM      ++ +  PG +     + MH                ++  A
Sbjct  76    DSALTALQYRENSMVTAASANMSACPPGCQISRGVKNMHHPHMHHHHHQQHHIPQLTENA  135

Query  890   YDPTENLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQA  1069
             Y+P E   ND      PT  TA +  +  +PK  K  K  K        +   ++   Q 
Sbjct  136   YEPREMEPNDGL----PTSPTAGSVLESAKPKRGKRVKDPKTTTQTAANKRGTKN---QR  188

Query  1070  VSTFDDWDDGNCGEFV----DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMPVP  1216
                 +  DD     F+    D ++E+  KH+       W   E  GL QV  D + MP P
Sbjct  189   KVKKESEDDLTKIMFLKTTHDYTEEDSSKHILIGSKSDWKSQEMVGLNQVVYDETTMPPP  248

Query  1217  VCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSR  1396
             VCSCTG  + CYKWGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSR
Sbjct  249   VCSCTGVLRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSR  308

Query  1397  LTAEG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             L AEG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  309   LAAEGHHDLSNPVDLKDHWAKHGTNRYITIK  339



>ref|NP_568605.1| basic pentacysteine 6 [Arabidopsis thaliana]
 sp|Q8L999.1|BPC6_ARATH RecName: Full=Protein BASIC PENTACYSTEINE6; Short=AtBPC6; AltName: 
Full=GAGA-binding transcriptional activator BBR/BPC6 [Arabidopsis 
thaliana]
 gb|AAM67342.1| unknown [Arabidopsis thaliana]
 gb|AAR25825.1| basic pentacysteine 6 [Arabidopsis thaliana]
 dbj|BAD93808.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABD85145.1| At5g42520 [Arabidopsis thaliana]
 dbj|BAE99281.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABL67948.1| GAGA-binding transcriptional activator [Arabidopsis thaliana]
 gb|ABL67949.1| GAGA-binding transcriptional activator [Arabidopsis thaliana]
 gb|AED94820.1| basic pentacysteine 6 [Arabidopsis thaliana]
Length=342

 Score =   250 bits (638),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 154/328 (47%), Positives = 199/328 (61%), Gaps = 36/328 (11%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  23    QHQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAIMERDS  82

Query  767   AISALKLRESSMNDEDIVSKS---PGAE-------------HIHYQQEMHEMISAAAYDP  898
             A++AL+ RE+SM      + S   PG +             H H+QQ     ++  AY+ 
Sbjct  83    ALTALQYRENSMVTAPAANMSACPPGCQISRGVKHLHHPHMHHHHQQHHIPQLTENAYET  142

Query  899   TENLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVST  1078
              E   ND    + P   T  +  K ++ K   PK  ++ A   +  +        Q    
Sbjct  143   REMEPNDGLPTSPPAGSTLESA-KPKRGKRVNPKATTQTAANKRGPKN-------QRKVK  194

Query  1079  FDDWDDGNCGEFV----DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMPVPVCS  1225
              +  DD N   FV    D +DE+  KH+       W   E  GL QV  D + MP PVCS
Sbjct  195   KESEDDLNKIMFVKTTHDYTDEDSSKHILIGSKSDWKSQEMVGLNQVVYDETTMPPPVCS  254

Query  1226  CTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTA  1405
             CTG  + CYKWGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL A
Sbjct  255   CTGVLRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAA  314

Query  1406  EG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             EG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  315   EGHHDLSNPVDLKDHWAKHGTNRYITIK  342



>ref|XP_010940930.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010940931.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010940932.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010940933.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010940934.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010940935.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010940936.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
Length=342

 Score =   249 bits (637),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 151/305 (50%), Positives = 188/305 (62%), Gaps = 16/305 (5%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKL-R  790
             MAIMAERD+AI +RN+A+ E+K ALAERDMA+LQRDAAI ERN A  ERDNAI+AL+  R
Sbjct  40    MAIMAERDSAIHDRNLAISEKKAALAERDMAILQRDAAIVERNNAFLERDNAIAALQYAR  99

Query  791   ESSMNDEDIVSKSPGA-------EHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQ  949
             E+ MN       SPG        +H+ +       +S A YD    +            +
Sbjct  100   ETGMNGNGGNGCSPGCTAPTKHHDHLPHVHPPPSQLSDAPYDHERQVDIAEAYPISTAVE  159

Query  950   TANNPRKVRQPKES--KPKKASKLArvvkreeveveDLSWQ-AVSTF-DDWDDG-NCGEF  1114
             +A   +  R  KE+  +     K     K +    +DL+ Q +++ F  +W         
Sbjct  160   SAKGCKAKRMRKENGVQAIPIKKSKSPKKNKRSGNDDLNKQVSIAKFHGEWKGQEQVSGG  219

Query  1115  VDASDEEQDKHLDTW-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCT  1291
              DA+     KH   W  +D GL QV+ D S MPVPVCSCTG   PCYKWGNGGWQS+CCT
Sbjct  220   GDANKIPVTKH--HWKGQDLGLNQVSFDESTMPVPVCSCTGKFHPCYKWGNGGWQSSCCT  277

Query  1292  TTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNR  1471
             TT+SMYPLP   +KR++RVGGRKMS  AF KLLSRL AEG+DLS P+DLKDHWAKHGTNR
Sbjct  278   TTLSMYPLPVMPNKRHARVGGRKMSGGAFIKLLSRLAAEGHDLSTPVDLKDHWAKHGTNR  337

Query  1472  YSTVK  1486
             Y T+K
Sbjct  338   YITIK  342



>ref|XP_006280751.1| hypothetical protein CARUB_v10026720mg [Capsella rubella]
 gb|EOA13649.1| hypothetical protein CARUB_v10026720mg [Capsella rubella]
Length=343

 Score =   249 bits (637),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 151/329 (46%), Positives = 198/329 (60%), Gaps = 36/329 (11%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  22    QHQPSMKQVMSIIAERDAAIQERNLAISEKKAAIAERDMAFLQRDTAIAERNNAIMERDS  81

Query  767   AISALKLRESSM---NDEDIVSKSPGAEHIHYQQEMHE--------------MISAAAYD  895
             A++AL+ RE+SM      ++ +  PG +     + MH                ++  AY+
Sbjct  82    ALTALQYRENSMVTAASANMSACPPGCQISRGVKNMHHPHMHHHHHQQHHIPQLTENAYE  141

Query  896   PTENLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS  1075
             P E   ND      PT  TA +  +  +PK  K  K  K        +   ++   Q   
Sbjct  142   PREMEPNDGL----PTSPTAGSVLESAKPKRGKRVKDPKTTTQTAANKRGTKN---QRKV  194

Query  1076  TFDDWDDGNCGEFV----DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMPVPVC  1222
               +  DD     F+    D ++E+  KH+       W   E  GL QV  D + MP PVC
Sbjct  195   KKESEDDLTKIMFLKTTHDYTEEDSSKHILIGSKSDWKSQEMVGLNQVVYDETTMPPPVC  254

Query  1223  SCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLT  1402
             SCTG  + CYKWGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL 
Sbjct  255   SCTGVLRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLA  314

Query  1403  AEG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             AEG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  315   AEGHHDLSNPVDLKDHWAKHGTNRYITIK  343



>ref|XP_009104251.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Brassica rapa]
 gb|ABP96709.1| GAGA-binding transcriptional activator [Brassica rapa subsp. 
pekinensis]
 gb|ABP96710.1| GAGA-binding transcriptional activator [Brassica rapa subsp. 
pekinensis]
Length=341

 Score =   249 bits (637),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 155/327 (47%), Positives = 197/327 (60%), Gaps = 34/327 (10%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+I+AERDAAI ERN+A+ ERK A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  22    QHQPSMKQVMSIIAERDAAIQERNLAISERKSAVAERDMAFLQRDTAIAERNNAIMERDS  81

Query  767   AISALKLRESSMNDEDIVSK-----SPGAE-----------HIHYQQEMHEMISAAAYDP  898
             A+SAL+ RE+SM     VS       PG +            +H  Q     +S  AYD 
Sbjct  82    ALSALQYRENSMATPSAVSNMAAACPPGCQMPRGVKHIHHPQMHQHQHHMLQLSDHAYDE  141

Query  899   TENLTNDPFNVTDPTPQTA-------NNPRKVRQPKESKPKKASKLArv--vkreeveve  1051
             +  +   P   T P P TA          ++V+ PK +    A+K       K ++   +
Sbjct  142   SREMDGLP---TSPPPGTALDSAKPKRGGKRVKDPKATTKTTANKRGPKNPRKVKKENED  198

Query  1052  DLS-WQAVSTFDDWDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSC  1228
             DL+    V T  D+ +    + V    +   K      E  GL QV  D + MP PVCSC
Sbjct  199   DLTKIMFVKTTLDYGEEETSKLVLTGSKSDWKS----QEMVGLNQVVYDETTMPPPVCSC  254

Query  1229  TGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAE  1408
             TG  + CYKWGNGGWQS+CCTTTISMYPLP   +KR++RVGGRKMS SAF+KLLSRL AE
Sbjct  255   TGDLRQCYKWGNGGWQSSCCTTTISMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAE  314

Query  1409  G-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             G +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  315   GHHDLSNPVDLKDHWAKHGTNRYITIK  341



>ref|XP_010481981.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Camelina 
sativa]
 ref|XP_010481982.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Camelina 
sativa]
Length=340

 Score =   249 bits (636),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 148/326 (45%), Positives = 194/326 (60%), Gaps = 33/326 (10%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  22    QHQPSMKQVMSIIAERDAAIQERNLAISEKKAAIAERDMAFLQRDTAIAERNNAIMERDS  81

Query  767   AISALKLRESSMNDEDIVSKS-PGAEHIHYQQEMHE-------------MISAAAYDPTE  904
             A++AL+ RE+SM      + S PG +     + MH               ++  AY+  E
Sbjct  82    ALTALQYRENSMVTAAAANMSAPGCQMSRGVKHMHHPHMHHHHQQHHIPQLTENAYETRE  141

Query  905   NLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFD  1084
                ND    + P      + +  R  +   PK  ++ A   +  +        Q     +
Sbjct  142   MEPNDGLQTSPPAGSALESAKPKRGKRVKDPKATTQTAANKRGPKN-------QRKVKKE  194

Query  1085  DWDDGNCGEFV----DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMPVPVCSCT  1231
               DD     FV    D ++E+  KH+       W   E  GL QV  D + MP PVCSCT
Sbjct  195   SEDDLTKIMFVKTTHDYTEEDSSKHILIGSKSDWKSQEMVGLNQVVYDETTMPPPVCSCT  254

Query  1232  GTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG  1411
             G  + CYKWGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG
Sbjct  255   GVLRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEG  314

Query  1412  -YDLSAPLDLKDHWAKHGTNRYSTVK  1486
              +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  315   HHDLSNPVDLKDHWAKHGTNRYITIK  340



>ref|XP_010494188.1| PREDICTED: protein BASIC PENTACYSTEINE6-like [Camelina sativa]
Length=342

 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 191/328 (58%), Gaps = 35/328 (11%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  22    QHQPSMKQVMSIIAERDAAIQERNLAISEKKAAIAERDMAFLQRDTAIAERNNAIMERDS  81

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHE----------------MISAAAYDP  898
             A++AL+ RE+SM      + S G       + +                   ++  AY+ 
Sbjct  82    ALTALQYRENSMVTAAGANMSAGPPGCQMSRGVKHMHHPHMHHHHQQHHIPQLTDNAYET  141

Query  899   TENLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVST  1078
              E   ND    + P      + +  R  +   PK  ++ A   +  +        Q    
Sbjct  142   REMEPNDGLPTSPPAGSALESAKPKRGKRVKDPKATTQTAANKRGPKN-------QRKVK  194

Query  1079  FDDWDDGNCGEFV----DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMPVPVCS  1225
              +  DD     FV    D ++E+  KH+       W   E  GL QV  D + MP PVCS
Sbjct  195   KESEDDLTKIMFVKTTHDYTEEDSSKHILIGSKSDWKSQEMVGLNQVVYDETTMPPPVCS  254

Query  1226  CTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTA  1405
             CTG  + CYKWGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL A
Sbjct  255   CTGVLRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAA  314

Query  1406  EG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             EG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  315   EGHHDLSNPVDLKDHWAKHGTNRYITIK  342



>gb|ADV59404.1| GAGA-binding transcriptional activator [Cardamine hirsuta]
 gb|ADV59405.1| GAGA-binding transcriptional activator [Cardamine hirsuta]
Length=343

 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 149/333 (45%), Positives = 199/333 (60%), Gaps = 45/333 (14%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  23    QHQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAIMERDS  82

Query  767   AISALKLRESSMNDEDIVSKS----PGAEHIHYQQEMHE------------MISAAAYDP  898
             A++AL+ RE+SM +    +      PG +     + +H              ++  AY+ 
Sbjct  83    ALTALQYRENSMVNAAAAANMSACPPGCQVSRGVKHLHHPHMHHHHQHNVPQLTENAYET  142

Query  899   TENLTNDPFNVTDPTPQTANNPR-----KVRQPKESKPKKASKLArvvkreeveveDLSW  1063
              E   ND   ++ PT     + +     +V+ PKE+ P  A+K                 
Sbjct  143   REIELNDGLPISTPTGSALESAKPKRGKRVKDPKETTPTAANKRGPKS------------  190

Query  1064  QAVSTFDDWDDGNCGEFV----DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMP  1210
             Q     ++ DD     FV    D ++E+  KH+       W   E  GL QV  D + MP
Sbjct  191   QRKVKKENEDDLTKIMFVKTTHDYTEEDSSKHILIGSKSDWKNQEMVGLNQVVYDETTMP  250

Query  1211  VPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLL  1390
              P+CSCTG  + CYKWGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLL
Sbjct  251   PPICSCTGILRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLL  310

Query  1391  SRLTAEG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             SRL AEG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  311   SRLAAEGHHDLSNPVDLKDHWAKHGTNRYITIK  343



>ref|XP_009378464.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X4 [Pyrus 
x bretschneideri]
Length=285

 Score =   245 bits (626),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 190/297 (64%), Gaps = 31/297 (10%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+A+RDAAI ERN AL E+  ALA RD A+ QRD A+A+R++AL ERDNA +AL 
Sbjct  17    KKIMSIIADRDAAIRERNAALAEKNEALAARDEALRQRDEALAQRDSALMERDNAYAALH  76

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
              R++++N         G++ +  +  +H +  A  +  T+++     N+T+  P +  +P
Sbjct  77    SRDNAVNFPLGGGAQRGSKRVQ-RPSIHSVTLADVHYSTKDV-----NITEAYPISVISP  130

Query  965   RKV--RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
               V  RQ K +K  KAS+     +  +   EDL+ QA S      DG             
Sbjct  131   EAVKSRQTKRAKENKASR---AKQSRKKVGEDLNRQASS------DG-------------  168

Query  1139  DKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPL  1315
              K+   WD  D GL  V+ D S MPVPVCSCTG P+ CYKWGNGGWQS+CCTT +SMYPL
Sbjct  169   IKYKSEWDTHDLGLNLVSFDESTMPVPVCSCTGIPRQCYKWGNGGWQSSCCTTHMSMYPL  228

Query  1316  PQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             PQ  +KR++R+GGRKMS S F++LLSRL A+G+DLS PLDLK++WA+HGTNRY T+K
Sbjct  229   PQMPNKRHARMGGRKMSGSVFTRLLSRLAADGHDLSIPLDLKEYWARHGTNRYITIK  285



>ref|XP_010442173.1| PREDICTED: protein BASIC PENTACYSTEINE6 [Camelina sativa]
Length=342

 Score =   247 bits (630),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 148/328 (45%), Positives = 194/328 (59%), Gaps = 35/328 (11%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  22    QHQPSMKQVMSIIAERDAAIQERNLAISEKKAAIAERDMAFLQRDTAIAERNNAIMERDS  81

Query  767   AISALKLRESSMNDEDIVSKS---PGAEHIHYQQEMHE-------------MISAAAYDP  898
             A++AL+ RE+SM      + S   PG +     + MH               ++  AY+ 
Sbjct  82    ALTALQYRENSMVTAAAANMSACPPGCQMSRGVKHMHHPHMHHHHQQHHIPQLTENAYET  141

Query  899   TENLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVST  1078
              E   ND    + P      + +  R  +   PK  ++ A   +  +        Q    
Sbjct  142   REMEPNDGLPTSPPAVSALESAKPKRGKRVKDPKATTQTAANKRGPKN-------QRKVK  194

Query  1079  FDDWDDGNCGEFV----DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMPVPVCS  1225
              +  DD     FV    D ++E+  KH+       W   E  GL QV  D + MP PVCS
Sbjct  195   KESEDDLTKIMFVKTTHDYTEEDSSKHILIGSKSDWKSQEMVGLNQVVYDETTMPPPVCS  254

Query  1226  CTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTA  1405
             CTG  + CYKWGNGGWQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL A
Sbjct  255   CTGVLRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAA  314

Query  1406  EG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             EG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  315   EGHHDLSNPVDLKDHWAKHGTNRYITIK  342



>gb|ABK96608.1| unknown [Populus trichocarpa x Populus deltoides]
Length=322

 Score =   246 bits (628),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 189/307 (62%), Gaps = 29/307 (9%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q N+    +  M I+ ERD AI ERN+AL E+K ALA RD A+ QR+ A+ ER+ AL 
Sbjct  40    KEQTNALAMNKKIMTILIERDDAIRERNLALAEKKEALAARDEAIQQREKALVERDKALM  99

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA++A++ RE++MN         G++ I +    H    + A D  E    D   ++
Sbjct  100   ERDNALAAIQYRENAMNYPLSGGSQRGSKRIPHPV-YHSNGMSEALDTGEMHITDALPIS  158

Query  935   DPTPQTANNPRKVRQPKESKPKKASKL--ArvvkreeveveDLSWQAVSTFDDWDDGNCG  1108
               T +T     K RQ K SK  KA  L  A+  ++     EDL+ Q              
Sbjct  159   SVTAETG----KARQTKRSKENKAVGLKAAKSPRKGSRVGEDLNKQG-------------  201

Query  1109  EFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSAC  1285
                 ASD ++ K    WD +D GL  +N D + MP PVCSCTG P+ CYKWG+GGWQSAC
Sbjct  202   ----ASDGKKIK--VEWDSQDVGLNLINFDETTMPAPVCSCTGVPRQCYKWGSGGWQSAC  255

Query  1286  CTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGT  1465
             CTTT+S YPLPQ  +KR++R+GGRKMS + F++LLSRL AEG+DL+ PLDLKD+WA+HGT
Sbjct  256   CTTTMSSYPLPQMPNKRHARIGGRKMSGNVFTRLLSRLAAEGHDLAIPLDLKDYWARHGT  315

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  316   NRYITIK  322



>emb|CDY69457.1| BnaCnng63620D [Brassica napus]
Length=325

 Score =   246 bits (628),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 155/325 (48%), Positives = 194/325 (60%), Gaps = 46/325 (14%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+I+AERDAAI ERN+A+ ERK A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  22    QHQPSMKQVMSIIAERDAAIQERNLAISERKSAVAERDMAFLQRDTAIAERNNAIMERDS  81

Query  767   AISALKLRESSMNDEDIVSK-----SPGAE-----------HIHYQQEMHEMISAAAYDP  898
             A+SAL+ RE+SM     VS       PG +            +H  Q     +S  AYD 
Sbjct  82    ALSALQYRENSMATPSAVSNMAAACPPGCQMPRGVKHIHHPQMHQHQHHMLQLSDHAYDE  141

Query  899   TENLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVST  1078
             +  +   P   T P P TA +         +KPK+  K  +          D      +T
Sbjct  142   SREMDGLP---TSPPPGTALD--------SAKPKRGGKRVK----------DPKATTKTT  180

Query  1079  FDDWDDGNCGEF-VDASDEEQDKHLDT-----W--DEDFGLEQVNSDVSAMPVPVCSCTG  1234
              +     N  +  +D  +EE  K + T     W   E  GL QV  D + MP PVCSCTG
Sbjct  181   ANKRGPKNPRKTTLDYGEEETSKLVLTGSKSDWKSQEMVGLNQVVYDETTMPPPVCSCTG  240

Query  1235  TPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG-  1411
               + CYKWGNGGWQS+CCTTTISMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG 
Sbjct  241   DLRQCYKWGNGGWQSSCCTTTISMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGH  300

Query  1412  YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  301   HDLSNPVDLKDHWAKHGTNRYITIK  325



>ref|XP_011047142.1| PREDICTED: protein BASIC PENTACYSTEINE4 [Populus euphratica]
 ref|XP_011047147.1| PREDICTED: protein BASIC PENTACYSTEINE4 [Populus euphratica]
 ref|XP_011047155.1| PREDICTED: protein BASIC PENTACYSTEINE4 [Populus euphratica]
Length=326

 Score =   246 bits (628),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 143/307 (47%), Positives = 188/307 (61%), Gaps = 29/307 (9%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q N+    +  M I+ ERD AI ERN+AL E+K ALA RD A+ QR+ A+ ER+ AL 
Sbjct  44    KEQTNALAMNKKIMTILIERDDAIRERNLALAEKKEALAARDEAIQQREKALVERDKALM  103

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA++A++ RE++MN         G++ I +    H    + A D  E    D   ++
Sbjct  104   ERDNALAAIQHRENAMNYSLSGGSQRGSKRIPHPV-YHSNGMSEALDTGEMHITDALPIS  162

Query  935   DPTPQTANNPRKVRQPKESKPKKASKL--ArvvkreeveveDLSWQAVSTFDDWDDGNCG  1108
               T +T     K RQ K SK  KA  L  A+  ++     EDL+ Q              
Sbjct  163   SVTAETG----KARQTKRSKENKAVGLKAAKSPRKGSRVGEDLNKQG-------------  205

Query  1109  EFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSAC  1285
                 ASD ++ K    WD +D GL  +N D + MP PVCSCTG P+ CYKWG+GGWQSAC
Sbjct  206   ----ASDGKKIK--VEWDSQDVGLNLINFDETTMPAPVCSCTGVPRQCYKWGSGGWQSAC  259

Query  1286  CTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGT  1465
             CTTT+S YPLPQ  +KR++R+GGRKMS + F++LLSRL AEG+DLS PLDLKD WA+HGT
Sbjct  260   CTTTMSSYPLPQMPNKRHARIGGRKMSGNVFTRLLSRLAAEGHDLSIPLDLKDFWARHGT  319

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  320   NRYITIK  326



>ref|XP_009378461.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009378462.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009378463.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X3 [Pyrus 
x bretschneideri]
Length=311

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 190/297 (64%), Gaps = 31/297 (10%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+A+RDAAI ERN AL E+  ALA RD A+ QRD A+A+R++AL ERDNA +AL 
Sbjct  43    KKIMSIIADRDAAIRERNAALAEKNEALAARDEALRQRDEALAQRDSALMERDNAYAALH  102

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
              R++++N         G++ +  +  +H +  A  +  T+++     N+T+  P +  +P
Sbjct  103   SRDNAVNFPLGGGAQRGSKRVQ-RPSIHSVTLADVHYSTKDV-----NITEAYPISVISP  156

Query  965   RKV--RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
               V  RQ K +K  KAS+     +  +   EDL+ QA S      DG             
Sbjct  157   EAVKSRQTKRAKENKASR---AKQSRKKVGEDLNRQASS------DG-------------  194

Query  1139  DKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPL  1315
              K+   WD  D GL  V+ D S MPVPVCSCTG P+ CYKWGNGGWQS+CCTT +SMYPL
Sbjct  195   IKYKSEWDTHDLGLNLVSFDESTMPVPVCSCTGIPRQCYKWGNGGWQSSCCTTHMSMYPL  254

Query  1316  PQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             PQ  +KR++R+GGRKMS S F++LLSRL A+G+DLS PLDLK++WA+HGTNRY T+K
Sbjct  255   PQMPNKRHARMGGRKMSGSVFTRLLSRLAADGHDLSIPLDLKEYWARHGTNRYITIK  311



>ref|XP_009378460.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X2 [Pyrus 
x bretschneideri]
Length=337

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 190/297 (64%), Gaps = 31/297 (10%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+A+RDAAI ERN AL E+  ALA RD A+ QRD A+A+R++AL ERDNA +AL 
Sbjct  69    KKIMSIIADRDAAIRERNAALAEKNEALAARDEALRQRDEALAQRDSALMERDNAYAALH  128

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
              R++++N         G++ +  +  +H +  A  +  T+++     N+T+  P +  +P
Sbjct  129   SRDNAVNFPLGGGAQRGSKRVQ-RPSIHSVTLADVHYSTKDV-----NITEAYPISVISP  182

Query  965   RKV--RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
               V  RQ K +K  KAS+     +  +   EDL+ QA S      DG             
Sbjct  183   EAVKSRQTKRAKENKASR---AKQSRKKVGEDLNRQASS------DG-------------  220

Query  1139  DKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPL  1315
              K+   WD  D GL  V+ D S MPVPVCSCTG P+ CYKWGNGGWQS+CCTT +SMYPL
Sbjct  221   IKYKSEWDTHDLGLNLVSFDESTMPVPVCSCTGIPRQCYKWGNGGWQSSCCTTHMSMYPL  280

Query  1316  PQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             PQ  +KR++R+GGRKMS S F++LLSRL A+G+DLS PLDLK++WA+HGTNRY T+K
Sbjct  281   PQMPNKRHARMGGRKMSGSVFTRLLSRLAADGHDLSIPLDLKEYWARHGTNRYITIK  337



>ref|XP_006379265.1| hypothetical protein POPTR_0009s12820g [Populus trichocarpa]
 gb|ADV59343.1| GAGA-binding transcriptional activator [Populus trichocarpa]
 gb|ADV59344.1| GAGA-binding transcriptional activator [Populus trichocarpa]
 gb|ERP57062.1| hypothetical protein POPTR_0009s12820g [Populus trichocarpa]
Length=320

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 141/307 (46%), Positives = 189/307 (62%), Gaps = 29/307 (9%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q N+    +  M I+ ERD AI ERN+AL E+K ALA RD A+ QR+ A+ ER+ AL 
Sbjct  38    KEQTNALAMNKKIMTILIERDDAIRERNLALAEKKEALAARDEAIQQREKALVERDKALM  97

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA++A++ RE++M+         G++ I +    H    + A D  E    D   ++
Sbjct  98    ERDNALAAIQYRENAMSYPLSGGSQRGSKRIPHPV-YHSNGMSEALDTGEMHITDALPIS  156

Query  935   DPTPQTANNPRKVRQPKESKPKKASKL--ArvvkreeveveDLSWQAVSTFDDWDDGNCG  1108
               T +T     K RQ K SK  KA  L  A+  ++     EDL+ Q              
Sbjct  157   SVTAETG----KARQTKRSKENKAVGLKAAKSPRKGSRVGEDLNKQG-------------  199

Query  1109  EFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSAC  1285
                 ASD ++ K    WD +D GL  +N D + MP PVCSCTG P+ CYKWG+GGWQSAC
Sbjct  200   ----ASDGKKIK--VEWDSQDVGLNLINFDETTMPAPVCSCTGVPRQCYKWGSGGWQSAC  253

Query  1286  CTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGT  1465
             CTTT+S YPLPQ  +KR++R+GGRKMS + F++LLSRL AEG+DL+ PLDLKD+WA+HGT
Sbjct  254   CTTTMSSYPLPQMPNKRHARIGGRKMSGNVFTRLLSRLAAEGHDLAIPLDLKDYWARHGT  313

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  314   NRYITIK  320



>ref|XP_009378459.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X1 [Pyrus 
x bretschneideri]
Length=338

 Score =   244 bits (624),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 190/297 (64%), Gaps = 31/297 (10%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+A+RDAAI ERN AL E+  ALA RD A+ QRD A+A+R++AL ERDNA +AL 
Sbjct  70    KKIMSIIADRDAAIRERNAALAEKNEALAARDEALRQRDEALAQRDSALMERDNAYAALH  129

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
              R++++N         G++ +  +  +H +  A  +  T+++     N+T+  P +  +P
Sbjct  130   SRDNAVNFPLGGGAQRGSKRVQ-RPSIHSVTLADVHYSTKDV-----NITEAYPISVISP  183

Query  965   RKV--RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
               V  RQ K +K  KAS+     +  +   EDL+ QA S      DG             
Sbjct  184   EAVKSRQTKRAKENKASR---AKQSRKKVGEDLNRQASS------DG-------------  221

Query  1139  DKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPL  1315
              K+   WD  D GL  V+ D S MPVPVCSCTG P+ CYKWGNGGWQS+CCTT +SMYPL
Sbjct  222   IKYKSEWDTHDLGLNLVSFDESTMPVPVCSCTGIPRQCYKWGNGGWQSSCCTTHMSMYPL  281

Query  1316  PQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             PQ  +KR++R+GGRKMS S F++LLSRL A+G+DLS PLDLK++WA+HGTNRY T+K
Sbjct  282   PQMPNKRHARMGGRKMSGSVFTRLLSRLAADGHDLSIPLDLKEYWARHGTNRYITIK  338



>emb|CDY41183.1| BnaA09g38320D [Brassica napus]
Length=296

 Score =   243 bits (620),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 143/299 (48%), Positives = 184/299 (62%), Gaps = 37/299 (12%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+A++A
Sbjct  32    SMKQVMSIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAIMERDSALAA  91

Query  779   LKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTAN  958
             L+ R+SSM+               +Q  +H M+       TEN        T  T +T  
Sbjct  92    LQYRDSSMSTSR-----------QHQPHIHHMLQV-----TEN--------TYETRETET  127

Query  959   NPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
             +P     P  +KPK+  K          +    + + V   ++ DD     F    DEE 
Sbjct  128   SP-----PLPTKPKRGRKAKEPKAAAASKRGPKTQRKVKKENE-DDLTKLMF----DEEA  177

Query  1139  DKHLDTW--DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYP  1312
                   W   E  GL +V  D + MP PVCSCTG  + CYKWGNGGWQS+CCTTT+SM+P
Sbjct  178   TGSKSDWRGQETVGLNRVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCCTTTLSMHP  237

Query  1313  LPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             LP   +K+++RVGGRKMS SAFSKLLSRL AEG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  238   LPALPNKKHARVGGRKMSGSAFSKLLSRLAAEGHHDLSNPVDLKDHWAKHGTNRYITIK  296



>gb|ADV59373.1| GAGA-binding transcriptional activator [Triphysaria pusilla]
Length=220

 Score =   240 bits (612),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 127/232 (55%), Positives = 160/232 (69%), Gaps = 15/232 (6%)
 Frame = +2

Query  800   MNDEDIVSKSPGAE--HIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNPRKV  973
             MND   +  S G E  HI YQQ+M   +S AAY P  +  +   ++T+     A+   K 
Sbjct  1     MNDNSTIPDSLGNEGKHIQYQQQMR-AVSEAAYGPRGSFRDSDISITE-----ASVTGKQ  54

Query  974   RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ-DKHL  1150
             R+ +++K +K  K A+  +      E +S Q  S  + WD+    E    SDE+  +K +
Sbjct  55    RRGRQTKDEKKMKSAKSPRVGRKFSEGVSKQVSS--NGWDNDQSFE----SDEDNLEKQV  108

Query  1151  DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASH  1330
              +W ++ GL Q+N D SAMPVPVC+CTG+PQPCY+WGNGGWQSACCTTTISMYPLPQ ++
Sbjct  109   VSWKDNLGLNQINFDDSAMPVPVCTCTGSPQPCYRWGNGGWQSACCTTTISMYPLPQVAN  168

Query  1331  KRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             KRYSRVGGRKMS SAFSKLL+RL AEGYD SAPLDLK+HWAKHGTNRYSTVK
Sbjct  169   KRYSRVGGRKMSGSAFSKLLNRLAAEGYDFSAPLDLKEHWAKHGTNRYSTVK  220



>ref|XP_008382362.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X2 [Malus domestica]
 ref|XP_008365907.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X4 [Malus 
domestica]
Length=285

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/297 (46%), Positives = 188/297 (63%), Gaps = 31/297 (10%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+A+RDAAI ERN AL E+  ALA RD A+ QRD A+ +R++AL ERDNA +AL 
Sbjct  17    KKIMSIIADRDAAIRERNAALAEKNEALAARDEALRQRDEALTQRDSALMERDNAYAALH  76

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
              R++++N         GA+ +  +   H +  A  +  T+++     ++T+  P +  +P
Sbjct  77    SRDNAVNFPLGGGAQRGAKRVQ-RPSNHSVTLADVHYSTKDV-----HITEAYPISVISP  130

Query  965   RKV--RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
               V  RQ K +K  KAS+     +  +   EDL+ QA S      DG             
Sbjct  131   EAVKSRQTKRAKENKASR---AKQSRKKVGEDLNRQASS------DG-------------  168

Query  1139  DKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPL  1315
              K+   WD  D GL  V+ D S MPVPVCSCTG P+ CYKWGNGGWQS+CCTT +SMYPL
Sbjct  169   IKYKSEWDTHDLGLNLVSFDESTMPVPVCSCTGIPRQCYKWGNGGWQSSCCTTHMSMYPL  228

Query  1316  PQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             PQ  +KR++R+GGRKMS S F++LLSRL A+G+DLS PLDLK++WA+HGTNRY T+K
Sbjct  229   PQMPNKRHARMGGRKMSGSVFTRLLSRLAADGHDLSIPLDLKEYWARHGTNRYITIK  285



>emb|CDX89057.1| BnaA04g01290D [Brassica napus]
Length=312

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 145/303 (48%), Positives = 193/303 (64%), Gaps = 28/303 (9%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M+I+AERDAAI ERN+A+ ERK A+AERDMA LQRD AIAERN A+ ERD+A++A
Sbjct  31    SMKQVMSIIAERDAAIQERNLAVSERKSAVAERDMAFLQRDTAIAERNNAIMERDSALTA  90

Query  779   LKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTA-  955
             L+ R++SM      +      HIH+Q  M ++    AY+  E  T+ P     PT  +A 
Sbjct  91    LQYRDNSM-----ATSRQHQPHIHHQHHMLQLTENNAYETREIGTSPP-----PTTGSAL  140

Query  956   -----NNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVD  1120
                     RKV++PK +  K+  K     K ++   +DLS      + + ++   G   D
Sbjct  141   ASAKPKRGRKVKEPKAAANKRGPK--TQRKVKKENEDDLSKIMSLDYSEEEEEAAGSKSD  198

Query  1121  ASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTI  1300
                +E            GL QV  D + MP PVCSCTG  + CYKWGNGGWQS+CCTTT+
Sbjct  199   WKSQEMM---------VGLNQVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCCTTTL  249

Query  1301  SMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG-YDLSAPLDLKDHWAKHGTNRYS  1477
             SM+PLP   +K+++RVGGRKMS SAF+KLLSRL AEG +DLS+P+DLKD WAKHGTNRY 
Sbjct  250   SMHPLPALPNKKHARVGGRKMSGSAFNKLLSRLAAEGHHDLSSPVDLKDRWAKHGTNRYI  309

Query  1478  TVK  1486
             T+K
Sbjct  310   TIK  312



>ref|XP_002313754.1| hypothetical protein POPTR_0009s12820g [Populus trichocarpa]
 gb|EEE87709.1| hypothetical protein POPTR_0009s12820g [Populus trichocarpa]
Length=301

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 138/307 (45%), Positives = 184/307 (60%), Gaps = 48/307 (16%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q N+    +  M I+ ERD AI ERN+AL E+K ALA RD A+ QR+ A+ ER+ AL 
Sbjct  38    KEQTNALAMNKKIMTILIERDDAIRERNLALAEKKEALAARDEAIQQREKALVERDKALM  97

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA++A++ RE++M+                    + +    A D  E    D   ++
Sbjct  98    ERDNALAAIQYRENAMS--------------------YPLSGGKALDTGEMHITDALPIS  137

Query  935   DPTPQTANNPRKVRQPKESKPKKASKL--ArvvkreeveveDLSWQAVSTFDDWDDGNCG  1108
               T +T     K RQ K SK  KA  L  A+  ++     EDL+ Q              
Sbjct  138   SVTAETG----KARQTKRSKENKAVGLKAAKSPRKGSRVGEDLNKQG-------------  180

Query  1109  EFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSAC  1285
                 ASD ++ K    WD +D GL  +N D + MP PVCSCTG P+ CYKWG+GGWQSAC
Sbjct  181   ----ASDGKKIKV--EWDSQDVGLNLINFDETTMPAPVCSCTGVPRQCYKWGSGGWQSAC  234

Query  1286  CTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGT  1465
             CTTT+S YPLPQ  +KR++R+GGRKMS + F++LLSRL AEG+DL+ PLDLKD+WA+HGT
Sbjct  235   CTTTMSSYPLPQMPNKRHARIGGRKMSGNVFTRLLSRLAAEGHDLAIPLDLKDYWARHGT  294

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  295   NRYITIK  301



>ref|XP_002305467.1| hypothetical protein POPTR_0004s17060g [Populus trichocarpa]
 gb|ABV53914.1| GAGA-motif binding transcriptional activator [Populus trichocarpa]
 gb|EEE85978.1| hypothetical protein POPTR_0004s17060g [Populus trichocarpa]
Length=317

 Score =   241 bits (615),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 189/308 (61%), Gaps = 31/308 (10%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q N+ +  +  M I+ ERD AI ERN+A  E+K ALA RD A+ QR+ A+AER+ AL 
Sbjct  35    KEQTNALVMNKKIMTILIERDDAIRERNLAFAEKKEALAARDEAIQQREKALAERDKALM  94

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA++A++ RE++MN         G++ I      H +  ++  D +E L +   +VT
Sbjct  95    ERDNALAAIQYRENAMNYPLSGGSQRGSKRIP-----HPVYHSS--DMSEALDSGEMHVT  147

Query  935   DPTPQT---ANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNC  1105
             +  P +   A N  K RQ K SK  KA  L               W+     +D +    
Sbjct  148   NALPISSVPAENA-KSRQTKRSKENKAVGLKAAKS---------PWKGNRVSEDLNKQG-  196

Query  1106  GEFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                  ASD ++ K    WD +D GL  +N D + M  PVCSCTG P+ CYKWG+GGWQSA
Sbjct  197   -----ASDGKKIK--VEWDSQDVGLNLINFDETTMTAPVCSCTGVPRQCYKWGSGGWQSA  249

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLPQ  +KR +RVGGRKMS + F++LLSRL AEG+DLS PLDLKD+WA+HG
Sbjct  250   CCTTTMSSYPLPQLPNKRRARVGGRKMSGNVFTRLLSRLAAEGHDLSIPLDLKDYWARHG  309

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  310   TNRYITIK  317



>gb|EPS70368.1| hypothetical protein M569_04392 [Genlisea aurea]
Length=241

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/288 (47%), Positives = 174/288 (60%), Gaps = 47/288 (16%)
 Frame = +2

Query  623   MAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRESSM  802
             MAERDAAI ERN+A+ E+K A+AERDMA+LQRD+AI+ERN A+ ERDN   AL  R +S 
Sbjct  1     MAERDAAIQERNLAISEKKAAIAERDMAILQRDSAISERNNAIIERDN---ALHFRSTST  57

Query  803   NDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNPRKVRQP  982
              + +    S GA+H+H+   +H+      YD  E+   +P             P     P
Sbjct  58    INTN--PSSTGAKHVHH---IHQ------YDEGEDDAAEPPKSHRAKRPKEPKPPPPPPP  106

Query  983   KESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQDKHLDTWD  1162
                K  K+SK A   + +E           +T  DW                       D
Sbjct  107   PSRKASKSSKRANKQQEDE-----------TTVQDWK----------------------D  133

Query  1163  EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYS  1342
             +D GL QV+ D + MPVPVCSCTG  +PCYKWGNGGWQS+CCTT +SM+PLP   +KR++
Sbjct  134   QDLGLNQVSFDETTMPVPVCSCTGVLRPCYKWGNGGWQSSCCTTNLSMHPLPAVPNKRHA  193

Query  1343  RVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             R+GGRKMS SAF+KLL+RL + G DL+ P+DLK+HWAKHGTNRY T+K
Sbjct  194   RIGGRKMSGSAFNKLLNRLASAGQDLTNPVDLKEHWAKHGTNRYITIK  241



>ref|XP_009138860.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X3 [Brassica 
rapa]
Length=301

 Score =   241 bits (614),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 141/307 (46%), Positives = 188/307 (61%), Gaps = 39/307 (13%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M+I+AERD AI ERN+A+ ERK A+AERDMA LQRD AIAERN A+ ERD+A++A
Sbjct  23    SMKQVMSIIAERDTAIQERNLAVSERKSAVAERDMAFLQRDTAIAERNNAIMERDSALTA  82

Query  779   LKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTA-  955
             L+ R++SM        +      H    M ++    AY+  E  T+ P     PT  +A 
Sbjct  83    LQYRDNSM-------ATSRQHQPHMPHHMLQLTENNAYETREIGTSPP-----PTTGSAL  130

Query  956   -----NNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVD  1120
                     RKV++PK +  K+  K                 Q     ++ DD +    +D
Sbjct  131   ASAKPKRGRKVKEPKAAANKRGPKN----------------QRKVKKENEDDLSKIMSLD  174

Query  1121  ASDEEQDKHLDT-WDED---FGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACC  1288
              S+EE+     + W  +     L QV  D + MP PVCSCTG  + CYKWGNGGWQS+CC
Sbjct  175   YSEEEEATGSKSDWKSEEMMVRLNQVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCC  234

Query  1289  TTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG-YDLSAPLDLKDHWAKHGT  1465
             TTT+SM+PLP   +K+++RVGGRKMS SAF+KLLSRL AEG +DLS+P+DLKD WAKHGT
Sbjct  235   TTTLSMHPLPALPNKKHARVGGRKMSGSAFNKLLSRLAAEGHHDLSSPVDLKDRWAKHGT  294

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  295   NRYITIK  301



>ref|XP_003532442.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform 1 [Glycine 
max]
 ref|XP_003532443.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform 2 [Glycine 
max]
 gb|KHN16871.1| Protein BASIC PENTACYSTEINE4 [Glycine soja]
Length=317

 Score =   241 bits (615),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 138/301 (46%), Positives = 187/301 (62%), Gaps = 27/301 (9%)
 Frame = +2

Query  593   NSTIRTYMAIMAERDAAILERNM--ALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             N  IR+   IMAER AAILE  +  A+ E+  ALA RD A+ QRD A+A+R+ AL ERDN
Sbjct  41    NKKIRS---IMAERQAAILEIELETAISEKNEALAARDAAIQQRDEALAQRDNALLERDN  97

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTP  946
             A++AL+ R +S+N         G++ +H+       ++ AAY   + +  D   VT   P
Sbjct  98    ALAALQSRNNSVNFPFGGGIQCGSKRMHHSSNHLSNMTEAAYSTKDMIIRDASPVT-VIP  156

Query  947   QTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDAS  1126
               A N  + ++ K++K    SK ++   + +   EDL+ QA S                 
Sbjct  157   SEAVNSHQAKRTKQNKVIN-SKASKPPCKVKKMGEDLNRQASS-----------------  198

Query  1127  DEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTIS  1303
               E  K    WD +D GL  V  D + MPVPVC+CTG P+ CYKWGNGGWQS+CCTTT+S
Sbjct  199   --EGTKIRSEWDKQDVGLNLVAFDETIMPVPVCTCTGIPRQCYKWGNGGWQSSCCTTTLS  256

Query  1304  MYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTV  1483
             MYPLPQ  +KR++R+GGRKMS S F++LLSRL +EG+DLS PLDLK++WA+HGTNRY T+
Sbjct  257   MYPLPQLPNKRHARIGGRKMSGSVFTRLLSRLVSEGHDLSIPLDLKEYWARHGTNRYITI  316

Query  1484  K  1486
             K
Sbjct  317   K  317



>ref|XP_008382361.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Malus domestica]
 ref|XP_008365904.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X3 [Malus 
domestica]
 ref|XP_008365905.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X3 [Malus 
domestica]
 ref|XP_008365906.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X3 [Malus 
domestica]
Length=311

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 138/297 (46%), Positives = 188/297 (63%), Gaps = 31/297 (10%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+A+RDAAI ERN AL E+  ALA RD A+ QRD A+ +R++AL ERDNA +AL 
Sbjct  43    KKIMSIIADRDAAIRERNAALAEKNEALAARDEALRQRDEALTQRDSALMERDNAYAALH  102

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
              R++++N         GA+ +  +   H +  A  +  T+++     ++T+  P +  +P
Sbjct  103   SRDNAVNFPLGGGAQRGAKRVQ-RPSNHSVTLADVHYSTKDV-----HITEAYPISVISP  156

Query  965   RKV--RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
               V  RQ K +K  KAS+     +  +   EDL+ QA S      DG             
Sbjct  157   EAVKSRQTKRAKENKASR---AKQSRKKVGEDLNRQASS------DG-------------  194

Query  1139  DKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPL  1315
              K+   WD  D GL  V+ D S MPVPVCSCTG P+ CYKWGNGGWQS+CCTT +SMYPL
Sbjct  195   IKYKSEWDTHDLGLNLVSFDESTMPVPVCSCTGIPRQCYKWGNGGWQSSCCTTHMSMYPL  254

Query  1316  PQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             PQ  +KR++R+GGRKMS S F++LLSRL A+G+DLS PLDLK++WA+HGTNRY T+K
Sbjct  255   PQMPNKRHARMGGRKMSGSVFTRLLSRLAADGHDLSIPLDLKEYWARHGTNRYITIK  311



>ref|XP_009399389.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=317

 Score =   241 bits (614),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 189/318 (59%), Gaps = 26/318 (8%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             + N TI+    IMAERD A+ ER++A+ E+K AL ERDMA LQRDAAIAERN A+ ERDN
Sbjct  8     KENQTIKL---IMAERDKALQERDLAISEKKAALVERDMAYLQRDAAIAERNNAIVERDN  64

Query  767   AISALKL-RESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYD-----PTENLTNDPFN  928
             AI++L+  RE+ M+     S  PG    H+  +         +      P++ L +    
Sbjct  65    AIASLEYARENGMS----ASCGPGCPSGHHGSKHTYHYHHQQHLQHIHPPSQQLVDASGQ  120

Query  929   VTDPT----PQTANNPRKVRQPKESKPKKASK-----LArvvkreeveveDLSWQAV--S  1075
               D      P +A +   V+  K  +  K +K     L +  K +    ++ S Q     
Sbjct  121   KKDAQGEMFPISAASETGVKALKAKRGGKVTKVQSSSLKKPRKSKRGGGDNFSKQVTIAK  180

Query  1076  TFDDWDDGNCGEFVDASDE-EQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCY  1252
                +W  G  G   D + +    KH +   +D GL QV  D + MPVPVCSCTG  + CY
Sbjct  181   KAGEWR-GEVGIGEDLTKQVSMAKHHEWKSQDLGLNQVAYDDTTMPVPVCSCTGKYRQCY  239

Query  1253  KWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPL  1432
             KWGNGGWQSACCT T+SMYPLP   +KR++RVGGRKMS SAF KLLSRL +EG+DLS P+
Sbjct  240   KWGNGGWQSACCTMTLSMYPLPVMPNKRHARVGGRKMSGSAFRKLLSRLASEGHDLSLPV  299

Query  1433  DLKDHWAKHGTNRYSTVK  1486
             DL++HWAKHGTNRY T+K
Sbjct  300   DLREHWAKHGTNRYITIK  317



>ref|XP_009138858.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Brassica 
rapa]
 ref|XP_009138859.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Brassica 
rapa]
Length=305

 Score =   240 bits (613),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 141/307 (46%), Positives = 188/307 (61%), Gaps = 39/307 (13%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M+I+AERD AI ERN+A+ ERK A+AERDMA LQRD AIAERN A+ ERD+A++A
Sbjct  27    SMKQVMSIIAERDTAIQERNLAVSERKSAVAERDMAFLQRDTAIAERNNAIMERDSALTA  86

Query  779   LKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTA-  955
             L+ R++SM        +      H    M ++    AY+  E  T+ P     PT  +A 
Sbjct  87    LQYRDNSM-------ATSRQHQPHMPHHMLQLTENNAYETREIGTSPP-----PTTGSAL  134

Query  956   -----NNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVD  1120
                     RKV++PK +  K+  K                 Q     ++ DD +    +D
Sbjct  135   ASAKPKRGRKVKEPKAAANKRGPKN----------------QRKVKKENEDDLSKIMSLD  178

Query  1121  ASDEEQDKHLDT-WDED---FGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACC  1288
              S+EE+     + W  +     L QV  D + MP PVCSCTG  + CYKWGNGGWQS+CC
Sbjct  179   YSEEEEATGSKSDWKSEEMMVRLNQVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCC  238

Query  1289  TTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG-YDLSAPLDLKDHWAKHGT  1465
             TTT+SM+PLP   +K+++RVGGRKMS SAF+KLLSRL AEG +DLS+P+DLKD WAKHGT
Sbjct  239   TTTLSMHPLPALPNKKHARVGGRKMSGSAFNKLLSRLAAEGHHDLSSPVDLKDRWAKHGT  298

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  299   NRYITIK  305



>ref|XP_009138854.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
 ref|XP_009138855.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
 ref|XP_009138856.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
 ref|XP_009138857.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
Length=306

 Score =   240 bits (613),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 141/307 (46%), Positives = 188/307 (61%), Gaps = 39/307 (13%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M+I+AERD AI ERN+A+ ERK A+AERDMA LQRD AIAERN A+ ERD+A++A
Sbjct  28    SMKQVMSIIAERDTAIQERNLAVSERKSAVAERDMAFLQRDTAIAERNNAIMERDSALTA  87

Query  779   LKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTA-  955
             L+ R++SM        +      H    M ++    AY+  E  T+ P     PT  +A 
Sbjct  88    LQYRDNSM-------ATSRQHQPHMPHHMLQLTENNAYETREIGTSPP-----PTTGSAL  135

Query  956   -----NNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVD  1120
                     RKV++PK +  K+  K                 Q     ++ DD +    +D
Sbjct  136   ASAKPKRGRKVKEPKAAANKRGPKN----------------QRKVKKENEDDLSKIMSLD  179

Query  1121  ASDEEQDKHLDT-WDED---FGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACC  1288
              S+EE+     + W  +     L QV  D + MP PVCSCTG  + CYKWGNGGWQS+CC
Sbjct  180   YSEEEEATGSKSDWKSEEMMVRLNQVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCC  239

Query  1289  TTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG-YDLSAPLDLKDHWAKHGT  1465
             TTT+SM+PLP   +K+++RVGGRKMS SAF+KLLSRL AEG +DLS+P+DLKD WAKHGT
Sbjct  240   TTTLSMHPLPALPNKKHARVGGRKMSGSAFNKLLSRLAAEGHHDLSSPVDLKDRWAKHGT  299

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  300   NRYITIK  306



>ref|XP_008365901.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X2 [Malus 
domestica]
 ref|XP_008365902.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X2 [Malus 
domestica]
Length=337

 Score =   241 bits (615),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 138/297 (46%), Positives = 188/297 (63%), Gaps = 31/297 (10%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+A+RDAAI ERN AL E+  ALA RD A+ QRD A+ +R++AL ERDNA +AL 
Sbjct  69    KKIMSIIADRDAAIRERNAALAEKNEALAARDEALRQRDEALTQRDSALMERDNAYAALH  128

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
              R++++N         GA+ +  +   H +  A  +  T+++     ++T+  P +  +P
Sbjct  129   SRDNAVNFPLGGGAQRGAKRVQ-RPSNHSVTLADVHYSTKDV-----HITEAYPISVISP  182

Query  965   RKV--RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
               V  RQ K +K  KAS+     +  +   EDL+ QA S      DG             
Sbjct  183   EAVKSRQTKRAKENKASR---AKQSRKKVGEDLNRQASS------DG-------------  220

Query  1139  DKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPL  1315
              K+   WD  D GL  V+ D S MPVPVCSCTG P+ CYKWGNGGWQS+CCTT +SMYPL
Sbjct  221   IKYKSEWDTHDLGLNLVSFDESTMPVPVCSCTGIPRQCYKWGNGGWQSSCCTTHMSMYPL  280

Query  1316  PQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             PQ  +KR++R+GGRKMS S F++LLSRL A+G+DLS PLDLK++WA+HGTNRY T+K
Sbjct  281   PQMPNKRHARMGGRKMSGSVFTRLLSRLAADGHDLSIPLDLKEYWARHGTNRYITIK  337



>ref|XP_004148546.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis sativus]
 gb|KGN43188.1| hypothetical protein Csa_7G007860 [Cucumis sativus]
Length=313

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 132/295 (45%), Positives = 178/295 (60%), Gaps = 24/295 (8%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+AERDAAI ERN+AL E+K ALA RD A+ QRD A+ +R++AL ERDNA++AL+
Sbjct  42    KKIMSIIAERDAAIRERNLALSEKKEALAARDEALRQRDEALVQRDSALMERDNALAALE  101

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
             +R+++ N           + +H+       IS  +Y   +    D F    P    A+  
Sbjct  102   IRDNASNFPLGGGVQRKTKRLHHLSNHMPNISETSYGTKDVHITDAF----PITVIASEA  157

Query  965   RKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQDK  1144
              K +Q K +K  K           +   EDL+  A +      DG              K
Sbjct  158   VKSQQGKRAKDNKLVSSKTSRPPRKKVGEDLNRHAAT------DGT-------------K  198

Query  1145  HLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQ  1321
             +   WD +D GL  V+ D S+MP P+CSCTG  + CYKWGNGGWQS+CCTT +SMYPLP 
Sbjct  199   YRTDWDGQDVGLNLVSFDDSSMPAPICSCTGFARQCYKWGNGGWQSSCCTTHMSMYPLPH  258

Query  1322  ASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
               +KR++R+GGRKMS S F+KLLSRL A G+DLS P+DLKDHWA+HGTNRY T++
Sbjct  259   LENKRHARMGGRKMSGSVFTKLLSRLAAAGHDLSVPVDLKDHWARHGTNRYITIR  313



>gb|ABK93737.1| unknown [Populus trichocarpa]
Length=317

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/308 (46%), Positives = 189/308 (61%), Gaps = 31/308 (10%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q N+ +  +  M I+ ERD AI ERN+A  E+K ALA RD A+ QR+ A+AER+ AL 
Sbjct  35    KEQTNALVMNKKIMTILIERDDAIRERNLAFAEKKEALAARDEAIQQREKALAERDKALM  94

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA++A++ RE++MN         G++ I      H +  ++  D +E L +   +VT
Sbjct  95    ERDNALAAIQYRENAMNYPLSGGSQRGSKRIP-----HPVYHSS--DMSEALDSGEMHVT  147

Query  935   DPTPQT---ANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNC  1105
             +  P +   A N  K RQ K SK  KA  L               W+     +D +    
Sbjct  148   NALPISSVPAENA-KSRQTKRSKENKAVGLKAAKS---------PWKGNRVSEDLNKQG-  196

Query  1106  GEFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                  ASD ++ K    WD +D GL  +N D + M  PVCSCTG P+ CY+WG+GGWQSA
Sbjct  197   -----ASDGKKIK--VEWDSQDVGLNLINFDETTMTAPVCSCTGVPRQCYRWGSGGWQSA  249

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLPQ  +KR +RVGGRKMS + F++LLSRL AEG+DLS PLDLKD+WA+HG
Sbjct  250   CCTTTMSSYPLPQLPNKRRARVGGRKMSGNVFTRLLSRLAAEGHDLSIPLDLKDYWARHG  309

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  310   TNRYITIK  317



>ref|XP_004172323.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis sativus]
Length=337

 Score =   241 bits (614),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 132/295 (45%), Positives = 178/295 (60%), Gaps = 24/295 (8%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+AERDAAI ERN+AL E+K ALA RD A+ QRD A+ +R++AL ERDNA++AL+
Sbjct  66    KKIMSIIAERDAAIRERNLALSEKKEALAARDEALRQRDEALVQRDSALMERDNALAALE  125

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
             +R+++ N           + +H+       IS  +Y   +    D F    P    A+  
Sbjct  126   IRDNASNFPLGGGVQRKTKRLHHLSNHMPNISETSYGTKDVHITDAF----PITVIASEA  181

Query  965   RKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQDK  1144
              K +Q K +K  K           +   EDL+  A +      DG              K
Sbjct  182   VKSQQGKRAKDNKLVSSKTSRPPRKKVGEDLNRHAAT------DGT-------------K  222

Query  1145  HLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQ  1321
             +   WD +D GL  V+ D S+MP P+CSCTG  + CYKWGNGGWQS+CCTT +SMYPLP 
Sbjct  223   YRTDWDGQDVGLNLVSFDDSSMPAPICSCTGFARQCYKWGNGGWQSSCCTTHMSMYPLPH  282

Query  1322  ASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
               +KR++R+GGRKMS S F+KLLSRL A G+DLS P+DLKDHWA+HGTNRY T++
Sbjct  283   LENKRHARMGGRKMSGSVFTKLLSRLAAAGHDLSVPVDLKDHWARHGTNRYITIR  337



>ref|XP_011037231.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Populus euphratica]
 ref|XP_011037232.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Populus euphratica]
Length=317

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/308 (46%), Positives = 189/308 (61%), Gaps = 31/308 (10%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q N+ +  +  M I+ ERD AI ERN+AL E+K ALA RD A+ QR+ A+ ER+ AL 
Sbjct  35    KEQTNALVMNKKIMTILIERDDAIRERNLALAEKKEALAARDEAIQQREKALVERDKALM  94

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA+++++ RE++MN         G++ I      H +  ++  D +E L +   +VT
Sbjct  95    ERDNALASIQCRENAMNYPLSGGSQRGSKRIP-----HPVYHSS--DMSEALDSGEMHVT  147

Query  935   DPTPQT---ANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNC  1105
             +  P +   A N  K RQ K SK  KA  L               W+     +D +    
Sbjct  148   NALPLSSVPAENA-KSRQTKRSKENKAVGLKAAKS---------PWKGNRVSEDLNKQG-  196

Query  1106  GEFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                  ASD ++ K    WD +D GL  +N D + M  PVCSCTG P+ CYKWG+GGWQSA
Sbjct  197   -----ASDGKKIK--VEWDSQDVGLNLINFDETTMTAPVCSCTGVPRQCYKWGSGGWQSA  249

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLPQ  +KR +RVGGRKMS + F++LLSRL AEG+DLS PLDLKD+WA+HG
Sbjct  250   CCTTTLSSYPLPQMPNKRRARVGGRKMSGNVFTRLLSRLAAEGHDLSIPLDLKDYWARHG  309

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  310   TNRYITIK  317



>ref|XP_008365900.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X1 [Malus 
domestica]
Length=338

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 138/297 (46%), Positives = 188/297 (63%), Gaps = 31/297 (10%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+A+RDAAI ERN AL E+  ALA RD A+ QRD A+ +R++AL ERDNA +AL 
Sbjct  70    KKIMSIIADRDAAIRERNAALAEKNEALAARDEALRQRDEALTQRDSALMERDNAYAALH  129

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
              R++++N         GA+ +  +   H +  A  +  T+++     ++T+  P +  +P
Sbjct  130   SRDNAVNFPLGGGAQRGAKRVQ-RPSNHSVTLADVHYSTKDV-----HITEAYPISVISP  183

Query  965   RKV--RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
               V  RQ K +K  KAS+     +  +   EDL+ QA S      DG             
Sbjct  184   EAVKSRQTKRAKENKASR---AKQSRKKVGEDLNRQASS------DG-------------  221

Query  1139  DKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPL  1315
              K+   WD  D GL  V+ D S MPVPVCSCTG P+ CYKWGNGGWQS+CCTT +SMYPL
Sbjct  222   IKYKSEWDTHDLGLNLVSFDESTMPVPVCSCTGIPRQCYKWGNGGWQSSCCTTHMSMYPL  281

Query  1316  PQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             PQ  +KR++R+GGRKMS S F++LLSRL A+G+DLS PLDLK++WA+HGTNRY T+K
Sbjct  282   PQMPNKRHARMGGRKMSGSVFTRLLSRLAADGHDLSIPLDLKEYWARHGTNRYITIK  338



>ref|XP_009399386.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009399387.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009399388.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=341

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 189/318 (59%), Gaps = 26/318 (8%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             + N TI+    IMAERD A+ ER++A+ E+K AL ERDMA LQRDAAIAERN A+ ERDN
Sbjct  32    KENQTIKL---IMAERDKALQERDLAISEKKAALVERDMAYLQRDAAIAERNNAIVERDN  88

Query  767   AISALKL-RESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYD-----PTENLTNDPFN  928
             AI++L+  RE+ M+     S  PG    H+  +         +      P++ L +    
Sbjct  89    AIASLEYARENGMS----ASCGPGCPSGHHGSKHTYHYHHQQHLQHIHPPSQQLVDASGQ  144

Query  929   VTDPT----PQTANNPRKVRQPKESKPKKASK-----LArvvkreeveveDLSWQAV--S  1075
               D      P +A +   V+  K  +  K +K     L +  K +    ++ S Q     
Sbjct  145   KKDAQGEMFPISAASETGVKALKAKRGGKVTKVQSSSLKKPRKSKRGGGDNFSKQVTIAK  204

Query  1076  TFDDWDDGNCGEFVDASDE-EQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCY  1252
                +W  G  G   D + +    KH +   +D GL QV  D + MPVPVCSCTG  + CY
Sbjct  205   KAGEWR-GEVGIGEDLTKQVSMAKHHEWKSQDLGLNQVAYDDTTMPVPVCSCTGKYRQCY  263

Query  1253  KWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPL  1432
             KWGNGGWQSACCT T+SMYPLP   +KR++RVGGRKMS SAF KLLSRL +EG+DLS P+
Sbjct  264   KWGNGGWQSACCTMTLSMYPLPVMPNKRHARVGGRKMSGSAFRKLLSRLASEGHDLSLPV  323

Query  1433  DLKDHWAKHGTNRYSTVK  1486
             DL++HWAKHGTNRY T+K
Sbjct  324   DLREHWAKHGTNRYITIK  341



>ref|XP_009379566.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X2 [Pyrus 
x bretschneideri]
Length=285

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/298 (45%), Positives = 188/298 (63%), Gaps = 33/298 (11%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+AERDAAI ERN AL E+  ALA RD A+ QRD A+A+R++A+ ERDNA +AL 
Sbjct  17    KKIMSIIAERDAAIRERNAALAEKNEALAARDEALRQRDEALAQRDSAMMERDNAYAALH  76

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD--PTPQTAN  958
              R++++N         GA+ +H +   H +  A A+  T+++     ++T+  P    + 
Sbjct  77    SRDNAVNFPLGGGAPRGAKRMH-RPSNHSVTLADAHYSTKDM-----HITEAYPVSLIST  130

Query  959   NPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVD-ASDEE  1135
                K RQ K +K  KAS+  +            SW+ V           GE ++  +  +
Sbjct  131   EDVKSRQTKRAKENKASRARQ------------SWKKV-----------GEDLNRQASSD  167

Query  1136  QDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYP  1312
               K+   WD  D GL  V  D SAMPVPVCSCTG P+ CYKWGNGGWQS+CC T +SMYP
Sbjct  168   GIKYRSEWDAHDLGLNLVTFDESAMPVPVCSCTGIPRQCYKWGNGGWQSSCCPTHMSMYP  227

Query  1313  LPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             LPQ  +KR++R+GGRKMS + F++LLSRL A+G+DLS PLDLK++W++HGTNRY T+K
Sbjct  228   LPQMPNKRHARMGGRKMSGNVFTRLLSRLAADGHDLSIPLDLKEYWSRHGTNRYITIK  285



>ref|XP_008448032.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448033.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448034.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448035.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448036.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448037.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448038.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
 ref|XP_008448039.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Cucumis melo]
Length=313

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/295 (45%), Positives = 178/295 (60%), Gaps = 24/295 (8%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+AERDAAI ERN+AL E+K ALA RD A+ QRD A+ +R++AL ERDNA++AL+
Sbjct  42    KKIMSIIAERDAAIRERNLALSEKKDALAARDEALRQRDEALVQRDSALMERDNALAALE  101

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP  964
             +R+++ N           + +H+       IS  +Y   +    D F    P    A+  
Sbjct  102   IRDNASNFPLGGGVQRKTKRLHHLSNHMPNISETSYGTKDVHITDAF----PITVIASEA  157

Query  965   RKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQDK  1144
              K +Q K +K  K           +   EDL+  A +      DG              K
Sbjct  158   VKSQQGKRAKDNKLVSSKTSKPPRKKVGEDLNRHAAT------DGT-------------K  198

Query  1145  HLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQ  1321
             +   WD +D GL  V+ D S+MP P+CSCTG  + CYKWGNGGWQS+CCTT +SMYPLP 
Sbjct  199   YRTDWDGQDVGLNLVSFDDSSMPAPICSCTGFARQCYKWGNGGWQSSCCTTHMSMYPLPH  258

Query  1322  ASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
               +KR++R+GGRKMS S F+KLLSRL A G+DLS P+DLKDHWA+HGTNRY T++
Sbjct  259   LENKRHARMGGRKMSGSVFTKLLSRLAAAGHDLSVPVDLKDHWARHGTNRYITIR  313



>gb|ABC25623.1| GAGA-binding transcriptional activator [Olimarabidopsis pumila]
 gb|ABC25624.1| GAGA-binding transcriptional activator [Olimarabidopsis pumila]
Length=338

 Score =   240 bits (612),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 148/327 (45%), Positives = 194/327 (59%), Gaps = 34/327 (10%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+++AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  19    QHQPSMKQVMSMIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAIMERDS  78

Query  767   AISALKLRESSMNDEDIVSKS---PGAE------------HIHYQQEMHEMISAAAYDPT  901
             A++AL+ RE+SM      + S   PG +              H+ Q     ++  AY+  
Sbjct  79    ALTALQYRENSMVTAAATNMSVCPPGCQISRGVKHMHHPHMHHHHQHHIPQLTENAYETR  138

Query  902   ENLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTF  1081
             E   ND      PT Q A +  +  +PK  K  K  K        +   ++   Q     
Sbjct  139   EMEPNDVL----PTSQPAGSALESAKPKRGKRVKDPKATTQTAANKRGPKN---QRKVKK  191

Query  1082  DDWDDGNCGEFV----DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMPVPVCSC  1228
             +  DD     FV    D ++E+  KH+       W   E  GL QV  D + MP PVCSC
Sbjct  192   ESEDDLTKIMFVKTTHDYTEEDSSKHILIGSKSDWKSQEMVGLNQVVYDETTMPPPVCSC  251

Query  1229  TGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAE  1408
             TG  + CYKWGNGGWQS+CCTTT+SMYPLP   +KR++RVG  KMS SAF+KLLSRL AE
Sbjct  252   TGILRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGDGKMSGSAFNKLLSRLAAE  311

Query  1409  G-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             G +DLS P+DLKDHWAKHGT+RY T+K
Sbjct  312   GHHDLSNPVDLKDHWAKHGTDRYITIK  338



>ref|NP_001141822.1| BBR/BPC transcription factor [Zea mays]
 ref|XP_008658294.1| PREDICTED: BBR/BPC transcription factor isoform X1 [Zea mays]
 gb|ACF87113.1| unknown [Zea mays]
 gb|ACG36592.1| GAGA-binding transcriptional activator [Zea mays]
 gb|ACR34757.1| unknown [Zea mays]
 gb|ADX60201.1| BBR/BPC transcription factor [Zea mays]
 gb|AFW86020.1| GAGA-binding transcriptional activator isoform 1 [Zea mays]
 gb|AFW86021.1| GAGA-binding transcriptional activator isoform 2 [Zea mays]
 gb|AFW86022.1| GAGA-binding transcriptional activator isoform 3 [Zea mays]
Length=330

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 139/305 (46%), Positives = 190/305 (62%), Gaps = 28/305 (9%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             +A+M E+D+AI ER+ AL E+K A+AERDMA  QRDAA+AERN A+ ERDNA++AL+L  
Sbjct  40    LALMNEKDSAIRERDHALAEKKAAIAERDMAFAQRDAAMAERNAAIVERDNALAALELAR  99

Query  794   SS---MNDEDIVSKSP---GAEHIHYQQEMHEMISAAAYDPTENLTNDPF------NVTD  937
             ++   MN  +   + P   G ++IH+    H+ +S     P + L N P+      ++++
Sbjct  100   TNGFNMNSGNGFHQGPPLNGTKNIHH----HDHLSHVQTSPLQ-LANSPYDHVREMHISE  154

Query  938   PTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFV  1117
               P  A  P  V + K  KP+K++  A   KR    +     +      DW   N G   
Sbjct  155   AYP-IATAPASVGKAK--KPRKSNSQASPSKRPSGVLR----KTKKATSDWK--NAGTTG  205

Query  1118  DASDEEQDKHL-DTW-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCT  1291
              A D  +   + + W D+D GL QV  D S MP P CSCTG    CYKWG+GGWQS+CCT
Sbjct  206   GAGDSARASVMKNEWKDQDLGLNQVVFDESTMPAPACSCTGELHQCYKWGSGGWQSSCCT  265

Query  1292  TTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNR  1471
               +SM+PLP   ++R++R+GGRKMS  AF+KLLSRL AEG+DLS P+DLKDHWAKHGTNR
Sbjct  266   MNMSMHPLPVMPNRRHARMGGRKMSGGAFAKLLSRLAAEGHDLSTPVDLKDHWAKHGTNR  325

Query  1472  YSTVK  1486
             Y T++
Sbjct  326   YITIR  330



>ref|XP_009116705.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Brassica 
rapa]
 ref|XP_009116706.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X2 [Brassica 
rapa]
Length=296

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 143/299 (48%), Positives = 183/299 (61%), Gaps = 37/299 (12%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+A++A
Sbjct  32    SMKQVMSIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAIMERDSALAA  91

Query  779   LKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTAN  958
             L+ R+SSM+               +Q  +H M+       TEN        T+ +P    
Sbjct  92    LQYRDSSMSTSR-----------QHQPHIHHMLQV-----TENTYET--RETETSPPPPT  133

Query  959   NPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
              P++ R+ KE K   A+K                 Q     ++ DD     F    DEE 
Sbjct  134   KPKRGRKAKEPKAAPANKRGPKT------------QRKVKKENEDDLTKLMF----DEEA  177

Query  1139  DKHLDTW--DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYP  1312
                   W   E  GL +V  D + MP PVCSCTG  + CYKWGNGGWQS+CCTTT+SM+P
Sbjct  178   TGSKSDWRGQETVGLNRVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCCTTTLSMHP  237

Query  1313  LPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             LP   +K+++RVGGRKMS SAFSKLLSRL AEG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  238   LPALPNKKHARVGGRKMSGSAFSKLLSRLAAEGHHDLSNPVDLKDHWAKHGTNRYITIK  296



>ref|XP_010531487.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Tarenaya hassleriana]
 ref|XP_010531488.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Tarenaya hassleriana]
Length=296

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 187/308 (61%), Gaps = 51/308 (17%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN AL  ++ ALA RD A+ QRD A++ER+ AL 
Sbjct  34    KEQHNALVMNKKIMSILAERDAAVQERNEALSAKREALAARDEALQQRDKALSERDNALM  93

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA++AL+ R SS+N      K              +M+ A      E L ++ F ++
Sbjct  94    ERDNALAALQYRGSSLNFPLSCGK-------------RDMVEAINTGEGETLISEAFPIS  140

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFD----DWDDGN  1102
                 + A++  K+ + KESKP ++          +   EDL+ +A S       DW+  +
Sbjct  141   TIPAEAASS--KLTKRKESKPVRSK--------GKKVGEDLNQRAASLGKKCRTDWE--S  188

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
             C                    D GL  V  D + MPVPVC+CTG+   CYKWGNGGWQS+
Sbjct  189   C--------------------DVGLNLVAFDETTMPVPVCTCTGSAHQCYKWGNGGWQSS  228

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLPQ  +KR+SR+GGRKMS S F++LLSRL AEG+DLS P+DLKD+WA+HG
Sbjct  229   CCTTTLSQYPLPQMPNKRHSRMGGRKMSGSVFTRLLSRLAAEGHDLSFPVDLKDYWARHG  288

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  289   TNRYITIK  296



>ref|XP_009116701.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
 ref|XP_009116702.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
 ref|XP_009116703.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
 ref|XP_009116704.1| PREDICTED: protein BASIC PENTACYSTEINE6-like isoform X1 [Brassica 
rapa]
Length=297

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 143/299 (48%), Positives = 183/299 (61%), Gaps = 37/299 (12%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+A++A
Sbjct  33    SMKQVMSIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAIMERDSALAA  92

Query  779   LKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTAN  958
             L+ R+SSM+               +Q  +H M+       TEN        T+ +P    
Sbjct  93    LQYRDSSMSTSR-----------QHQPHIHHMLQV-----TENTYET--RETETSPPPPT  134

Query  959   NPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
              P++ R+ KE K   A+K                 Q     ++ DD     F    DEE 
Sbjct  135   KPKRGRKAKEPKAAPANKRGPKT------------QRKVKKENEDDLTKLMF----DEEA  178

Query  1139  DKHLDTW--DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYP  1312
                   W   E  GL +V  D + MP PVCSCTG  + CYKWGNGGWQS+CCTTT+SM+P
Sbjct  179   TGSKSDWRGQETVGLNRVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCCTTTLSMHP  238

Query  1313  LPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             LP   +K+++RVGGRKMS SAFSKLLSRL AEG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  239   LPALPNKKHARVGGRKMSGSAFSKLLSRLAAEGHHDLSNPVDLKDHWAKHGTNRYITIK  297



>ref|XP_010555253.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Tarenaya hassleriana]
 ref|XP_010555254.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Tarenaya hassleriana]
Length=295

 Score =   237 bits (605),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 183/310 (59%), Gaps = 55/310 (18%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAAI ERN AL  ++ ALA RD A+ QRD A++ER+ AL 
Sbjct  33    KEQHNALVMNKKIMSILAERDAAIQERNEALSAKREALAARDEALQQRDKALSERDNALM  92

Query  755   ERDNAISALKLRESSMN-DEDIVSKSPGAEHIHY-QQEMHEMISAAAYDPTENLTNDPFN  928
             ERDNAI+AL+ RE+S+N      S+S  AE I+  +  + E    +A  P          
Sbjct  93    ERDNAIAALQYRENSLNFPLKHSSQSDMAEAINTGETHIPEAFPISAISP----------  142

Query  929   VTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDD  1096
               +PT       +K R+P +SK KK  +             DL+ +  S       DWD 
Sbjct  143   --EPTNMKLTKRKKERKPVQSKGKKVGE-------------DLNRRVASPGKRCRTDWD-  186

Query  1097  GNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQ  1276
                                    D GL  V  D + MPVPVC+CTG+   CYKWGNGGWQ
Sbjct  187   ---------------------STDVGLNLVIFDETTMPVPVCTCTGSVHHCYKWGNGGWQ  225

Query  1277  SACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAK  1456
             S+CCTTT+S YPLPQ  +KR+SR+GGRKMS S F +LLSRL AEG+DLS P+DLKD+WA+
Sbjct  226   SSCCTTTLSQYPLPQMLNKRHSRMGGRKMSGSVFMRLLSRLAAEGHDLSCPVDLKDYWAR  285

Query  1457  HGTNRYSTVK  1486
             HGTNRY T+K
Sbjct  286   HGTNRYITIK  295



>ref|XP_009379565.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X1 [Pyrus 
x bretschneideri]
Length=311

 Score =   238 bits (607),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 135/298 (45%), Positives = 188/298 (63%), Gaps = 33/298 (11%)
 Frame = +2

Query  605   RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALK  784
             +  M+I+AERDAAI ERN AL E+  ALA RD A+ QRD A+A+R++A+ ERDNA +AL 
Sbjct  43    KKIMSIIAERDAAIRERNAALAEKNEALAARDEALRQRDEALAQRDSAMMERDNAYAALH  102

Query  785   LRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD--PTPQTAN  958
              R++++N         GA+ +H +   H +  A A+  T+++     ++T+  P    + 
Sbjct  103   SRDNAVNFPLGGGAPRGAKRMH-RPSNHSVTLADAHYSTKDM-----HITEAYPVSLIST  156

Query  959   NPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVD-ASDEE  1135
                K RQ K +K  KAS+  +            SW+ V           GE ++  +  +
Sbjct  157   EDVKSRQTKRAKENKASRARQ------------SWKKV-----------GEDLNRQASSD  193

Query  1136  QDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYP  1312
               K+   WD  D GL  V  D SAMPVPVCSCTG P+ CYKWGNGGWQS+CC T +SMYP
Sbjct  194   GIKYRSEWDAHDLGLNLVTFDESAMPVPVCSCTGIPRQCYKWGNGGWQSSCCPTHMSMYP  253

Query  1313  LPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             LPQ  +KR++R+GGRKMS + F++LLSRL A+G+DLS PLDLK++W++HGTNRY T+K
Sbjct  254   LPQMPNKRHARMGGRKMSGNVFTRLLSRLAADGHDLSIPLDLKEYWSRHGTNRYITIK  311



>gb|ABG57061.1| GAGA-binding transcriptional activator [Cardamine pratensis]
 gb|ABG57062.1| GAGA-binding transcriptional activator [Cardamine pratensis]
Length=342

 Score =   239 bits (609),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 194/328 (59%), Gaps = 35/328 (11%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+I+AER AAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  22    QHQPSMKQVMSIIAERGAAIQERNLAISEKKAAIAERDMAFLQRDTAIAERNNAIMERDS  81

Query  767   AISALKLRESSMNDEDIVSKS----PGAEHIHYQQEMHE------------MISAAAYDP  898
             A++AL+ RE+SM +    +      PG +     + +H              ++  AY+ 
Sbjct  82    ALTALQYRENSMVNAAAAANMSACPPGCQISRGVKHLHHPHMHHHHQHNVPQLTDNAYET  141

Query  899   TENLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVST  1078
              E   ND    + PT     + +  R  +   PK  ++ A   +  +        Q    
Sbjct  142   REMEPNDGLPTSTPTGSALESAKPKRGKRVKDPKATTQTAANKRGPKS-------QRKVK  194

Query  1079  FDDWDDGNCGEFV----DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMPVPVCS  1225
              ++ DD     FV    D ++E+  KH+       W   E  GL QV  D + MP P+CS
Sbjct  195   KENEDDLTKIMFVKSTHDYTEEDSSKHILIGSKSDWKNQEMVGLNQVVYDETTMPPPICS  254

Query  1226  CTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTA  1405
             CTG  + CYKWGNGGWQS+CCTTT+SMYPLP   +KR +RVGGRKMS SAF+KLLSRL A
Sbjct  255   CTGILRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRRARVGGRKMSGSAFNKLLSRLAA  314

Query  1406  EG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             EG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  315   EGHHDLSNPVDLKDHWAKHGTNRYITIK  342



>ref|XP_008779943.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779949.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779953.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779960.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779965.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779971.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
 ref|XP_008779973.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
Length=351

 Score =   239 bits (609),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 155/323 (48%), Positives = 194/323 (60%), Gaps = 30/323 (9%)
 Frame = +2

Query  593   NSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAI  772
             N TI+  MAIMAERD AI ERN+AL E+K ALAERDMA+LQRDAAIAERN A+ ERDNAI
Sbjct  34    NHTIKI-MAIMAERDNAIQERNIALAEKKAALAERDMAILQRDAAIAERNNAIMERDNAI  92

Query  773   SALKL-RESSMNDEDIVSKSPG--AEHIHYQQEMHEMISAAAYDPTE-NLTNDPFN----  928
             +AL+  RE+ +N     +  PG  A         H+        P+   L++ P+N    
Sbjct  93    AALQYARENGLNGNGASACPPGCTAPRGTKHIHHHQQQHLQHIHPSPPQLSDAPYNHTRE  152

Query  929   --VTDPTPQTANNPRKVRQPKESKPKKASK---------LArvvkreeveveDLSWQAV-  1072
               +T+  P +  +    +  K  +P+K +K              K  +   EDL+ Q   
Sbjct  153   MHITEAFPISTASESIAKGRKAKRPRKETKAQNSPSKKSSKSPRKSRKGGGEDLNRQVTI  212

Query  1073  -STFDDWDDGNCGEFVDASDEEQD----KHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGT  1237
                  +W +    E     D  +     KH +   +D GL QV  D + MP PVCSCTG 
Sbjct  213   AKPASEWRN----EIRGGDDLNKQVALTKHQEWKGQDLGLNQVTFDEATMPTPVCSCTGK  268

Query  1238  PQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYD  1417
              QPCYKWGNGGWQSACCTTT+SMYPLP   +KR++RVGGRKMS  AF KLLSRL AEG+D
Sbjct  269   YQPCYKWGNGGWQSACCTTTLSMYPLPVMPNKRHARVGGRKMSGGAFRKLLSRLAAEGHD  328

Query  1418  LSAPLDLKDHWAKHGTNRYSTVK  1486
             LS P+DLKD+WAKHGTNRY T+K
Sbjct  329   LSQPVDLKDNWAKHGTNRYITIK  351



>ref|XP_006655749.1| PREDICTED: barley B recombinant-like protein D-like [Oryza brachyantha]
Length=330

 Score =   238 bits (607),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 137/304 (45%), Positives = 185/304 (61%), Gaps = 27/304 (9%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             +A+M +RD AI ER+ AL E+K A+AERDMA  QRDAA+AERN A+ ERDNA++AL+L  
Sbjct  41    LALMNDRDNAIRERDHALAEKKAAIAERDMAFAQRDAAMAERNAAVVERDNALAALELAR  100

Query  794   SSMNDEDIVSKSP-----GAEHIHYQQEMHEMISAAAYDPTENLTNDPF------NVTDP  940
             ++  + +  +  P     G+++IH+    H+ +S A   P + L + P+      ++++ 
Sbjct  101   TNGLNMNNGNGFPQGSLNGSKNIHH----HDQLSHAQSSPLQ-LADSPYDHAREMHISEA  155

Query  941   TPQTANNPRKVRQPKESKPK--KASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
              P  +  P  V + K SK    +AS L R              +      DW +     +
Sbjct  156   YP-ISTAPGSVGKAKRSKKNNSQASPLKRPSGVLR--------KTKKPSGDWKNVGMSGY  206

Query  1115  VDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTT  1294
              D S        +  D+D GL QV  D S MP P CSCTG  + CYKWGNGGWQS+CCT 
Sbjct  207   GDDSAHASVMKNEWKDQDLGLNQVAFDESTMPAPACSCTGKLRQCYKWGNGGWQSSCCTM  266

Query  1295  TISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRY  1474
              ISMYPLP   +KR++R+GGRKMS  AF+KLLSRL AEG+DLS P+DLKDHWAKHGTNRY
Sbjct  267   NISMYPLPVIPNKRHARMGGRKMSGGAFTKLLSRLAAEGHDLSTPVDLKDHWAKHGTNRY  326

Query  1475  STVK  1486
              T++
Sbjct  327   ITIR  330



>ref|XP_003525427.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoformX1 [Glycine 
max]
 ref|XP_003525429.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoformX3 [Glycine 
max]
 ref|XP_006580620.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X4 [Glycine 
max]
 gb|KHN17473.1| Protein BASIC PENTACYSTEINE4 [Glycine soja]
Length=317

 Score =   238 bits (606),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 137/301 (46%), Positives = 187/301 (62%), Gaps = 27/301 (9%)
 Frame = +2

Query  593   NSTIRTYMAIMAERDAAILERNM--ALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             N  IR+   IMAER AAILE  +  A+ E+  ALA RD A+ QRD A+A+R+ AL ERDN
Sbjct  41    NKKIRS---IMAERQAAILEIELEAAISEKNEALAARDAAIRQRDEALAQRDNALLERDN  97

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTP  946
             A++AL+ R +S+N         G++ +H+       ++ AAY+  + +  D   VT   P
Sbjct  98    ALAALQSRNNSVNFPFGGGIQCGSKRMHHSSNHLSNMTEAAYNTKDMIIRDASPVT-VIP  156

Query  947   QTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDAS  1126
               A N  + ++ KE+K    SK ++   + +   EDL+ QA S                 
Sbjct  157   SEAVNSHQSKRSKENKVIN-SKASKPPCKVKKMGEDLNRQASS-----------------  198

Query  1127  DEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTIS  1303
               E  K    WD +D G+  V  D + M VPVC+CTG P+ CYKWGNGGWQS+CCTTT+S
Sbjct  199   --EGTKIRSEWDRQDVGVNLVAFDETIMLVPVCTCTGVPRQCYKWGNGGWQSSCCTTTLS  256

Query  1304  MYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTV  1483
             MYPLPQ  +KR++R+GGRKMS S F++LLSRL +EG+DLS PLDLK++WA+HGTNRY T+
Sbjct  257   MYPLPQLPNKRHARIGGRKMSGSVFTRLLSRLVSEGHDLSIPLDLKEYWARHGTNRYITI  316

Query  1484  K  1486
             K
Sbjct  317   K  317



>ref|XP_008779916.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008779922.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008779926.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008779932.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
 ref|XP_008779939.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
Length=387

 Score =   239 bits (609),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 155/323 (48%), Positives = 194/323 (60%), Gaps = 30/323 (9%)
 Frame = +2

Query  593   NSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAI  772
             N TI+  MAIMAERD AI ERN+AL E+K ALAERDMA+LQRDAAIAERN A+ ERDNAI
Sbjct  70    NHTIKI-MAIMAERDNAIQERNIALAEKKAALAERDMAILQRDAAIAERNNAIMERDNAI  128

Query  773   SALKL-RESSMNDEDIVSKSPG--AEHIHYQQEMHEMISAAAYDPTE-NLTNDPFN----  928
             +AL+  RE+ +N     +  PG  A         H+        P+   L++ P+N    
Sbjct  129   AALQYARENGLNGNGASACPPGCTAPRGTKHIHHHQQQHLQHIHPSPPQLSDAPYNHTRE  188

Query  929   --VTDPTPQTANNPRKVRQPKESKPKKASK---------LArvvkreeveveDLSWQAV-  1072
               +T+  P +  +    +  K  +P+K +K              K  +   EDL+ Q   
Sbjct  189   MHITEAFPISTASESIAKGRKAKRPRKETKAQNSPSKKSSKSPRKSRKGGGEDLNRQVTI  248

Query  1073  -STFDDWDDGNCGEFVDASDEEQD----KHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGT  1237
                  +W +    E     D  +     KH +   +D GL QV  D + MP PVCSCTG 
Sbjct  249   AKPASEWRN----EIRGGDDLNKQVALTKHQEWKGQDLGLNQVTFDEATMPTPVCSCTGK  304

Query  1238  PQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYD  1417
              QPCYKWGNGGWQSACCTTT+SMYPLP   +KR++RVGGRKMS  AF KLLSRL AEG+D
Sbjct  305   YQPCYKWGNGGWQSACCTTTLSMYPLPVMPNKRHARVGGRKMSGGAFRKLLSRLAAEGHD  364

Query  1418  LSAPLDLKDHWAKHGTNRYSTVK  1486
             LS P+DLKD+WAKHGTNRY T+K
Sbjct  365   LSQPVDLKDNWAKHGTNRYITIK  387



>ref|XP_010933934.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
Length=350

 Score =   237 bits (605),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 152/319 (48%), Positives = 193/319 (61%), Gaps = 23/319 (7%)
 Frame = +2

Query  593   NSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAI  772
             N TI+ +MAIMAERD AI ERN+AL E+K ALAERDMA+LQRDAAI ERN+A+ ERDNAI
Sbjct  34    NQTIK-FMAIMAERDNAIQERNIALAEKKAALAERDMAILQRDAAITERNSAIMERDNAI  92

Query  773   SALKL-RESSMNDEDIVSKSPG--AEHIHYQQEMHEMISAAAYDPTENLTND-PFN----  928
             +AL+  RE+ MN     +  PG  A         H+        P+    +D P+N    
Sbjct  93    AALQYARENGMNANGAPACPPGCAASRGSKHIHHHQQQHLQHIHPSPAQPSDAPYNHARE  152

Query  929   --VTDPTPQTANNPRKVRQPKESKPKKASKL---------ArvvkreeveveDLSWQAV-  1072
               +T+  P +  +    +  K  +P+K +K+             K  +   EDL+ Q   
Sbjct  153   MHITEAFPISTASESVAKGRKAKRPRKETKVQNSPSKKPSKSPRKSRKGGGEDLNRQVTI  212

Query  1073  -STFDDWDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPC  1249
                  +W     G+ ++       KH +   +D GL QV  D + MP PVCSCTG  Q C
Sbjct  213   AKPASEWRGEVGGDDLN-KRVSLTKHQEWKGQDLGLNQVTFDEATMPTPVCSCTGKYQQC  271

Query  1250  YKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAP  1429
             YKWGNGGWQSACCTTT+SMYPLP   +KR++R+GGRKMS  AF KLLSRL AEG+DL  P
Sbjct  272   YKWGNGGWQSACCTTTLSMYPLPVMPNKRHTRMGGRKMSGGAFRKLLSRLAAEGHDLLQP  331

Query  1430  LDLKDHWAKHGTNRYSTVK  1486
             +DLKDHWAKHGTNRY T+K
Sbjct  332   VDLKDHWAKHGTNRYITIK  350



>ref|XP_002437754.1| hypothetical protein SORBIDRAFT_10g002020 [Sorghum bicolor]
 gb|EER89121.1| hypothetical protein SORBIDRAFT_10g002020 [Sorghum bicolor]
Length=329

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 188/303 (62%), Gaps = 24/303 (8%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             +A+M E+D+AI ER+ AL E+K A+AERDMA  QRDAA+AERN A+ ERDNA++AL+L  
Sbjct  39    LALMNEKDSAIRERDHALAEKKAAIAERDMAFAQRDAAMAERNAAIVERDNALAALELAR  98

Query  794   SSMNDEDIVS---KSP---GAEHIHYQQEMHEMISAAAYDPTENLTNDPF------NVTD  937
             ++  + +  +   + P   G +++H+    H+ +S     P + L + P+      ++++
Sbjct  99    TNGFNMNNGNGFHQGPPLNGTKNVHH----HDQLSHVQTSPLQ-LADSPYDHVREMHISE  153

Query  938   PTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFV  1117
               P  A  P  + + K  KP+K++  A  +KR    +     +      DW +G      
Sbjct  154   AYP-IATAPGTIGKAK--KPRKSNSQASPLKRPSGVLR----KTKKATGDWKNGGMSGVA  206

Query  1118  DASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTT  1297
               S        +  D+D GL QV  D S MP P CSCTG    CYKWGNGGWQS+CCTT 
Sbjct  207   GDSARAAVMKNEWKDQDLGLNQVAFDESTMPAPACSCTGELHQCYKWGNGGWQSSCCTTN  266

Query  1298  ISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYS  1477
             +SMYPLP   ++R++R+GGRKMS  AF+KLLSRL AEG+DLS P+DLKDHWAKHGTNRY 
Sbjct  267   MSMYPLPVMPNRRHARMGGRKMSGGAFTKLLSRLAAEGHDLSIPVDLKDHWAKHGTNRYI  326

Query  1478  TVK  1486
             T++
Sbjct  327   TIR  329



>gb|AGT17153.1| basic pentacysteine 6 [Saccharum hybrid cultivar R570]
Length=330

 Score =   236 bits (601),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 183/300 (61%), Gaps = 18/300 (6%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             +A+M E+D+AI ER+ AL E+K A+AERDMA  QRDAA+AERN A+ ERDNA++AL+L  
Sbjct  40    LALMNEKDSAIRERDHALAEKKAAIAERDMAFAQRDAAMAERNAAIVERDNALAALELAR  99

Query  794   SSMNDEDIVS---KSP---GAEHIHYQQEMHEMISAA---AYDPTENLTNDPFNVTDPTP  946
             ++  + +  +   + P   G ++IH+  ++  + ++A   A  P +++     +   P  
Sbjct  100   TNGFNMNNGNGFHQGPPLNGTKNIHHHDQISHVQTSALQLADSPYDHVREMHISEAYPIT  159

Query  947   QTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDAS  1126
                 +  K ++P++S   +AS L             +  +      DW +G        S
Sbjct  160   TAPGSIGKAKKPRKSN-SQASPL--------KRPSGVLRKTKKATGDWKNGGMTGVAGDS  210

Query  1127  DEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISM  1306
                     +  D+D GL QV  D S MP P CSCTG    CYKWGNGGWQS+CCTT +SM
Sbjct  211   ARASVMKNEWKDQDLGLNQVAFDESTMPAPACSCTGELHQCYKWGNGGWQSSCCTTNMSM  270

Query  1307  YPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             YPLP   ++R++R+GGRKMS  AF+KLLSRL AEG+DLS P+DLKDHWAKHGTNRY T++
Sbjct  271   YPLPVMPNRRHTRMGGRKMSGGAFTKLLSRLAAEGHDLSIPVDLKDHWAKHGTNRYITIR  330



>ref|XP_004964426.1| PREDICTED: barley B recombinant-like protein D-like isoform X1 
[Setaria italica]
 ref|XP_004964427.1| PREDICTED: barley B recombinant-like protein D-like isoform X2 
[Setaria italica]
Length=329

 Score =   235 bits (600),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 139/305 (46%), Positives = 191/305 (63%), Gaps = 28/305 (9%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             +A+M E+D+AI ER+ AL E+K A+AERDMA  QRDAA+AERN A+ ERDNA++AL+L  
Sbjct  39    LALMNEKDSAIRERDHALAEKKAAIAERDMAFAQRDAAMAERNAAIVERDNALAALELAR  98

Query  794   SSMNDEDI------VSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPF------NVTD  937
             ++  + +       V    G ++IH     H+ +S     P + L + P+      ++++
Sbjct  99    TNGFNMNNGNGFHQVPPLNGTKNIHN----HDQLSHVQTSPLQ-LADSPYDHTREMHISE  153

Query  938   PTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGN-CGEF  1114
               P  A  P  + + K  KP+K S  A  +KR    +     +      DW +G   G  
Sbjct  154   AYP-IATAPSSIGKGK--KPRKNSSQASPLKRPSGVLR----KTKKVAGDWKNGGMSGGG  206

Query  1115  VDASDEEQDKHLDTW-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCT  1291
              D++     K  + W D+D GL QV  D S MP P CSCTG  + CYKWGNGGWQS+CCT
Sbjct  207   EDSARASVMK--NEWKDQDLGLNQVPFDESTMPAPACSCTGELRQCYKWGNGGWQSSCCT  264

Query  1292  TTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNR  1471
              ++SMYPLP   ++R++R+GGRKMS SAF+KLLSRL AEG+DLS P+DLKDHWAKHGTNR
Sbjct  265   MSMSMYPLPVMPNRRHARMGGRKMSGSAFTKLLSRLAAEGHDLSTPVDLKDHWAKHGTNR  324

Query  1472  YSTVK  1486
             Y T++
Sbjct  325   YITIR  329



>ref|NP_001056691.1| Os06g0130600 [Oryza sativa Japonica Group]
 sp|Q5VSA8.1|BBRD_ORYSJ RecName: Full=Barley B recombinant-like protein D; Short=BBR-like 
protein D; AltName: Full=GAGA-binding transcriptional activator 
BBR-D [Oryza sativa Japonica Group]
 dbj|BAD67667.1| putative basic pentacysteine 4 [Oryza sativa Japonica Group]
 gb|AAX59045.1| barley B recombinant-like protein D [Oryza sativa Japonica Group]
 gb|AAX59046.1| barley B recombinant-like protein D [Oryza sativa Japonica Group]
 dbj|BAF18605.1| Os06g0130600 [Oryza sativa Japonica Group]
 dbj|BAG92056.1| unnamed protein product [Oryza sativa Japonica Group]
Length=331

 Score =   235 bits (600),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 131/305 (43%), Positives = 182/305 (60%), Gaps = 29/305 (10%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             +A+M +RD AI ER+ AL E+K A+AERDMA  QRDAA+AERN A+ ERDNA++AL+L  
Sbjct  42    LALMNDRDNAIRERDHALAEKKAAIAERDMAFTQRDAAMAERNAAVVERDNALAALELAR  101

Query  794   SSMNDEDIVSKSP-----GAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD-------  937
             ++  + +  +  P     G+++IH+    H+ +S A   P + L + P++          
Sbjct  102   TNGLNMNNGNGFPQGSLSGSKNIHH----HDQLSHAQSSPLQ-LADSPYDHAREMHISEA  156

Query  938   -PTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
              P      +  K ++PK++  + +          + +     W+ V      DD      
Sbjct  157   YPISTAPGSAGKAKRPKKNSSQASPLKRPSGVLRKTKKPSGDWKNVGMSGCGDDSAHASV  216

Query  1115  VDASDEEQDKHLDTW-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCT  1291
             +           + W D++ GL QV  D S MP P CSCTG  + CYKWGNGGWQS+CCT
Sbjct  217   MK----------NEWKDQNLGLNQVAFDDSTMPAPACSCTGKLRQCYKWGNGGWQSSCCT  266

Query  1292  TTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNR  1471
               ISMYPLP   +KR++R+GGRKMS  AF+KLLSRL AEG+DLS P+DLKDHWAKHGTNR
Sbjct  267   MNISMYPLPVMPNKRHARMGGRKMSGGAFTKLLSRLAAEGHDLSTPVDLKDHWAKHGTNR  326

Query  1472  YSTVK  1486
             Y T++
Sbjct  327   YITIR  331



>gb|ADV59380.1| GAGA-binding transcriptional activator [Helianthus annuus]
Length=308

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/305 (44%), Positives = 184/305 (60%), Gaps = 32/305 (10%)
 Frame = +2

Query  581   KDQNNSTI-RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             KDQN   + R  M I++ERD AI ER+ AL E+K AL ERDMA+ QRD AIA+RN A+ E
Sbjct  33    KDQNAMMMNRKIMHIVSERDTAIEERDRALLEKKAALEERDMAIQQRDTAIADRNDAIRE  92

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD  937
             RDNAI+AL+ +E++MN              H Q++           P+  +  DP +VT+
Sbjct  93    RDNAIAALRFQETTMNS-------------HLQRKRGHHNHHHHTQPSYMM--DP-HVTE  136

Query  938   PTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFV  1117
               P TA     V + K +K  K    +               +        +D N     
Sbjct  137   ALPITAVPGEPVHKSKITKEIKPRGGSGGGGSGSSSRSKKQKKV------GEDLNRNVTT  190

Query  1118  DASDEEQDKHLDTWD-EDFGL-EQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCT  1291
             D S  E       WD ++FGL +Q++ D S MP+P+CSCTG  + CYKWG+GGWQS+CCT
Sbjct  191   DGSKAE-------WDAQEFGLMDQISFDESTMPIPICSCTGVARQCYKWGSGGWQSSCCT  243

Query  1292  TTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNR  1471
             TT+S+YPLPQ  +KR+SR+GGRKMS + F++L+ RL ++G+DLSAP+DLK++WA HGTNR
Sbjct  244   TTLSVYPLPQMPNKRHSRMGGRKMSGTVFTRLIGRLASQGHDLSAPVDLKNYWANHGTNR  303

Query  1472  YSTVK  1486
             Y T+K
Sbjct  304   YITIK  308



>emb|CDY42683.1| BnaC04g22230D [Brassica napus]
Length=320

 Score =   233 bits (594),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 185/302 (61%), Gaps = 28/302 (9%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             M+I+AERDAAI ERN+A+ ERK A+AERDMA LQRD AIAERN A+ ERD+A++AL+ R+
Sbjct  36    MSIIAERDAAIQERNLAISERKSAVAERDMAFLQRDTAIAERNNAIMERDSALTALQYRD  95

Query  794   SSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNPRKV  973
             +SM             H H  Q     ++  AY+  E  T+ P   T  +   +  P++ 
Sbjct  96    NSMATSRQHQPH--MHHQHQHQHHMLQLTENAYETRETETSPP---TTGSALESAKPKRG  150

Query  974   RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFV-----DASDEEQ  1138
             R+ K+ K   A+K                 Q     ++ DD +   FV     D S+EE+
Sbjct  151   RKLKDPKAAAANKRGPKT------------QRKVKKENEDDLSKIMFVKTTTLDYSEEEE  198

Query  1139  DKHLDTWDED-----FGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTIS  1303
             +      D        GL QV  D + MP PVCSCTG  + CYKWGNGGWQS+CCTTT+S
Sbjct  199   EATGSKSDWKSREMVVGLNQVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCCTTTLS  258

Query  1304  MYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG-YDLSAPLDLKDHWAKHGTNRYST  1480
             M+PLP   +K+++RVGGRKMS SAF+K LSRL AEG +DLS+ +DLKDHWAKHGTNRY T
Sbjct  259   MHPLPALPNKKHARVGGRKMSGSAFNKYLSRLAAEGHHDLSSHVDLKDHWAKHGTNRYIT  318

Query  1481  VK  1486
             +K
Sbjct  319   IK  320



>ref|XP_006411681.1| hypothetical protein EUTSA_v10025867mg [Eutrema salsugineum]
 gb|ESQ53134.1| hypothetical protein EUTSA_v10025867mg [Eutrema salsugineum]
Length=295

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/313 (42%), Positives = 187/313 (60%), Gaps = 61/313 (19%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN A+  +K ALA RD A+ QRD A++ER+ A+ 
Sbjct  33    KEQHNALVMNKKIMSILAERDAAVKERNEAVAAKKEALAARDEALEQRDKALSERDNAIM  92

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ER++A++AL+ RE+++N                      ++S A    +++   +  ++ 
Sbjct  93    ERESALNALQYRENNLN---------------------YILSCARRGGSQSCVTEESHLP  131

Query  935   DPTPQT-----ANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDD  1087
             DP+P +     A N R  ++ K+SK +  SK        +   EDL+ Q  S       D
Sbjct  132   DPSPISTIPPEAANTRPAKRKKQSKQETRSK-------GKKVGEDLNRQVASPGKKCRKD  184

Query  1088  WDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNG  1267
             WD                        D GL  V  D + MPVP+C+CTGT + CYKWGNG
Sbjct  185   WDS----------------------NDVGLNLVTFDETTMPVPMCTCTGTARQCYKWGNG  222

Query  1268  GWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDH  1447
             GWQS+CCTTT+S YPLPQ  +KR+SR+GGRKMS S FS+LLSRL  +G++LS+P+DLKD+
Sbjct  223   GWQSSCCTTTLSQYPLPQMPNKRHSRMGGRKMSGSVFSRLLSRLAGQGHELSSPVDLKDY  282

Query  1448  WAKHGTNRYSTVK  1486
             WA+HGTNRY T+K
Sbjct  283   WARHGTNRYITIK  295



>emb|CDX71826.1| BnaC08g30480D [Brassica napus]
Length=301

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 132/302 (44%), Positives = 170/302 (56%), Gaps = 39/302 (13%)
 Frame = +2

Query  599   TIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISA  778
             +++  M+I+AERDAAI ERN+A+ E+K ALAERDMA LQRD AIAERN A+ ERD+A++A
Sbjct  33    SMKQVMSIIAERDAAIQERNLAISEKKAALAERDMAFLQRDTAIAERNNAIMERDSALAA  92

Query  779   LKLRE---SSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQ  949
             L+ R+   S+               +   +  +E        P            +P   
Sbjct  93    LQFRDSSMSTSRQHQPHIHHQQHHMLQVTENAYETRETETSPPPPTKPKRGRKAKEPKAP  152

Query  950   TAN--NPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDA  1123
              AN   P+  R+ K+      +KL                +A  +  DW           
Sbjct  153   AANKRGPKTQRKVKKENEDDLTKLM------------FDEEATGSKSDWRS---------  191

Query  1124  SDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTIS  1303
                          E  GL +V  D + MP PVCSCTG  + CYKWGNGGWQS+CCTTT+S
Sbjct  192   ------------QETVGLNRVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCCTTTLS  239

Query  1304  MYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG-YDLSAPLDLKDHWAKHGTNRYST  1480
             M+PLP   +K+++RVGGRKMS SAFSKLLSRL AEG +DLS P+DLKDHWAKHGTNRY T
Sbjct  240   MHPLPALPNKKHARVGGRKMSGSAFSKLLSRLAAEGHHDLSNPVDLKDHWAKHGTNRYIT  299

Query  1481  VK  1486
             +K
Sbjct  300   IK  301



>gb|ABU63288.1| GAGA-motif binding transcriptional activator, partial [Cardamine 
pratensis]
Length=275

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/313 (41%), Positives = 186/313 (59%), Gaps = 61/313 (19%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAAI ERN A+  +K ALA RD A+ QRD A++ER+ A+ 
Sbjct  13    KEQHNALVMNKKIMSILAERDAAIKERNEAVAAKKEALAARDEALEQRDKALSERDNAIM  72

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             E ++A++AL+ RE+++N                      ++S A    +++   +  ++ 
Sbjct  73    ETESALNALQFRENNLN---------------------YILSCAKRGGSQSCATEESHIP  111

Query  935   DPTPQT-----ANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDD  1087
             +P+P T     A+N R  ++ KE+K    SK+       +   EDL+ Q  S       D
Sbjct  112   NPSPITTIPPEADNSRPAKRKKETKQGTRSKV-------KKVGEDLNRQVASPGTKCRKD  164

Query  1088  WDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNG  1267
             WD                        + GL  V  D + MPVP+C+CTGT + CYKWGNG
Sbjct  165   WDSN----------------------EVGLNLVTFDETTMPVPMCTCTGTARQCYKWGNG  202

Query  1268  GWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDH  1447
             GWQS+CCTTT+S YPLPQ  +KR+SR+GGRKMS S FS+LL+RL  EG +LS+P+DLKD+
Sbjct  203   GWQSSCCTTTLSQYPLPQMPNKRHSRMGGRKMSGSVFSRLLTRLAGEGRELSSPVDLKDY  262

Query  1448  WAKHGTNRYSTVK  1486
             WA+HGTNRY T+K
Sbjct  263   WARHGTNRYITIK  275



>gb|ADV59374.1| GAGA-binding transcriptional activator [Triphysaria pusilla]
Length=293

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 131/301 (44%), Positives = 175/301 (58%), Gaps = 30/301 (10%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  + IMAERDAAI ERN+A+ E+K ALAERDMA+LQRDAAIAERN A++E +N
Sbjct  22    QHQPSMKHIITIMAERDAAIQERNLAISEKKSALAERDMAILQRDAAIAERNNAIKELEN  81

Query  767   AISALKLRESSMNDEDIVS-KSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPT  943
             AI+ L   E++       S + P      +  + H        + + N       +TDP 
Sbjct  82    AIATLHYHENTTTPHCPSSCQIPNGVKHVHHPQQHVQHQPHIVETSHNNNIKDMQITDPG  141

Query  944   PQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDA  1123
             P  A       +P+  +PK           ++++ E     A S    W  G        
Sbjct  142   PSKA-------RPRAKRPKDTPTKKTPKSSKKIKRESEGNAAKS--QGWKSG--------  184

Query  1124  SDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTIS  1303
                             GL +V  D + M  PVCSCTG  + CYKWGNGGWQS+CCTT +S
Sbjct  185   ------------PNFLGLNEVVFDETTMSAPVCSCTGVLRQCYKWGNGGWQSSCCTTNLS  232

Query  1304  MYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTV  1483
             MYPLP   +KR++R+GGRKMS SAF+KLLSRLT+EG+DLS P+DLK++WAKHGTNRY T+
Sbjct  233   MYPLPALPNKRHARIGGRKMSGSAFNKLLSRLTSEGHDLSNPVDLKENWAKHGTNRYITI  292

Query  1484  K  1486
             K
Sbjct  293   K  293



>ref|XP_008803317.1| PREDICTED: barley B recombinant-like protein D isoform X3 [Phoenix 
dactylifera]
Length=342

 Score =   231 bits (590),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 152/325 (47%), Positives = 196/325 (60%), Gaps = 27/325 (8%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             + N TI+ +MAIM+ERD AI E N+AL E+K ALAERD+A+LQRD AIAERN A+ ERDN
Sbjct  20    KENQTIK-FMAIMSERDNAIQEHNIALAEKKAALAERDVAILQRDTAIAERNNAIMERDN  78

Query  767   AISALKL-RESSMNDEDIVSKSPG--AEHIHYQQEMHEMISAAAYDPTE-NLTNDPFN--  928
             AI+AL+  RE+ MN     +  PG  A         H+        P+   L++ P+N  
Sbjct  79    AIAALQYARENGMNTNGATACPPGCAAPRGSKHIHHHQQQHLQHIHPSPPQLSDAPYNHY  138

Query  929   -------VTDPTP-----QTANNPRKVRQPKE------SKPKKASKLArvvkreeveveD  1054
                    +T+  P     ++A   R V++P++      S  KK+SK  R  ++   E  +
Sbjct  139   NHAREMHITEAFPISTASESAAKGRMVKRPRKETKVQNSPYKKSSKTPRKSRKGGGEDLN  198

Query  1055  LSWQAVSTFDDWDDGNCGEFVDASDE-EQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCT  1231
                       DW  G  G   D ++     KH +   +D GL QV  + + MP PVCSCT
Sbjct  199   RQVTIAKPASDWR-GEVGGGDDLNERVSLTKHQEWKGQDLGLNQVTFEEATMPTPVCSCT  257

Query  1232  GTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG  1411
             G  Q CYKW NGGWQSACCTTT+SMYPLP   +KR++R+GGRKMS  AF KLLSRL AEG
Sbjct  258   GKYQQCYKWENGGWQSACCTTTLSMYPLPVMPNKRHTRMGGRKMSGGAFRKLLSRLAAEG  317

Query  1412  YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             +DLS  +DLKDHWAKHGTNRY T+K
Sbjct  318   HDLSQSVDLKDHWAKHGTNRYITIK  342



>ref|XP_010919161.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010919162.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
 ref|XP_010919163.1| PREDICTED: barley B recombinant-like protein D [Elaeis guineensis]
Length=350

 Score =   232 bits (591),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 148/322 (46%), Positives = 191/322 (59%), Gaps = 29/322 (9%)
 Frame = +2

Query  593   NSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAI  772
             N TI+  M IMAERD AI ERN+AL E+K ALAERDMA+LQRDAAI+ERN A+ ERDNAI
Sbjct  34    NHTIKI-MTIMAERDNAIQERNIALAEKKAALAERDMAILQRDAAISERNNAIMERDNAI  92

Query  773   SALKL-RESSMNDEDIVSKSPG--AEHIHYQQEMHEMISAAAYDPTENLTNDPFN-----  928
             +AL+  RE+ +N     +  PG  A    +     +      +     L++ P+N     
Sbjct  93    AALQYARENGLNGNGASACPPGCTARGTKHIHHHQQQHLQHIHLSPPQLSDAPYNHTREM  152

Query  929   -VTDPTPQTANNPRKVRQPKESKPKKASKL---------ArvvkreeveveDLSWQAV--  1072
              +T+  P +  +    +  K  +P+K +K+             K  +   EDL+ Q    
Sbjct  153   HITEAFPISTASEGVAKGRKAKRPRKENKVQNSPSKKSSKSPRKSRKGGGEDLNRQVTIA  212

Query  1073  STFDDWDDGNCGEFVDASDEEQD----KHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTP  1240
                 +W +    E     D  +     KH +   +D GL QV  D + M  PVCSCTG  
Sbjct  213   KPASEWRN----EVRGGDDLNKQVALTKHQEWKGQDLGLNQVTFDEATMSTPVCSCTGKY  268

Query  1241  QPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDL  1420
             Q CYKWG+GGWQSACCTTT+SMYPLP   +KR++RVGGRKMS  AF KLLSRL AEG+DL
Sbjct  269   QQCYKWGSGGWQSACCTTTLSMYPLPVMPNKRHARVGGRKMSGGAFRKLLSRLAAEGHDL  328

Query  1421  SAPLDLKDHWAKHGTNRYSTVK  1486
             S P+DLK+HWAKHGTNRY T+K
Sbjct  329   SQPVDLKEHWAKHGTNRYITIK  350



>emb|CDX72731.1| BnaC07g47530D [Brassica napus]
Length=269

 Score =   229 bits (583),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 179/308 (58%), Gaps = 52/308 (17%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN AL  ++ ALA RD A+ QRD AI+ER+ A+ 
Sbjct  8     KEQHNALVMNKKIMSILAERDAAVKERNEALAAKQEALAARDEALQQRDLAISERDNAIM  67

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ER+NA++AL+ RE+ +N     +K  G     YQ    E        P   + ++P    
Sbjct  68    ERENALTALQHRENHLNYILDCAKRGG-----YQTCFTEETHLPNPSPLSTIPHEP----  118

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
                P T     + ++   SK KK+              EDL+ Q  S       DWD   
Sbjct  119   ---PNTKTKKDRKQETARSKRKKSG------------GEDLNRQLASPGKKCRKDWD---  160

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
             C                    D GL  V  D + MPVP+C+CTGT + CYKWGNGGWQS+
Sbjct  161   CN-------------------DVGLNLVTFDETTMPVPMCTCTGTARQCYKWGNGGWQSS  201

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLPQ  +KR+SR+GGRKMS + FS+LLSRL  EG+DLS+P+DLKD+WA+HG
Sbjct  202   CCTTTLSQYPLPQMPNKRHSRIGGRKMSGNVFSRLLSRLAGEGHDLSSPVDLKDYWARHG  261

Query  1463  TNRYSTVK  1486
             TNRY  +K
Sbjct  262   TNRYIIIK  269



>gb|ADV59375.1| GAGA-binding transcriptional activator [Triphysaria pusilla]
Length=220

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 156/232 (67%), Gaps = 15/232 (6%)
 Frame = +2

Query  800   MNDEDIVSKSPGAE--HIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNPRKV  973
             MND   +  S G E  HI YQQ+M   +S AAY P  +  +   ++T+     A+   K 
Sbjct  1     MNDNSTIPDSLGNEGKHIQYQQQMR-AVSEAAYGPRGSFRDSDISITE-----ASVTGKQ  54

Query  974   RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ-DKHL  1150
             R+ +++K +K  K A+  +      E +S Q  S  + WD+    E    SDE+  +K +
Sbjct  55    RRGRQTKDEKKMKSAKSPRVGRKFSEGVSKQVSS--NGWDNDQSFE----SDEDNLEKQV  108

Query  1151  DTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASH  1330
              +W ++ GL Q+N D SAMPVPVC+CTG+PQPCY+WGNGGWQSACCTT ISMYPLPQ ++
Sbjct  109   VSWKDNLGLNQINFDDSAMPVPVCTCTGSPQPCYRWGNGGWQSACCTTPISMYPLPQVAN  168

Query  1331  KRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             KRYSRVGGRKMS SAFSKLL+RL AEGYD SAPLDLK+ W K+GTNRYS VK
Sbjct  169   KRYSRVGGRKMSGSAFSKLLNRLAAEGYDFSAPLDLKEPWGKYGTNRYSPVK  220



>gb|ADV59377.1| GAGA-binding transcriptional activator [Triphysaria pusilla]
Length=293

 Score =   229 bits (585),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 181/303 (60%), Gaps = 34/303 (11%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  + IMAERDAAI ERN+A+ E+K ALAERDMA+LQRDAAIAERN A++E +N
Sbjct  22    QHQPSMKHIITIMAERDAAIQERNLAISEKKSALAERDMAILQRDAAIAERNDAIKELEN  81

Query  767   AISALKLRESSMNDEDIVS-KSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPT  943
             AI+ L   E++       S + P      +  + H        + + N       +TDP 
Sbjct  82    AIATLHYHENTTTPHCPSSCQIPNGVKHVHHPQQHVQHQPHIVETSHNNNIKDMQITDPG  141

Query  944   PQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLS--WQAVSTFDDWDDGNCGEFV  1117
             P  A  PR  ++PK++  KK  K ++ +KRE  +    S  W++   F            
Sbjct  142   PSKAR-PR-AKRPKDTPTKKTPKSSKRIKRESEDNAAKSQGWKSGPNF------------  187

Query  1118  DASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTT  1297
                               GL +V  D + M  PVCSC G  + CYKWGNGGWQS+CCTT 
Sbjct  188   -----------------LGLNEVVFDETTMSAPVCSCAGVLRQCYKWGNGGWQSSCCTTN  230

Query  1298  ISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYS  1477
             +SMYPLP   +KR++R+GGRKMS SAF+KLLSRLT+EG+DLS  +DLK++WAKHGTNRY 
Sbjct  231   LSMYPLPALPNKRHARIGGRKMSGSAFNKLLSRLTSEGHDLSNSVDLKENWAKHGTNRYI  290

Query  1478  TVK  1486
             T+K
Sbjct  291   TIK  293



>emb|CDO96980.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   230 bits (586),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 130/303 (43%), Positives = 182/303 (60%), Gaps = 24/303 (8%)
 Frame = +2

Query  581   KDQNNSTIRTYM-AIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             K+QN   + T +  ++AERDAAI ER+ AL E++ AL ERD A+ QRD AI+ER+ AL E
Sbjct  33    KEQNAFFMNTKINMLLAERDAAIEERDRALSEKRAALDERDSAIQQRDTAISERDHALRE  92

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD  937
             RDNAI+AL+ +ES+MN         G +  +  +  H   + +A    E    + F +T 
Sbjct  93    RDNAIAALQFQESTMNGALGCGTQHGMKRFNQHRSPHANSAQSANKTREGHITEAFPITA  152

Query  938   PTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFV  1117
              + + A    +  Q K +K            ++    EDL+    +      DG+  E+ 
Sbjct  153   ISSEAA----RSHQAKRTKVNNVIPTKSKSAKKAKVGEDLNRHVTT------DGSKAEW-  201

Query  1118  DASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTT  1297
             DA D               L Q++ D + MP+PVC+CTG  + CYKWGNGGWQS+CCTT+
Sbjct  202   DAQDLSS------------LNQISFDETRMPIPVCTCTGVARQCYKWGNGGWQSSCCTTS  249

Query  1298  ISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYS  1477
             +S+YPLPQ  +KR++R+GGRKMS S FS+LL+RL A G+DLS  LDLK++WAKHGTNRY 
Sbjct  250   LSVYPLPQIPNKRHARMGGRKMSGSVFSRLLTRLAAGGHDLSIALDLKNYWAKHGTNRYI  309

Query  1478  TVK  1486
             T+K
Sbjct  310   TIK  312



>ref|XP_002880369.1| ATBPC4/BBR/BPC4/BPC4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56628.1| ATBPC4/BBR/BPC4/BPC4 [Arabidopsis lyrata subsp. lyrata]
Length=296

 Score =   229 bits (584),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 132/308 (43%), Positives = 180/308 (58%), Gaps = 50/308 (16%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN A+  +K A+A RD A+ QRD A++ER+ AL 
Sbjct  33    KEQHNALVMNKKIMSILAERDAAVHERNQAVSAKKEAVAARDEALQQRDKALSERDKALI  92

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA +AL+  E+S+N      K    +      E H++           L+  P  VT
Sbjct  93    ERDNAYAALQHHENSLNFALSGGKRVDGDDCFGIGEPHKLHVVP-------LSTIPPEVT  145

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
             + T  T    +K  +  +SK KK  +             DL+ +  +    +  DWD   
Sbjct  146   NSTKVTKR--KKENKQGQSKVKKVGE-------------DLNRRVAAPGKKSRTDWD---  187

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                                 +D GL  V  D + MPVP+C+CTG+   CYKWGNGGWQS+
Sbjct  188   -------------------SQDVGLNLVTFDETTMPVPMCTCTGSAHQCYKWGNGGWQSS  228

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLPQ  +KR+SR+GGRKMS + FS+LLSRL AEGYDLS P+DLKD+WA+HG
Sbjct  229   CCTTTLSQYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAAEGYDLSCPVDLKDYWARHG  288

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  289   TNRYITIK  296



>ref|XP_008803316.1| PREDICTED: barley B recombinant-like protein D isoform X2 [Phoenix 
dactylifera]
Length=427

 Score =   233 bits (595),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 154/323 (48%), Positives = 196/323 (61%), Gaps = 27/323 (8%)
 Frame = +2

Query  593   NSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAI  772
             N TI+ +MAIM+ERD AI E N+AL E+K ALAERD+A+LQRD AIAERN A+ ERDNAI
Sbjct  107   NQTIK-FMAIMSERDNAIQEHNIALAEKKAALAERDVAILQRDTAIAERNNAIMERDNAI  165

Query  773   SALKL-RESSMNDEDIVSKSPG--AEHIHYQQEMHEMISAAAYDPTE-NLTNDPFN----  928
             +AL+  RE+ MN     +  PG  A         H+        P+   L++ P+N    
Sbjct  166   AALQYARENGMNTNGATACPPGCAAPRGSKHIHHHQQQHLQHIHPSPPQLSDAPYNHYNH  225

Query  929   -----VTDPTP-----QTANNPRKVRQP-KESKP-----KKASKLArvvkreeveveDLS  1060
                  +T+  P     ++A   R V++P KE+K      KK+SK  R  ++   E  +  
Sbjct  226   AREMHITEAFPISTASESAAKGRMVKRPRKETKVQNSPYKKSSKTPRKSRKGGGEDLNRQ  285

Query  1061  WQAVSTFDDWDDGNCGEFVDASDE-EQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGT  1237
                     DW  G  G   D ++     KH +   +D GL QV  + + MP PVCSCTG 
Sbjct  286   VTIAKPASDWR-GEVGGGDDLNERVSLTKHQEWKGQDLGLNQVTFEEATMPTPVCSCTGK  344

Query  1238  PQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYD  1417
              Q CYKW NGGWQSACCTTT+SMYPLP   +KR++R+GGRKMS  AF KLLSRL AEG+D
Sbjct  345   YQQCYKWENGGWQSACCTTTLSMYPLPVMPNKRHTRMGGRKMSGGAFRKLLSRLAAEGHD  404

Query  1418  LSAPLDLKDHWAKHGTNRYSTVK  1486
             LS  +DLKDHWAKHGTNRY T+K
Sbjct  405   LSQSVDLKDHWAKHGTNRYITIK  427



>emb|CDY15905.1| BnaA04g12060D [Brassica napus]
Length=286

 Score =   228 bits (582),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 135/304 (44%), Positives = 178/304 (59%), Gaps = 49/304 (16%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN A+  +  ALA RD A+LQRD A+AER+ AL 
Sbjct  30    KEQHNALVMNKKIMSILAERDAAVHERNQAVSAKLEALAARDQALLQRDKALAERDKALI  89

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA +AL+  E+S+N     + S G           +    A  D  + L    F + 
Sbjct  90    ERDNAFAALQHHENSLN----FALSGG-----------KRCQGADDDDDDVL----FTID  130

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
             D  P T+ NP           K+  +      + +   EDL+                  
Sbjct  131   DLCPTTSTNP----------TKEIKRKKENKPKGKKVGEDLNL----------------L  164

Query  1115  VDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTT  1294
             V A  ++  K  DT    FGL  V  D   MPVPVC+CTG+   CYKWGNGGWQS+CCTT
Sbjct  165   VAAPGKKCKKDWDT--NHFGLNLVTFDEKTMPVPVCTCTGSAHQCYKWGNGGWQSSCCTT  222

Query  1295  TISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRY  1474
             T+S+YPLPQ  +KR+SRVGGRKMS + FS+LLS L AEGYDLS+ +DLKD+WA+HGTNRY
Sbjct  223   TLSLYPLPQKPNKRHSRVGGRKMSGNVFSRLLSHLAAEGYDLSSRVDLKDYWARHGTNRY  282

Query  1475  STVK  1486
              T+K
Sbjct  283   ITIK  286



>dbj|BAK05756.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score =   230 bits (586),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/305 (43%), Positives = 182/305 (60%), Gaps = 27/305 (9%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             +A+M+ERD AI+ER+ AL E+K A+AERDMA  QRD+A+AERN A+ ERDNA++AL+L  
Sbjct  40    LALMSERDNAIMERDHALAEKKAAMAERDMAFAQRDSAMAERNAAIVERDNALAALELAR  99

Query  794   SSMNDEDIVSKSP-----GAEHIHYQ------QEMHEMISAAAYDPTENL-TNDPFNV-T  934
             ++  + +  +        GA++ H+       Q +   ++ A YD    +  +D + + T
Sbjct  100   TNGFNMNNGNGFNPGSLNGAKNFHHHDQQPHAQSLPLQLADAPYDHAREMHISDAYPIST  159

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDD-GNCGE  1111
              P        +  +   +  P K                 +  +      DW D G  G 
Sbjct  160   APVSAAGKAKKPKKNSSQGSPLK-------------RPSGVLRKTKKAAGDWRDVGISGG  206

Query  1112  FVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCT  1291
               D +        +  D+D GL QV+ D S+MP P CSCTG  + CYKWGNGGWQS+CCT
Sbjct  207   GEDPAHVASAMKNEWKDQDLGLNQVSFDESSMPAPACSCTGVLRQCYKWGNGGWQSSCCT  266

Query  1292  TTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNR  1471
              ++S+YPLP   +KR++R+GGRKMS SAF+KLLSRL AEG+DLSA +DLKDHWAKHGTNR
Sbjct  267   MSMSLYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLAAEGHDLSASVDLKDHWAKHGTNR  326

Query  1472  YSTVK  1486
             Y T++
Sbjct  327   YITIR  331



>dbj|BAK06066.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/305 (43%), Positives = 182/305 (60%), Gaps = 27/305 (9%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             +A+M+ERD AI+ER+ AL E+K A+AERDMA  QRD+A+AERN A+ ERDNA++AL+L  
Sbjct  40    LALMSERDNAIMERDHALAEKKAAMAERDMAFAQRDSAMAERNAAIVERDNALAALELAR  99

Query  794   SSMNDEDIVSKSP-----GAEHIHYQ------QEMHEMISAAAYDPTENL-TNDPFNV-T  934
             ++  + +  +        GA++ H+       Q +   ++ A YD    +  +D + + T
Sbjct  100   TNGFNMNNGNGFNPGSLNGAKNFHHHDQQPHAQSLPLQLADAPYDHAREMHISDAYPIST  159

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDD-GNCGE  1111
              P        +  +   +  P K                 +  +      DW D G  G 
Sbjct  160   APVSAAGKAKKPKKNSSQGSPLK-------------RPSGVLRKTKKAAGDWRDVGISGG  206

Query  1112  FVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCT  1291
               D +        +  D+D GL QV+ D S+MP P CSCTG  + CYKWGNGGWQS+CCT
Sbjct  207   GEDPAHVASVMKNEWKDQDLGLNQVSFDESSMPAPACSCTGVLRQCYKWGNGGWQSSCCT  266

Query  1292  TTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNR  1471
              ++S+YPLP   +KR++R+GGRKMS SAF+KLLSRL AEG+DLSA +DLKDHWAKHGTNR
Sbjct  267   MSMSLYPLPVMPNKRHARMGGRKMSGSAFTKLLSRLAAEGHDLSASVDLKDHWAKHGTNR  326

Query  1472  YSTVK  1486
             Y T++
Sbjct  327   YITIR  331



>ref|NP_565503.1| basic pentacysteine 4 [Arabidopsis thaliana]
 ref|NP_850012.1| basic pentacysteine 4 [Arabidopsis thaliana]
 sp|Q8S8C6.1|BPC4_ARATH RecName: Full=Protein BASIC PENTACYSTEINE4; Short=AtBPC4 [Arabidopsis 
thaliana]
 gb|AAM15408.1| expressed protein [Arabidopsis thaliana]
 gb|AAM61121.1| unknown [Arabidopsis thaliana]
 gb|ABG48465.1| At2g21240 [Arabidopsis thaliana]
 dbj|BAF00970.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH19851.1| AT2G21240 [Arabidopsis thaliana]
 gb|AEC07147.1| basic pentacysteine 4 [Arabidopsis thaliana]
 gb|AEC07148.1| basic pentacysteine 4 [Arabidopsis thaliana]
Length=296

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/304 (43%), Positives = 180/304 (59%), Gaps = 42/304 (14%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN A+  +K A+A RD A+ QRD A++ER+ AL 
Sbjct  33    KEQHNALVMNKKIMSILAERDAAVHERNQAVSAKKEAVAARDEALQQRDKALSERDKALI  92

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA +AL+  E+S+N      K    +      E H++              + F ++
Sbjct  93    ERDNAYAALQHHENSLNFALSGGKCVDGDDCFGIGEPHKL--------------EVFPLS  138

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
                P+  N     ++ KE+K      L++V K  E     +      +  DWD       
Sbjct  139   TIPPEVTNTKVVNKRKKENK----QGLSKVKKVGEDLNRRVPAPGKKSRTDWDS------  188

Query  1115  VDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTT  1294
                             +D GL  V  D + MPVP+CSCTG+ + CYKWGNGGWQS+CCTT
Sbjct  189   ----------------QDVGLNLVTFDETTMPVPMCSCTGSTRQCYKWGNGGWQSSCCTT  232

Query  1295  TISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRY  1474
             T+S YPLPQ  +KR+SR+GGRKMS + FS+LLSRL+AEGYDLS P+DLKD+WA+HGTNRY
Sbjct  233   TLSQYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLSAEGYDLSCPVDLKDYWARHGTNRY  292

Query  1475  STVK  1486
              T+K
Sbjct  293   ITIK  296



>gb|AAR25824.1| basic pentacysteine 4 [Arabidopsis thaliana]
Length=296

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/304 (43%), Positives = 180/304 (59%), Gaps = 42/304 (14%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN A+  +K A+A RD A+ QRD A++ER+ AL 
Sbjct  33    KEQHNALVMNKKIMSILAERDAAVHERNQAVSAKKEAVAARDEALQQRDKALSERDKALI  92

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA +AL+  E+S+N      K    +      E H++              + F ++
Sbjct  93    ERDNAYAALQHHENSLNFALSGGKCVDGDDCFGIGEPHKL--------------EVFPLS  138

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
                P+  N     ++ KE+K      L++V K  E     +      +  DWD       
Sbjct  139   TIPPEVTNTKVVNKRKKENK----QGLSKVKKVGEDLNRRVPAPGKKSRTDWDS------  188

Query  1115  VDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTT  1294
                             +D GL  V  D + MPVP+CSCTG+ + CYKWGNGGWQS+CCTT
Sbjct  189   ----------------QDVGLNLVTFDETTMPVPMCSCTGSTRQCYKWGNGGWQSSCCTT  232

Query  1295  TISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRY  1474
             T+S YPLPQ  +KR+SR+GGRKMS + FS+LLSRL+AEGYDLS P+DLKD+WA+HGTNRY
Sbjct  233   TLSQYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLSAEGYDLSCPVDLKDYWARHGTNRY  292

Query  1475  STVK  1486
              T+K
Sbjct  293   ITIK  296



>ref|XP_009140266.1| PREDICTED: protein BASIC PENTACYSTEINE4 [Brassica rapa]
Length=286

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 136/304 (45%), Positives = 179/304 (59%), Gaps = 49/304 (16%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN A+  +  ALA RD A+LQRD A+AER+ AL 
Sbjct  30    KEQHNALVMNKKIMSILAERDAAVHERNQAVSAKIEALAARDQALLQRDKALAERDKALI  89

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA +AL+  E+S+N     + S G           +    A  D  + L    F + 
Sbjct  90    ERDNAFAALQHHENSLN----FALSGG-----------KRCQGADDDDDDVL----FTID  130

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
             D  P T+ N  K  + K+    K  K+            DL+                  
Sbjct  131   DLCPTTSTNTTKAIKRKKENKPKGKKVGE----------DLNL----------------L  164

Query  1115  VDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTT  1294
             V A  +++ K  DT    FGL  V  D   MPVPVC+CTG+   CYKWGNGGWQS+CCTT
Sbjct  165   VAAPGKKRKKDWDT--NHFGLNLVTFDEKTMPVPVCTCTGSAHQCYKWGNGGWQSSCCTT  222

Query  1295  TISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRY  1474
             T+S+YPLPQ  +KR+SRVGGRKMS + FS+LLS L AEGYDLS+ +DLKD+WA+HGTNRY
Sbjct  223   TLSLYPLPQKPNKRHSRVGGRKMSGNVFSRLLSHLAAEGYDLSSRVDLKDYWARHGTNRY  282

Query  1475  STVK  1486
              T+K
Sbjct  283   ITIK  286



>ref|XP_008803315.1| PREDICTED: barley B recombinant-like protein D isoform X1 [Phoenix 
dactylifera]
Length=445

 Score =   232 bits (592),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 195/323 (60%), Gaps = 27/323 (8%)
 Frame = +2

Query  593   NSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAI  772
             N TI+ +MAIM+ERD AI E N+AL E+K ALAERD+A+LQRD AIAERN A+ ERDNAI
Sbjct  125   NQTIK-FMAIMSERDNAIQEHNIALAEKKAALAERDVAILQRDTAIAERNNAIMERDNAI  183

Query  773   SALKL-RESSMNDEDIVSKSPG--AEHIHYQQEMHEMISAAAYDPTE-NLTNDPFN----  928
             +AL+  RE+ MN     +  PG  A         H+        P+   L++ P+N    
Sbjct  184   AALQYARENGMNTNGATACPPGCAAPRGSKHIHHHQQQHLQHIHPSPPQLSDAPYNHYNH  243

Query  929   -----VTDPTP-----QTANNPRKVRQPKE------SKPKKASKLArvvkreeveveDLS  1060
                  +T+  P     ++A   R V++P++      S  KK+SK  R  ++   E  +  
Sbjct  244   AREMHITEAFPISTASESAAKGRMVKRPRKETKVQNSPYKKSSKTPRKSRKGGGEDLNRQ  303

Query  1061  WQAVSTFDDWDDGNCGEFVDASDE-EQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGT  1237
                     DW  G  G   D ++     KH +   +D GL QV  + + MP PVCSCTG 
Sbjct  304   VTIAKPASDWR-GEVGGGDDLNERVSLTKHQEWKGQDLGLNQVTFEEATMPTPVCSCTGK  362

Query  1238  PQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYD  1417
              Q CYKW NGGWQSACCTTT+SMYPLP   +KR++R+GGRKMS  AF KLLSRL AEG+D
Sbjct  363   YQQCYKWENGGWQSACCTTTLSMYPLPVMPNKRHTRMGGRKMSGGAFRKLLSRLAAEGHD  422

Query  1418  LSAPLDLKDHWAKHGTNRYSTVK  1486
             LS  +DLKDHWAKHGTNRY T+K
Sbjct  423   LSQSVDLKDHWAKHGTNRYITIK  445



>ref|XP_006294544.1| hypothetical protein CARUB_v10023579mg [Capsella rubella]
 gb|EOA27442.1| hypothetical protein CARUB_v10023579mg [Capsella rubella]
Length=294

 Score =   226 bits (576),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 132/308 (43%), Positives = 182/308 (59%), Gaps = 52/308 (17%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN A+  +K A+A RD A+ QRD A++ER+ AL 
Sbjct  33    KEQHNALVMNKKIMSILAERDAAVHERNQAVSAKKEAVAARDEALQQRDKALSERDKALI  92

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA +AL+  E+S+N      K    +   +  E H++    A  P   L+  P  VT
Sbjct  93    ERDNAYAALQHHENSLNFALSGGKRADGDDC-FGTETHKL----AVFP---LSTIPPEVT  144

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
             +      N  +K  +  + K KK  +             DL+ +  +    +  DWD   
Sbjct  145   NTK---VNKRKKENKQGQVKLKKVGE-------------DLNRRVAAPGKKSRTDWDS--  186

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                                 +D GL  V  D + MPVP+C+CTG+ + CYKWGNGGWQS+
Sbjct  187   --------------------QDVGLNLVTFDETTMPVPMCTCTGSARQCYKWGNGGWQSS  226

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLPQ  +KR+SR+GGRKMS + FS+LLSRL AEGYDLS P+DLKD+WA+HG
Sbjct  227   CCTTTLSQYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAAEGYDLSCPVDLKDYWARHG  286

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  287   TNRYITIK  294



>ref|XP_010429023.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Camelina sativa]
Length=297

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 174/304 (57%), Gaps = 41/304 (13%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAAI ERN A+  +K A+A RD A+ QRD A++ER+ AL 
Sbjct  33    KEQHNALVMNKKIMSILAERDAAIHERNQAVSAKKEAIAARDEALQQRDKALSERDKALI  92

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA +AL+  E+S+N      K           E H++           L+  P  VT
Sbjct  93    ERDNAYAALQHHENSLNFALSGGKRGDDGDDCVGVEPHKLTVFP-------LSAIPPEVT  145

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
               T + A   ++ +Q +    K    L             ++     +  DWD       
Sbjct  146   STTTKVAKRKKESKQGQVKMKKVGEDL----------NRRVAAPGKKSRKDWDS------  189

Query  1115  VDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTT  1294
                              D GL  V  D + MPVP+C+CTG+ + CYKWGNGGWQS+CCTT
Sbjct  190   ----------------LDVGLNLVTFDETTMPVPMCTCTGSARQCYKWGNGGWQSSCCTT  233

Query  1295  TISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRY  1474
             T+S YPLPQ  +KR+SR+GGRKMS + FS+LLSRL AEGYDLS P+DLKD+WA+HGTNRY
Sbjct  234   TLSEYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAAEGYDLSCPVDLKDYWARHGTNRY  293

Query  1475  STVK  1486
              T+K
Sbjct  294   ITIK  297



>ref|XP_010028660.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X2 [Eucalyptus 
grandis]
Length=303

 Score =   225 bits (574),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 137/297 (46%), Positives = 174/297 (59%), Gaps = 34/297 (11%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             M I+ E++ AI ER  A  + K A+  RD A  QR+ A+ ER+ AL ERDNA +AL+  E
Sbjct  35    MNILREKEQAIQERKDAEAQTKAAIGARDEAFRQREEALVERDKALMERDNARAALQYWE  94

Query  794   SSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQT-----AN  958
             +++N   +     G + +H     H   S A  D  E L  D   +TD  P +     A 
Sbjct  95    NAINFTMVGGNQHGLKRVH-----HPPYSPA--DIAEALNAD-VRITDAFPISSITADAI  146

Query  959   NPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
              PR+ ++ KE K   ASK +   ++ +   EDL+ Q +S                     
Sbjct  147   KPRQGKRSKEGK-GIASKGSSTQRKGKRVGEDLNVQVLS-------------------HA  186

Query  1139  DKHLDTWDE-DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPL  1315
              K    WD  D  L  V  + S MPVPVCSCTG P+ CYKWGNGGWQS+CCTTT+SMYPL
Sbjct  187   KKVRSKWDSADVCLNLVVFNGSTMPVPVCSCTGIPRHCYKWGNGGWQSSCCTTTLSMYPL  246

Query  1316  PQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             PQ  HKR++RV GRKMS S F+KLLSRL AEG+DLS PLDLKD+WAKHGTNRY T+K
Sbjct  247   PQIPHKRHARVSGRKMSGSVFTKLLSRLAAEGHDLSIPLDLKDYWAKHGTNRYITIK  303



>ref|XP_010028658.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028659.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55432.1| hypothetical protein EUGRSUZ_I01334 [Eucalyptus grandis]
Length=314

 Score =   225 bits (574),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 137/297 (46%), Positives = 174/297 (59%), Gaps = 34/297 (11%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             M I+ E++ AI ER  A  + K A+  RD A  QR+ A+ ER+ AL ERDNA +AL+  E
Sbjct  46    MNILREKEQAIQERKDAEAQTKAAIGARDEAFRQREEALVERDKALMERDNARAALQYWE  105

Query  794   SSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQT-----AN  958
             +++N   +     G + +H     H   S A  D  E L  D   +TD  P +     A 
Sbjct  106   NAINFTMVGGNQHGLKRVH-----HPPYSPA--DIAEALNAD-VRITDAFPISSITADAI  157

Query  959   NPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
              PR+ ++ KE K   ASK +   ++ +   EDL+ Q +S                     
Sbjct  158   KPRQGKRSKEGK-GIASKGSSTQRKGKRVGEDLNVQVLS-------------------HA  197

Query  1139  DKHLDTWDE-DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPL  1315
              K    WD  D  L  V  + S MPVPVCSCTG P+ CYKWGNGGWQS+CCTTT+SMYPL
Sbjct  198   KKVRSKWDSADVCLNLVVFNGSTMPVPVCSCTGIPRHCYKWGNGGWQSSCCTTTLSMYPL  257

Query  1316  PQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             PQ  HKR++RV GRKMS S F+KLLSRL AEG+DLS PLDLKD+WAKHGTNRY T+K
Sbjct  258   PQIPHKRHARVSGRKMSGSVFTKLLSRLAAEGHDLSIPLDLKDYWAKHGTNRYITIK  314



>ref|XP_006294545.1| hypothetical protein CARUB_v10023579mg, partial [Capsella rubella]
 gb|EOA27443.1| hypothetical protein CARUB_v10023579mg, partial [Capsella rubella]
Length=336

 Score =   226 bits (575),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 132/308 (43%), Positives = 182/308 (59%), Gaps = 52/308 (17%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN A+  +K A+A RD A+ QRD A++ER+ AL 
Sbjct  75    KEQHNALVMNKKIMSILAERDAAVHERNQAVSAKKEAVAARDEALQQRDKALSERDKALI  134

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA +AL+  E+S+N      K    +   +  E H++    A  P   L+  P  VT
Sbjct  135   ERDNAYAALQHHENSLNFALSGGKRADGDDC-FGTETHKL----AVFP---LSTIPPEVT  186

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
             +      N  +K  +  + K KK  +             DL+ +  +    +  DWD   
Sbjct  187   NTK---VNKRKKENKQGQVKLKKVGE-------------DLNRRVAAPGKKSRTDWDS--  228

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                                 +D GL  V  D + MPVP+C+CTG+ + CYKWGNGGWQS+
Sbjct  229   --------------------QDVGLNLVTFDETTMPVPMCTCTGSARQCYKWGNGGWQSS  268

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLPQ  +KR+SR+GGRKMS + FS+LLSRL AEGYDLS P+DLKD+WA+HG
Sbjct  269   CCTTTLSQYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAAEGYDLSCPVDLKDYWARHG  328

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  329   TNRYITIK  336



>ref|XP_010416867.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Camelina sativa]
Length=295

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 128/308 (42%), Positives = 179/308 (58%), Gaps = 51/308 (17%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAAI ERN A+  +K A+A RD A+ QRD A++ER+ AL 
Sbjct  33    KEQHNALVMNKKIMSILAERDAAIHERNQAVSAKKEAVAARDEALQQRDKALSERDKALI  92

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA +AL+                     H++  ++  +S    D  ++      +  
Sbjct  93    ERDNAYAALQ---------------------HHENSLNFALSGGKRDDGDDCVGVEPHKL  131

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
                P +A  P      K +K KK SK  +   + +   EDL+ +  +    +  DWD   
Sbjct  132   AVFPLSAIPPEVTSTTKVAKRKKESK--QGQVKIKKVGEDLNRRVAAPGKKSRKDWDS--  187

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                                  + GL  V  D + MPVP+C+CTG+ + CYKWGNGGWQS+
Sbjct  188   --------------------LEVGLNLVTFDETTMPVPMCTCTGSARQCYKWGNGGWQSS  227

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S+YPLPQ  +KR+SR+GGRKMS + FS+LLSRL AEGYDLS P+DLKD+WA+HG
Sbjct  228   CCTTTLSLYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAAEGYDLSCPVDLKDYWARHG  287

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  288   TNRYITIK  295



>gb|EMS63619.1| hypothetical protein TRIUR3_11677 [Triticum urartu]
Length=385

 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/294 (45%), Positives = 181/294 (62%), Gaps = 15/294 (5%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKL-R  790
             +A+++ERD AI+ER+ AL E+K A+AERDMA  QRD+A+AERN A+ ERDNA++AL+L R
Sbjct  40    LALLSERDTAIMERDHALAEKKAAMAERDMAFAQRDSAMAERNAAIVERDNALAALELAR  99

Query  791   ESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPF------NVTDPTPQT  952
              +  N       +PG+ +       H+    A   P + L + P+      +++D  P  
Sbjct  100   TNGFNMNSGNGFNPGSLNGAKNFHHHDQQPHAQSSPLQ-LADSPYDHAREMHISDAYP-I  157

Query  953   ANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDD-GNCGEFVDASD  1129
             +  P       +   K +S+ + + +   V       +      DW D G  G   D + 
Sbjct  158   STAPVTAAGKAKKPKKNSSQASPLKRPSGVLR-----KTKKAGGDWRDAGMSGVGEDPAR  212

Query  1130  EEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMY  1309
                +   +  D+D GL QV+ D S+MP P CSCTG  + CYKWGNGGWQS+CCT ++SMY
Sbjct  213   AASEMKNEWKDQDLGLNQVSFDESSMPAPACSCTGVLRQCYKWGNGGWQSSCCTMSMSMY  272

Query  1310  PLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNR  1471
             PLP   +KR++R+GGRKMS SAF+KLLSRL AEG+DLSA +DLKDHWAKHGTNR
Sbjct  273   PLPVMPNKRHARMGGRKMSGSAFTKLLSRLAAEGHDLSASVDLKDHWAKHGTNR  326



>ref|XP_004503784.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503785.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X2 [Cicer 
arietinum]
Length=308

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 188/309 (61%), Gaps = 40/309 (13%)
 Frame = +2

Query  581   KDQN----NSTIRTYMAIMAERDAAILERNM--ALDERKRALAERDMAMLQRDAAIAERN  742
             K+QN    N  IR+   IMAER AAILE  +  A+ E+  ALA RD A+ QRD A+A+R+
Sbjct  33    KEQNALVMNKKIRS---IMAERQAAILELELEAAISEKNEALAARDAALRQRDEALAQRD  89

Query  743   TALEERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDP  922
             +AL ERDNA++AL+ R +S+N       + G++ +H+       ++ AAY   + +  D 
Sbjct  90    SALLERDNALAALQSRSNSVN----FPFNGGSKRMHHSSNHLSDMTEAAYGSKDIIIRDA  145

Query  923   FNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGN  1102
               VT  T +      K    K SK  K SK      + +   EDL+ +A S         
Sbjct  146   SPVTVITSEAV----KSHLAKRSKGNKVSK---PPTKVKKMGEDLNRKAYS---------  189

Query  1103  CGEFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQS  1279
                       E  K    WD +D GL  V  D + MPVPVC+CTG P+ CYKWGNGGWQS
Sbjct  190   ----------EGTKIKSEWDRQDVGLNLVAFDETIMPVPVCTCTGVPRQCYKWGNGGWQS  239

Query  1280  ACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKH  1459
             +CCTTT+SMYPLPQ  +KR++R+GGRKMS S F++LLSRL +EG+D+S PLDLK++WA+H
Sbjct  240   SCCTTTLSMYPLPQLPNKRHARIGGRKMSGSVFTRLLSRLASEGHDVSIPLDLKEYWARH  299

Query  1460  GTNRYSTVK  1486
             GTNRY T+K
Sbjct  300   GTNRYITIK  308



>gb|AET05031.2| GAGA-binding transcriptional activator BBR/BPC6-like protein 
[Medicago truncatula]
Length=312

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 185/309 (60%), Gaps = 36/309 (12%)
 Frame = +2

Query  581   KDQN----NSTIRTYMAIMAERDAAILERNMA--LDERKRALAERDMAMLQRDAAIAERN  742
             K+QN    N  IR+   IMAER AA+LE  +   + E+  ALA RD+A+ QRD A+A+R+
Sbjct  33    KEQNALVMNKKIRS---IMAERQAALLELELEAAISEKNEALAARDVALRQRDEALAQRD  89

Query  743   TALEERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDP  922
              AL ERDNA++AL+ R S+ N         G++ +H+       ++ AAY  T+ +  D 
Sbjct  90    NALLERDNALAALQSRNSTANFPFNGGIQRGSKRMHHSSNHISNMTEAAYSTTDIIIRDA  149

Query  923   FNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGN  1102
               VT  T +      K    K +K  KAS+      + +   EDL+ +A S         
Sbjct  150   SPVTVITSEDV----KSHLTKRTKENKASQ---TPTKIKKMGEDLNRKAYS---------  193

Query  1103  CGEFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQS  1279
                       E  K    WD +D GL  +  D + MPVPVC+CTG P+ CYKWGNGGWQS
Sbjct  194   ----------EGTKIKSEWDRQDVGLNSIAFDETVMPVPVCTCTGVPRQCYKWGNGGWQS  243

Query  1280  ACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKH  1459
             +CCTTT+SM+PLPQ  +KR++R+GGRKMS + F +LLSR  +EG+DLS PLDLKD+WA+H
Sbjct  244   SCCTTTLSMHPLPQLPNKRHARIGGRKMSGNVFRRLLSRFASEGHDLSIPLDLKDYWARH  303

Query  1460  GTNRYSTVK  1486
             GTNRY T+K
Sbjct  304   GTNRYITIK  312



>ref|XP_009804621.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Nicotiana sylvestris]
 ref|XP_009804622.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Nicotiana sylvestris]
Length=313

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/307 (42%), Positives = 189/307 (62%), Gaps = 31/307 (10%)
 Frame = +2

Query  581   KDQNNSTIRTYMAIM-AERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             KDQ    + T + ++ AERDAA+ ER+ A+ E+   L ERD+A+ QRD AIAER+TA++E
Sbjct  33    KDQEAFIMNTKIRMLFAERDAAVEERDRAVIEKNTVLTERDLAIQQRDTAIAERDTAIKE  92

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD  937
             RDNAI+AL  +ES+MN   +  ++ G +  +  +   +  + +     +    D F ++ 
Sbjct  93    RDNAIAALHFQESTMNGT-LGCRTRGTKRPNQTKNHCDNSTDSVCINRDVPLTDAFPISA  151

Query  938   PTPQTANNPRKVRQPKESKPKK--ASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGE  1111
              + + A    K  Q K +K  K  + K A+  ++ +   EDL+    +      DG+  E
Sbjct  152   ISSEVA----KALQVKRTKGNKGMSRKSAKSPRKTKKVSEDLNRHLTT------DGSKAE  201

Query  1112  FVDASDEEQDKHLDTWD-EDFG-LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSAC  1285
                            WD +D G + Q+  D S+MP+PVC+CTG P+ CYKWG+GGWQS+C
Sbjct  202   ---------------WDAQDLGSINQIKFDESSMPIPVCTCTGIPRQCYKWGSGGWQSSC  246

Query  1286  CTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGT  1465
             CTT +S YPLPQ  +KR++R+GGRKMS S FS+LL+RL A G+DLS P+DLK +WAKHGT
Sbjct  247   CTTYLSEYPLPQLPNKRHARIGGRKMSGSVFSRLLTRLAAVGHDLSMPIDLKTYWAKHGT  306

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  307   NRYITIK  313



>ref|XP_010431840.1| PREDICTED: LOW QUALITY PROTEIN: protein BASIC PENTACYSTEINE5-like 
[Camelina sativa]
Length=293

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 127/309 (41%), Positives = 180/309 (58%), Gaps = 55/309 (18%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  R  M+I+AE+DAA+ E+N A+  +K ALA RD A+ QRD A++ER+ A+ 
Sbjct  33    KEQHNALVMNRKIMSILAEKDAAVKEKNEAVAAKKEALAARDEALEQRDKALSERDNAIM  92

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDP-FNV  931
             ER++A+ AL+ RE+++N     +   G++                   TE  ++ P  + 
Sbjct  93    ERESALKALQYRENNLNYILSCANRGGSQ-------------------TEEESHLPSLSP  133

Query  932   TDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDG  1099
                 P  A N R  ++ KE K    SK        +   +DL+ QA S    +  DWD  
Sbjct  134   ISTVPPEAANTRPTKRKKEXKQGARSK-------AKRVGDDLNRQAASPGMKSRKDWDS-  185

Query  1100  NCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQS  1279
                                   D GL  V  D + MPVP+C+CTGT + CYKWG+GGWQS
Sbjct  186   ---------------------NDVGLNLVTYDEATMPVPMCTCTGTARQCYKWGHGGWQS  224

Query  1280  ACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKH  1459
             +CCTTT+S YPLPQ  +KR+SR+GGRKMS   FS+LLSRL  +G+DLS+ +DLKD+WA+H
Sbjct  225   SCCTTTLSQYPLPQMPNKRHSRIGGRKMSGGVFSRLLSRLAGQGHDLSSLVDLKDYWARH  284

Query  1460  GTNRYSTVK  1486
             GTNRY T+K
Sbjct  285   GTNRYITIK  293



>ref|XP_007159983.1| hypothetical protein PHAVU_002G283200g [Phaseolus vulgaris]
 ref|XP_007159984.1| hypothetical protein PHAVU_002G283200g [Phaseolus vulgaris]
 gb|ESW31977.1| hypothetical protein PHAVU_002G283200g [Phaseolus vulgaris]
 gb|ESW31978.1| hypothetical protein PHAVU_002G283200g [Phaseolus vulgaris]
Length=312

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 175/303 (58%), Gaps = 36/303 (12%)
 Frame = +2

Query  593   NSTIRTYMAIMAERDAAILERNM--ALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             N  IR+   IMAER AAILE  +  A+  +  ALA RD A+ QRD A+A+R+ A+ ERDN
Sbjct  41    NKKIRS---IMAERQAAILELELEAAISVKNEALAARDAAIRQRDEALAQRDNAILERDN  97

Query  767   AISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTEN--LTNDPFN-VTD  937
             A++AL+ R +S++         G++ +H+       +S A+Y   +   L   PF  V  
Sbjct  98    ALAALQSRNNSVSFPFGSRIQCGSKRMHHSSNHLPNMSEASYKTKDASPLAVIPFEAVKS  157

Query  938   PTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFV  1117
             P  +     + +     + P K  K+   + R+       S++      +W         
Sbjct  158   PQAKRTKENKVISSKASNPPYKVKKMGEDLNRKA------SFEGTKIRSEWHR-------  204

Query  1118  DASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTT  1297
                            +D GL  V  D + MPVPVC+CTG P+ CYKWGNGGWQS+CCTTT
Sbjct  205   ---------------QDVGLNLVTFDETTMPVPVCTCTGIPRQCYKWGNGGWQSSCCTTT  249

Query  1298  ISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYS  1477
             +SM+PLPQ  +KR++R+GGRKMS S F++LLSRL  EG+DLS PLDLK++WA+HGTNRY 
Sbjct  250   LSMHPLPQLPNKRHARIGGRKMSGSVFTRLLSRLVLEGHDLSIPLDLKEYWARHGTNRYI  309

Query  1478  TVK  1486
             T+K
Sbjct  310   TIK  312



>ref|XP_011088552.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X2 [Sesamum indicum]
Length=305

 Score =   222 bits (565),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 185/306 (60%), Gaps = 32/306 (10%)
 Frame = +2

Query  581   KDQNNSTIRTYMAIMA-ERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             K+QN   +   ++++  ERDAAI ER+ AL E+K AL ERD+A+ QRDAAIA+R+ AL E
Sbjct  28    KEQNAYHVNAKISMLCDERDAAIQERDRALAEKKVALNERDVAIQQRDAAIADRDNALRE  87

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD  937
             RDNAI+AL+  ES+MN   + + + G +  ++ +        +A +  E    +   ++ 
Sbjct  88    RDNAIAALQFHESTMN-AVLGNNARGLKRTNHPRNQQANNVKSARNLGERCITNALPISA  146

Query  938   -PTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
              P+        KV +   SK  K+ +  +                       +D N    
Sbjct  147   IPSDAEKEERTKVNKNITSKKTKSPRKVKRKG--------------------EDLNRNIT  186

Query  1115  VDASDEEQDKHLDTWD-EDFG-LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACC  1288
              + S  E       W+ ++FG +  ++ + S MPVP+CSCTG P+ CYKWGNGGWQS+CC
Sbjct  187   TEGSKAE-------WEAQEFGSISPISFNESTMPVPICSCTGAPRQCYKWGNGGWQSSCC  239

Query  1289  TTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTN  1468
             TT+IS+YPLPQ  +KR++R+GGRKMS S FS+LL+R+ + G+DLS P+DLK++WAKHGTN
Sbjct  240   TTSISVYPLPQIPNKRHARMGGRKMSGSVFSRLLTRMASAGHDLSIPIDLKNYWAKHGTN  299

Query  1469  RYSTVK  1486
             RY T+K
Sbjct  300   RYITIK  305



>ref|XP_010472104.1| PREDICTED: protein BASIC PENTACYSTEINE4 [Camelina sativa]
Length=295

 Score =   221 bits (564),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 177/308 (57%), Gaps = 51/308 (17%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAAI ERN A+  +K A+A RD A+ QRD A++ER+ AL 
Sbjct  33    KEQHNALVMNKKIMSILAERDAAIHERNQAVSAKKEAVAARDEALQQRDKALSERDKALI  92

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA +AL+                     H++  ++  +S       ++      +  
Sbjct  93    ERDNAYAALQ---------------------HHENSLNFALSGGKRGDGDDCVGVEPHKL  131

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
                P +   P      K +K KK SK  +   + +   EDL+ +  +    +  DWD   
Sbjct  132   AVFPLSTIPPEVTSTTKVAKRKKESK--QGQVKMKKVGEDLNRRVAAPGKKSRKDWDS--  187

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                                  D GL  V  D + MPVP+C+CTG+ + CYKWGNGGWQS+
Sbjct  188   --------------------LDVGLNLVTFDETIMPVPMCTCTGSARQCYKWGNGGWQSS  227

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S+YPLPQ  +KR+SR+GGRKMS + FS+LLSRL AEGYDLS P+DLKD+WA+HG
Sbjct  228   CCTTTLSLYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAAEGYDLSCPVDLKDYWARHG  287

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  288   TNRYITIK  295



>ref|XP_003630555.1| GAGA-binding transcriptional activator BBR/BPC4-like protein 
[Medicago truncatula]
Length=356

 Score =   223 bits (569),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 185/309 (60%), Gaps = 36/309 (12%)
 Frame = +2

Query  581   KDQN----NSTIRTYMAIMAERDAAILERNMA--LDERKRALAERDMAMLQRDAAIAERN  742
             K+QN    N  IR+   IMAER AA+LE  +   + E+  ALA RD+A+ QRD A+A+R+
Sbjct  77    KEQNALVMNKKIRS---IMAERQAALLELELEAAISEKNEALAARDVALRQRDEALAQRD  133

Query  743   TALEERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDP  922
              AL ERDNA++AL+ R S+ N         G++ +H+       ++ AAY  T+ +  D 
Sbjct  134   NALLERDNALAALQSRNSTANFPFNGGIQRGSKRMHHSSNHISNMTEAAYSTTDIIIRDA  193

Query  923   FNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGN  1102
               VT  T +      K    K +K  KAS+      + +   EDL+ +A S         
Sbjct  194   SPVTVITSEDV----KSHLTKRTKENKASQ---TPTKIKKMGEDLNRKAYS---------  237

Query  1103  CGEFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQS  1279
                       E  K    WD +D GL  +  D + MPVPVC+CTG P+ CYKWGNGGWQS
Sbjct  238   ----------EGTKIKSEWDRQDVGLNSIAFDETVMPVPVCTCTGVPRQCYKWGNGGWQS  287

Query  1280  ACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKH  1459
             +CCTTT+SM+PLPQ  +KR++R+GGRKMS + F +LLSR  +EG+DLS PLDLKD+WA+H
Sbjct  288   SCCTTTLSMHPLPQLPNKRHARIGGRKMSGNVFRRLLSRFASEGHDLSIPLDLKDYWARH  347

Query  1460  GTNRYSTVK  1486
             GTNRY T+K
Sbjct  348   GTNRYITIK  356



>gb|KHG11898.1| basic pentacysteine4 -like protein [Gossypium arboreum]
Length=310

 Score =   222 bits (565),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 190/314 (61%), Gaps = 48/314 (15%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAAI ERN+A+ ERK ALA RD A+ QRD A+AER++AL 
Sbjct  33    KEQSNALVMNKKIMSILAERDAAIRERNIAVSERKEALAARDEALQQRDKALAERDSALI  92

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQE-MHEMISAAAYDPTEN----LTND  919
             ERDNA++ L+ RE++ N        P    I   +  MH    ++  D T N    +TN 
Sbjct  93    ERDNALAVLQCRENAKN-------FPFGSGIQRGRTCMHLSYHSSDMDETLNHEMHVTNA  145

Query  920   PFNVTDPTPQTANNP---RKVRQPKESK-PKKASKLArvvkreeveveDLSWQAVSTFDD  1087
                 T P+ +  + P    KV +   SK P+K  K+A          EDL+ Q       
Sbjct  146   LPVSTIPSAEGKSCPVKRTKVNKAVSSKSPRKIKKVA----------EDLNRQV------  189

Query  1088  WDDGNCGEFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGN  1264
                          D E  K    W+ E  GL  +N D + + VPVCSCTG P+ CYKWGN
Sbjct  190   -------------DTEVRKCKSEWNSEHIGLSLINFDETKISVPVCSCTGVPRHCYKWGN  236

Query  1265  GGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKD  1444
             GGWQS+CCTT+IS YPLPQ  +KR++RVGGRKMS S F+KLLSRL AEGYD+S PLDLK 
Sbjct  237   GGWQSSCCTTSISSYPLPQMPNKRHARVGGRKMSGSVFTKLLSRLAAEGYDVSKPLDLKT  296

Query  1445  HWAKHGTNRYSTVK  1486
             +WA+HGTNRY T+K
Sbjct  297   YWARHGTNRYITIK  310



>ref|XP_011088547.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Sesamum indicum]
 ref|XP_011088549.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Sesamum indicum]
 ref|XP_011088550.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Sesamum indicum]
 ref|XP_011088551.1| PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1 [Sesamum indicum]
Length=308

 Score =   221 bits (564),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 185/306 (60%), Gaps = 32/306 (10%)
 Frame = +2

Query  581   KDQNNSTIRTYMAIMA-ERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             K+QN   +   ++++  ERDAAI ER+ AL E+K AL ERD+A+ QRDAAIA+R+ AL E
Sbjct  31    KEQNAYHVNAKISMLCDERDAAIQERDRALAEKKVALNERDVAIQQRDAAIADRDNALRE  90

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD  937
             RDNAI+AL+  ES+MN   + + + G +  ++ +        +A +  E    +   ++ 
Sbjct  91    RDNAIAALQFHESTMN-AVLGNNARGLKRTNHPRNQQANNVKSARNLGERCITNALPISA  149

Query  938   -PTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
              P+        KV +   SK  K+ +  +                       +D N    
Sbjct  150   IPSDAEKEERTKVNKNITSKKTKSPRKVKRKG--------------------EDLNRNIT  189

Query  1115  VDASDEEQDKHLDTWD-EDFG-LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACC  1288
              + S  E       W+ ++FG +  ++ + S MPVP+CSCTG P+ CYKWGNGGWQS+CC
Sbjct  190   TEGSKAE-------WEAQEFGSISPISFNESTMPVPICSCTGAPRQCYKWGNGGWQSSCC  242

Query  1289  TTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTN  1468
             TT+IS+YPLPQ  +KR++R+GGRKMS S FS+LL+R+ + G+DLS P+DLK++WAKHGTN
Sbjct  243   TTSISVYPLPQIPNKRHARMGGRKMSGSVFSRLLTRMASAGHDLSIPIDLKNYWAKHGTN  302

Query  1469  RYSTVK  1486
             RY T+K
Sbjct  303   RYITIK  308



>ref|XP_003557130.1| PREDICTED: barley B recombinant-like protein D [Brachypodium 
distachyon]
 ref|XP_010228059.1| PREDICTED: barley B recombinant-like protein D [Brachypodium 
distachyon]
 ref|XP_010228060.1| PREDICTED: barley B recombinant-like protein D [Brachypodium 
distachyon]
 ref|XP_010228061.1| PREDICTED: barley B recombinant-like protein D [Brachypodium 
distachyon]
 ref|XP_010228062.1| PREDICTED: barley B recombinant-like protein D [Brachypodium 
distachyon]
 ref|XP_010228063.1| PREDICTED: barley B recombinant-like protein D [Brachypodium 
distachyon]
Length=327

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 134/298 (45%), Positives = 187/298 (63%), Gaps = 17/298 (6%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             +A+M+ERD AI+ER+ AL E+K ALAERDMA  QR++A+ ERN A+ ERDNA++AL+L  
Sbjct  40    LALMSERDNAIMERDHALAEKKAALAERDMAFAQRESAMVERNAAIVERDNALAALELAR  99

Query  794   SSMNDEDIVSKSP-----GAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTAN  958
             ++  + +  +  P     G ++ H+    H+ +S A   P + L + P++ +     +  
Sbjct  100   TNGFNVNNGNGFPAGSLSGTKNFHH----HDQLSHAQSSPRQ-LADSPYDHSKEMHISEA  154

Query  959   NPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDD-GNCGEFVDASDEE  1135
              P  +      K K++ K +    +    V   + +A     DW D G  G   D + E 
Sbjct  155   YPISIASGNAGKIKRSKKNSSPPMKRPSGVLRKTKKATG---DWRDVGMSGGGEDPARES  211

Query  1136  QDKHLDTW-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYP  1312
               K  + W D+D GL QV  D S+MP P CSCTG  + CYKWGNGGWQS+CCT ++SMYP
Sbjct  212   VMK--NEWKDQDLGLNQVAYDESSMPAPSCSCTGKLRQCYKWGNGGWQSSCCTMSMSMYP  269

Query  1313  LPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             LP   +KR++R+GGRKMS SAF+KLLSRL  EG+DLS  +DLKDHWAKHGTNRY T++
Sbjct  270   LPVMPNKRHARMGGRKMSGSAFTKLLSRLAGEGHDLSTSVDLKDHWAKHGTNRYITIR  327



>ref|NP_001274818.1| protein BASIC PENTACYSTEINE4-like [Solanum tuberosum]
 gb|ADV59398.1| GAGA-binding transcriptional activator [Solanum tuberosum]
Length=313

 Score =   219 bits (558),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 182/309 (59%), Gaps = 35/309 (11%)
 Frame = +2

Query  581   KDQNNSTIRTYM-AIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             KDQ    + T +  + AERDAA+ ER+ A+ E+K A AERD A+ QRD A AER+TA++E
Sbjct  33    KDQEAFIMNTKIRMVFAERDAAVEERDRAVIEKKEAYAERDFAIQQRDTAFAERDTAVKE  92

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD  937
             RDNAI+AL   ES+ N   +  ++ G +    Q + H       Y+      N    V D
Sbjct  93    RDNAIAALHFLESTTNGS-LGCRTRGTKRPE-QPKNH-----CNYNTDSVCINRDVPVAD  145

Query  938   PTPQTA--NNPRKVRQPKESKPKK--ASKLArvvkreeveveDLSWQAVSTFDDWDDGNC  1105
               P +A  +   KV Q K SK  K  ++K A+   + +   EDL+    +      DG+ 
Sbjct  146   AFPISAISSEAAKVLQVKRSKVNKGMSTKSAKSSTKTKKANEDLNRHLTT------DGSK  199

Query  1106  GEFVDASDEEQDKHLDTWD-EDFG-LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQS  1279
              E               WD +D G ++Q+  D S MP+PVC+CTG P+ CYKWG+GGWQS
Sbjct  200   AE---------------WDAQDLGSIDQIQFDESTMPIPVCTCTGIPRQCYKWGSGGWQS  244

Query  1280  ACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKH  1459
             +CCTT +S YPLPQ  +KR++R+GGRKMS S FS+LL+R      DLS P+DLK +WAKH
Sbjct  245   SCCTTYLSEYPLPQLPNKRHARLGGRKMSGSVFSRLLTRFAVADRDLSMPIDLKTYWAKH  304

Query  1460  GTNRYSTVK  1486
             GTNRY T+K
Sbjct  305   GTNRYITIK  313



>gb|ABU63289.1| GAGA-motif binding transcriptional activator, partial [Arabidopsis 
thaliana]
Length=297

 Score =   219 bits (557),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 127/313 (41%), Positives = 183/313 (58%), Gaps = 69/313 (22%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  ++I+AERDAA+ ERN A+   K ALA RD A+ QRD A++ER+ A+ 
Sbjct  43    KEQHNALVMNKKIISILAERDAAVKERNEAVAATKEALASRDEALEQRDKALSERDNAIM  102

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             E ++A++AL+ RE+++N                      ++S A  D ++    +  ++ 
Sbjct  103   ETESALNALRYRENNLN---------------------YILSCAKRDGSQRFITEESHLP  141

Query  935   DPTPQT-----ANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDD  1087
             +P+P +     A N R  ++ KESK  K               EDL+    S    +  D
Sbjct  142   NPSPISTIPPEAANTRPTKRKKESKQGK------------KMGEDLNRPVASPGKKSRKD  189

Query  1088  WDDGNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNG  1267
             WD  +               L T+DE           + MPVP+C+CTGT + CYKWGNG
Sbjct  190   WDSNDV--------------LVTFDE-----------TTMPVPMCTCTGTARQCYKWGNG  224

Query  1268  GWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDH  1447
             GWQS+CCTTT+S YPLPQ  +KR+SRVGGRKMS S FS+LLSRL  EG++LS+P+DLK++
Sbjct  225   GWQSSCCTTTLSEYPLPQMPNKRHSRVGGRKMSGSVFSRLLSRLAGEGHELSSPVDLKNY  284

Query  1448  WAKHGTNRYSTVK  1486
             WA+HGTNRY T+K
Sbjct  285   WARHGTNRYITIK  297



>gb|ABU63290.1| GAGA-motif binding transcriptional activator, partial [Arabidopsis 
thaliana]
Length=297

 Score =   218 bits (556),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 128/308 (42%), Positives = 184/308 (60%), Gaps = 59/308 (19%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  ++I+AERDAA+ ERN A+   K ALA RD A+ QRD A++ER+ A+ 
Sbjct  43    KEQHNALVMNKKIISILAERDAAVKERNEAVAATKEALASRDEALEQRDKALSERDNAIM  102

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             E ++A++AL+ RE+++N     +K  G++           I+  ++ P      +P  ++
Sbjct  103   ETESALNALRYRENNLNYILSCAKRGGSQRF---------ITEESHLP------NPSPIS  147

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
                P+ AN  R  ++ KESK  K               EDL+    S    +  DWD  +
Sbjct  148   TIPPEAANT-RPTKRKKESKQGK------------KMGEDLNRPVASPGKKSRKDWDSND  194

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                            L T+DE           + MPVP+C+CTGT + CYKWGNGGWQS+
Sbjct  195   V--------------LVTFDE-----------TTMPVPMCACTGTARQCYKWGNGGWQSS  229

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLPQ  +KR+SRVGGRKMS S FS+LLSRL  EG++LS+P+DLK++WA+HG
Sbjct  230   CCTTTLSEYPLPQMPNKRHSRVGGRKMSGSVFSRLLSRLAGEGHELSSPVDLKNYWARHG  289

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  290   TNRYITIK  297



>ref|XP_002865511.1| GAGA-binding transcriptional activator [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41770.1| GAGA-binding transcriptional activator [Arabidopsis lyrata subsp. 
lyrata]
Length=332

 Score =   219 bits (558),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 145/333 (44%), Positives = 191/333 (57%), Gaps = 56/333 (17%)
 Frame = +2

Query  587   QNNSTIRTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDN  766
             Q+  +++  M+I+AERDAAI ERN+A+ E+K A+AERDMA LQRD AIAERN A+ ERD+
Sbjct  23    QHQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAIMERDS  82

Query  767   AISALKLRESSMNDEDIVSKS---PGAE-------------HIHYQQEMHEMISAAAYDP  898
             A++AL+ RE+SM      + S   PG +             H H+QQ     ++  AY+ 
Sbjct  83    ALTALQYRENSMVTAAATNMSACPPGCQISRGVKHLHHPHMHHHHQQHHIPQLTENAYET  142

Query  899   TENLTNDPFNVTDPTPQTANNP-----RKVRQPKESKPKKASKLArvvkreeveveDLSW  1063
              E   ND    + P      +      ++V+ PK +    A+K     +R+  +  D   
Sbjct  143   REMEPNDGLPTSPPAGSALESAKPKRGKRVKDPKATAQTTANKRGPKNQRKVKKESD---  199

Query  1064  QAVSTFDDWDDGNCGEFV----DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMP  1210
                      DD N   FV    D ++E+  KH+       W   E  GL QV  D + MP
Sbjct  200   ---------DDLNKIMFVKTTHDYTEEDSSKHILIGSKSDWKSQEMVGLNQVVYDETTMP  250

Query  1211  VPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLL  1390
              PVCSCTG            WQS+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLL
Sbjct  251   PPVCSCTGV-----------WQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLL  299

Query  1391  SRLTAEG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             SRL AEG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  300   SRLAAEGHHDLSNPVDLKDHWAKHGTNRYITIK  332



>ref|XP_010444881.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Camelina sativa]
Length=280

 Score =   217 bits (553),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 179/308 (58%), Gaps = 65/308 (21%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERD A+ E+N A+  +K ALA RD A+ QRD A++ER+TA+ 
Sbjct  32    KEQHNALVMNKKIMSILAERDTAVKEKNEAVAAKKEALAARDEALEQRDKALSERDTAIM  91

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ER++A++AL+ RE++                                 TE  ++ P +++
Sbjct  92    ERESALNALQYRENNRGGSQ----------------------------TEEESHLP-SLS  122

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
               TP+ AN  R  ++ KESK    SK        +   EDL+ QA S    +  DWD   
Sbjct  123   PITPEAANT-RTTKRKKESKQGARSK-------AKKVGEDLNRQAASPGMKSRKDWDSN-  173

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                                  D GL  V  D + MPVP+C+CTGT + CYKWG+GGWQS+
Sbjct  174   ---------------------DVGLNLVTFDETTMPVPMCTCTGTARQCYKWGHGGWQSS  212

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPL Q  +KR+SR+GGRKMS   FS+LLSRL  +G+DLS+ +DLKD+WA+HG
Sbjct  213   CCTTTLSQYPLLQMPNKRHSRIGGRKMSGGVFSRLLSRLAGQGHDLSSLVDLKDYWARHG  272

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  273   TNRYITIK  280



>ref|NP_195602.5| basic pentacysteine 5 [Arabidopsis thaliana]
 gb|AEE86991.1| basic pentacysteine 5 [Arabidopsis thaliana]
Length=258

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/308 (42%), Positives = 183/308 (59%), Gaps = 59/308 (19%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  ++I+AERDAA+ ERN A+   K ALA RD A+ QRD A++ER+ A+ 
Sbjct  4     KEQHNALVMNKKIISILAERDAAVKERNEAVAATKEALASRDEALEQRDKALSERDNAIM  63

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             E ++A++AL+ RE+++N     +K  G++           I+  ++ P      +P  ++
Sbjct  64    ETESALNALRYRENNLNYILSCAKRGGSQRF---------ITEESHLP------NPSPIS  108

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
                P+ AN  R  ++ KESK  K               EDL+    S    +  DWD  +
Sbjct  109   TIPPEAANT-RPTKRKKESKQGK------------KMGEDLNRPVASPGKKSRKDWDSND  155

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                            L T+DE             MPVP+C+CTGT + CYKWGNGGWQS+
Sbjct  156   V--------------LVTFDE-----------MTMPVPMCTCTGTARQCYKWGNGGWQSS  190

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLPQ  +KR+SRVGGRKMS S FS+LLSRL  EG++LS+P+DLK++WA+HG
Sbjct  191   CCTTTLSEYPLPQMPNKRHSRVGGRKMSGSVFSRLLSRLAGEGHELSSPVDLKNYWARHG  250

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  251   TNRYITIK  258



>ref|XP_004230934.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Solanum lycopersicum]
 ref|XP_010315340.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Solanum lycopersicum]
Length=313

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 134/308 (44%), Positives = 179/308 (58%), Gaps = 33/308 (11%)
 Frame = +2

Query  581   KDQNNSTIRTYM-AIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             KDQ    + T +  + AERDAA+ ERN A+ E+K A AERD A+ QRD A AER+TA++E
Sbjct  33    KDQEAFIMNTKIRMVFAERDAAVEERNRAVIEKKEAYAERDFAIQQRDTAFAERDTAIKE  92

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD  937
             RDNAI+AL   ES+ N   +  ++ G +    Q + H       Y+      N    V D
Sbjct  93    RDNAIAALHFLESTTNGS-LGCRTRGTKRPE-QPKNHR-----NYNTDSVCINRDVPVAD  145

Query  938   PTPQTA--NNPRKVRQPKESKPKK--ASKLArvvkreeveveDLSWQAVSTFDDWDDGNC  1105
               P +A  +   K  Q K SK  K  ++K A+  ++ +   EDL+               
Sbjct  146   AFPISAISSEAAKALQVKRSKVNKGMSTKSAKSPRKTKKVNEDLNRHLSK----------  195

Query  1106  GEFVDASDEEQDKHLDTWDEDFG-LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                 D S  E D H      D G ++Q+  D S MP+PVC+CTG P+ CYKWG+GGWQS+
Sbjct  196   ----DGSKAEWDAH------DLGSIDQIQFDESTMPIPVCTCTGIPRQCYKWGSGGWQSS  245

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTT +S YPLPQ  +KR++R+GGRKMS S FS+LL+R      DLS P+DLK +WAKHG
Sbjct  246   CCTTYLSEYPLPQLPNKRHARLGGRKMSGSVFSRLLTRFAVADRDLSMPIDLKTYWAKHG  305

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  306   TNRYITIK  313



>ref|XP_006359607.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Solanum tuberosum]
Length=313

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 181/309 (59%), Gaps = 35/309 (11%)
 Frame = +2

Query  581   KDQNNSTIRTYM-AIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             KDQ    + T +  + AERDAA+ ER+ A+ E+K A AERD A+ QRD A AER+TA++E
Sbjct  33    KDQEAFIMNTKIRMVFAERDAAVEERDRAVIEKKEAYAERDFAIQQRDTAFAERDTAVKE  92

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD  937
             RDNAI+AL   ES+ N   +  ++ G +    Q + H       Y+      N    V D
Sbjct  93    RDNAIAALHFLESTTNGS-LGCRTRGTKRPE-QPKNHR-----NYNTDSVCINRDVPVAD  145

Query  938   PTPQTA--NNPRKVRQPKESKPKK--ASKLArvvkreeveveDLSWQAVSTFDDWDDGNC  1105
               P +A  +   K  Q K SK  K  ++K A+   + +   EDL+    +      DG+ 
Sbjct  146   AFPISAISSEAAKALQVKRSKVNKGMSTKSAKSSTKTKKVNEDLNRHLTT------DGSK  199

Query  1106  GEFVDASDEEQDKHLDTWD-EDFGL-EQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQS  1279
              E               WD +D GL +Q+  D S MP+PVC+CTG P+ CYKWG+GGWQS
Sbjct  200   AE---------------WDAQDLGLIDQIQFDESTMPIPVCTCTGIPRQCYKWGSGGWQS  244

Query  1280  ACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKH  1459
             +CCTT +S YPLPQ  +KR++R+GGRKMS S FS+LL+R      DLS P+DLK +WAKH
Sbjct  245   SCCTTYLSEYPLPQLPNKRHARLGGRKMSGSVFSRLLTRFAVADRDLSMPIDLKTYWAKH  304

Query  1460  GTNRYSTVK  1486
             GTNRY T+K
Sbjct  305   GTNRYITIK  313



>ref|NP_001190957.1| basic pentacysteine 5 [Arabidopsis thaliana]
 sp|F4JUI3.1|BPC5_ARATH RecName: Full=Protein BASIC PENTACYSTEINE5; Short=AtBPC5; AltName: 
Full=GAGA-motif binding transcriptional activator BBR/BPC5 
[Arabidopsis thaliana]
 gb|AEE86992.1| basic pentacysteine 5 [Arabidopsis thaliana]
Length=283

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 128/308 (42%), Positives = 183/308 (59%), Gaps = 59/308 (19%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  ++I+AERDAA+ ERN A+   K ALA RD A+ QRD A++ER+ A+ 
Sbjct  29    KEQHNALVMNKKIISILAERDAAVKERNEAVAATKEALASRDEALEQRDKALSERDNAIM  88

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             E ++A++AL+ RE+++N     +K  G++           I+  ++ P      +P  ++
Sbjct  89    ETESALNALRYRENNLNYILSCAKRGGSQRF---------ITEESHLP------NPSPIS  133

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
                P+ AN  R  ++ KESK  K               EDL+    S    +  DWD  +
Sbjct  134   TIPPEAANT-RPTKRKKESKQGK------------KMGEDLNRPVASPGKKSRKDWDSND  180

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                            L T+DE             MPVP+C+CTGT + CYKWGNGGWQS+
Sbjct  181   V--------------LVTFDE-----------MTMPVPMCTCTGTARQCYKWGNGGWQSS  215

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLPQ  +KR+SRVGGRKMS S FS+LLSRL  EG++LS+P+DLK++WA+HG
Sbjct  216   CCTTTLSEYPLPQMPNKRHSRVGGRKMSGSVFSRLLSRLAGEGHELSSPVDLKNYWARHG  275

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  276   TNRYITIK  283



>emb|CDY22406.1| BnaA06g37280D [Brassica napus]
Length=262

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 129/308 (42%), Positives = 176/308 (57%), Gaps = 59/308 (19%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN AL  ++ ALA RD A+ QRD AI+ER+ A+ 
Sbjct  8     KEQHNALVMNKKIMSILAERDAAVKERNEALAAKQEALAARDEALQQRDLAISERDNAIM  67

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ER+NA++AL+ RE+ +N     +K  G     YQ    E        P   + ++P N  
Sbjct  68    ERENALTALQHRENHLNYILDCAKRGG-----YQTCFTEETHLPNPSPLSTIPHEPPN--  120

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
                                     +K  +  KR++   EDL+ Q  S       DWD  +
Sbjct  121   ------------------------TKRKKDRKRKKAGGEDLNRQLASPGKKCRKDWDCND  156

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
              G                      L  V  D + MPVP+C+CTGT + CYKWGNGGWQS+
Sbjct  157   VG----------------------LNLVTFDETTMPVPMCTCTGTARQCYKWGNGGWQSS  194

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLPQ  +KR+SR+GGRKMS + FS+LLSRL  EG+DLS+P+DLKD+WA+HG
Sbjct  195   CCTTTLSQYPLPQMPNKRHSRIGGRKMSGNVFSRLLSRLAGEGHDLSSPVDLKDYWARHG  254

Query  1463  TNRYSTVK  1486
             TNRY  +K
Sbjct  255   TNRYIIIK  262



>gb|ADV59402.1| GAGA-binding transcriptional activator [Lotus japonicus]
 gb|ADV59403.1| GAGA-binding transcriptional activator [Lotus japonicus]
 gb|AFK46069.1| unknown [Lotus japonicus]
Length=317

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 130/297 (44%), Positives = 183/297 (62%), Gaps = 32/297 (11%)
 Frame = +2

Query  617   AIMAERDAAILERNMA--LDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLR  790
             +IMAER AA+LE  +   + E+  ALA RD+A+ QRD A+A+R+ AL +RDNA++AL+ R
Sbjct  46    SIMAERQAALLELELEAAISEKNEALAARDLALRQRDEALAQRDNALLQRDNALAALQNR  105

Query  791   ESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNPRK  970
              S++N         G++ IH+       I+  +Y     +T D   + D +P T   P  
Sbjct  106   NSAVNFPFSGGSQRGSKWIHHSPNHLSDITETSY-----ITKDMI-IRDASPVTIVTPED  159

Query  971   VR--QPKESKPKKA--SKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQ  1138
             VR  Q K +K  K   SK ++   + +   EDL+ +A S                   E 
Sbjct  160   VRSHQAKRTKESKVVNSKSSKPPCKVKKLGEDLNKKASS-------------------EG  200

Query  1139  DKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPL  1315
              K    WD +D GL  +  D + MPVPVC+CTG  + CYKWGNGGWQS+CCTTT+S+YPL
Sbjct  201   TKFRSEWDSQDVGLNLIAFDGTIMPVPVCTCTGIARQCYKWGNGGWQSSCCTTTLSVYPL  260

Query  1316  PQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             PQ  +KR++R+GGRKMS S F++LLS+L +EG+D+S PLDLK++WA+HGTNRY T+K
Sbjct  261   PQLPNKRHARIGGRKMSGSVFTRLLSKLASEGHDISIPLDLKNYWARHGTNRYITIK  317



>gb|EAY99518.1| hypothetical protein OsI_21488 [Oryza sativa Indica Group]
Length=274

 Score =   215 bits (547),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 127/291 (44%), Positives = 161/291 (55%), Gaps = 58/291 (20%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             +A+M +RD AI ER+ AL E+K A+AERDMA  QRDAA+AERN A+ ERDNA++AL    
Sbjct  42    LALMNDRDNAIRERDHALAEKKAAIAERDMAFTQRDAAMAERNAAVVERDNALAAL----  97

Query  794   SSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNPRKV  973
                            E I Y        +  A  P +N +        P  + +   RK 
Sbjct  98    ---------------ESIPYLNSSRS--AGKAKRPKKNSSQ-----ASPLKRPSGVLRKT  135

Query  974   RQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQDKHLD  1153
             ++P                          W+ V      DD      +   +E +D++L 
Sbjct  136   KKPSG-----------------------DWKNVGMSGCGDDSAHASVM--KNEWKDQNL-  169

Query  1154  TWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHK  1333
                   GL QV  D S MP P CSCTG  + CYKWGNGGWQS+CCT  ISMYPLP   +K
Sbjct  170   ------GLNQVAFDDSTMPAPACSCTGKLRQCYKWGNGGWQSSCCTMNISMYPLPVMPNK  223

Query  1334  RYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             R++R+GGRKMS  AF+KLLSRL AEG+DLS P+DLKDHWAKHGTNRY T++
Sbjct  224   RHARMGGRKMSGGAFTKLLSRLAAEGHDLSTPVDLKDHWAKHGTNRYITIR  274



>gb|ABR17349.1| unknown [Picea sitchensis]
Length=313

 Score =   216 bits (550),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 127/305 (42%), Positives = 174/305 (57%), Gaps = 31/305 (10%)
 Frame = +2

Query  611   YMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKL-  787
             +M+++AERDAAILERN A  E+K A AE++ A+ QRD A A+RNTA+ ERD A +AL   
Sbjct  27    FMSVLAERDAAILERNTAFSEKKAAFAEKETAIFQRDVAYADRNTAILERDAAAAALDYA  86

Query  788   RESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP-  964
             R+   N +    +S     +   + +  +     +   E  T  P NV  P P     P 
Sbjct  87    RDGGWNGQ----RSLSCGTLSNAKILQVLAENPTFSAREYQTMRPINVAFPAPVLEAPPY  142

Query  965   -----------RKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGE  1111
                        +K    KES  K+ S  +      + +    S   V+T    ++G  GE
Sbjct  143   EEPQKTAKRTSKKKDGEKESPSKRKSDGSEPKSLRQKKQRKPS---VTT----EEGLNGE  195

Query  1112  FVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCT  1291
                   E+  K+LD       +  +  D+SAMP+PVC+CTG  Q CY+WGNGGWQSACCT
Sbjct  196   VTVVKKEQ--KNLDVV-----INGIVFDISAMPIPVCTCTGVAQQCYRWGNGGWQSACCT  248

Query  1292  TTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNR  1471
             T+ISMYPLP   ++R +RV GRKMS  AF KLL RL AEGY+L+ P+DLK +WAKHGTN+
Sbjct  249   TSISMYPLPMNPNRRGARVAGRKMSGGAFRKLLERLGAEGYNLNYPIDLKSYWAKHGTNK  308

Query  1472  YSTVK  1486
             + T++
Sbjct  309   FVTIR  313



>gb|ADV59364.1| GAGA-binding transcriptional activator [Picea sitchensis]
Length=313

 Score =   216 bits (550),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 127/305 (42%), Positives = 174/305 (57%), Gaps = 31/305 (10%)
 Frame = +2

Query  611   YMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKL-  787
             +M+++AERDAAILERN A  E+K A AE++ A+ QRD A A+RNTA+ ERD A +AL   
Sbjct  27    FMSVLAERDAAILERNTAFSEKKAAFAEKETAIFQRDVAYADRNTAILERDAAAAALDYA  86

Query  788   RESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNP-  964
             R+   N +    +S     +   + +  +     +   E  T  P NV  P P     P 
Sbjct  87    RDGGWNGQ----RSLSCGTLSNAKILQVLAENPTFSAREYQTMRPINVAYPAPVLEAPPY  142

Query  965   -----------RKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGE  1111
                        +K    KES  K+ S  +      + +    S   V+T    ++G  GE
Sbjct  143   EEPQKTAKRTSKKKDGEKESPSKRKSDGSEPKSLRQKKQRKPS---VTT----EEGLNGE  195

Query  1112  FVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCT  1291
                   E+  K+LD       +  +  D+SAMP+PVC+CTG  Q CY+WGNGGWQSACCT
Sbjct  196   VTVVKKEQ--KNLDVV-----INGIVFDISAMPIPVCTCTGVAQQCYRWGNGGWQSACCT  248

Query  1292  TTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNR  1471
             T+ISMYPLP   ++R +RV GRKMS  AF KLL RL AEGY+L+ P+DLK +WAKHGTN+
Sbjct  249   TSISMYPLPMNPNRRGARVAGRKMSGGAFRKLLERLGAEGYNLNYPIDLKSYWAKHGTNK  308

Query  1472  YSTVK  1486
             + T++
Sbjct  309   FVTIR  313



>emb|CDY70283.1| BnaCnng67580D [Brassica napus]
Length=284

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/304 (42%), Positives = 171/304 (56%), Gaps = 51/304 (17%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN A+  +  ALA RD A+ QRD A+AER+ AL 
Sbjct  30    KEQHNALVMNKKIMSILAERDAAVHERNQAVSAKMEALAARDQALQQRDKALAERDKALI  89

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ERDNA +AL+                     H++  ++  +S        +  +  F + 
Sbjct  90    ERDNAFAALQ---------------------HHENSLNFALSGGKRCQGGDDDDVLFTID  128

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
             D  P T+ N  K  + K+    K  K+            DL+                  
Sbjct  129   DLCPTTSTNTTKSIKRKKDNKPKGKKVGE----------DLNL----------------L  162

Query  1115  VDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTT  1294
             V A  ++  K  DT    FGL  V  D   MPVPVC+CTG+   CYKWGNGGWQS+CCTT
Sbjct  163   VAAPGKKCKKDWDT--NHFGLNLVTFDEKTMPVPVCTCTGSAHQCYKWGNGGWQSSCCTT  220

Query  1295  TISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRY  1474
             ++S YPLPQ  +KR+SRVGGRKMS + FS+LLS L AEG DLS+ +DLKD+WA+HGTNRY
Sbjct  221   SLSQYPLPQMPNKRHSRVGGRKMSGNVFSRLLSHLAAEGCDLSSHVDLKDYWARHGTNRY  280

Query  1475  STVK  1486
              T+K
Sbjct  281   ITIK  284



>ref|XP_009627338.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009627339.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=306

 Score =   215 bits (548),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 180/311 (58%), Gaps = 46/311 (15%)
 Frame = +2

Query  581   KDQNNSTIRTYMAIM-AERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             KDQ    + T + ++ AERDAA+ ER+ A+ E+   LAERD+A+ QRD AIAER+TA++E
Sbjct  33    KDQEAFIMNTKIRMLCAERDAAVEERDRAVIEKNTVLAERDLAIQQRDTAIAERDTAIKE  92

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD  937
             RDNAI+AL L + S  +  +  ++ G +  +  +   +  + +     +    D F ++ 
Sbjct  93    RDNAIAAL-LFQESTMNGTLGCRTRGTKRPNQSKNHCDNSTDSICINRDVPLTDAFPISA  151

Query  938   PTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFV  1117
              + + A    K  Q K +K  K                                      
Sbjct  152   ISSEVA----KALQVKRTKGNKGMSRKTKKV-----------------------------  178

Query  1118  DASDEEQDKHLDT------WD-EDFG-LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGW  1273
                +E+ ++HL T      WD +D G + Q+  D S+MP+PVC+CTG P+ CYKWG+GGW
Sbjct  179   ---NEDLNRHLTTDGSKAEWDAQDLGSINQIKFDESSMPIPVCTCTGIPRQCYKWGSGGW  235

Query  1274  QSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWA  1453
             QS+CCTT +S YPLPQ  +KR++R+GGRKMS S FS+LL+RL A G+DLS P+DLK +WA
Sbjct  236   QSSCCTTYLSEYPLPQLPNKRHARIGGRKMSGSVFSRLLTRLAAVGHDLSLPIDLKTYWA  295

Query  1454  KHGTNRYSTVK  1486
             KHGTNRY T+K
Sbjct  296   KHGTNRYITIK  306



>ref|XP_009101921.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Brassica rapa]
Length=262

 Score =   212 bits (539),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 128/308 (42%), Positives = 175/308 (57%), Gaps = 59/308 (19%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN AL  ++ ALA RD A+ QRD AI+ER+ A+ 
Sbjct  8     KEQHNALVMNKKIMSILAERDAAVKERNEALAAKQEALAARDEALQQRDLAISERDNAIM  67

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ER+NA++AL+ RE+ +N     +K  G     YQ    E        P   + ++P N  
Sbjct  68    ERENALTALQHRENHLNYILDCAKRGG-----YQTCFTEETHLPNPSPLSTIPHEPPN--  120

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
                                     +K  +  KR++   EDL+ Q  S       DWD  +
Sbjct  121   ------------------------TKRKKDRKRKKAGGEDLNRQLASPGKKCRKDWDCND  156

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
              G                      L  V  D + MPVP+C+CTGT + CYKWGNGG QS+
Sbjct  157   VG----------------------LNLVTFDETTMPVPMCTCTGTARQCYKWGNGGGQSS  194

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S YPLPQ  +KR+SR+GGRKMS + FS+LLSRL  EG+DLS+P+DLKD+WA+HG
Sbjct  195   CCTTTLSQYPLPQMPNKRHSRIGGRKMSGNVFSRLLSRLAGEGHDLSSPVDLKDYWARHG  254

Query  1463  TNRYSTVK  1486
             TNRY  +K
Sbjct  255   TNRYIIIK  262



>ref|XP_010667727.1| PREDICTED: protein BASIC PENTACYSTEINE4-like [Beta vulgaris subsp. 
vulgaris]
Length=290

 Score =   211 bits (537),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 133/305 (44%), Positives = 172/305 (56%), Gaps = 50/305 (16%)
 Frame = +2

Query  581   KDQNNSTI-RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
             K+QN   + R  + I+AERD AI E N AL E++RAL ER+ A+ QR+ AI ER+ A+ E
Sbjct  33    KEQNALHMNRKLLNIIAERDDAIEEMNRALHEKRRALEERETAISQRNLAIKERDDAVME  92

Query  758   RDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD  937
             RDN ++AL   ++SM  + +   S G +H          ++  +Y   E    D F  T 
Sbjct  93    RDNVLNAL---QNSMKQQPL---SCGVQH------GTNRLADQSYVTHEMHFLDAFCRT-  139

Query  938   PTPQTANNPRKVRQPKESKPKK--ASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGE  1111
                  A+   K  QPK+ K  K  ASK               S +   T D     N   
Sbjct  140   ---AVASGCNKSPQPKKMKESKGCASK---------------SRREKQTSDHLKVRN---  178

Query  1112  FVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCT  1291
                          + + E  GL +V+ D S MP P CSCTG  + CYKWG GGWQS+CCT
Sbjct  179   -------------NLYGESLGLNRVDYDDSIMPAPGCSCTGIFRQCYKWGTGGWQSSCCT  225

Query  1292  TTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNR  1471
             TTIS+YPLP A +KRY+R+GGRKMS S FSKLLSRL  EG+D S P+D+KDHW+KHGTNR
Sbjct  226   TTISVYPLPPAPNKRYARLGGRKMSGSVFSKLLSRLALEGFDFSIPVDMKDHWSKHGTNR  285

Query  1472  YSTVK  1486
             Y T+K
Sbjct  286   YITIK  290



>ref|NP_001078691.1| basic pentacysteine 6 [Arabidopsis thaliana]
 gb|AED94822.1| basic pentacysteine 6 [Arabidopsis thaliana]
Length=282

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 133/290 (46%), Positives = 168/290 (58%), Gaps = 36/290 (12%)
 Frame = +2

Query  701   MAMLQRDAAIAERNTALEERDNAISALKLRESSMNDEDIVSKS---PGAE----------  841
             MA LQRD AIAERN A+ ERD+A++AL+ RE+SM      + S   PG +          
Sbjct  1     MAFLQRDTAIAERNNAIMERDSALTALQYRENSMVTAPAANMSACPPGCQISRGVKHLHH  60

Query  842   ---HIHYQQEMHEMISAAAYDPTENLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASK  1012
                H H+QQ     ++  AY+  E   ND    + P   T  +  K ++ K   PK  ++
Sbjct  61    PHMHHHHQQHHIPQLTENAYETREMEPNDGLPTSPPAGSTLESA-KPKRGKRVNPKATTQ  119

Query  1013  LArvvkreeveveDLSWQAVSTFDDWDDGNCGEFV----DASDEEQDKHL-----DTW--  1159
              A   +  +        Q     +  DD N   FV    D +DE+  KH+       W  
Sbjct  120   TAANKRGPKN-------QRKVKKESEDDLNKIMFVKTTHDYTDEDSSKHILIGSKSDWKS  172

Query  1160  DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRY  1339
              E  GL QV  D + MP PVCSCTG  + CYKWGNGGWQS+CCTTT+SMYPLP   +KR+
Sbjct  173   QEMVGLNQVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRH  232

Query  1340  SRVGGRKMSASAFSKLLSRLTAEG-YDLSAPLDLKDHWAKHGTNRYSTVK  1486
             +RVGGRKMS SAF+KLLSRL AEG +DLS P+DLKDHWAKHGTNRY T+K
Sbjct  233   ARVGGRKMSGSAFNKLLSRLAAEGHHDLSNPVDLKDHWAKHGTNRYITIK  282



>gb|ADV59358.1| GAGA-binding transcriptional activator [Pinus taeda]
Length=312

 Score =   206 bits (525),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 126/301 (42%), Positives = 166/301 (55%), Gaps = 26/301 (9%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             MA++AERD AILER+ A+ E+K A AERD+A+LQR+ AI++RN+AL ERD A +AL    
Sbjct  28    MAVIAERDVAILERDTAIAEKKAAYAERDVALLQREVAISDRNSALLERDAAAAALGY-S  86

Query  794   SSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDP-TENLTNDPFNVTDPTPQTANNPRK  970
               MN     S S G       Q + ++      DP +E+L      V +   QT     +
Sbjct  87    GQMNLSGQRSPSCGTLVGIKVQSVGQVFP----DPHSESL------VAEQPKQTNQADNR  136

Query  971   VRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEEQDKHL  1150
             ++  +ES   K       +            Q        D       V     +QD   
Sbjct  137   IKGERESPSNKVFNGYEPITPVFKIQ-----QKKGATTGQDTNGLLAVVKHEMRDQDYKE  191

Query  1151  DTWDEDFGLEQVNSDVS---------AMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTIS  1303
             D    D     +  D S         A+P+PVCSCTG PQ CY+WG+GGWQSACCTT+IS
Sbjct  192   DKTTFDTSGLPITFDTSALPITFDASALPIPVCSCTGVPQQCYRWGSGGWQSACCTTSIS  251

Query  1304  MYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTV  1483
             MYPLP   +KR +R+GGRKMS  AF+KLL+RL A+GY L  P+DLK+HWAKHGTNRY  +
Sbjct  252   MYPLPMNPNKRGARLGGRKMSGGAFAKLLARLIADGYSLEYPVDLKNHWAKHGTNRYIRI  311

Query  1484  K  1486
             +
Sbjct  312   Q  312



>ref|XP_006404565.1| hypothetical protein EUTSA_v10000273mg [Eutrema salsugineum]
 gb|ESQ46018.1| hypothetical protein EUTSA_v10000273mg [Eutrema salsugineum]
Length=291

 Score =   200 bits (508),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 125/307 (41%), Positives = 167/307 (54%), Gaps = 54/307 (18%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN A+  ++ A+A RD A+ QRD        AL 
Sbjct  34    KEQHNALVMNKKIMSILAERDAAVQERNQAVSAKREAVAARDEALQQRD-------KALS  86

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAA--YDPTENLTNDPFN  928
             ERD    AL  R+++            A   H++  ++  +S     YD  +  +    +
Sbjct  87    ERD---KALIERDTAF-----------AALQHHENSLNFALSGGKQRYDVDDGFSFGETH  132

Query  929   VTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCG  1108
               D  P T         P E K  K  K  +   ++                  +D N G
Sbjct  133   KPDVFPITT-------IPAEKKVSKRKKQGQAKGKKVG----------------EDLNRG  169

Query  1109  EFVDASDEEQDKHLDTWD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSAC  1285
                       D     WD  D GL  V  D + MPVPVC+CTG+   CYKWGNGGWQS+C
Sbjct  170   VAAPGKKSRTD-----WDSNDVGLNLVTFDETTMPVPVCTCTGSAHQCYKWGNGGWQSSC  224

Query  1286  CTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGT  1465
             CTTT+S YPLPQ  +KR+SRVGGRKMS + FS+LLSRL AEGY+LS P+DLKD+WA+HGT
Sbjct  225   CTTTLSQYPLPQMPNKRHSRVGGRKMSGNVFSRLLSRLAAEGYELSCPVDLKDYWARHGT  284

Query  1466  NRYSTVK  1486
             NRY T+K
Sbjct  285   NRYITIK  291



>ref|XP_009109516.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Brassica rapa]
 emb|CDX90300.1| BnaA08g16840D [Brassica napus]
Length=285

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 123/308 (40%), Positives = 172/308 (56%), Gaps = 62/308 (20%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN AL  +K ALA RD A+ QRD A++ER+ A+ 
Sbjct  34    KEQHNALVMNKKIMSILAERDAALKERNEALAAKKEALAARDEALEQRDKALSERDNAIM  93

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             ER+ A++AL                    H   +  ++ ++S A    TE  ++ P    
Sbjct  94    ERETALNAL--------------------HYPEKNNLNYILSCAKRGGTEGRSHPPRPPP  133

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
                     NP K    ++ + K+  K+            DL+  A S       DWD   
Sbjct  134   VSPIPADKNPTK----RKKETKQGKKVGD----------DLNRLAASPGKKCRKDWDV--  177

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                                  + GL  V  D + MPVP+C+CTGT + CYKWG+GGWQS+
Sbjct  178   --------------------NEVGLNLVAFDETTMPVPMCTCTGTARQCYKWGSGGWQSS  217

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHG  1462
             CCTTT+S +PLPQ  +KR+SR+GGRKMS + FS+LLSRL  EG DLS+P+DLKD+WA+HG
Sbjct  218   CCTTTLSQHPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAGEGQDLSSPVDLKDYWARHG  277

Query  1463  TNRYSTVK  1486
             TNRY T+K
Sbjct  278   TNRYITIK  285



>emb|CDY12110.1| BnaC03g60260D [Brassica napus]
Length=279

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 126/310 (41%), Positives = 174/310 (56%), Gaps = 72/310 (23%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ ERN AL  +K ALA RD A+ QRD A++ER+ A+ 
Sbjct  34    KEQHNALVMNKKIMSILAERDAALKERNEALAAKKEALAARDEALEQRDKALSERDNAIM  93

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTE--NLTNDPFN  928
             ER+ A++AL                    H   +  ++ ++S A    TE  +L N    
Sbjct  94    ERETALNAL--------------------HYPEKNNLNYILSCAKRGETERSHLPNPSHI  133

Query  929   VTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDD  1096
              T PT       RK+      + K+ +KL            DL+  A S       DWD 
Sbjct  134   STKPTK------RKI------ETKQGNKLGE----------DLNRLAASPGKKCRKDWDV  171

Query  1097  GNCGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQ  1276
                                    + GL  V  D + MPVP+C+CTGT + CYKWG+GGWQ
Sbjct  172   ----------------------NEVGLNLVAFDETTMPVPMCTCTGTARQCYKWGSGGWQ  209

Query  1277  SACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAK  1456
             S+CCTTT+S +PLPQ  +KR+SR+GGRKMS + FS+LLSRL  +G DLS+P+DLKD+WA+
Sbjct  210   SSCCTTTLSQHPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAGQGQDLSSPVDLKDYWAR  269

Query  1457  HGTNRYSTVK  1486
             HGTNRY T+K
Sbjct  270   HGTNRYITIK  279



>ref|XP_009418729.1| PREDICTED: barley B recombinant-like protein D [Musa acuminata 
subsp. malaccensis]
Length=346

 Score =   196 bits (499),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 120/309 (39%), Positives = 180/309 (58%), Gaps = 20/309 (6%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKL-R  790
             +A++AERD+AI ER +A+ E+  ALAE DMA+ +RDAA A+R+ A+ ERDNAI+AL+  R
Sbjct  40    IALIAERDSAIQERELAISEKTAALAELDMALKERDAAFAKRDNAIMERDNAIAALRYAR  99

Query  791   ESSMN---DEDIVS-KSPGAEHIHYQQEMH-------EMISAAAYDPTENLTND---PFN  928
             E S N   ++   S  +P     H  Q+ H         ++ A YD    +      P +
Sbjct  100   EKSYNGYNEQGCCSWCTPPLWTSHSHQDAHLDVHESPPQLADAPYDHIRQMHITEAYPIS  159

Query  929   VTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCG  1108
             +     +     +K+    ++ P K S  ++  ++ +    D S + VS           
Sbjct  160   MVPDYSEKEMKAKKITTSTQATPHKMS--SKSPRKIKEGHGDDSNKLVSHAKKHGKLKGQ  217

Query  1109  EFVDASDE--EQDKHLDTW-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQS  1279
             E V    +  E     DTW + +   ++ +++  ++P PVCSCTG  + CY+WG+ GWQS
Sbjct  218   EIVGGKKDLNEVPTMTDTWRNCNLCFDEFSANELSVPAPVCSCTGKLRQCYRWGDFGWQS  277

Query  1280  ACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKH  1459
             +CCT+++SMYPLP   +KR++R+GGRKMS SAF KLL  L  +GYDLS  +DLK+HWAKH
Sbjct  278   SCCTSSLSMYPLPVMPNKRHARMGGRKMSGSAFRKLLRCLAVDGYDLSMAVDLKNHWAKH  337

Query  1460  GTNRYSTVK  1486
             GTNRY T++
Sbjct  338   GTNRYITIR  346



>gb|ADE76107.1| unknown [Picea sitchensis]
 gb|ADV59366.1| GAGA-binding transcriptional activator [Picea sitchensis]
Length=294

 Score =   192 bits (488),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 114/301 (38%), Positives = 168/301 (56%), Gaps = 44/301 (15%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             MA++AERD AILER+ A+ E+K              AA AER+ AL +R+ AIS    R 
Sbjct  28    MAVIAERDVAILERDTAIAEKK--------------AAYAERDVALLQREVAISD---RN  70

Query  794   SSMNDEDIVSKSPG-AEHIHYQQEMHEMISAAAYDPTENLTND-PFNVTDP--------T  943
             S++ + D  + + G + HI+   +   +         + +    P  V++         T
Sbjct  71    SALLERDAAAAALGYSGHINLTGQRGPLCGTLVGIKVQTVGQTFPAPVSEALLAEQPKQT  130

Query  944   PQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDA  1123
              Q  NN +  ++P  +K     +L   V++ +  + D + Q  +          G     
Sbjct  131   NQADNNIKGQKEPPSNKVFNGCELITPVRKIQQNMGDTTGQETN----------GLLAVV  180

Query  1124  SDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTIS  1303
               E++       D+D+   ++  D SA+P+PVCSCTG PQ CY+WG+GGWQSACCTT+IS
Sbjct  181   KHEKK-------DQDYTENKITFDTSALPIPVCSCTGVPQQCYRWGSGGWQSACCTTSIS  233

Query  1304  MYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTV  1483
             +YPLP   +KR +R+GGRKMS  AF+KLL+RL A+GY L  P+DLK+HWAKHGTNRY  +
Sbjct  234   IYPLPLNPNKRGARLGGRKMSGGAFAKLLARLIADGYSLEYPVDLKNHWAKHGTNRYIRI  293

Query  1484  K  1486
             +
Sbjct  294   Q  294



>gb|EYU36766.1| hypothetical protein MIMGU_mgv1a0134691mg, partial [Erythranthe 
guttata]
Length=192

 Score =   187 bits (476),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +2

Query  1148  LDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQAS  1327
             LD  D+D GL QV  D S MPVPVCSCTG  +PCYKWGNGGWQS+CCTT +SMYPLP   
Sbjct  80    LDWKDQDLGLNQVAFDESTMPVPVCSCTGFLRPCYKWGNGGWQSSCCTTNLSMYPLPAVP  139

Query  1328  HKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             +KR++RVGGRKMS SAF+KL+SRL AEG+DLS P+DLKDHWAKHGTNRY T+K
Sbjct  140   NKRHARVGGRKMSGSAFNKLISRLAAEGHDLSNPVDLKDHWAKHGTNRYITIK  192



>gb|EAZ35708.1| hypothetical protein OsJ_19997 [Oryza sativa Japonica Group]
Length=307

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/280 (40%), Positives = 159/280 (57%), Gaps = 29/280 (10%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             +A+M +RD AI ER+ AL E+K A+AERDMA  QRDAA+AERN A+ ERDNA++AL+L  
Sbjct  42    LALMNDRDNAIRERDHALAEKKAAIAERDMAFTQRDAAMAERNAAVVERDNALAALELAR  101

Query  794   SSMNDEDIVSKSP-----GAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVTD-------  937
             ++  + +  +  P     G+++IH+    H+ +S A   P + L + P++          
Sbjct  102   TNGLNMNNGNGFPQGSLSGSKNIHH----HDQLSHAQSSPLQ-LADSPYDHAREMHISEA  156

Query  938   -PTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEF  1114
              P      +  K ++PK++  + +          + +     W+ V      DD      
Sbjct  157   YPISTAPGSAGKAKRPKKNSSQASPLKRPSGVLRKTKKPSGDWKNVGMSGCGDDSAHASV  216

Query  1115  VDASDEEQDKHLDTW-DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCT  1291
             +           + W D++ GL QV  D S MP P CSCTG  + CYKWGNGGWQS+CCT
Sbjct  217   MK----------NEWKDQNLGLNQVAFDDSTMPAPACSCTGKLRQCYKWGNGGWQSSCCT  266

Query  1292  TTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG  1411
               ISMYPLP   +KR++R+GGRKMS  AF+KLLSRL AEG
Sbjct  267   MNISMYPLPVMPNKRHARMGGRKMSGGAFTKLLSRLAAEG  306



>ref|XP_009137623.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Brassica rapa]
 ref|XP_009138239.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Brassica rapa]
 ref|XP_009138877.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Brassica rapa]
 ref|XP_009139486.1| PREDICTED: protein BASIC PENTACYSTEINE5-like [Brassica rapa]
Length=287

 Score =   188 bits (478),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 172/305 (56%), Gaps = 58/305 (19%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             +DQ+N+ +  +  M+I+AERDAA+ ER+ AL  ++ ALA RD A+  RD A+        
Sbjct  36    EDQHNALVMNQKIMSILAERDAALKERDDALAAKQEALAARDEALDLRDKAL--------  87

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQE-MHEMISAAAYDPTENLTNDPFNV  931
                           S+ D  I+ +      + +++  ++ ++S A    +++      ++
Sbjct  88    --------------SLRDNAILERDSALSALQFREHNLNYILSRAKLGASQS-----SHL  128

Query  932   TDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGE  1111
              +P+P +         P E+ P K  K  +   R + +                    GE
Sbjct  129   PNPSPLST-------IPHEAAPSKRKKKRKQETRSKGK------------------RVGE  163

Query  1112  FVDASDEEQDKHLDTWDEDF-GLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACC  1288
                AS  ++ +    WD +  GL  V  D + MPVP+C+CTGT + CYKWGNGGWQS+CC
Sbjct  164   DHVASPGKKCR--KDWDSNVVGLNLVTFDETTMPVPMCTCTGTARHCYKWGNGGWQSSCC  221

Query  1289  TTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTN  1468
             TTT+S+YPLPQ  +KR+SRVGGRKMS + FS+LLSRL  +G+DLS+P+DLKD+WA+HGTN
Sbjct  222   TTTLSLYPLPQMPNKRHSRVGGRKMSGNVFSRLLSRLAGQGHDLSSPVDLKDYWARHGTN  281

Query  1469  RYSTV  1483
             RY T+
Sbjct  282   RYITI  286



>emb|CBI19814.3| unnamed protein product [Vitis vinifera]
Length=146

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +2

Query  1163  EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYS  1342
             +D GL QV  D S MP PVCSCTG  + CYKWGNGGWQS+CCTTT+SMYPLP   +KR++
Sbjct  39    QDLGLNQVTFDESTMPAPVCSCTGVLRQCYKWGNGGWQSSCCTTTLSMYPLPAVPNKRHA  98

Query  1343  RVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             RVGGRKMS SAF+KLLSRL AEG+DLS P+DLKDHWAKHGTNRY T+K
Sbjct  99    RVGGRKMSGSAFNKLLSRLAAEGHDLSIPVDLKDHWAKHGTNRYITIK  146



>emb|CDY42593.1| BnaC01g00050D [Brassica napus]
Length=282

 Score =   186 bits (473),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 167/305 (55%), Gaps = 58/305 (19%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             +DQ+N+ +  +  M+I+AERDAA+ ER+ AL  ++ ALA RD               AL+
Sbjct  31    EDQHNALVMNQKIMSILAERDAALKERDDALAAKQEALAARD--------------EALD  76

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             +RD A+S        + D  I+ +      + +++     I + A   + +L N     T
Sbjct  77    QRDKALS--------LRDNAILERDSALSALQFREHNLNYILSRAKLGSSHLPNPSPLST  128

Query  935   DPTPQTANNPRKVRQPK-ESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGE  1111
              P     +  +K R+P+  SK K+  +             DL+    S            
Sbjct  129   IPHEAAPSKRKKKRKPETRSKGKRVGE-------------DLNHHVAS------------  163

Query  1112  FVDASDEEQDKHLDTWDEDF-GLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACC  1288
                       K    WD +  GL  V  D + MPVP+C+CTGT + CYKWGNGGWQS+CC
Sbjct  164   -------PGKKCRKDWDSNVVGLNLVTFDETTMPVPMCTCTGTARHCYKWGNGGWQSSCC  216

Query  1289  TTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTN  1468
             TTT+S+YPLPQ  +KR+SRVGGRKMS + FS+LLSRL  +G+DLS+P+DLKD+WA+HGTN
Sbjct  217   TTTLSLYPLPQMPNKRHSRVGGRKMSGNVFSRLLSRLAGQGHDLSSPVDLKDYWARHGTN  276

Query  1469  RYSTV  1483
             RY T+
Sbjct  277   RYITI  281



>emb|CBI37978.3| unnamed protein product [Vitis vinifera]
Length=248

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = +2

Query  1157  WD-EDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHK  1333
             WD +D GL  V  D S MPVPVCSCTG P+ CYKWGNGGWQS+CCTTT+S YPLPQ  +K
Sbjct  138   WDSQDLGLNLVTFDESTMPVPVCSCTGVPRQCYKWGNGGWQSSCCTTTLSSYPLPQMPNK  197

Query  1334  RYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             R++R+GGRKMS S F++LLSRL AEG+DLS PLDLKD+WAKHGTNRY  +K
Sbjct  198   RHARMGGRKMSGSVFTRLLSRLAAEGHDLSMPLDLKDYWAKHGTNRYIIIK  248


 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 59/74 (80%), Gaps = 1/74 (1%)
 Frame = +2

Query  581  KDQNNSTI-RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
            K+QN  T+ +  + I+AERD AI ERN+AL E+K AL ERD A++QRDAAI+ER+ AL E
Sbjct  33   KEQNALTMNKKVVNILAERDNAIRERNIALSEKKAALEERDEALMQRDAAISERDNALLE  92

Query  758  RDNAISALKLRESS  799
            RDNAI+AL+ RESS
Sbjct  93   RDNAIAALRYRESS  106



>emb|CDY41951.1| BnaA01g05230D [Brassica napus]
Length=287

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 115/305 (38%), Positives = 173/305 (57%), Gaps = 58/305 (19%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             +DQ+N+ +  +  M+I+AERDAA+ ER+ AL  ++ ALA RD               AL+
Sbjct  36    EDQHNALVMNQKIMSILAERDAALKERDDALAAKQEALAVRD--------------EALD  81

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQE-MHEMISAAAYDPTENLTNDPFNV  931
              RD A+S        + D  I+ +      + +++  ++ ++S A    +++      ++
Sbjct  82    LRDKALS--------LRDNAILERDSALSALQFREHNLNYILSRAKLGASQS-----SHL  128

Query  932   TDPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGE  1111
              +P+P +         P E+ P K  K  +   R + +                    GE
Sbjct  129   PNPSPLST-------VPHEAAPSKRKKKRKPETRSKGK------------------RVGE  163

Query  1112  FVDASDEEQDKHLDTWDEDF-GLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACC  1288
                AS  ++ +    WD +  GL  V  D + MPVP+C+CTGT + CYKWGNGGWQS+CC
Sbjct  164   DHVASPGKKCR--KDWDSNVVGLNLVTFDETTMPVPMCTCTGTARHCYKWGNGGWQSSCC  221

Query  1289  TTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTN  1468
             TTT+S+YPLPQ  +KR+SRVGGRKMS + FS+LLSRL  +G+DLS+P+DLKD+WA+HGTN
Sbjct  222   TTTLSLYPLPQMPNKRHSRVGGRKMSGNVFSRLLSRLAGQGHDLSSPVDLKDYWARHGTN  281

Query  1469  RYSTV  1483
             RY T+
Sbjct  282   RYITI  286



>ref|XP_009627340.1| PREDICTED: protein BASIC PENTACYSTEINE4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=274

 Score =   183 bits (464),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/274 (39%), Positives = 145/274 (53%), Gaps = 56/274 (20%)
 Frame = +2

Query  689   AERDMAMLQRDAAIAERNTALEERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMH  868
             AERD A+ +RD A+ E+NT L ERD AI     R++++ + D   K           E  
Sbjct  49    AERDAAVEERDRAVIEKNTVLAERDLAIQQ---RDTAIAERDTAIK-----------ERD  94

Query  869   EMISAAAYDPTENLTNDPFNVTDPTPQTANNPRKVRQPKESKPKKASKLArvvkreevev  1048
               I+A  +   E+  N          +  N   K  Q K +K  K               
Sbjct  95    NAIAALLFQ--ESTMNGTLGCRTRGTKRPNQIAKALQVKRTKGNKGM-------------  139

Query  1049  eDLSWQAVSTFDDWDDGNCGEFVDASDEEQDKHLDT------WD-EDFG-LEQVNSDVSA  1204
                                       +E+ ++HL T      WD +D G + Q+  D S+
Sbjct  140   -------------------SRKTKKVNEDLNRHLTTDGSKAEWDAQDLGSINQIKFDESS  180

Query  1205  MPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSK  1384
             MP+PVC+CTG P+ CYKWG+GGWQS+CCTT +S YPLPQ  +KR++R+GGRKMS S FS+
Sbjct  181   MPIPVCTCTGIPRQCYKWGSGGWQSSCCTTYLSEYPLPQLPNKRHARIGGRKMSGSVFSR  240

Query  1385  LLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             LL+RL A G+DLS P+DLK +WAKHGTNRY T+K
Sbjct  241   LLTRLAAVGHDLSLPIDLKTYWAKHGTNRYITIK  274


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +2

Query  581  KDQNNSTIRTYMAIM-AERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEE  757
            KDQ    + T + ++ AERDAA+ ER+ A+ E+   LAERD+A+ QRD AIAER+TA++E
Sbjct  33   KDQEAFIMNTKIRMLCAERDAAVEERDRAVIEKNTVLAERDLAIQQRDTAIAERDTAIKE  92

Query  758  RDNAISALKLRESSMN  805
            RDNAI+AL  +ES+MN
Sbjct  93   RDNAIAALLFQESTMN  108



>ref|XP_006852992.1| hypothetical protein AMTR_s00185p00053620 [Amborella trichopoda]
 gb|ERN14459.1| hypothetical protein AMTR_s00185p00053620 [Amborella trichopoda]
Length=94

 Score =   175 bits (444),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 76/94 (81%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +2

Query  1205  MPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSK  1384
             MP+PVCSCTG  Q CYKWGNGGWQSACCTT ISMYPLP   +KR++RVGGRKMS SAF+K
Sbjct  1     MPIPVCSCTGVLQQCYKWGNGGWQSACCTTQISMYPLPVMPNKRHARVGGRKMSGSAFTK  60

Query  1385  LLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             LLSRL AEG+DLS PLDLKDHWAKHGTNRY T+K
Sbjct  61    LLSRLAAEGHDLSVPLDLKDHWAKHGTNRYITIK  94



>gb|ADV59362.1| GAGA-binding transcriptional activator [Physcomitrella patens]
 gb|ADV59363.1| GAGA-binding transcriptional activator [Physcomitrella patens]
Length=328

 Score =   180 bits (456),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 121/325 (37%), Positives = 173/325 (53%), Gaps = 51/325 (16%)
 Frame = +2

Query  614   MAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRE  793
             M I+AERDAA++E++ AL E+  A AERD A+LQRD A A+R+ A+  RD A++AL   E
Sbjct  21    MDIIAERDAALMEKSTALAEKMAAYAERDAAILQRDIASADRDAAILTRDAALAALARLE  80

Query  794   ----------------SSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTE-NLTNDP  922
                              SM+   ++ +   AEH  +  E H         PT  N ++  
Sbjct  81    RKSSGRGRRPSQTALDESMHGSKLLQRMDLAEHSAFSSEFH---------PTAANPSHSG  131

Query  923   FNVTDPTPQTANNPRKVRQPKESK-------PKKASKLArvvkreeveveDLSWQAVSTF  1081
               + DP         +  + KES+        +KA+++A    R +         A    
Sbjct  132   IMLLDPDSAHLQGVHRFSRDKESQIEIFVRTKRKATEMAEATHRGKHPRA-----APKKS  186

Query  1082  DDWDDGNCGEFVDASDEEQDKHLDTWDEDFGL-----EQVNSDV-----SAMPVPVCSCT  1231
              +W   + G+      +E++      +E+ G      E V+S +        P+P CSCT
Sbjct  187   RNWPVTHQGQ---QPVQERESQAQVANEEEGGQIREPELVSSRIFRSQTVPTPIPYCSCT  243

Query  1232  GTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG  1411
             G  Q CY+WGNGGWQSACCTT ISM+PLP    KR SR+ GRKMSA AF KLL +L +EG
Sbjct  244   GMNQQCYRWGNGGWQSACCTTLISMFPLPLNPKKRGSRLAGRKMSAGAFDKLLEKLVSEG  303

Query  1412  YDLSAPLDLKDHWAKHGTNRYSTVK  1486
              +++ P+DL++HWAKHGTNRY T++
Sbjct  304   VNINLPVDLREHWAKHGTNRYVTLR  328



>ref|XP_010497662.1| PREDICTED: protein BASIC PENTACYSTEINE6-like, partial [Camelina 
sativa]
Length=131

 Score =   172 bits (436),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 99/131 (76%), Gaps = 8/131 (6%)
 Frame = +2

Query  1118  DASDEEQDKHL-----DTW--DEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQ  1276
             D ++E+  KH+       W   E  GL QV  D + MP PVCSCTG  + CYKWGNGGWQ
Sbjct  1     DYTEEDSSKHILIGSKSDWKSQEMVGLNQVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQ  60

Query  1277  SACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEG-YDLSAPLDLKDHWA  1453
             S+CCTTT+SMYPLP   +KR++RVGGRKMS SAF+KLLSRL AEG +DLS P+DLKDHWA
Sbjct  61    SSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGHHDLSNPVDLKDHWA  120

Query  1454  KHGTNRYSTVK  1486
             KHGTNRY T+K
Sbjct  121   KHGTNRYITIK  131



>ref|XP_002868871.1| hypothetical protein ARALYDRAFT_327841 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45130.1| hypothetical protein ARALYDRAFT_327841 [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score =   178 bits (451),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 111/280 (40%), Positives = 156/280 (56%), Gaps = 51/280 (18%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  M+I+AERDAA+ E N A+   K ALA RD A+ QRD A++ER+ A+ 
Sbjct  46    KEQHNALVMNKKIMSILAERDAAVKEINEAVAATKEALAARDEALEQRDKALSERDNAIM  105

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             E ++A++AL+ RE+++N                      ++S A    + +   D  ++ 
Sbjct  106   ETESALNALRYRENNLN---------------------YILSCAKRGGSHSCVTDESHLP  144

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
              P+P  +  P +    K +K KK SK     K ++V   DL+ Q  S    +  DWD   
Sbjct  145   APSP-ISTIPPEAAHTKLAKRKKESKQGARSKGKKVGE-DLNRQVASPGKKSRKDWDS--  200

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                                  D GL  V  D + MPVP+C+CTGT + CYKWGNGGWQS+
Sbjct  201   --------------------YDVGLNLVTFDETTMPVPMCTCTGTARQCYKWGNGGWQSS  240

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLT  1402
             CCTTT+S YPLPQ  +KR+SRVGGRKMS S FS+LLS LT
Sbjct  241   CCTTTLSQYPLPQMPNKRHSRVGGRKMSGSVFSRLLSLLT  280



>gb|EYU36767.1| hypothetical protein MIMGU_mgv1a022586mg, partial [Erythranthe 
guttata]
Length=341

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +2

Query  1148  LDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQAS  1327
             LD  D+D GL QV  D S MPVPVCSCTG  +PCYKWGNGGWQS+CCTT +SMYPLP   
Sbjct  238   LDWKDQDLGLNQVAFDESTMPVPVCSCTGFLRPCYKWGNGGWQSSCCTTNLSMYPLPAVP  297

Query  1328  HKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKH  1459
             +KR++RVGGRKMS SAF+KL+SRL AEG+DLS P+DLKDHWAKH
Sbjct  298   NKRHARVGGRKMSGSAFNKLISRLAAEGHDLSNPVDLKDHWAKH  341



>gb|AFX95922.1| GAGA-binding transcriptional activator, partial [Ziziphus jujuba]
Length=102

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +2

Query  1199  SAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAF  1378
             S MPVP+CSCTG P+ CYKWGNGGWQS+CCTT +SMYPLPQ  +KR++R+GGRKMS S F
Sbjct  7     STMPVPMCSCTGVPRQCYKWGNGGWQSSCCTTNMSMYPLPQMPNKRHARMGGRKMSGSVF  66

Query  1379  SKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             ++LLSRL A+G+DLS PLDLKD+WA+HGTNRY TVK
Sbjct  67    TRLLSRLAAQGHDLSMPLDLKDYWARHGTNRYITVK  102



>gb|AFG52200.1| hypothetical protein 0_6008_01, partial [Pinus taeda]
 gb|AFG52201.1| hypothetical protein 0_6008_01, partial [Pinus taeda]
 gb|AFG52202.1| hypothetical protein 0_6008_01, partial [Pinus taeda]
 gb|AFG52203.1| hypothetical protein 0_6008_01, partial [Pinus taeda]
 gb|AFG52204.1| hypothetical protein 0_6008_01, partial [Pinus taeda]
 gb|AFG52205.1| hypothetical protein 0_6008_01, partial [Pinus taeda]
 gb|AFG52206.1| hypothetical protein 0_6008_01, partial [Pinus taeda]
 gb|AFG52207.1| hypothetical protein 0_6008_01, partial [Pinus taeda]
 gb|AFG52208.1| hypothetical protein 0_6008_01, partial [Pinus taeda]
 gb|AFG52209.1| hypothetical protein 0_6008_01, partial [Pinus taeda]
 gb|AFG52210.1| hypothetical protein 0_6008_01, partial [Pinus taeda]
 gb|AFG52211.1| hypothetical protein 0_6008_01, partial [Pinus taeda]
 gb|AFG52212.1| hypothetical protein 0_6008_01, partial [Pinus taeda]
Length=124

 Score =   162 bits (411),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 64/98 (65%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +2

Query  1193  DVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKMSAS  1372
             D+S MP+PVC+CTG  Q CY+WGNGGWQSACCTT+ISMYPLP   ++R +RV GRKMS  
Sbjct  27    DISTMPIPVCTCTGVAQQCYRWGNGGWQSACCTTSISMYPLPMNPNRRGARVAGRKMSGG  86

Query  1373  AFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             AF KLL RL AEG++L+ P+DLK +WAKHGTN++ T++
Sbjct  87    AFRKLLERLGAEGFNLNYPIDLKSYWAKHGTNKFVTIR  124



>emb|CAB38811.1| putative protein [Arabidopsis thaliana]
 emb|CAB80554.1| putative protein [Arabidopsis thaliana]
Length=445

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/279 (39%), Positives = 157/279 (56%), Gaps = 59/279 (21%)
 Frame = +2

Query  581   KDQNNSTI--RTYMAIMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALE  754
             K+Q+N+ +  +  ++I+AERDAA+ ERN A+   K ALA RD A+ QRD A++ER+ A+ 
Sbjct  43    KEQHNALVMNKKIISILAERDAAVKERNEAVAATKEALASRDEALEQRDKALSERDNAIM  102

Query  755   ERDNAISALKLRESSMNDEDIVSKSPGAEHIHYQQEMHEMISAAAYDPTENLTNDPFNVT  934
             E ++A++AL+ RE+++N     +K  G++           I+  ++ P      +P  ++
Sbjct  103   ETESALNALRYRENNLNYILSCAKRGGSQRF---------ITEESHLP------NPSPIS  147

Query  935   DPTPQTANNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVS----TFDDWDDGN  1102
                P+ AN  R  ++ KESK  K               EDL+    S    +  DWD  +
Sbjct  148   TIPPEAANT-RPTKRKKESKQGK------------KMGEDLNRPVASPGKKSRKDWDSND  194

Query  1103  CGEFVDASDEEQDKHLDTWDEDFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSA  1282
                            L T+DE             MPVP+C+CTGT + CYKWGNGGWQS+
Sbjct  195   V--------------LVTFDE-----------MTMPVPMCTCTGTARQCYKWGNGGWQSS  229

Query  1283  CCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRL  1399
             CCTTT+S YPLPQ  +KR+SRVGGRKMS S FS+LLSRL
Sbjct  230   CCTTTLSEYPLPQMPNKRHSRVGGRKMSGSVFSRLLSRL  268



>ref|XP_006844102.1| hypothetical protein AMTR_s00006p00254090 [Amborella trichopoda]
 gb|ERN05777.1| hypothetical protein AMTR_s00006p00254090 [Amborella trichopoda]
Length=356

 Score =   169 bits (428),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 110/312 (35%), Positives = 153/312 (49%), Gaps = 48/312 (15%)
 Frame = +2

Query  620   IMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRESS  799
             + AERDAA+ ER+MA+ E+K A +ERD A  QRD A+A+R  A+ ERD A++AL   ES 
Sbjct  70    VKAERDAAVRERDMAIAEKKAATSERDSAFNQRDMALAQREEAVMERDAALAAL---ESL  126

Query  800   MNDE-DIVSKSPGAEHIHYQQEMHEMISAAAYD-PTENLT------NDPFNVTDPTPQTA  955
               D  D  +      HI    ++   +  A  D P EN        +    ++ P+ Q  
Sbjct  127   KRDHPDWHAYVAQLAHIFSSTQLGSCVREARVDQPIENYAYNSNRADGQMGLSGPS-QPV  185

Query  956   NNPRKVRQPKESKPKKASKLArvvkreeveveDLSWQAVSTFDDWDDGNCGEFVDASDEE  1135
               P     P     K   K                         WD    G    A++  
Sbjct  186   VAPTDGSNPDMGPTKNGEKRKGGA--------------------WDGKKPGRRNSATNPA  225

Query  1136  QDKHLDTWDEDFGLEQVNSDVS---------------AMPVPVCSCTGTPQPCYKWGNGG  1270
             + K     ++  G+ Q N   +               +MPVP CSCTG    C++WG+GG
Sbjct  226   K-KRKPAAEKKVGIAQQNPKPTGQKRRERGSSLHKSLSMPVPYCSCTGANHICHRWGDGG  284

Query  1271  WQSACCTTTISMYPLPQASHKRYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHW  1450
             WQSACCT  +S+YPLP   +K+  R+ GRKMS  AF K+L RL  +G D++ P+DLKDHW
Sbjct  285   WQSACCTPVMSVYPLPMNPYKKGYRLTGRKMSGGAFQKVLQRLGQQGVDVTKPIDLKDHW  344

Query  1451  AKHGTNRYSTVK  1486
             AKHG+N+Y  +K
Sbjct  345   AKHGSNKYVMIK  356



>gb|EYU40418.1| hypothetical protein MIMGU_mgv1a012572mg [Erythranthe guttata]
Length=246

 Score =   165 bits (417),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 2/110 (2%)
 Frame = +2

Query  1160  DEDFG--LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHK  1333
             D+D G  L+ +  D S MPVPVCSCTG  + CYKWG GGWQS+CCTT +S YPLPQ  +K
Sbjct  136   DQDLGSTLQMIRFDESTMPVPVCSCTGVARQCYKWGKGGWQSSCCTTALSEYPLPQMPNK  195

Query  1334  RYSRVGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTV  1483
             R++R+GGRKMS + FS+LL+RL   G+DLS PLDLK +WAKHGTNRY T+
Sbjct  196   RHARMGGRKMSGTVFSRLLTRLGTAGHDLSVPLDLKIYWAKHGTNRYITI  245


 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  620  IMAERDAAILERNMALDERKRALAERDMAMLQRDAAIAERNTALEERDNAISALKLRESS  799
            +  E++AA+ ER+ A+ E K  L E + A+ QRD AI ERN AL+ERDNAI+AL+  ES+
Sbjct  25   LFEEKEAALKERDKAISETKAILKEMEFAITQRDLAIIERNNALKERDNAIAALQFHESN  84

Query  800  MND  808
            M +
Sbjct  85   MRN  87



>ref|XP_010244189.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Nelumbo nucifera]
 ref|XP_010244254.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Nelumbo nucifera]
Length=277

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +2

Query  1175  LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGG  1354
             +  VN D+S +P+PVCSCTGTPQ CY+WG GGWQSACCTT+ISMYPLP ++ +R +R+ G
Sbjct  174   INGVNMDISGIPIPVCSCTGTPQQCYRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAG  233

Query  1355  RKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             RKMS  AF K+L +L AEGY+LS P+DL+ +WAKHGTN++ T++
Sbjct  234   RKMSQGAFKKVLEKLAAEGYNLSNPIDLRTYWAKHGTNKFVTIR  277



>emb|CDP05467.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  1166  DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSR  1345
             D  +  ++ D+S +P+PVCSCTGTPQ CY+WG GGWQSACCTTTISMYPLP ++ +R +R
Sbjct  176   DVVINGIDLDISGIPIPVCSCTGTPQQCYRWGCGGWQSACCTTTISMYPLPMSTKRRGAR  235

Query  1346  VGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             + GRKMS  AF K+L +L AEGY+ + P+DL+ HWAKHGTN++ T++
Sbjct  236   IAGRKMSQGAFKKVLEKLAAEGYNFANPIDLRSHWAKHGTNKFVTIR  282



>ref|XP_010069462.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Eucalyptus grandis]
 ref|XP_010069463.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Eucalyptus grandis]
 gb|KCW57821.1| hypothetical protein EUGRSUZ_H00573 [Eucalyptus grandis]
Length=285

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  1175  LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGG  1354
             +  +N D+S +P+PVCSCTGTPQ CY+WG+GGWQSACCTT +SMYPLP ++ +R +R+ G
Sbjct  182   INGINMDISCIPIPVCSCTGTPQQCYRWGSGGWQSACCTTGLSMYPLPMSTKRRGARIAG  241

Query  1355  RKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             RKMS  AF K+L +L AEGY+ + P+DL+ HWAKHGTN++ T++
Sbjct  242   RKMSIGAFKKVLEKLAAEGYNFTNPIDLRTHWAKHGTNKFVTIR  285



>ref|NP_001266117.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
 gb|ADV59386.1| GAGA-binding transcriptional activator [Solanum lycopersicum]
Length=281

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  1166  DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSR  1345
             D  L  ++ D+S +P+PVCSCTG+PQ CY+WG GGWQSACCTT+ISMYPLP ++ +R +R
Sbjct  175   DIVLNGIDMDISVIPIPVCSCTGSPQQCYRWGCGGWQSACCTTSISMYPLPMSTKRRGAR  234

Query  1346  VGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             + GRKMS  AF K+L +L AEGY+ + P+DL+ HWAKHGTN++ T++
Sbjct  235   IAGRKMSQGAFKKVLEKLAAEGYNFANPIDLRTHWAKHGTNKFVTIR  281



>ref|NP_001275629.1| protein BASIC PENTACYSTEINE2-like [Solanum tuberosum]
 gb|ADV59395.1| GAGA-binding transcriptional activator [Solanum tuberosum]
Length=281

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  1166  DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSR  1345
             D  L  ++ D+S +P+PVCSCTG+PQ CY+WG GGWQSACCTT+ISMYPLP ++ +R +R
Sbjct  175   DIVLNGIDMDISVIPIPVCSCTGSPQQCYRWGCGGWQSACCTTSISMYPLPMSTKRRGAR  234

Query  1346  VGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             + GRKMS  AF K+L +L AEGY+ + P+DL+ HWAKHGTN++ T++
Sbjct  235   IAGRKMSQGAFKKVLEKLAAEGYNFANPIDLRTHWAKHGTNKFVTIR  281



>ref|XP_010554370.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Tarenaya hassleriana]
 ref|XP_010554371.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Tarenaya hassleriana]
Length=278

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  1166  DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSR  1345
             D  +  V+ D+S++PVPVC+CTGTPQ CY+WG GGWQSACCTT ISMYPLP ++ +R +R
Sbjct  172   DVVINGVSMDISSLPVPVCTCTGTPQQCYRWGCGGWQSACCTTNISMYPLPMSTKRRGAR  231

Query  1346  VGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             + GRKMS  AF K+L +L AEG++ S+P+DLK HWA+HGTN++ T++
Sbjct  232   ISGRKMSQGAFKKVLEKLAAEGFNFSSPIDLKSHWARHGTNKFVTIR  278



>gb|KDP38181.1| hypothetical protein JCGZ_04824 [Jatropha curcas]
Length=278

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  1166  DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSR  1345
             D  +  ++ D+S +P+PVCSCTGTPQ CY+WG GGWQSACCTT +SMYPLP ++ +R +R
Sbjct  172   DVVINGIDMDISGIPIPVCSCTGTPQQCYRWGCGGWQSACCTTNVSMYPLPMSTKRRGAR  231

Query  1346  VGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             + GRKMS  AF K+L +L AEGY+ + P+DL+ HWAKHGTN++ T++
Sbjct  232   IAGRKMSQGAFKKVLEKLAAEGYNFANPIDLRTHWAKHGTNKFVTIR  278



>ref|XP_006374227.1| GAGA-binding family protein [Populus trichocarpa]
 gb|ERP52024.1| GAGA-binding family protein [Populus trichocarpa]
Length=238

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +2

Query  1175  LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGG  1354
             +  +N D+S +P+PVCSCTG PQ CY+WG GGWQSACCTT IS+YPLP +  +R +R+ G
Sbjct  135   INGINMDISVIPIPVCSCTGNPQQCYRWGCGGWQSACCTTCISVYPLPMSMKRRGARIAG  194

Query  1355  RKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             RKMS  AF K+L +L  EGYD S P+DL+ HWAKHGTN++ T++
Sbjct  195   RKMSLGAFKKVLEKLAGEGYDFSNPIDLRTHWAKHGTNKFVTIR  238



>ref|XP_011021717.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Populus euphratica]
Length=279

 Score =   160 bits (405),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  1166  DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSR  1345
             D  +  ++ D+S +P+PVCSCTGTPQ CY+WG GGWQSACCTT +SMYPLP +S +R +R
Sbjct  173   DVVINGIDMDISGIPIPVCSCTGTPQQCYRWGCGGWQSACCTTNVSMYPLPMSSKRRGAR  232

Query  1346  VGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             + GRKMS  AF K+L +L AEGY+ + P+DL+ HWA+HGTN++ T++
Sbjct  233   IAGRKMSQGAFKKVLEKLAAEGYNFANPIDLRAHWARHGTNKFVTIR  279



>ref|XP_011000745.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Populus euphratica]
 ref|XP_011000747.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Populus euphratica]
Length=290

 Score =   160 bits (406),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +2

Query  1175  LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGG  1354
             +  +N D+S +P+PVCSCTG PQ CY+WG GGWQSACCTT ISMYPLP ++ +R +R+ G
Sbjct  187   INGINMDMSVIPIPVCSCTGNPQQCYRWGCGGWQSACCTTCISMYPLPMSTKRRGARIAG  246

Query  1355  RKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             RKMS+ AF K+L +L  EGYD S P+DL+ HWAKHGTN++ T++
Sbjct  247   RKMSSGAFKKVLEKLADEGYDFSNPIDLRTHWAKHGTNKFVTIR  290



>ref|XP_008220956.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Prunus mume]
Length=278

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  1166  DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSR  1345
             D  +  +N D+S +P+PVCSCTG PQ CY+WG GGWQSACCTT +SMYPLP ++ +R +R
Sbjct  172   DVVINGINMDISGIPIPVCSCTGAPQQCYRWGCGGWQSACCTTNVSMYPLPMSTKRRGAR  231

Query  1346  VGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             + GRKMS  AF K+L +L AEGY+ + P+DL+ HWA+HGTN++ T++
Sbjct  232   IAGRKMSQGAFKKVLEKLAAEGYNFANPIDLRGHWARHGTNKFVTIR  278



>ref|XP_006374225.1| GAGA-binding family protein [Populus trichocarpa]
 ref|XP_006374226.1| hypothetical protein POPTR_0015s05200g [Populus trichocarpa]
 gb|ERP52022.1| GAGA-binding family protein [Populus trichocarpa]
 gb|ERP52023.1| hypothetical protein POPTR_0015s05200g [Populus trichocarpa]
Length=288

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  1175  LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGG  1354
             +  +N D+S +P+PVCSCTG PQ CY+WG GGWQSACCTT IS+YPLP ++ +R +R+ G
Sbjct  185   INGINMDISVIPIPVCSCTGNPQQCYRWGCGGWQSACCTTCISVYPLPMSTKRRGARIAG  244

Query  1355  RKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             RKMS  AF K+L +L  EGYD S P+DL+ HWAKHGTN++ T++
Sbjct  245   RKMSLGAFKKVLEKLAGEGYDFSNPIDLRTHWAKHGTNKFVTIR  288



>gb|ADV59349.1| GAGA-binding transcriptional activator [Populus trichocarpa]
 gb|ADV59350.1| GAGA-binding transcriptional activator [Populus trichocarpa]
Length=284

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  1175  LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGG  1354
             +  +N D+S +P+PVCSCTG PQ CY+WG GGWQSACCTT IS+YPLP ++ +R +R+ G
Sbjct  181   INGINMDISVIPIPVCSCTGNPQQCYRWGCGGWQSACCTTCISVYPLPMSTKRRGARIAG  240

Query  1355  RKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             RKMS  AF K+L +L  EGYD S P+DL+ HWAKHGTN++ T++
Sbjct  241   RKMSLGAFKKVLEKLAGEGYDFSNPIDLRTHWAKHGTNKFVTIR  284



>ref|XP_010271107.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Nelumbo nucifera]
 ref|XP_010271108.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Nelumbo nucifera]
 ref|XP_010271109.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Nelumbo nucifera]
Length=284

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +2

Query  1175  LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGG  1354
             +  V+ D+S +P+PVCSCTGTPQ CY+WG GGWQSACCTT++SMYPLP ++ +R +R+ G
Sbjct  181   INGVDMDISGIPIPVCSCTGTPQQCYRWGCGGWQSACCTTSLSMYPLPMSTKRRGARIAG  240

Query  1355  RKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             RKMS  AF K+L +L +EGY+LS P+DL+ +WAKHGTN++ T++
Sbjct  241   RKMSQGAFKKVLEKLVSEGYNLSNPIDLRPYWAKHGTNKFVTIR  284



>ref|XP_006391183.1| hypothetical protein EUTSA_v10018977mg [Eutrema salsugineum]
 gb|ESQ28469.1| hypothetical protein EUTSA_v10018977mg [Eutrema salsugineum]
Length=281

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = +2

Query  1184  VNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGGRKM  1363
             V+ D+  +PVPVCSCTG  QPCY+WG GGWQSACCTT +SMYPLP ++ +R +R+ GRKM
Sbjct  181   VSMDIGCLPVPVCSCTGMAQPCYRWGCGGWQSACCTTNVSMYPLPMSTKRRGARIAGRKM  240

Query  1364  SASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             S  AF K+L +L+A+G+D S+P+DLK HWAKHGTN++ T++
Sbjct  241   SQGAFKKVLEKLSADGFDFSSPIDLKSHWAKHGTNKFVTIR  281



>ref|XP_009762917.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Nicotiana sylvestris]
Length=282

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  1166  DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSR  1345
             D  +  ++ D+S +P+PVCSCTG PQ CY+WG GGWQSACCTT+ISMYPLP ++ +R +R
Sbjct  176   DIVINGIDMDISGIPIPVCSCTGAPQQCYRWGCGGWQSACCTTSISMYPLPMSTKRRGAR  235

Query  1346  VGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             + GRKMS  AF K+L +L AEGY  + P+DL+ HWAKHGTN++ T++
Sbjct  236   IAGRKMSQGAFKKVLEKLAAEGYSFANPIDLRTHWAKHGTNKFVTIR  282



>ref|NP_001268137.1| GAGA-binding transcriptional activator BBR/BPC1-like [Vitis vinifera]
 ref|XP_010649609.1| PREDICTED: GAGA-binding transcriptional activator BBR/BPC1-like 
isoform X1 [Vitis vinifera]
 ref|XP_010650043.1| PREDICTED: GAGA-binding transcriptional activator BBR/BPC1-like 
isoform X1 [Vitis vinifera]
 ref|XP_010650443.1| PREDICTED: GAGA-binding transcriptional activator BBR/BPC1-like 
isoform X1 [Vitis vinifera]
 gb|ACC64525.1| GAGA-binding transcriptional activator BBR/BPC1-like [Vitis vinifera]
 gb|ACC64526.1| GAGA-binding transcriptional activator BBR/BPC1-like [Vitis vinifera]
Length=293

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  1166  DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSR  1345
             D  +  ++ D+S +P+PVCSCTG PQ CY+WG GGWQSACCTT+ISMYPLP ++ +R +R
Sbjct  187   DVVINGIDMDISGIPIPVCSCTGNPQQCYRWGCGGWQSACCTTSISMYPLPMSTKRRGAR  246

Query  1346  VGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             + GRKMS  AF K+L +L AEGY+ + P+DL+ HWAKHGTN++ T++
Sbjct  247   IAGRKMSQGAFKKVLEKLAAEGYNFANPIDLRRHWAKHGTNKFVTIR  293



>ref|XP_010415406.1| PREDICTED: protein BASIC PENTACYSTEINE3-like [Camelina sativa]
 ref|XP_010415407.1| PREDICTED: protein BASIC PENTACYSTEINE3-like [Camelina sativa]
Length=276

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +2

Query  1175  LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGG  1354
             +  V+ D+  +PVPVCSCTG PQ CY+WG GGWQSACCTT +SMYPLP ++ +R +R+ G
Sbjct  173   INGVSMDIGCLPVPVCSCTGMPQQCYRWGCGGWQSACCTTNVSMYPLPISAKRRGARIAG  232

Query  1355  RKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             RKMS  AF K+L +L+A+G+D S P+DLK HWAKHGTN++ T++
Sbjct  233   RKMSQGAFRKVLEKLSADGFDFSIPIDLKSHWAKHGTNKFVTIR  276



>ref|XP_009608500.1| PREDICTED: protein BASIC PENTACYSTEINE2 [Nicotiana tomentosiformis]
 gb|ADV59383.1| GAGA-binding transcriptional activator [Nicotiana tabacum]
Length=282

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  1166  DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSR  1345
             D  +  ++ D+S +P+PVCSCTG PQ CY+WG GGWQSACCTT+ISMYPLP ++ +R +R
Sbjct  176   DIVINGIDMDISGIPIPVCSCTGAPQQCYRWGCGGWQSACCTTSISMYPLPMSTKRRGAR  235

Query  1346  VGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             + GRKMS  AF K+L +L AEGY  + P+DL+ HWAKHGTN++ T++
Sbjct  236   IAGRKMSQGAFKKVLEKLAAEGYSFANPIDLRTHWAKHGTNKFVTIR  282



>gb|ADV59351.1| GAGA-binding transcriptional activator [Populus trichocarpa]
 gb|ADV59352.1| GAGA-binding transcriptional activator [Populus trichocarpa]
Length=284

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +2

Query  1175  LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGG  1354
             +  +N D+S +P+PVCSCTG PQ CY+WG GGWQSACCTT IS+YPLP +  +R +R+ G
Sbjct  181   INGINMDISVIPIPVCSCTGNPQQCYRWGCGGWQSACCTTCISVYPLPMSMKRRGARIAG  240

Query  1355  RKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             RKMS  AF K+L +L  EGYD S P+DL+ HWAKHGTN++ T++
Sbjct  241   RKMSLGAFKKVLEKLAGEGYDFSNPIDLRTHWAKHGTNKFVTIR  284



>ref|XP_010917292.1| PREDICTED: protein Barley B recombinant-like [Elaeis guineensis]
 ref|XP_010917294.1| PREDICTED: protein Barley B recombinant-like [Elaeis guineensis]
Length=271

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  1166  DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSR  1345
             D  +  ++ D+S +P P+CSCTGTPQ CY+WG GGWQSACCTT+ISMYPLP ++ +R +R
Sbjct  165   DVVINGIDLDISGIPTPICSCTGTPQQCYRWGVGGWQSACCTTSISMYPLPMSTKRRGAR  224

Query  1346  VGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             + GRKMS  AF K+L +L  EGY+LS P+DLK +WAKHGTN++ T++
Sbjct  225   IAGRKMSQGAFKKVLEKLAGEGYNLSNPIDLKTYWAKHGTNKFVTIR  271



>ref|XP_008806632.1| PREDICTED: protein Barley B recombinant-like [Phoenix dactylifera]
 ref|XP_008806633.1| PREDICTED: protein Barley B recombinant-like [Phoenix dactylifera]
 ref|XP_008806634.1| PREDICTED: protein Barley B recombinant-like [Phoenix dactylifera]
 ref|XP_008806635.1| PREDICTED: protein Barley B recombinant-like [Phoenix dactylifera]
Length=272

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  1166  DFGLEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSR  1345
             D  +  ++ D+S +P PVCSCTGTPQ CY+WG GGWQSACCTT+ISMYPLP ++ +R +R
Sbjct  166   DVVINGIDLDISGIPTPVCSCTGTPQQCYRWGVGGWQSACCTTSISMYPLPMSTKRRGAR  225

Query  1346  VGGRKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             + GRKMS  AF K+L +L  EGY+LS P+DLK +WAKHGTN++ T++
Sbjct  226   IAGRKMSQGAFKKVLEKLAGEGYNLSNPIDLKTYWAKHGTNKFVTIR  272



>ref|XP_011035535.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Populus euphratica]
 ref|XP_011035536.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Populus euphratica]
 ref|XP_011035537.1| PREDICTED: protein BASIC PENTACYSTEINE2-like [Populus euphratica]
Length=284

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +2

Query  1175  LEQVNSDVSAMPVPVCSCTGTPQPCYKWGNGGWQSACCTTTISMYPLPQASHKRYSRVGG  1354
             +  +N D+S +P+PVCSCTG PQ CY+WG GGWQSACCTT IS+YPLP +  +R +R+ G
Sbjct  181   INGINMDISVIPIPVCSCTGNPQQCYRWGCGGWQSACCTTCISVYPLPMSMKRRGARIAG  240

Query  1355  RKMSASAFSKLLSRLTAEGYDLSAPLDLKDHWAKHGTNRYSTVK  1486
             RKMS  AF K+L +L  EGYD S P+DL+ HWAKHGTN++ T++
Sbjct  241   RKMSLGAFKKVLEKLAGEGYDFSNPIDLRTHWAKHGTNKFVTIR  284



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5506164531480