BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1930_g1_i1 len=2180 path=[2158:0-2179]

Length=2180
                                                                      Score     E

ref|XP_009763312.1|  PREDICTED: serine/threonine-protein kinase GIN4    503   2e-161   
ref|XP_009768987.1|  PREDICTED: uncharacterized protein LOC104219917    498   5e-160   
ref|XP_009598286.1|  PREDICTED: uncharacterized protein LOC104094126    499   6e-160   
ref|XP_004244627.1|  PREDICTED: serine/threonine-protein kinase M...    496   1e-157   
ref|XP_009620190.1|  PREDICTED: uncharacterized protein LOC104112065    509   2e-156   
emb|CDP12123.1|  unnamed protein product                                481   6e-153   
ref|XP_010325368.1|  PREDICTED: serine/threonine-protein kinase P...    469   3e-148   
ref|XP_010325369.1|  PREDICTED: serine/threonine-protein kinase P...    466   6e-147   
ref|XP_006343890.1|  PREDICTED: serine/threonine-protein kinase d...    466   6e-147   
gb|EYU23387.1|  hypothetical protein MIMGU_mgv1a020213mg                446   1e-141   
ref|XP_006352309.1|  PREDICTED: light-sensor Protein kinase-like        437   2e-140   
ref|XP_011080871.1|  PREDICTED: uncharacterized protein LOC105164...    442   4e-137   
ref|XP_011080869.1|  PREDICTED: uncharacterized protein LOC105164...    442   5e-137   
gb|KDO76456.1|  hypothetical protein CISIN_1g003542mg                   409   5e-127   
ref|XP_006476428.1|  PREDICTED: probable serine/threonine-protein...    408   2e-126   
ref|XP_006439402.1|  hypothetical protein CICLE_v10018862mg             408   3e-126   
ref|XP_010658951.1|  PREDICTED: mitogen-activated protein kinase ...    398   2e-124   
ref|XP_010104990.1|  Light-sensor Protein kinase                        397   1e-123   
ref|XP_010689808.1|  PREDICTED: mitogen-activated protein kinase ...    394   3e-121   
ref|XP_010545236.1|  PREDICTED: mitogen-activated protein kinase ...    391   4e-121   
ref|XP_007040439.1|  Kinase family protein, putative isoform 3          389   5e-121   
ref|XP_010689812.1|  PREDICTED: mitogen-activated protein kinase ...    392   7e-121   
ref|XP_004300853.1|  PREDICTED: uncharacterized protein LOC101304004    394   2e-120   
ref|XP_007040437.1|  Kinase family protein, putative isoform 1          389   2e-120   
emb|CBI40479.3|  unnamed protein product                                384   8e-120   
ref|XP_010261489.1|  PREDICTED: light-sensor Protein kinase             385   3e-119   
ref|XP_002280598.2|  PREDICTED: mitogen-activated protein kinase ...    385   4e-119   Vitis vinifera
ref|XP_006444885.1|  hypothetical protein CICLE_v10023409mg             384   6e-119   
emb|CDP08715.1|  unnamed protein product                                379   5e-118   
ref|XP_006839188.1|  hypothetical protein AMTR_s00097p00141680          380   1e-117   
ref|XP_010441344.1|  PREDICTED: serine/threonine-protein kinase P...    382   1e-117   
ref|XP_010447859.1|  PREDICTED: mitogen-activated protein kinase ...    381   2e-117   
ref|XP_006283223.1|  hypothetical protein CARUB_v10004253mg             381   2e-117   
ref|XP_010095716.1|  Light-sensor Protein kinase                        379   3e-117   
gb|AAG51718.1|AC066689_17  phytochrome, putative; 80131-78152           378   3e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022552.1|  PREDICTED: mitogen-activated protein kinase ...    379   1e-116   
ref|XP_011037745.1|  PREDICTED: mitogen-activated protein kinase ...    379   1e-116   
ref|XP_002303628.2|  hypothetical protein POPTR_0003s13680g             379   1e-116   Populus trichocarpa [western balsam poplar]
ref|XP_002320182.1|  hypothetical protein POPTR_0014s09090g             375   3e-116   Populus trichocarpa [western balsam poplar]
ref|NP_564829.1|  putative serine/threonine/tyrosine kinase             378   3e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004516399.1|  PREDICTED: mitogen-activated protein kinase ...    376   6e-116   
ref|XP_010418486.1|  PREDICTED: serine/threonine-protein kinase N...    377   9e-116   
ref|XP_010473689.1|  PREDICTED: serine/threonine-protein kinase N...    376   1e-115   
ref|XP_010674040.1|  PREDICTED: uncharacterized protein LOC104890305    374   3e-115   
ref|XP_010430555.1|  PREDICTED: serine/threonine-protein kinase N...    375   3e-115   
ref|NP_198988.1|  protein kinase                                        375   3e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887904.1|  kinase family protein                              375   4e-115   
gb|KCW77427.1|  hypothetical protein EUGRSUZ_D01773                     372   4e-115   
ref|XP_006301064.1|  hypothetical protein CARUB_v10021457mg             375   5e-115   
ref|XP_010553553.1|  PREDICTED: serine/threonine-protein kinase M...    374   8e-115   
ref|XP_009336247.1|  PREDICTED: mitogen-activated protein kinase ...    374   2e-114   
ref|XP_006391646.1|  hypothetical protein EUTSA_v10023305mg             373   2e-114   
ref|XP_010053169.1|  PREDICTED: uncharacterized protein LOC104441681    373   3e-114   
ref|XP_008239072.1|  PREDICTED: mitogen-activated protein kinase ...    373   3e-114   
ref|XP_002509924.1|  serine-threonine protein kinase, putative          372   4e-114   Ricinus communis
gb|KDP25332.1|  hypothetical protein JCGZ_20488                         371   8e-114   
ref|XP_009352367.1|  PREDICTED: mitogen-activated protein kinase ...    371   1e-113   
ref|XP_008437968.1|  PREDICTED: mitogen-activated protein kinase ...    369   3e-113   
ref|XP_009377265.1|  PREDICTED: mitogen-activated protein kinase ...    369   5e-113   
ref|XP_007210709.1|  hypothetical protein PRUPE_ppa024039mg             369   9e-113   
ref|XP_007219478.1|  hypothetical protein PRUPE_ppa021542mg             368   1e-112   
emb|CBI34452.3|  unnamed protein product                                364   1e-112   
ref|XP_008392447.1|  PREDICTED: mitogen-activated protein kinase ...    369   2e-112   
ref|XP_009349671.1|  PREDICTED: mitogen-activated protein kinase ...    369   2e-112   
ref|XP_004134312.1|  PREDICTED: light-sensor Protein kinase-like        366   3e-112   
ref|XP_009118811.1|  PREDICTED: light-sensor Protein kinase             358   5e-112   
gb|KDP28518.1|  hypothetical protein JCGZ_14289                         366   5e-112   
gb|KEH18707.1|  Serine/Threonine kinase family protein                  365   7e-112   
ref|XP_011093433.1|  PREDICTED: mitogen-activated protein kinase ...    364   2e-111   
ref|XP_009757710.1|  PREDICTED: mitogen-activated protein kinase ...    363   4e-111   
ref|XP_009377877.1|  PREDICTED: mitogen-activated protein kinase ...    363   6e-111   
ref|XP_002868578.1|  kinase family protein                              364   8e-111   
emb|CDY38007.1|  BnaCnng08680D                                          353   4e-110   
gb|EYU32213.1|  hypothetical protein MIMGU_mgv1a021687mg                361   4e-110   
ref|XP_008364823.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    361   5e-110   
ref|XP_008349540.1|  PREDICTED: mitogen-activated protein kinase ...    360   6e-110   
ref|XP_009620502.1|  PREDICTED: mitogen-activated protein kinase ...    360   1e-109   
ref|XP_010924823.1|  PREDICTED: uncharacterized protein LOC105047...    358   5e-109   
ref|XP_010053791.1|  PREDICTED: uncharacterized protein LOC104442157    358   6e-109   
ref|XP_010924822.1|  PREDICTED: tyrosine-protein kinase ABL1-like...    358   1e-108   
ref|XP_009140115.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    357   2e-108   
ref|XP_010326856.1|  PREDICTED: mitogen-activated protein kinase ...    356   4e-108   
ref|NP_171652.1|  putative serine/threonine/tyrosine kinase             349   5e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548520.1|  PREDICTED: uncharacterized protein LOC100813704    355   5e-108   
ref|XP_006418422.1|  hypothetical protein EUTSA_v10009834mg             354   6e-108   
ref|XP_009112819.1|  PREDICTED: probable serine/threonine-protein...    356   7e-108   
ref|XP_009112888.1|  PREDICTED: mitogen-activated protein kinase ...    356   8e-108   
ref|XP_007135218.1|  hypothetical protein PHAVU_010G111000g             355   9e-108   
ref|XP_008437376.1|  PREDICTED: serine/threonine-protein kinase ULK1    355   2e-107   
ref|XP_007051620.1|  F22L4.1 protein, putative isoform 1                354   2e-107   
ref|XP_010915694.1|  PREDICTED: uncharacterized protein LOC105040733    353   3e-107   
ref|XP_010914091.1|  PREDICTED: serine/threonine-protein kinase H...    353   3e-107   
ref|XP_004308323.1|  PREDICTED: uncharacterized protein LOC101300294    353   8e-107   
ref|XP_008791458.1|  PREDICTED: mitogen-activated protein kinase ...    352   9e-107   
ref|XP_006339677.1|  PREDICTED: mitogen-activated protein kinase ...    352   1e-106   
ref|XP_006405314.1|  hypothetical protein EUTSA_v10027660mg             352   2e-106   
ref|XP_009410857.1|  PREDICTED: mitogen-activated protein kinase ...    351   2e-106   
ref|XP_004143955.1|  PREDICTED: uncharacterized protein LOC101209943    352   2e-106   
emb|CAA73313.1|  hypothetical protein                                   351   2e-106   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42533.1|  hypothetical protein AALP_AA1G006700                    348   8e-106   
ref|XP_006303540.1|  hypothetical protein CARUB_v10010980mg             347   3e-105   
ref|XP_008376057.1|  PREDICTED: mitogen-activated protein kinase ...    348   4e-105   
ref|XP_002532661.1|  serine-threonine protein kinase, putative          348   4e-105   Ricinus communis
ref|XP_010474742.1|  PREDICTED: light-sensor Protein kinase-like ...    341   5e-105   
ref|XP_008783955.1|  PREDICTED: serine/threonine-protein kinase P...    345   4e-104   
emb|CDY34416.1|  BnaA09g11580D                                          347   6e-104   
ref|XP_004511529.1|  PREDICTED: serine/threonine-protein kinase d...    350   9e-104   
ref|XP_003611022.1|  Integrin-linked protein kinase                     349   1e-103   
gb|AAF81305.1|AC061957_1  Contains similarity to a photoreceptor ...    352   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889366.1|  predicted protein                                  350   3e-103   
emb|CDY38181.1|  BnaA09g12080D                                          343   3e-103   
ref|XP_010474743.1|  PREDICTED: uncharacterized protein LOC104754...    343   4e-103   
ref|XP_008798680.1|  PREDICTED: tyrosine-protein kinase ABL1-like       341   5e-103   
ref|XP_010480291.1|  PREDICTED: CBL-interacting serine/threonine-...    342   6e-103   
emb|CDY25576.1|  BnaC09g12010D                                          347   1e-102   
ref|XP_009415712.1|  PREDICTED: uncharacterized protein LOC103996521    340   2e-102   
ref|XP_009396649.1|  PREDICTED: tyrosine-protein kinase ABL1-like       338   2e-101   
ref|XP_003538680.1|  PREDICTED: uncharacterized protein LOC100778844    340   3e-100   
ref|XP_008233214.1|  PREDICTED: mitogen-activated protein kinase ...    329   2e-98    
ref|XP_007158560.1|  hypothetical protein PHAVU_002G162700g             327   1e-95    
ref|XP_009395061.1|  PREDICTED: tyrosine-protein kinase ABL1-like       317   1e-93    
ref|XP_003569381.1|  PREDICTED: uncharacterized protein LOC100834316    315   1e-92    
ref|XP_010523184.1|  PREDICTED: LOW QUALITY PROTEIN: G protein-co...    311   5e-91    
ref|XP_006644379.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    309   2e-90    
gb|AAU05456.1|  At1g01450                                               301   2e-90    Arabidopsis thaliana [mouse-ear cress]
gb|EMS45702.1|  Light-sensor Protein kinase                             303   1e-88    
dbj|BAJ99445.1|  predicted protein                                      303   2e-88    
ref|XP_008656656.1|  PREDICTED: uncharacterized protein LOC103636079    300   3e-87    
gb|AFW83300.1|  putative DUF1221-domain containing protein kinase...    301   3e-87    
gb|EAY75006.1|  hypothetical protein OsI_02905                          300   4e-87    Oryza sativa Indica Group [Indian rice]
emb|CDY27699.1|  BnaUnng00490D                                          298   3e-86    
ref|NP_001043605.1|  Os01g0621600                                       296   1e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969200.1|  PREDICTED: uncharacterized protein LOC101780...    291   5e-84    
ref|XP_004969199.1|  PREDICTED: uncharacterized protein LOC101780...    292   6e-84    
ref|XP_002440343.1|  hypothetical protein SORBIDRAFT_09g029990          290   5e-83    Sorghum bicolor [broomcorn]
gb|AFW81274.1|  putative DUF1221-domain containing protein kinase...    287   1e-82    
gb|EMT32473.1|  Light-sensor Protein kinase                             288   2e-82    
ref|XP_008656084.1|  PREDICTED: uncharacterized protein LOC103635406    288   2e-82    
ref|XP_002458176.1|  hypothetical protein SORBIDRAFT_03g028250          286   9e-82    Sorghum bicolor [broomcorn]
emb|CDY49880.1|  BnaA04g11340D                                          285   9e-82    
ref|XP_006396707.1|  hypothetical protein EUTSA_v10029146mg             278   6e-80    
ref|XP_004963555.1|  PREDICTED: uncharacterized protein LOC101774845    276   1e-78    
ref|XP_003565830.1|  PREDICTED: mitogen-activated protein kinase ...    248   2e-67    
gb|EAY99213.1|  hypothetical protein OsI_21171                          244   1e-66    Oryza sativa Indica Group [Indian rice]
ref|NP_001056458.1|  Os05g0585800                                       243   2e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655640.1|  PREDICTED: light-sensor Protein kinase-like        203   6e-53    
ref|XP_002983016.1|  hypothetical protein SELMODRAFT_117674             154   5e-38    
ref|XP_001761872.1|  predicted protein                                  140   6e-34    
ref|XP_001774078.1|  predicted protein                                  137   2e-32    
gb|EYU32409.1|  hypothetical protein MIMGU_mgv11b017814mg               138   2e-32    
sp|P25848.3|PHY1_CERPU  RecName: Full=Light-sensor Protein kinase...    140   8e-31    Ceratodon purpureus
ref|XP_001776234.1|  predicted protein                                  129   2e-30    
emb|CAA71838.1|  photoreceptor                                          138   4e-30    Ceratodon purpureus
ref|XP_001777649.1|  predicted protein                                  129   4e-30    
ref|XP_001773947.1|  predicted protein                                  129   4e-30    
ref|XP_001774434.1|  predicted protein                                  127   1e-29    
ref|XP_001774439.1|  predicted protein                                  126   3e-29    
ref|XP_001783695.1|  predicted protein                                  126   3e-29    
ref|XP_001783992.1|  predicted protein                                  125   6e-29    
ref|XP_001775413.1|  predicted protein                                  128   6e-29    
ref|XP_001755795.1|  predicted protein                                  125   2e-28    
gb|KHN06285.1|  hypothetical protein glysoja_021123                     122   2e-27    
ref|XP_001755793.1|  predicted protein                                  121   3e-27    
ref|XP_001752225.1|  predicted protein                                  120   4e-27    
ref|XP_002983141.1|  hypothetical protein SELMODRAFT_117448             122   5e-27    
ref|XP_001781141.1|  predicted protein                                  118   6e-26    
dbj|BAJ93315.1|  predicted protein                                      114   5e-24    
dbj|BAJ94289.1|  predicted protein                                      114   6e-24    
ref|XP_001780791.1|  predicted protein                                  111   9e-24    
ref|XP_001765777.1|  predicted protein                                  111   1e-23    
ref|XP_010270066.1|  PREDICTED: serine/threonine-protein kinase H...    111   6e-23    
gb|ABK06447.1|  flag-tagged protein kinase domain of putative mit...    111   7e-23    
ref|XP_001783338.1|  predicted protein                                  107   8e-23    
ref|XP_003564407.1|  PREDICTED: serine/threonine-protein kinase H...    111   8e-23    
ref|XP_006391896.1|  hypothetical protein EUTSA_v10023512mg             111   8e-23    
ref|XP_002888028.1|  hypothetical protein ARALYDRAFT_475103             110   1e-22    
ref|NP_176430.1|  protein high leaf temperature 1                       110   1e-22    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113082.1|  PREDICTED: serine/threonine-protein kinase HT1     110   1e-22    
emb|CDY19547.1|  BnaC09g13560D                                          110   1e-22    
emb|CDY63734.1|  BnaCnng42530D                                          110   1e-22    
gb|KFK35905.1|  hypothetical protein AALP_AA4G051600                    110   1e-22    
ref|XP_010430294.1|  PREDICTED: serine/threonine-protein kinase HT1     110   1e-22    
ref|XP_010418233.1|  PREDICTED: serine/threonine-protein kinase H...    110   1e-22    
emb|CDY12945.1|  BnaA09g13290D                                          110   1e-22    
emb|CDY03279.1|  BnaC09g10690D                                          110   1e-22    
ref|XP_010473458.1|  PREDICTED: serine/threonine-protein kinase H...    110   1e-22    
ref|XP_010270068.1|  PREDICTED: serine/threonine-protein kinase H...    110   1e-22    
sp|Q2MHE4.1|HT1_ARATH  RecName: Full=Serine/threonine-protein kin...    110   1e-22    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009112690.1|  PREDICTED: serine/threonine-protein kinase HT1     110   1e-22    
ref|XP_006302349.1|  hypothetical protein CARUB_v10020429mg             110   1e-22    
emb|CDP04467.1|  unnamed protein product                                110   2e-22    
gb|EMT06203.1|  Serine/threonine-protein kinase HT1                     109   2e-22    
emb|CDY39795.1|  BnaA09g10470D                                          110   2e-22    
ref|XP_001758080.1|  predicted protein                                  107   2e-22    
gb|EYU33864.1|  hypothetical protein MIMGU_mgv1a017667mg                109   2e-22    
ref|XP_001777764.1|  predicted protein                                  112   2e-22    
ref|XP_004508863.1|  PREDICTED: serine/threonine-protein kinase H...    108   4e-22    
ref|XP_002455332.1|  hypothetical protein SORBIDRAFT_03g008630          108   5e-22    Sorghum bicolor [broomcorn]
ref|XP_004967953.1|  PREDICTED: serine/threonine-protein kinase H...    108   5e-22    
ref|XP_006643652.1|  PREDICTED: serine/threonine-protein kinase H...    108   5e-22    
ref|NP_001130627.1|  uncharacterized protein LOC100191726               108   6e-22    Zea mays [maize]
gb|ACF78924.1|  unknown                                                 108   6e-22    Zea mays [maize]
ref|XP_003523074.1|  PREDICTED: serine/threonine-protein kinase H...    108   6e-22    
gb|KHN19311.1|  Serine/threonine-protein kinase HT1                     108   7e-22    
ref|XP_001762830.1|  predicted protein                                  105   7e-22    
ref|XP_009627519.1|  PREDICTED: serine/threonine-protein kinase H...    108   8e-22    
ref|XP_009768184.1|  PREDICTED: serine/threonine-protein kinase H...    107   9e-22    
ref|XP_003608966.1|  Fibroblast growth factor receptor                  107   1e-21    
gb|KEH31846.1|  tyrosine kinase family protein                          107   1e-21    
ref|XP_009780566.1|  PREDICTED: serine/threonine-protein kinase H...    107   1e-21    
ref|XP_009626934.1|  PREDICTED: serine/threonine-protein kinase H...    107   1e-21    
ref|XP_001782419.1|  predicted protein                                  104   1e-21    
ref|XP_002970550.1|  hypothetical protein SELMODRAFT_37511              103   2e-21    
gb|AAF70839.1|AC003113_6  F24O1.13                                      107   2e-21    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004236673.1|  PREDICTED: serine/threonine-protein kinase HT1     107   2e-21    
ref|XP_006449834.1|  hypothetical protein CICLE_v10015659mg             107   2e-21    
ref|XP_006346769.1|  PREDICTED: serine/threonine-protein kinase H...    107   2e-21    
ref|XP_006467353.1|  PREDICTED: serine/threonine-protein kinase H...    106   2e-21    
ref|XP_001783922.1|  predicted protein                                  104   2e-21    
ref|XP_010090956.1|  Serine/threonine-protein kinase HT1                106   2e-21    
gb|ETO10875.1|  hypothetical protein RFI_26503                          106   2e-21    
ref|XP_001308342.1|  TKL family protein kinase                          110   2e-21    Trichomonas vaginalis G3
dbj|BAD44848.1|  putative protein kinase                                106   3e-21    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004501934.1|  PREDICTED: serine/threonine-protein kinase H...    106   3e-21    
gb|EMS58860.1|  Serine/threonine-protein kinase HT1                     105   3e-21    
gb|KHN18460.1|  Serine/threonine-protein kinase HT1                     106   3e-21    
ref|XP_003528701.2|  PREDICTED: serine/threonine-protein kinase H...    106   3e-21    
ref|XP_010678755.1|  PREDICTED: serine/threonine-protein kinase H...    106   3e-21    
ref|XP_011095979.1|  PREDICTED: serine/threonine-protein kinase HT1     106   3e-21    
gb|AES92694.2|  Serine/Threonine-kinase HT1-like protein                106   3e-21    
ref|XP_003550738.1|  PREDICTED: serine/threonine-protein kinase H...    105   3e-21    
ref|XP_006476768.1|  PREDICTED: serine/threonine-protein kinase H...    106   3e-21    
ref|XP_001779657.1|  predicted protein                                  102   3e-21    
gb|KHN49033.1|  Serine/threonine-protein kinase HT1                     105   4e-21    
ref|XP_008440056.1|  PREDICTED: serine/threonine-protein kinase HT1     105   4e-21    
ref|XP_004507651.1|  PREDICTED: serine/threonine-protein kinase H...    105   4e-21    
ref|XP_011086225.1|  PREDICTED: serine/threonine-protein kinase H...    105   4e-21    
ref|XP_007209317.1|  hypothetical protein PRUPE_ppa007935mg             105   4e-21    
gb|AES71532.2|  Serine/Threonine-kinase HT1-like protein                105   5e-21    
gb|KGN49067.1|  hypothetical protein Csa_6G511830                       105   5e-21    
gb|KDQ19166.1|  hypothetical protein BOTBODRAFT_485672                  104   5e-21    
ref|XP_003550476.2|  PREDICTED: serine/threonine-protein kinase H...    105   7e-21    
ref|XP_003601281.1|  Fibroblast growth factor receptor                  105   7e-21    
ref|XP_010546527.1|  PREDICTED: serine/threonine-protein kinase HT1     105   7e-21    
ref|XP_008239758.1|  PREDICTED: serine/threonine-protein kinase H...    104   7e-21    
ref|XP_001752525.1|  predicted protein                                  108   8e-21    
ref|XP_007026235.1|  Serine/threonine-protein kinase HT1                105   8e-21    
ref|XP_004231068.1|  PREDICTED: serine/threonine-protein kinase H...    107   9e-21    
ref|XP_007154003.1|  hypothetical protein PHAVU_003G082800g             105   9e-21    
emb|CDY08153.1|  BnaA06g15730D                                          105   9e-21    
ref|XP_008393038.1|  PREDICTED: serine/threonine-protein kinase H...    104   1e-20    
gb|KHG28529.1|  Serine/threonine-protein kinase HT1                     104   1e-20    
gb|KDP20681.1|  hypothetical protein JCGZ_21152                         104   1e-20    
ref|XP_004231067.1|  PREDICTED: serine/threonine-protein kinase H...    107   1e-20    
ref|XP_001759353.1|  predicted protein                                  107   1e-20    
ref|XP_003525363.1|  PREDICTED: serine/threonine-protein kinase H...    104   1e-20    
gb|ABK06445.1|  flag-tagged protein kinase domain of putative mit...    104   1e-20    
ref|XP_010936736.1|  PREDICTED: serine/threonine-protein kinase H...    104   1e-20    
emb|CDY16124.1|  BnaC08g39990D                                          104   1e-20    
ref|XP_010052902.1|  PREDICTED: serine/threonine-protein kinase HT1     104   1e-20    
ref|XP_004362345.1|  leucine-rich repeat-containing protein             107   1e-20    
ref|XP_008811862.1|  PREDICTED: serine/threonine-protein kinase H...    106   2e-20    
emb|CDP17984.1|  unnamed protein product                                103   2e-20    
ref|XP_009120403.1|  PREDICTED: serine/threonine-protein kinase HT1     105   2e-20    
ref|XP_008811883.1|  PREDICTED: receptor-like protein kinase ANXU...    106   2e-20    
ref|XP_010676343.1|  PREDICTED: serine/threonine-protein kinase HT1     104   2e-20    
ref|XP_001320204.1|  TKL family protein kinase                          107   2e-20    Trichomonas vaginalis G3
ref|XP_008811875.1|  PREDICTED: serine/threonine-protein kinase H...    106   2e-20    
ref|XP_008811868.1|  PREDICTED: serine/threonine-protein kinase H...    106   2e-20    
ref|XP_001755417.1|  predicted protein                                  107   2e-20    
ref|XP_008227501.1|  PREDICTED: serine/threonine-protein kinase HT1     103   2e-20    
ref|XP_001777756.1|  predicted protein                                  100   2e-20    
emb|CDX80321.1|  BnaC09g34210D                                          105   2e-20    
emb|CDY69707.1|  BnaAnng31270D                                          105   2e-20    
gb|AGA37259.1|  mitogen-activated protein kinase kinase kinase Ra...    104   2e-20    
gb|ABK06446.1|  flag-tagged protein kinase domain of putative mit...    103   2e-20    
ref|XP_002518405.1|  protein with unknown function                      103   2e-20    Ricinus communis
ref|XP_006352377.1|  PREDICTED: serine/threonine-protein kinase H...    103   2e-20    
ref|XP_010243015.1|  PREDICTED: serine/threonine-protein kinase H...    103   2e-20    
ref|XP_009355185.1|  PREDICTED: serine/threonine-protein kinase H...    103   2e-20    
emb|CDP12396.1|  unnamed protein product                                102   2e-20    
ref|XP_001755370.1|  predicted protein                                  106   2e-20    
ref|XP_006364514.1|  PREDICTED: serine/threonine-protein kinase C...    105   2e-20    
emb|CDY32673.1|  BnaA02g07350D                                          104   3e-20    
ref|XP_002866305.1|  kinase family protein                              105   3e-20    
ref|XP_003630047.1|  Protein kinase                                     103   3e-20    
ref|XP_008782450.1|  PREDICTED: serine/threonine-protein kinase H...    103   3e-20    
emb|CDY32674.1|  BnaA02g07360D                                          104   3e-20    
emb|CDY33786.1|  BnaA09g45920D                                          103   3e-20    
gb|AAL58946.1|AF462860_1  AT5g58950/k19m22_150                          104   3e-20    
ref|XP_001785719.1|  predicted protein                                  106   3e-20    
gb|KDO69682.1|  hypothetical protein CISIN_1g017994mg                   102   3e-20    
gb|ABK06431.1|  flag-tagged protein kinase domain of putative mit...    103   3e-20    
ref|XP_009126724.1|  PREDICTED: serine/threonine-protein kinase H...    104   4e-20    
ref|XP_001758175.1|  predicted protein                                  105   4e-20    
ref|XP_002316594.2|  hypothetical protein POPTR_0011s00780g             102   4e-20    
ref|XP_006307549.1|  hypothetical protein CARUB_v10009171mg             103   4e-20    
ref|XP_009588109.1|  PREDICTED: serine/threonine-protein kinase H...    104   4e-20    
ref|XP_003290422.1|  roco8, ROCO family protein                         106   4e-20    
ref|XP_011014814.1|  PREDICTED: serine/threonine-protein kinase H...    102   4e-20    
emb|CDX88676.1|  BnaA03g09730D                                          103   4e-20    
ref|XP_006439808.1|  hypothetical protein CICLE_v10020764mg             102   4e-20    
ref|NP_190277.1|  protein kinase family protein                         103   4e-20    
ref|XP_009588108.1|  PREDICTED: serine/threonine-protein kinase E...    104   5e-20    
emb|CDX71145.1|  BnaC03g12290D                                          103   5e-20    
ref|XP_008374443.1|  PREDICTED: serine/threonine-protein kinase H...    102   5e-20    
gb|AAL77660.1|  At1g14000/F7A19_9                                       103   5e-20    
emb|CDY36424.1|  BnaC05g10250D                                          103   5e-20    
ref|XP_011000655.1|  PREDICTED: serine/threonine-protein kinase H...    102   5e-20    
ref|XP_010476433.1|  PREDICTED: serine/threonine-protein kinase T...    103   5e-20    
ref|NP_568893.1|  protein kinase family protein                         104   5e-20    
ref|XP_006383831.1|  hypothetical protein POPTR_0004s00360g             102   5e-20    
ref|XP_003534727.1|  PREDICTED: serine/threonine-protein kinase H...    102   5e-20    
gb|AAF79405.1|AC068197_15  F16A14.22                                    103   5e-20    
ref|XP_008653068.1|  PREDICTED: tyrosine-protein kinase TXK-like ...    104   5e-20    
ref|XP_009117948.1|  PREDICTED: probable serine/threonine-protein...    103   5e-20    
ref|XP_008653067.1|  PREDICTED: tyrosine-protein kinase TXK-like ...    104   5e-20    
ref|XP_010458870.1|  PREDICTED: probable serine/threonine-protein...    103   5e-20    
ref|NP_172853.1|  VH1-interacting kinase                                103   5e-20    
ref|XP_007138085.1|  hypothetical protein PHAVU_009G179100g             102   5e-20    
emb|CDX98142.1|  BnaA06g08930D                                          103   5e-20    
ref|XP_009132020.1|  PREDICTED: serine/threonine-protein kinase H...    103   5e-20    
ref|XP_009596827.1|  PREDICTED: serine/threonine-protein kinase H...    102   5e-20    
emb|CDY02848.1|  BnaC02g10410D                                          103   6e-20    
ref|XP_006598654.1|  PREDICTED: serine/threonine-protein kinase H...    102   6e-20    
ref|XP_007213545.1|  hypothetical protein PRUPE_ppa018711mg             102   6e-20    
ref|XP_011047021.1|  PREDICTED: serine/threonine-protein kinase H...    102   6e-20    
ref|XP_002890035.1|  kinase family protein                              103   6e-20    
ref|XP_010495703.1|  PREDICTED: serine/threonine-protein kinase T...    103   6e-20    
gb|AGA37228.1|  mitogen-activated protein kinase kinase kinase Ra...    103   6e-20    
ref|XP_007041723.1|  ACT-like protein tyrosine kinase family prot...    104   6e-20    
gb|AGA37222.1|  mitogen-activated protein kinase kinase kinase Ra...    102   6e-20    
ref|XP_009363031.1|  PREDICTED: serine/threonine-protein kinase H...    102   6e-20    
ref|XP_003532870.1|  PREDICTED: serine/threonine-protein kinase H...    101   8e-20    
ref|XP_007046003.1|  VH1-interacting kinase                             102   8e-20    
ref|XP_007036199.1|  Serine/threonine-protein kinase HT1                101   9e-20    
dbj|BAJ93913.1|  predicted protein                                      102   9e-20    
ref|XP_004293345.1|  PREDICTED: serine/threonine-protein kinase H...    101   9e-20    
gb|KFK43645.1|  hypothetical protein AALP_AA1G154100                    102   9e-20    
ref|XP_010527937.1|  PREDICTED: serine/threonine-protein kinase H...    102   9e-20    
ref|XP_004250248.2|  PREDICTED: serine/threonine-protein kinase H...    101   9e-20    
ref|XP_009357527.1|  PREDICTED: serine/threonine-protein kinase H...    101   9e-20    
ref|XP_001580820.1|  TKL family protein kinase                          105   9e-20    
ref|XP_009802640.1|  PREDICTED: serine/threonine-protein kinase H...    103   9e-20    
ref|XP_006476769.1|  PREDICTED: serine/threonine-protein kinase H...    101   9e-20    
ref|XP_001758081.1|  predicted protein                                98.2    9e-20    
gb|EFA77775.1|  leucine-rich repeat-containing protein                  105   1e-19    
gb|KDO69681.1|  hypothetical protein CISIN_1g017994mg                   101   1e-19    
gb|KDO69683.1|  hypothetical protein CISIN_1g017994mg                 99.8    1e-19    
ref|XP_009802639.1|  PREDICTED: serine/threonine-protein kinase E...    103   1e-19    
ref|XP_009404093.1|  PREDICTED: serine/threonine-protein kinase T...    102   1e-19    
ref|XP_009768190.1|  PREDICTED: serine/threonine-protein kinase H...    101   1e-19    
gb|KEH31058.1|  tyrosine kinase family protein                          101   1e-19    
gb|ACG43022.1|  ATP binding protein                                     103   1e-19    
gb|KEH31056.1|  tyrosine kinase family protein                          101   1e-19    
ref|XP_006598655.1|  PREDICTED: serine/threonine-protein kinase H...    100   1e-19    
gb|ETO29225.1|  Kelch repeat-containing protein                         101   1e-19    
ref|XP_006345054.1|  PREDICTED: serine/threonine-protein kinase H...    101   1e-19    
ref|XP_008358762.1|  PREDICTED: serine/threonine-protein kinase H...    101   1e-19    
ref|XP_002460599.1|  hypothetical protein SORBIDRAFT_02g031600          103   1e-19    
gb|KDQ19169.1|  hypothetical protein BOTBODRAFT_103444                99.0    1e-19    
ref|XP_010533473.1|  PREDICTED: serine/threonine-protein kinase H...    100   1e-19    
ref|XP_010443644.1|  PREDICTED: serine/threonine-protein kinase H...    103   1e-19    
ref|XP_003547275.1|  PREDICTED: serine/threonine-protein kinase H...    101   1e-19    
ref|XP_010454531.1|  PREDICTED: serine/threonine-protein kinase H...    102   1e-19    
ref|XP_010483508.1|  PREDICTED: serine/threonine-protein kinase H...    102   1e-19    
gb|KHN32979.1|  Serine/threonine-protein kinase HT1                     100   1e-19    
ref|XP_006827333.1|  hypothetical protein AMTR_s00010p00267960          102   1e-19    
emb|CDX86103.1|  BnaC03g56180D                                          102   2e-19    
ref|XP_001773113.1|  predicted protein                                  103   2e-19    
ref|XP_009827806.1|  TKL protein kinase                                 103   2e-19    
ref|XP_002453200.1|  hypothetical protein SORBIDRAFT_04g001590          103   2e-19    
ref|XP_001583531.1|  TKL family protein kinase                          103   2e-19    
ref|XP_008371029.1|  PREDICTED: serine/threonine-protein kinase HT1     100   2e-19    
ref|XP_006401021.1|  hypothetical protein EUTSA_v10013257mg             102   2e-19    
ref|NP_001050317.2|  Os03g0401100                                     99.0    2e-19    
dbj|BAD38895.1|  disease resistance-like protein                        103   2e-19    
gb|EYU42008.1|  hypothetical protein MIMGU_mgv1a008582mg                100   2e-19    
gb|KDO83018.1|  hypothetical protein CISIN_1g013833mg                   100   2e-19    
ref|XP_006417067.1|  hypothetical protein EUTSA_v10007646mg             101   2e-19    
dbj|GAM23214.1|  hypothetical protein SAMD00019534_063890               103   2e-19    
ref|XP_006473731.1|  PREDICTED: probable serine/threonine-protein...    101   2e-19    
emb|CDX99086.1|  BnaA06g17770D                                          101   2e-19    
ref|XP_004333042.1|  Dual specificity protein kinase                    103   3e-19    
ref|XP_006280285.1|  hypothetical protein CARUB_v10026210mg             102   3e-19    
ref|XP_011046628.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    102   3e-19    
ref|XP_006438747.1|  hypothetical protein CICLE_v10031585mg             100   3e-19    
dbj|GAM18507.1|  hypothetical protein SAMD00019534_016820               103   3e-19    
ref|XP_011014812.1|  PREDICTED: serine/threonine-protein kinase E...    102   3e-19    
gb|EYU37994.1|  hypothetical protein MIMGU_mgv1a003777mg                100   3e-19    
ref|XP_009413468.1|  PREDICTED: probable tyrosine-protein kinase ...    100   3e-19    
ref|XP_011014813.1|  PREDICTED: serine/threonine-protein kinase T...    102   3e-19    
ref|XP_009149952.1|  PREDICTED: serine/threonine-protein kinase HT1     101   3e-19    
ref|XP_010678756.1|  PREDICTED: serine/threonine-protein kinase H...  99.8    3e-19    
ref|XP_003288062.1|  hypothetical protein DICPUDRAFT_33484              103   3e-19    
ref|XP_010917104.1|  PREDICTED: serine/threonine-protein kinase T...    100   3e-19    
gb|EMS49920.1|  Dual specificity protein kinase pyk1                    100   4e-19    
gb|AFC37605.1|  serine threonine protein kinase                         101   4e-19    
ref|XP_006435271.1|  hypothetical protein CICLE_v10000919mg             101   4e-19    
ref|XP_009148681.1|  PREDICTED: serine/threonine-protein kinase T...    100   4e-19    
gb|EYU40458.1|  hypothetical protein MIMGU_mgv1a003866mg                101   4e-19    
ref|XP_004957523.1|  PREDICTED: kinase suppressor of Ras 1-like         102   4e-19    
emb|CBK25503.2|  unnamed protein product                              99.0    4e-19    
gb|KDO84978.1|  hypothetical protein CISIN_1g010091mg                   101   4e-19    
ref|XP_011092952.1|  PREDICTED: serine/threonine-protein kinase H...    101   4e-19    
ref|XP_010664108.1|  PREDICTED: serine/threonine-protein kinase T...    101   4e-19    
ref|XP_004360363.1|  RGS domain-containing protein                      102   5e-19    
gb|KHN49037.1|  Serine/threonine-protein kinase HT1                     102   5e-19    
emb|CBI18907.3|  unnamed protein product                                101   5e-19    
gb|KHG29816.1|  Dual specificity protein kinase splA                    100   5e-19    
ref|XP_006473729.1|  PREDICTED: probable serine/threonine-protein...    101   5e-19    
ref|XP_006384592.1|  hypothetical protein POPTR_0004s18590g             101   5e-19    
gb|KEH30795.1|  dual specificity kinase splA-like protein               100   5e-19    
ref|XP_002986767.1|  hypothetical protein SELMODRAFT_43546            98.6    5e-19    
ref|XP_010251265.1|  PREDICTED: serine/threonine-protein kinase H...  99.4    5e-19    
gb|KCW79017.1|  hypothetical protein EUGRSUZ_C00439                     102   5e-19    
ref|XP_004516570.1|  PREDICTED: dual specificity protein kinase s...    100   5e-19    
ref|XP_006473728.1|  PREDICTED: probable serine/threonine-protein...    101   5e-19    
gb|EFA81810.1|  leucine-rich repeat-containing protein                  102   5e-19    
ref|XP_009794338.1|  PREDICTED: serine/threonine-protein kinase HT1     100   5e-19    
ref|XP_008806079.1|  PREDICTED: serine/threonine-protein kinase HT1   99.8    5e-19    
ref|XP_004340534.1|  Serine/threonine protein kinase                    102   5e-19    
ref|XP_010426149.1|  PREDICTED: serine/threonine-protein kinase H...    100   5e-19    
ref|XP_010943229.1|  PREDICTED: serine/threonine-protein kinase HT1   99.4    5e-19    
ref|XP_006473727.1|  PREDICTED: probable serine/threonine-protein...    101   5e-19    
ref|XP_010235132.1|  PREDICTED: serine/threonine-protein kinase HT1     100   5e-19    
gb|EMT10098.1|  Dual specificity protein kinase pyk1                    100   6e-19    
ref|XP_004152474.1|  PREDICTED: serine/threonine-protein kinase H...  99.4    6e-19    
ref|XP_001780123.1|  predicted protein                                  102   6e-19    
ref|XP_010523476.1|  PREDICTED: dual specificity protein kinase shkB    100   6e-19    
ref|XP_010664107.1|  PREDICTED: serine/threonine-protein kinase T...    101   6e-19    
ref|XP_010538798.1|  PREDICTED: RAF proto-oncogene serine/threoni...    101   6e-19    
ref|XP_001777770.1|  predicted protein                                95.9    6e-19    
ref|XP_001580941.1|  TKL family protein kinase                          102   6e-19    
ref|XP_006828865.1|  hypothetical protein AMTR_s00001p00169860          101   6e-19    
ref|XP_002969519.1|  hypothetical protein SELMODRAFT_63609            98.2    7e-19    
gb|AAL48491.1|  HL03036p                                                101   7e-19    
ref|XP_011071844.1|  PREDICTED: serine/threonine-protein kinase H...  99.0    7e-19    
ref|XP_004169709.1|  PREDICTED: serine/threonine-protein kinase H...  98.2    7e-19    
ref|XP_006653907.1|  PREDICTED: probable serine/threonine-protein...    100   7e-19    
ref|XP_002306203.2|  hypothetical protein POPTR_0004s18550g             100   7e-19    
ref|NP_001168730.1|  uncharacterized LOC100382522                       100   8e-19    
ref|XP_009594090.1|  PREDICTED: serine/threonine-protein kinase HT1   99.8    8e-19    
ref|NP_001063830.1|  Os09g0544300                                       100   8e-19    
ref|XP_010538796.1|  PREDICTED: RGS domain-containing serine/thre...    101   8e-19    
ref|XP_001761405.1|  predicted protein                                95.5    8e-19    
ref|XP_004333203.1|  protein kinase domain containing protein           102   9e-19    
ref|XP_007157711.1|  hypothetical protein PHAVU_002G091900g           99.4    9e-19    
ref|XP_010047192.1|  PREDICTED: uncharacterized protein LOC104436154    101   9e-19    
ref|XP_010503308.1|  PREDICTED: serine/threonine-protein kinase H...    100   9e-19    
ref|XP_006829524.1|  hypothetical protein AMTR_s00074p00148190        99.0    9e-19    
gb|EEE70151.1|  hypothetical protein OsJ_30202                          100   1e-18    
gb|EYU37995.1|  hypothetical protein MIMGU_mgv1a003777mg                100   1e-18    
ref|XP_010515017.1|  PREDICTED: serine/threonine-protein kinase H...  98.6    1e-18    
ref|XP_002883550.1|  kinase family protein                              100   1e-18    
ref|XP_003578561.1|  PREDICTED: serine/threonine-protein kinase EDR1    100   1e-18    
ref|XP_006648244.1|  PREDICTED: RGS domain-containing serine/thre...    100   1e-18    
ref|XP_009764771.1|  PREDICTED: serine/threonine-protein kinase H...    100   1e-18    
emb|CDP00370.1|  unnamed protein product                              99.4    1e-18    
gb|AAA62441.1|  tyrosine kinase                                         101   1e-18    
ref|NP_511119.2|  hopscotch                                             101   1e-18    
gb|EEE56194.1|  hypothetical protein OsJ_05153                        99.8    1e-18    
ref|XP_006660922.1|  PREDICTED: serine/threonine-protein kinase H...    100   1e-18    
ref|XP_007149071.1|  hypothetical protein PHAVU_005G038600g           97.8    1e-18    
gb|ACL83837.1|  hop-PA                                                  101   1e-18    
ref|XP_011075534.1|  PREDICTED: serine/threonine-protein kinase H...  99.0    1e-18    
ref|XP_009397691.1|  PREDICTED: serine/threonine-protein kinase H...  98.6    1e-18    
ref|XP_004239105.1|  PREDICTED: serine/threonine-protein kinase HT1   99.0    1e-18    
ref|XP_008861977.1|  TKL/DRK protein kinase                             101   1e-18    
gb|KCW86563.1|  hypothetical protein EUGRSUZ_B03199                   97.8    1e-18    
gb|EPS61404.1|  hypothetical protein M569_13392                       97.8    1e-18    
ref|XP_009356336.1|  PREDICTED: serine/threonine-protein kinase HT1   99.0    1e-18    
ref|XP_002962713.1|  hypothetical protein SELMODRAFT_78499            95.5    1e-18    
ref|XP_001773049.1|  predicted protein                                  100   1e-18    
emb|CBK23550.2|  unnamed protein product                                100   1e-18    
ref|XP_008382083.1|  PREDICTED: dual specificity protein kinase zakA    100   1e-18    
ref|XP_008781231.1|  PREDICTED: serine/threonine-protein kinase H...    100   2e-18    
ref|XP_640564.1|  leucine-rich repeat-containing protein                101   2e-18    
ref|NP_001266007.1|  Hop-interacting protein THI135                   99.8    2e-18    
ref|XP_008781230.1|  PREDICTED: serine/threonine-protein kinase H...    100   2e-18    
ref|XP_008809573.1|  PREDICTED: serine/threonine-protein kinase T...  99.0    2e-18    
ref|XP_002100874.1|  GE17301                                            100   2e-18    
ref|XP_010101206.1|  Serine/threonine-protein kinase HT1              97.8    2e-18    
ref|NP_001045706.1|  Os02g0120100                                     99.8    2e-18    
ref|XP_003517809.1|  PREDICTED: dual specificity protein kinase s...  98.6    2e-18    
dbj|GAM23578.1|  hypothetical protein SAMD00019534_067530               100   2e-18    
ref|XP_009347900.1|  PREDICTED: probable serine/threonine-protein...  99.8    2e-18    
ref|XP_006290934.1|  hypothetical protein CARUB_v10017047mg           99.4    2e-18    
ref|XP_010233723.1|  PREDICTED: serine/threonine-protein kinase E...  99.8    2e-18    
ref|XP_009387398.1|  PREDICTED: serine/threonine-protein kinase HT1   97.4    2e-18    
ref|XP_004963118.1|  PREDICTED: serine/threonine-protein kinase H...  97.4    2e-18    
ref|XP_010044474.1|  PREDICTED: LOW QUALITY PROTEIN: dual specifi...  98.6    2e-18    
ref|XP_010647137.1|  PREDICTED: serine/threonine-protein kinase H...  95.5    2e-18    
ref|XP_010941373.1|  PREDICTED: serine/threonine-protein kinase H...  99.8    2e-18    
ref|XP_010941372.1|  PREDICTED: serine/threonine-protein kinase H...  99.8    2e-18    
ref|XP_010037566.1|  PREDICTED: serine/threonine-protein kinase H...  97.4    2e-18    
ref|XP_010646466.1|  PREDICTED: probable serine/threonine-protein...  99.4    2e-18    
ref|YP_003406869.1|  serine/threonine protein kinase                    100   2e-18    
gb|EYU28799.1|  hypothetical protein MIMGU_mgv1a006706mg              98.2    2e-18    
gb|KDP26301.1|  hypothetical protein JCGZ_22286                       99.4    2e-18    



>ref|XP_009763312.1| PREDICTED: serine/threonine-protein kinase GIN4 [Nicotiana sylvestris]
 ref|XP_009763313.1| PREDICTED: serine/threonine-protein kinase GIN4 [Nicotiana sylvestris]
Length=968

 Score =   503 bits (1296),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 323/712 (45%), Positives = 410/712 (58%), Gaps = 108/712 (15%)
 Frame = +3

Query  3     FALRTFYGE-IGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIK  179
             FALR F+GE I  L  EI+ V+SLSHPN+LQYHCGFYDEERKEG+LVMELM+KSL  +IK
Sbjct  261   FALRNFFGELIEPLVDEISLVLSLSHPNILQYHCGFYDEERKEGYLVMELMNKSLATYIK  320

Query  180   ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
             E+SGQRKR  F IPVAVD+MLQIARGMEYLHSR I+HGELNPSN+LL+P +S  E+YFH+
Sbjct  321   EHSGQRKRGPFPIPVAVDIMLQIARGMEYLHSRKIYHGELNPSNVLLKPRNSSAESYFHA  380

Query  360   KVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVY  539
             KV GFGL+ +KS Y   N    S   D  IW+APEVLAEQE  +  SK   K++EKADVY
Sbjct  381   KVKGFGLTSIKSNYKAAN----SNAADSFIWHAPEVLAEQE--KSESKCTYKYTEKADVY  434

Query  540   SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
             S+GM+CFQ+LTGKAPF+E    LQG+KM  ++  GERPLFPYP PKYL NL RKCW T+P
Sbjct  435   SYGMVCFQLLTGKAPFDEH---LQGEKMARNIRTGERPLFPYPSPKYLANLTRKCWQTNP  491

Query  720   NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDN---VPPG  890
             N RP FSS+CRIL YIKKVLVINPEHG P+CPPPLVDYC+IEA Y KKFPG++   + P 
Sbjct  492   NLRPSFSSLCRILHYIKKVLVINPEHGQPECPPPLVDYCEIEASYSKKFPGEDSTSLAP-  550

Query  891   VSEIPFQMFAYKLVEKEKTLGND----------GFAVR------ARDDHLVSMDDLCLVP  1022
             VS+IPFQMFAY+LVEKEK  GN           GF+ R      + D+H+ ++DDL   P
Sbjct  551   VSQIPFQMFAYRLVEKEKISGNSKEKHWDSSHYGFSGRRTASMQSDDEHMATIDDLFFAP  610

Query  1023  NNGTRGRLSTCSEIIDRNDLGTFADQRSAISE-----ILQPKlllsdnildlsdnllnTA  1187
             ++    R S CSEII+R D   F DQRS ISE     +     +   +       L+  A
Sbjct  611   SD----RRSVCSEIIERKD-SRFLDQRSVISETPLRKVFSFDQMSICSESPGEKFLMAVA  665

Query  1188  DESPAFVDTPEWKLLSELPPDHQTSPHVETPGnknlsststskklslE------------  1331
             +E   F D PE K +   P   Q SP  +T     LS     K   LE            
Sbjct  666   NEKTIFADIPERKAIL-TPSGDQCSPRTDTSERTILSMRKNQKLKFLENQENAMSPKTGD  724

Query  1332  -RVASKPKVQPRIVSCDSAEKK-----QKQISSEATGKKDSSEPEStr-----kkllrtm  1478
              +++S    + ++ S   +EKK     Q   SSE   K+ +S  +        ++   + 
Sbjct  725   RKLSSSVAAEQKLASPGISEKKNSSGDQISTSSEIQEKEHTSVDQKLMISAIPEEKNSSD  784

Query  1479  ktkfrltkIPEKKTLSAANSQ-------------SSNSPESPHKAAIT------------  1583
               + +  +IPEKK  S AN +                 P++P K  ++            
Sbjct  785   DQELKCNEIPEKKQSSTANVKPVRGDSTQRKTLSRRTKPKNPEKKVLSSPEANQSSMSSE  844

Query  1584  ------LKPTKPKLSFKNAIFHPNFKGEQSSKEHGKNKYKSPGASPARLMTRSNSMGLHA  1745
                    KP   K+S K A  H   +  +SS    K    SP +SPAR+           
Sbjct  845   NSETTASKPRNSKVSVKKATLHKKLQDRESSTAPEKLMDSSPRSSPARVKKIQ-------  897

Query  1746  SSSISSPMHPMKLSSPARVTPSTRALKTA---SSPFSSPMHPLKLSSPARVT  1892
             SS++SSP    K SS  R +P+  +        SP +SP++P   S  ARV 
Sbjct  898   SSTMSSPTQTPKTSSFPR-SPAITSNGNGYGYQSPSASPLNP--CSRCARVN  946



>ref|XP_009768987.1| PREDICTED: uncharacterized protein LOC104219917 [Nicotiana sylvestris]
Length=907

 Score =   498 bits (1282),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 262/445 (59%), Positives = 314/445 (71%), Gaps = 36/445 (8%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FALR F+G++  L  EI+ V SLSHPN+LQYHCGFYDEERKEG+LVMELM+ +L  +IKE
Sbjct  264   FALRNFFGDVEPLHAEISLVFSLSHPNILQYHCGFYDEERKEGYLVMELMNDTLATYIKE  323

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             +SGQRKR  FS   AVD+MLQIARGMEYLH+R I+HGELNPS++LL+  +S  E+YFH+K
Sbjct  324   HSGQRKRPPFSTSAAVDIMLQIARGMEYLHARKIYHGELNPSHVLLKARNSSAESYFHAK  383

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             + GFGL+ +K  Y   N        D +IWYAPEVLAE E+P   +K   K++EKADVYS
Sbjct  384   LKGFGLTSIKITYKTVN----HNAADSIIWYAPEVLAEHEKP--GTKCTYKYTEKADVYS  437

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CFQILTGK PF+EG   LQG+K+V ++ AGERPLFPYP PKYL NL R+CWHT+PN
Sbjct  438   FGMICFQILTGKVPFDEGH--LQGEKVVRNIRAGERPLFPYPSPKYLVNLTRRCWHTNPN  495

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDN---VPPGV  893
              RP FSS+CRIL YIKKVLVINPEHG P+  PPLVDYCDIE GY KKFP      + P V
Sbjct  496   LRPRFSSLCRILHYIKKVLVINPEHGQPETAPPLVDYCDIEGGYSKKFPEYESMCLTP-V  554

Query  894   SEIPFQMFAYKLVEKEKTLG------NDGFAVRAR------DDHLVSMDDLCLVPNNGTR  1037
             S+IPFQMFAY+L+EKEK  G      NDGF+V  R      D HL +MDDL L P++G  
Sbjct  555   SQIPFQMFAYRLIEKEKISGKNWDSSNDGFSVHRRASMLSDDGHLAAMDDLFLAPSDGR-  613

Query  1038  GRLSTCSEIIDRNDLGTFADQRSAISEILQPKlllsdnildlsdn-----llnTADESPA  1202
                S CSEIIDR D   F DQRSAISEI   KL L D     S++         ADE   
Sbjct  614   ---SVCSEIIDRKDSRLF-DQRSAISEIPHRKLFLFDQASVGSESPDRRFSSVAADEKFF  669

Query  1203  FVDTPEWKLLSELPPDHQTSPHVET  1277
             F D+P+ K+LS   P    SP ++T
Sbjct  670   FADSPDRKVLS--TPVVDRSPRIDT  692



>ref|XP_009598286.1| PREDICTED: uncharacterized protein LOC104094126 [Nicotiana tomentosiformis]
 ref|XP_009598287.1| PREDICTED: uncharacterized protein LOC104094126 [Nicotiana tomentosiformis]
 ref|XP_009598288.1| PREDICTED: uncharacterized protein LOC104094126 [Nicotiana tomentosiformis]
Length=968

 Score =   499 bits (1286),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 308/676 (46%), Positives = 391/676 (58%), Gaps = 104/676 (15%)
 Frame = +3

Query  3     FALRTFYGE-IGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIK  179
             FALR F+GE I  L  EI+ V+SLSHPN+LQYHCGFYDEERKEG+LVMELM+KSL  +IK
Sbjct  261   FALRNFFGELIEPLVDEISVVLSLSHPNILQYHCGFYDEERKEGYLVMELMNKSLATYIK  320

Query  180   ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
             E+SGQRKR  F IP+AVD+MLQIARGMEYLHSR I+HGELNPSN+ L+P +S  ++YFH+
Sbjct  321   EHSGQRKRGPFPIPIAVDIMLQIARGMEYLHSRKIYHGELNPSNVFLKPRNSSADSYFHA  380

Query  360   KVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVY  539
             KV GFGL+ +KS Y   N    S   D  IWYAPE+LAEQE  +  SK   K++EKADVY
Sbjct  381   KVKGFGLASIKSNYKAAN----SNAADSFIWYAPEILAEQE--KSESKCTYKYTEKADVY  434

Query  540   SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
             S+GM+CFQ+LTGKAPF+E    LQG+KM  ++  GERPLFPYP PKYL NL RKCW T+P
Sbjct  435   SYGMVCFQLLTGKAPFDEH---LQGEKMARNIRTGERPLFPYPSPKYLANLTRKCWQTNP  491

Query  720   NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDN---VPPG  890
             N RP FSS+CRIL YIKKVLVINPEHG P+CPPPLVDYC+IE  Y KKFPG++   + P 
Sbjct  492   NLRPSFSSLCRILHYIKKVLVINPEHGQPECPPPLVDYCEIEVAYSKKFPGEDSISLAP-  550

Query  891   VSEIPFQMFAYKLVEKEKTLGND----------GF------AVRARDDHLVSMDDLCLVP  1022
             VS+IPFQMFAY+LVEKE+  GN           GF      ++++ D+H+ ++DDL   P
Sbjct  551   VSQIPFQMFAYRLVEKERISGNSKEKHWDSSHYGFSGHRTASMQSDDEHMAAIDDLFFAP  610

Query  1023  NNGTRGRLSTCSEIIDRNDLGTFADQRSAISE-----ILQPKlllsdnildlsdnllnTA  1187
             ++    R S CSEII+R D   F DQRS ISE     +     +   +        +  A
Sbjct  611   SD----RRSVCSEIIERKD-SRFLDQRSVISETPLRKVFSFDQMSLCSESPGEKFPMAVA  665

Query  1188  DESPAFVDTPEWKLLSELPPDHQTSPHVETPGnknlsststskklslERV--ASKPKVQP  1361
             +E   F D PE + +     D Q SP ++TP     S     K   LE    A  PK   
Sbjct  666   NEKTIFADIPEREAILTQSGD-QRSPRIDTPERTISSMRKNQKLKFLENQENAMSPKTGE  724

Query  1362  RIVSCDSAEKKQKQISSEATGKKDSS---------------EPEStr-------kkllrt  1475
             R +S  S   +QK  S   + KK+SS                P+  +       ++   +
Sbjct  725   RKLS-SSVAAEQKLASPGISEKKNSSGDKILTSSEIQEKKLAPDDQKLVSCAIPEEKNSS  783

Query  1476  mktkfrltkIPEKKTLSAANSQ-------------SSNSPESPHKAAIT-----------  1583
                +    +IPEKK LS AN +                 P++P K  ++           
Sbjct  784   DNQELGCNEIPEKKQLSTANVKPVRGDSAQRKTLSRRTKPKNPEKKVLSSPEANQSSMSS  843

Query  1584  -------LKPTKPKLSFKNAIFHPNFKGEQSSKEHGKNKYKSPGASPARLMTRSNSMGLH  1742
                     KP   K+S K A  H   + ++SS    K    SP +SPAR           
Sbjct  844   ENSETTASKPINSKVSAKKATLHKKLQDKESSTAPEKLTDSSPRSSPARFKRIQ------  897

Query  1743  ASSSISSPMHPMKLSS  1790
              SS++SSP    K SS
Sbjct  898   -SSTMSSPTQTPKTSS  912



>ref|XP_004244627.1| PREDICTED: serine/threonine-protein kinase MARK1 [Solanum lycopersicum]
Length=1044

 Score =   496 bits (1276),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 252/430 (59%), Positives = 308/430 (72%), Gaps = 37/430 (9%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FALR F+GE+  L  EI+ V SLSHPN+LQYHCGFYDEERKEG+LVMELM+ +L  +IK+
Sbjct  260   FALRNFFGEVEPLHDEISLVFSLSHPNILQYHCGFYDEERKEGYLVMELMNDTLTTYIKD  319

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             +SGQRKR  FS   AVD+MLQIA+GMEYLHS+ I+HGELNPS++LLR  +S  E+YFH+K
Sbjct  320   HSGQRKRPPFSTSAAVDIMLQIAKGMEYLHSKKIYHGELNPSHVLLRARNSSAESYFHAK  379

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             + GFGL+ +KS Y       +    D VIW+APEVLAEQE+P   SK   K++E+ADVYS
Sbjct  380   LKGFGLTSIKSTYK----TASHNAADSVIWFAPEVLAEQEKP--GSKCAFKYTEQADVYS  433

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CFQILTGK PF+EG   LQG+K+V ++ AGERPLFPYP PKYL NL R+CWHT+PN
Sbjct  434   FGMICFQILTGKVPFDEGH--LQGEKVVRNIRAGERPLFPYPSPKYLVNLTRRCWHTNPN  491

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDN----VPPG  890
              RP FSS+CRILRYIKKVLVINPEHG P+  PPLVDYCDIEA Y KKF  +     +P  
Sbjct  492   LRPRFSSLCRILRYIKKVLVINPEHGQPETAPPLVDYCDIEASYSKKFAEEESTSLIP--  549

Query  891   VSEIPFQMFAYKLVEKEKTLGN------DGFAVRAR------DDHLVSMDDLCLVPNNGT  1034
             VS+IPFQMFAY+L+EKEK +G       DGF+V  R      D  L +MDDL L P++G 
Sbjct  550   VSQIPFQMFAYRLIEKEKIIGKNWDPSRDGFSVHRRASLLSDDGQLSAMDDLFLAPSDGR  609

Query  1035  RGRLSTCSEIIDRNDLGTFADQRSAISEI------LQPKlllsdnildlsdnllnTADES  1196
                 S CSEIIDR D   F DQRSAISEI      L  +  +     +   + + TADE+
Sbjct  610   ----SVCSEIIDRKD-SRFFDQRSAISEIPHRRLLLFDQTSVGSESPERRFSSVATADET  664

Query  1197  PAFVDTPEWK  1226
               F D+P+ K
Sbjct  665   LFFADSPDRK  674



>ref|XP_009620190.1| PREDICTED: uncharacterized protein LOC104112065 [Nicotiana tomentosiformis]
Length=1897

 Score =   509 bits (1311),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 261/445 (59%), Positives = 317/445 (71%), Gaps = 36/445 (8%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FALR F+G++  L  EI+ V SLSHPN+LQYHCGFYDEERKEG+LVMELM+ +L  +IKE
Sbjct  264   FALRNFFGDVEPLHSEISLVFSLSHPNILQYHCGFYDEERKEGYLVMELMNDTLATYIKE  323

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             +SGQRKR+ FS   AVD+MLQIARGMEY+H+R I+HGELNPS++LL+  +S  E+YFH+K
Sbjct  324   HSGQRKRLPFSTSAAVDIMLQIARGMEYMHARKIYHGELNPSHVLLKARNSSAESYFHAK  383

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             + GFGL+ +KS Y   N        D +IWYAPEVLAE E+P   +K  +K++EKADVYS
Sbjct  384   IKGFGLTSIKSTYKTVN----HSAADSIIWYAPEVLAENEKP--GTKCTSKYTEKADVYS  437

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CFQILTGK PF+EG   LQG+K+V ++ AGERPLFPYP PKYL NL R+CWHT+PN
Sbjct  438   FGMICFQILTGKVPFDEGH--LQGEKVVRNIRAGERPLFPYPSPKYLVNLTRRCWHTNPN  495

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDN---VPPGV  893
              RP FSS+CRIL YIKKVLVINPEHG P+  PPLVDYCDIE GY KKF  +    + P V
Sbjct  496   LRPRFSSLCRILHYIKKVLVINPEHGQPETAPPLVDYCDIEGGYSKKFSEEESTCLTP-V  554

Query  894   SEIPFQMFAYKLVEKEKTLG------NDGFAVRAR------DDHLVSMDDLCLVPNNGTR  1037
             S+IPFQMFAY+L+EKEK  G      NDGF+V  R      D HL +MDDL L P++G  
Sbjct  555   SQIPFQMFAYRLIEKEKISGKNWDSSNDGFSVHRRASILSDDGHLAAMDDLFLAPSDGR-  613

Query  1038  GRLSTCSEIIDRNDLGTFADQRSAISEILQPKlllsdnildlsdn-----llnTADESPA  1202
                S CSEIIDR D   F DQRSAISEI   KL L D     S++         ADE   
Sbjct  614   ---SVCSEIIDRKDSRLF-DQRSAISEIPHRKLYLFDQASVGSESPDRRFSSVAADEKFF  669

Query  1203  FVDTPEWKLLSELPPDHQTSPHVET  1277
             F D+P+ K+LS   P    SP ++T
Sbjct  670   FADSPDRKVLS--TPIVDRSPRIDT  692



>emb|CDP12123.1| unnamed protein product [Coffea canephora]
Length=938

 Score =   481 bits (1237),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 243/389 (62%), Positives = 292/389 (75%), Gaps = 29/389 (7%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FALRTF+GEI  L  EI+ V+SLSHPN+LQ+ C FYDEERKEGFLVMELM K+L  +IKE
Sbjct  263   FALRTFFGEIEPLHEEISLVLSLSHPNILQHLCAFYDEERKEGFLVMELMHKNLKNYIKE  322

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             N GQRKR+ FS+PVAVD+MLQIARG+EYLHSR I+HGELNPSNILLR   S  E+YF +K
Sbjct  323   NCGQRKRIPFSVPVAVDIMLQIARGLEYLHSRKIYHGELNPSNILLRARHSSTESYFQAK  382

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             ++GFGL+ +KS   F     +S  VDPVIWYAPEVLAEQEQP    K  AK+SEKADVYS
Sbjct  383   LTGFGLASIKS---FARSQHSS--VDPVIWYAPEVLAEQEQP--GKKGNAKYSEKADVYS  435

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGML F++LTGK PFE+    LQGDKMV ++ AGERPLFPYP PKYL+NL RKCWH +P 
Sbjct  436   FGMLFFELLTGKVPFEDSH--LQGDKMVRNIRAGERPLFPYPAPKYLSNLTRKCWHPNPF  493

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG--VS  896
              RP FSS+CRILRYIKK L+INPEHG P+ PPPLVDYCDIEA Y KKFPG+  P    V+
Sbjct  494   IRPSFSSICRILRYIKKDLIINPEHGQPESPPPLVDYCDIEAAYSKKFPGEESPDLSPVT  553

Query  897   EIPFQMFAYKLVEKEKT----------LGNDGFAVRAR----DDHLVSMDDLCLVPNNGT  1034
             +IPFQ+ AY+LV+KEK+          LG++    R      D+H+ ++DDL LVP++  
Sbjct  554   DIPFQLNAYRLVQKEKSCGSSKDKNCDLGSEELPQRPASIYGDEHVAAIDDLFLVPSD--  611

Query  1035  RGRLSTCSEIIDRNDLGTFADQRSAISEI  1121
               R S CSEII+  ++    D+RS ISEI
Sbjct  612   --RRSVCSEIIESKNIRAAYDERSVISEI  638



>ref|XP_010325368.1| PREDICTED: serine/threonine-protein kinase PLK4-like isoform 
X1 [Solanum lycopersicum]
Length=971

 Score =   469 bits (1207),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 306/705 (43%), Positives = 411/705 (58%), Gaps = 101/705 (14%)
 Frame = +3

Query  3     FALRTFYGE-IGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIK  179
             FALR F+GE I ++  EI+ V SLSHPN+LQYHCGFYDEE+KEG+LVMELM+KSL  +IK
Sbjct  264   FALRNFFGELIESVVAEISLVYSLSHPNILQYHCGFYDEEKKEGYLVMELMNKSLATYIK  323

Query  180   ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
             E+S QRK+  FSI VAVD+MLQIARGMEYLHSR I+HGELNPSN+LL+P +   E+YFH+
Sbjct  324   EHSCQRKKGPFSIQVAVDIMLQIARGMEYLHSRKIYHGELNPSNVLLKPRNPSAESYFHA  383

Query  360   KVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVY  539
             KV GFGL+ +KS Y   +        +  IWYAPE+L E+E+P   SK   K++EKADVY
Sbjct  384   KVKGFGLTSVKSSYKAAD----ENSAESFIWYAPEILTEKEKPE--SKCTYKYTEKADVY  437

Query  540   SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
             S+GM+CFQ+LTGKAPF+E    LQG+KM  ++  GERPLFP+P PKYL NL RKCW  +P
Sbjct  438   SYGMICFQLLTGKAPFDEH---LQGEKMAQNIRTGERPLFPHPSPKYLVNLTRKCWQMNP  494

Query  720   NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDN---VPPG  890
             + RP FSS+CRIL YIKKVLVINP HG P+CPPPLVDYC+IEAGY KKF G++   + P 
Sbjct  495   DLRPSFSSLCRILHYIKKVLVINPGHGQPECPPPLVDYCEIEAGYSKKFAGEDSTGLAP-  553

Query  891   VSEIPFQMFAYKLVEKEKTLGND----------------GFAVRARDDHLVSMDDLCLVP  1022
             VS+IPFQMFAY+LVEKE+  GN                   ++++ ++H+ +MDDL   P
Sbjct  554   VSQIPFQMFAYRLVEKERISGNSKDKHWDSSHYGHSSHRTASMQSDNEHMDAMDDLFFGP  613

Query  1023  NNGTRGRLSTCSEIIDRNDLGTFADQRSAISE-----ILQPKlllsdnildlsdnllnTA  1187
             ++    R S CSEII+      F DQR+ ISE     +   + L   +            
Sbjct  614   SD----RRSVCSEIIESKG-PRFWDQRTVISETPLRKVFSFEQLSVSSESPKEKIPAAAT  668

Query  1188  DESPAFVDTPEWKLLSELPPDHQTSPHVETPGnknlsststskklslERV----------  1337
             +E P + D  E K +  +P   Q+SPHV+T   K +SS   +KKL++  +          
Sbjct  669   NEKPIYDDILERKEIL-IPSGDQSSPHVDTTPRKAISSMRKNKKLNVMEIKENVMSSKTD  727

Query  1338  -----------------ASKPKVQPRIVSCDSAEKK------QKQISS---EATGKKDSS  1439
                              A K     +I++    +KK      QK ISS   E     D+ 
Sbjct  728   DRKPSSSEQKIVTPVISAKKNSSGDQIITHSEIQKKKHAPDGQKLISSATPEEKNSSDNQ  787

Query  1440  EPEStrkkllrtmktkfrltkI---PEKKTLSAANSQSSN-------SPESPHK---AAI  1580
             +P+ ++ +  +   T   +  I   P ++   +  ++S N       SPE+      + I
Sbjct  788   QPKDSQSQEKKQSSTAANVKNIRGDPTQRKAVSRRTESKNPEKKVLSSPEANQNSISSEI  847

Query  1581  TL-KPTKPKLSFKNAIFHPNFKGEQSSKEHGKNKYKSPGASPARLMTRSNSMGLHASSSI  1757
             T  KP+  K++ K A FH   + ++SS    K    SP +SPAR            SS++
Sbjct  848   TASKPSNSKVTAKKAPFHKKLQDKESSTTPEKLTDPSPRSSPARAKRIQ-------SSTM  900

Query  1758  SSPMHPMKLSSPARVTPSTRALKTASSPFSSPMHPLKLSSPARVT  1892
             SSP   +K SSP R    T       SP +SP++P   S  ARV+
Sbjct  901   SSPTRSLKGSSP-RSPAITTYGNGYQSPCASPLNP--CSRYARVS  942



>ref|XP_010325369.1| PREDICTED: serine/threonine-protein kinase PLK4-like isoform 
X2 [Solanum lycopersicum]
Length=967

 Score =   466 bits (1198),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 305/705 (43%), Positives = 410/705 (58%), Gaps = 105/705 (15%)
 Frame = +3

Query  3     FALRTFYGE-IGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIK  179
             FALR F+GE I ++  EI+ V SLSHPN+LQYHCGFYDEE+KEG+LVMELM+KSL  +IK
Sbjct  264   FALRNFFGELIESVVAEISLVYSLSHPNILQYHCGFYDEEKKEGYLVMELMNKSLATYIK  323

Query  180   ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
             E+S QRK+  FSI VAVD+MLQIARGMEYLHSR I+HGELNPSN+LL+P +   E+YFH+
Sbjct  324   EHSCQRKKGPFSIQVAVDIMLQIARGMEYLHSRKIYHGELNPSNVLLKPRNPSAESYFHA  383

Query  360   KVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVY  539
             KV GFGL+ +KS Y   +        +  IWYAPE+L E+E+P   SK   K++EKADVY
Sbjct  384   KVKGFGLTSVKSSYKAAD----ENSAESFIWYAPEILTEKEKPE--SKCTYKYTEKADVY  437

Query  540   SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
             S+GM+CFQ+LTGKAPF+E    LQG+KM  ++  GERPLFP+P PKYL NL RKCW  +P
Sbjct  438   SYGMICFQLLTGKAPFDEH---LQGEKMAQNIRTGERPLFPHPSPKYLVNLTRKCWQMNP  494

Query  720   NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDN---VPPG  890
             + RP FSS+CRIL YIKKVLVINP HG P+CPPPLVDYC+IEAGY KKF G++   + P 
Sbjct  495   DLRPSFSSLCRILHYIKKVLVINPGHGQPECPPPLVDYCEIEAGYSKKFAGEDSTGLAP-  553

Query  891   VSEIPFQMFAYKLVEKEKTLGND----------------GFAVRARDDHLVSMDDLCLVP  1022
             VS+IPFQMFAY+LVEKE+  GN                   ++++ ++H+ +MDDL   P
Sbjct  554   VSQIPFQMFAYRLVEKERISGNSKDKHWDSSHYGHSSHRTASMQSDNEHMDAMDDLFFGP  613

Query  1023  NNGTRGRLSTCSEIIDRNDLGTFADQRSAISE-----ILQPKlllsdnildlsdnllnTA  1187
             ++    R S CSEII+      F DQR+ ISE     +   + L   +            
Sbjct  614   SD----RRSVCSEIIESKG-PRFWDQRTVISETPLRKVFSFEQLSVSSESPKEKIPAAAT  668

Query  1188  DESPAFVDTPEWKLLSELPPDHQTSPHVETPGnknlsststskklslERV----------  1337
             +E P + D  E K +  +P   Q+SPHV+T   K +SS   +KKL++  +          
Sbjct  669   NEKPIYDDILERKEIL-IPSGDQSSPHVDTTPRKAISSMRKNKKLNVMEIKENVMSSKTD  727

Query  1338  -----------------ASKPKVQPRIVSCDSAEKK------QKQISS---EATGKKDSS  1439
                              A K     +I++    +KK      QK ISS   E     D+ 
Sbjct  728   DRKPSSSEQKIVTPVISAKKNSSGDQIITHSEIQKKKHAPDGQKLISSATPEEKNSSDNQ  787

Query  1440  EPEStrkkllrtmktkfrltkI---PEKKTLSAANSQSSN-------SPESPHK---AAI  1580
             +P+ ++ +  +   T   +  I   P ++   +  ++S N       SPE+      + I
Sbjct  788   QPKDSQSQEKKQSSTAANVKNIRGDPTQRKAVSRRTESKNPEKKVLSSPEANQNSISSEI  847

Query  1581  TL-KPTKPKLSFKNAIFHPNFKGEQSSKEHGKNKYKSPGASPARLMTRSNSMGLHASSSI  1757
             T  KP+  K++ K A FH   + ++SS         SP +SPAR            SS++
Sbjct  848   TASKPSNSKVTAKKAPFHKKLQDKESSTTPD----PSPRSSPARAKRIQ-------SSTM  896

Query  1758  SSPMHPMKLSSPARVTPSTRALKTASSPFSSPMHPLKLSSPARVT  1892
             SSP   +K SSP R    T       SP +SP++P   S  ARV+
Sbjct  897   SSPTRSLKGSSP-RSPAITTYGNGYQSPCASPLNP--CSRYARVS  938



>ref|XP_006343890.1| PREDICTED: serine/threonine-protein kinase dst1-like [Solanum 
tuberosum]
Length=971

 Score =   466 bits (1198),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 232/392 (59%), Positives = 288/392 (73%), Gaps = 35/392 (9%)
 Frame = +3

Query  3     FALRTFYGE-IGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIK  179
             FALR F+GE I  +  EI+ V SLSHPN+LQYHCGFYDEE+KEG+LVMELMSKSL  +IK
Sbjct  264   FALRNFFGELIEPVVAEISLVFSLSHPNILQYHCGFYDEEKKEGYLVMELMSKSLATYIK  323

Query  180   ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
             E+S QRK+  FS+ VAVD+MLQIARGMEYLHS  I+HGELNPSN+LL+P +   E+YFH+
Sbjct  324   EHSSQRKKGPFSVQVAVDIMLQIARGMEYLHSIKIYHGELNPSNVLLKPRNPSAESYFHA  383

Query  360   KVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVY  539
             KV GFGL  MKS Y   +        +  IWYAPE+L E+E+P   SK   K++EKADVY
Sbjct  384   KVKGFGLKSMKSSYKAAD----ENSAESFIWYAPEILTEKEKPE--SKCTYKYTEKADVY  437

Query  540   SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
             S+GM+CFQ+LTGKAPF+E    LQG+KM  ++  GERPLFP+P PKYL NL RKCW T+P
Sbjct  438   SYGMICFQLLTGKAPFDEH---LQGEKMAQNIRTGERPLFPHPSPKYLVNLTRKCWQTNP  494

Query  720   NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDN---VPPG  890
             + RP FSS+CRIL YIKKVLVINP HG P+CPPPLVDYC+IEAGY KKFPG++   + P 
Sbjct  495   DLRPSFSSLCRILHYIKKVLVINPGHGQPECPPPLVDYCEIEAGYSKKFPGEDSTGLAP-  553

Query  891   VSEIPFQMFAYKLVEKEKTLGND----------GF------AVRARDDHLVSMDDLCLVP  1022
             VS+IPFQMFAY+LVEKE+  GN           G+      ++++ ++H+ +MDDL   P
Sbjct  554   VSQIPFQMFAYRLVEKERISGNSKDKHWDSSHYGYSSHRTASMQSDNEHMDAMDDLFFGP  613

Query  1023  NNGTRGRLSTCSEIIDRNDLGTFADQRSAISE  1118
             ++    R S CSEII+  D   F DQR+ ISE
Sbjct  614   SD----RRSICSEIIESKD-PRFWDQRTVISE  640



>gb|EYU23387.1| hypothetical protein MIMGU_mgv1a020213mg [Erythranthe guttata]
Length=762

 Score =   446 bits (1147),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 226/375 (60%), Positives = 277/375 (74%), Gaps = 22/375 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             +ALRTFYG++G L  EI+T++SLSHPNVLQY C FYDE+RKEGFLVMELMSK L  +IKE
Sbjct  255   YALRTFYGDVGPLYSEISTILSLSHPNVLQYLCAFYDEDRKEGFLVMELMSKDLGSYIKE  314

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             NSGQR R+ FSIP+AVD+MLQIARGMEYLHS+ I+HG LNPS++LL+  ++     F +K
Sbjct  315   NSGQRNRVPFSIPIAVDIMLQIARGMEYLHSKKIYHGVLNPSSVLLKAKNA-SIGGFQAK  373

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             V+GFGLS +KS YT ++ P+ + GVD  IW APE+L E E   G+      ++EKADVYS
Sbjct  374   VAGFGLSSIKSYYTSKS-PKKT-GVDLDIWLAPEILTELE---GNKNISPNYTEKADVYS  428

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGMLCF++LTGK PFE+G   LQG+KM  ++ AGERPLF YP PKYLTNL +KCW T+PN
Sbjct  429   FGMLCFELLTGKVPFEDGH--LQGEKMARNIRAGERPLFSYPSPKYLTNLTKKCWQTNPN  486

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP----GDNVPPG  890
              RP FSS+CR+LRYIKK+LVINP+HGHPD PPPLVDYCD+EAGY+KKFP       + P 
Sbjct  487   LRPSFSSICRVLRYIKKILVINPDHGHPDSPPPLVDYCDMEAGYLKKFPEKGGAGVLAPP  546

Query  891   VSEIPFQMFAYKLVEKEKTLGNDGFAVR----ARDDHLVSMDDLCLVPNNGTRGRLSTCS  1058
             V +IPFQMF YK+VEKEK         R      +DH  +MDD  L P++    R S CS
Sbjct  547   VLQIPFQMFTYKIVEKEKFYSKKWEIHRPASMFDEDH--NMDDFLLAPSD----RRSVCS  600

Query  1059  EIIDRNDLGTFADQR  1103
             EIID  + G   D R
Sbjct  601   EIIDTKNSGIAVDMR  615



>ref|XP_006352309.1| PREDICTED: light-sensor Protein kinase-like, partial [Solanum 
tuberosum]
Length=579

 Score =   437 bits (1123),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 213/329 (65%), Positives = 255/329 (78%), Gaps = 18/329 (5%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+GE+  L  EI+ V SLSH N+LQYHCGFYDEERKEG+LVMELM+ +L  +IK+
Sbjct  260  FALRNFFGEVEPLHDEISLVFSLSHSNILQYHCGFYDEERKEGYLVMELMNDTLATYIKD  319

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            +SGQRKR  FS   AVD+MLQIA+GMEYLHSR I+HGELNPS++LLR  +S  E+YFH+K
Sbjct  320  HSGQRKRPPFSTSAAVDIMLQIAKGMEYLHSRKIYHGELNPSHVLLRARNSSAESYFHAK  379

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            + GFGL+ +KS Y       +    D VIW+APEVLAEQE+P   SK   K++EKADVYS
Sbjct  380  LKGFGLTSIKSTYK----TASHNAADSVIWFAPEVLAEQEKP--GSKCAYKYTEKADVYS  433

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CFQILTGK PF+EG   LQG+K+V ++ AGERPLFPYP PKYL NL R+CWH +PN
Sbjct  434  FGMICFQILTGKVPFDEGH--LQGEKVVRNIRAGERPLFPYPSPKYLVNLTRRCWHANPN  491

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD---NVPPGV  893
             RP FSS+CRILRYIKKVLVINPEHG P+  PPLVDYCDIEA Y KKF  +   ++ P V
Sbjct  492  LRPRFSSLCRILRYIKKVLVINPEHGQPETAPPLVDYCDIEASYSKKFAEEESTSLTP-V  550

Query  894  SEIPFQMFAYKLVEKEKTLG------NDG  962
            S+IPFQMFAY+L+EKEK  G      NDG
Sbjct  551  SQIPFQMFAYRLIEKEKIFGKNWDPSNDG  579



>ref|XP_011080871.1| PREDICTED: uncharacterized protein LOC105164021 isoform X2 [Sesamum 
indicum]
Length=1039

 Score =   442 bits (1136),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 281/385 (73%), Gaps = 26/385 (7%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA+R FYG +  L  EI++V+SLSHPNVLQYHC FYDE+RKEGFLVMELMSK+L  +IKE
Sbjct  262   FAMRNFYGSVDPLHAEISSVLSLSHPNVLQYHCAFYDEDRKEGFLVMELMSKNLGAYIKE  321

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             +SGQR R+ FSIPVAVD+MLQIARGMEYLHSR I+HG+LNPSN+LL+  ++     F +K
Sbjct  322   HSGQRNRIPFSIPVAVDIMLQIARGMEYLHSRKIYHGDLNPSNVLLKAKNA-SIGGFQAK  380

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             ++GFGL+ + S  T R+ P+ +GG D  IW APEVL E  QP   SK   K+++KADVYS
Sbjct  381   ITGFGLTSVMSS-TARS-PKPTGG-DLDIWLAPEVLTELGQP--DSKCSTKYTDKADVYS  435

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             F MLCF +LTGK  FE+G   LQG+KM  ++ AGERPLF YP PKYL+NLI+KCW ++PN
Sbjct  436   FAMLCFTLLTGKVSFEDGH--LQGEKMARNIRAGERPLFSYPSPKYLSNLIKKCWQSNPN  493

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPG---DNVPPGV  893
              RP FSS+CRILRYIKK LVINP+HG PD PP LVDY D+E GY+KK PG   +++ P V
Sbjct  494   QRPTFSSICRILRYIKKNLVINPDHGDPDSPPLLVDYYDLETGYLKKVPGEGSEDLAP-V  552

Query  894   SEIPFQMFAYKLVEKEKT------LGNDGFAVRA----RDDHLVSMDDLCLVPNNGTRGR  1043
             S IPFQMF YK+VE+EK       L  +G   RA     D+ + +MDDL L P++    R
Sbjct  553   SLIPFQMFTYKVVEREKISGKKWDLATEGSVHRAPSVFDDEQMATMDDLFLAPSD----R  608

Query  1044  LSTCSEIIDRNDLGTFADQRSAISE  1118
              S CSEIID  +    AD RS ISE
Sbjct  609   RSVCSEIIDSKNPTVAADMRSVISE  633



>ref|XP_011080869.1| PREDICTED: uncharacterized protein LOC105164021 isoform X1 [Sesamum 
indicum]
 ref|XP_011080870.1| PREDICTED: uncharacterized protein LOC105164021 isoform X1 [Sesamum 
indicum]
Length=1041

 Score =   442 bits (1136),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 281/385 (73%), Gaps = 26/385 (7%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA+R FYG +  L  EI++V+SLSHPNVLQYHC FYDE+RKEGFLVMELMSK+L  +IKE
Sbjct  262   FAMRNFYGSVDPLHAEISSVLSLSHPNVLQYHCAFYDEDRKEGFLVMELMSKNLGAYIKE  321

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             +SGQR R+ FSIPVAVD+MLQIARGMEYLHSR I+HG+LNPSN+LL+  ++     F +K
Sbjct  322   HSGQRNRIPFSIPVAVDIMLQIARGMEYLHSRKIYHGDLNPSNVLLKAKNA-SIGGFQAK  380

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             ++GFGL+ + S  T R+ P+ +GG D  IW APEVL E  QP   SK   K+++KADVYS
Sbjct  381   ITGFGLTSVMSS-TARS-PKPTGG-DLDIWLAPEVLTELGQP--DSKCSTKYTDKADVYS  435

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             F MLCF +LTGK  FE+G   LQG+KM  ++ AGERPLF YP PKYL+NLI+KCW ++PN
Sbjct  436   FAMLCFTLLTGKVSFEDGH--LQGEKMARNIRAGERPLFSYPSPKYLSNLIKKCWQSNPN  493

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPG---DNVPPGV  893
              RP FSS+CRILRYIKK LVINP+HG PD PP LVDY D+E GY+KK PG   +++ P V
Sbjct  494   QRPTFSSICRILRYIKKNLVINPDHGDPDSPPLLVDYYDLETGYLKKVPGEGSEDLAP-V  552

Query  894   SEIPFQMFAYKLVEKEKT------LGNDGFAVRA----RDDHLVSMDDLCLVPNNGTRGR  1043
             S IPFQMF YK+VE+EK       L  +G   RA     D+ + +MDDL L P++    R
Sbjct  553   SLIPFQMFTYKVVEREKISGKKWDLATEGSVHRAPSVFDDEQMATMDDLFLAPSD----R  608

Query  1044  LSTCSEIIDRNDLGTFADQRSAISE  1118
              S CSEIID  +    AD RS ISE
Sbjct  609   RSVCSEIIDSKNPTVAADMRSVISE  633



>gb|KDO76456.1| hypothetical protein CISIN_1g003542mg [Citrus sinensis]
Length=811

 Score =   409 bits (1051),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 219/393 (56%), Positives = 266/393 (68%), Gaps = 33/393 (8%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F LR FYGE+ +L  EI+T++SLSHPN++QY CGF DEE+KE FLVMELMSK L  +++E
Sbjct  240   FVLRHFYGELESLNAEISTMLSLSHPNIVQYLCGFCDEEKKEFFLVMELMSKDLSCYMRE  299

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G R+R SFS+PV VD+MLQIARGME+LH++ I+HGELNPSNI L+  S  G  YFH K
Sbjct  300   TFGSRRRNSFSLPVVVDIMLQIARGMEFLHAQKIYHGELNPSNIYLKARSMEG--YFHVK  357

Query  363   VSGFGLSMMKSQYTFRNCPRAS----GGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKA  530
             VSGFGLS  ++ Y  RN P AS       +P IWYAPEVLAEQE     S S +K SEKA
Sbjct  358   VSGFGLSTART-YASRNTPPASPQNQTAPNPYIWYAPEVLAEQEGT--GSTSTSKCSEKA  414

Query  531   DVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWH  710
             DVYSFGMLCF++LTGK PFE+G   LQGDKM  ++ AGERPLFP   PKYL NL +KCWH
Sbjct  415   DVYSFGMLCFELLTGKVPFEDGH--LQGDKMTKNIRAGERPLFPSGSPKYLVNLTKKCWH  472

Query  711   TSPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG  890
             T+P+ RP FSS+CRILRYIKK +  NP+    +   PL DYCDIEAG+++KF G+  P  
Sbjct  473   TNPSQRPSFSSICRILRYIKKFMANNPDIARSEFQSPLADYCDIEAGFVRKFVGEGCPDV  532

Query  891   --VSEIPFQMFAYKLVEKEKT----------LGNDGFAVRARDDHLVSMDDLCLVPNNGT  1034
               VS+IPFQMFAYK+ EKEK           LG+D        D + S+ D  +VP   T
Sbjct  533   APVSQIPFQMFAYKIAEKEKANSSNKGKHWELGSD--VASTCKDEVFSVGDEGMVPVTET  590

Query  1035  RGRLSTCSEIIDRNDLGTFADQRSAISEILQPK  1133
             R   S CS++       TF D RS  SE    K
Sbjct  591   R---SVCSDVKSV----TF-DMRSVYSEAFGKK  615



>ref|XP_006476428.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0277165-like 
isoform X1 [Citrus sinensis]
 ref|XP_006476429.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0277165-like 
isoform X2 [Citrus sinensis]
 ref|XP_006476430.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0277165-like 
isoform X3 [Citrus sinensis]
Length=833

 Score =   408 bits (1049),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 218/393 (55%), Positives = 266/393 (68%), Gaps = 33/393 (8%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F LR FYGE+ +L  EI+T++SLSHPN++QY CGF DEE+KE FLVMELMSK L  +++E
Sbjct  262   FVLRHFYGELESLNAEISTMLSLSHPNIVQYLCGFCDEEKKEFFLVMELMSKDLSCYMRE  321

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G R+R SFS+PV VD+MLQIARGME+LH++ I+HGELNPSNI L+  S  G  YFH K
Sbjct  322   TFGSRRRNSFSLPVVVDIMLQIARGMEFLHAQKIYHGELNPSNIYLKARSMEG--YFHVK  379

Query  363   VSGFGLSMMKSQYTFRNCPRAS----GGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKA  530
             VSGFGLS  ++ Y  RN P AS       +P IWYAPEVLAEQE     S S +K SEKA
Sbjct  380   VSGFGLSTART-YASRNTPPASPQNQTAPNPYIWYAPEVLAEQEGT--GSTSTSKCSEKA  436

Query  531   DVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWH  710
             D+YSFGMLCF++LTGK PFE+G   LQGDKM  ++ AGERPLFP   PKYL NL +KCWH
Sbjct  437   DIYSFGMLCFELLTGKVPFEDGH--LQGDKMTKNIRAGERPLFPSGSPKYLVNLTKKCWH  494

Query  711   TSPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG  890
             T+P+ RP FSS+CRILRYIKK +  NP+    +   PL DYCDIEAG+++KF G+  P  
Sbjct  495   TNPSQRPSFSSICRILRYIKKFMANNPDIARSEFQSPLADYCDIEAGFVRKFVGEGCPDV  554

Query  891   --VSEIPFQMFAYKLVEKEKT----------LGNDGFAVRARDDHLVSMDDLCLVPNNGT  1034
               VS+IPFQMFAYK+ EKEK           LG+D        D + S+ D  +VP   T
Sbjct  555   APVSQIPFQMFAYKIAEKEKANSSNKGKHWELGSD--VASTCKDEVFSVGDEGMVPVTET  612

Query  1035  RGRLSTCSEIIDRNDLGTFADQRSAISEILQPK  1133
             R   S CS++       TF D RS  SE    K
Sbjct  613   R---SVCSDVKSV----TF-DMRSVYSEAFGKK  637



>ref|XP_006439402.1| hypothetical protein CICLE_v10018862mg [Citrus clementina]
 gb|ESR52642.1| hypothetical protein CICLE_v10018862mg [Citrus clementina]
Length=833

 Score =   408 bits (1048),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 219/393 (56%), Positives = 265/393 (67%), Gaps = 33/393 (8%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F LR FYGE+ +L  EI+T++SLSHPN++QY CGF DEE+KE FLVMELMSK L  +++E
Sbjct  262   FVLRHFYGELESLNAEISTMLSLSHPNIVQYLCGFCDEEKKEFFLVMELMSKDLSCYMRE  321

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G R+R SFS+PV VD+MLQIARGME+LH++ I+HGELNPSNI L+  S  G  YFH K
Sbjct  322   TFGSRRRNSFSLPVVVDIMLQIARGMEFLHAQKIYHGELNPSNIYLKGRSMEG--YFHVK  379

Query  363   VSGFGLSMMKSQYTFRNCPRAS----GGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKA  530
             VSGFGLS  ++ Y  RN P AS       +P IWYAPEVLAEQE     S S +K SEKA
Sbjct  380   VSGFGLSTART-YASRNTPPASPQNQTAPNPYIWYAPEVLAEQEGT--GSTSTSKCSEKA  436

Query  531   DVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWH  710
             DVYSFGMLCF++LTGK PFE+G   LQGDKM  ++ AGERPLFP   PKYL NL +KCWH
Sbjct  437   DVYSFGMLCFELLTGKVPFEDGH--LQGDKMTKNIRAGERPLFPSGSPKYLVNLTKKCWH  494

Query  711   TSPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG  890
             T+P+ RP FSS+CRILRYIKK +  NP+    +   PL DYCDIEAG+++KF G+  P  
Sbjct  495   TNPSQRPSFSSICRILRYIKKFMANNPDIARSEFQSPLADYCDIEAGFVRKFVGEGCPDV  554

Query  891   --VSEIPFQMFAYKLVEKEKT----------LGNDGFAVRARDDHLVSMDDLCLVPNNGT  1034
               VS+IPFQMFAYK+ EKEK           LG+D        D + S  D  +VP   T
Sbjct  555   APVSQIPFQMFAYKIAEKEKANSSNKGKHWELGSD--VASTCKDEVFSAGDEGMVPVTET  612

Query  1035  RGRLSTCSEIIDRNDLGTFADQRSAISEILQPK  1133
             R   S CS++       TF D RS  SE    K
Sbjct  613   R---SVCSDVKSV----TF-DMRSVYSEAFGKK  637



>ref|XP_010658951.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7 [Vitis 
vinifera]
 ref|XP_010658962.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7 [Vitis 
vinifera]
 ref|XP_010658970.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7 [Vitis 
vinifera]
Length=668

 Score =   398 bits (1023),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 200/317 (63%), Positives = 244/317 (77%), Gaps = 7/317 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+GEI  L  EI++++SLSHPN++QY CGFYDEE+KE  LVME+M+K L   IKE
Sbjct  250  FALRQFFGEIEPLNSEISSLLSLSHPNIMQYLCGFYDEEKKECLLVMEMMNKDLHSQIKE  309

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N GQR+R+ F +PV VD+MLQIARGMEYLHS  ++HG+LNPSNI L+  +S  E YFH+K
Sbjct  310  NCGQRRRILFPLPVMVDLMLQIARGMEYLHSVKVYHGDLNPSNIFLKARNSSTEGYFHAK  369

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGLS +K+ +TF        G DP+IW+APEVLAEQEQ  GSS S +KFSEKADVYS
Sbjct  370  VSGFGLSSIKN-HTFSRSSPGQNGTDPLIWHAPEVLAEQEQ-LGSSCS-SKFSEKADVYS  426

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGMLCF++LTGK PFE+    LQGDKM  ++ AGERPLFP+P  KYL NL ++CWHT P 
Sbjct  427  FGMLCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFPSHKYLANLAKRCWHTDPV  484

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGVS  896
             RP FSS+CRILRYIK+ LV NP+H  P+   P VDY ++EAG++KK    G   P  VS
Sbjct  485  QRPSFSSICRILRYIKRFLVQNPDHSQPELTQPPVDYFELEAGFVKKLTVEGQLDPMPVS  544

Query  897  EIPFQMFAYKLVEKEKT  947
            +IPFQMFAY+LVEKEKT
Sbjct  545  QIPFQMFAYRLVEKEKT  561



>ref|XP_010104990.1| Light-sensor Protein kinase [Morus notabilis]
 gb|EXC02947.1| Light-sensor Protein kinase [Morus notabilis]
Length=697

 Score =   397 bits (1019),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 204/395 (52%), Positives = 259/395 (66%), Gaps = 31/395 (8%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FALR F+GEI  L  EI+ ++ LSH N++QY CGF DEE+KE FLVMELMSK L  ++KE
Sbjct  262   FALRHFFGEIQPLTSEISNLLFLSHSNIVQYLCGFCDEEKKEFFLVMELMSKDLSSYMKE  321

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             N G R+R+ FS+PV VD+MLQIARGMEYLHS+NI+HGELNPSNI L+  +S  E+Y  +K
Sbjct  322   NCGPRRRVLFSLPVVVDLMLQIARGMEYLHSQNIYHGELNPSNIFLKVRNS-SESYLQAK  380

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             +SGFGLS +  +   RN P  +  VDP IW+APE+LAEQEQ +  S S +K++EKADVYS
Sbjct  381   ISGFGLSSVNKKSNPRNSPNQNATVDPFIWHAPEILAEQEQQQPGSNSSSKYTEKADVYS  440

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CF++LTGK PFE+G   LQGDKM  ++ AGERPLFP+P PKYL NL ++CW T P+
Sbjct  441   FGMICFELLTGKVPFEDGH--LQGDKMSRNIRAGERPLFPHPSPKYLVNLTKRCWQTDPS  498

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNV---PPGV  893
              RP FSS+CRILRYIKK L +NPE   P    P VDY DIEAG++KK   +        V
Sbjct  499   QRPSFSSICRILRYIKKFLALNPEPALPLMQSPSVDYYDIEAGFLKKTLAEGWCSDVSSV  558

Query  894   SEIPFQMFAYKLVEKEKTLG-------------------------NDGFAVRARDDHLVS  998
             S+IPFQMF+Y+L EKEKT                           ND +A    D  + +
Sbjct  559   SQIPFQMFSYRLSEKEKTCTTSKDIHHHELISDTSSICRDTASACNDEYATVMEDHTVPA  618

Query  999   MDDLCLVPNNGTRGRLSTCSEIIDRNDLGTFADQR  1103
             +D   +      +     C+E+  R   GT   QR
Sbjct  619   IDTRSVCSETPMKSAPKKCTEVKGRKGSGTPKTQR  653



>ref|XP_010689808.1| PREDICTED: mitogen-activated protein kinase kinase kinase 12-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=803

 Score =   394 bits (1011),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 192/326 (59%), Positives = 243/326 (75%), Gaps = 8/326 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+GE   L  EI+++MSLSHPNV  Y CGF+DEE+KE F+VMELMSK L+ +IKE
Sbjct  258  FVLRHFFGESSLLNSEISSLMSLSHPNVGHYLCGFHDEEKKEYFVVMELMSKDLNSYIKE  317

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G ++RM FS P AVD+MLQIARGMEYLHS+ I+HG+LNPSN+L++P +S  E YFH+K
Sbjct  318  VCGSKRRMPFSFPAAVDIMLQIARGMEYLHSKKIYHGDLNPSNVLIKPRNSSSEGYFHAK  377

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAK-FSEKADVY  539
            +SGFGL  +K+  +  + P  +G     IW+APEVL EQE+   SS    K +SEKADVY
Sbjct  378  ISGFGLKGVKTVASRTSSPNQNGIQPSFIWHAPEVLIEQEKAGSSSGKDFKYYSEKADVY  437

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SFGMLCF++LTGK PFE+G   LQGDKM  ++ AGERPLFP+ LPKY  NL ++CW T P
Sbjct  438  SFGMLCFEVLTGKVPFEDGH--LQGDKMSRNIKAGERPLFPFALPKYFANLTKRCWQTDP  495

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPL-VDYCDIEAGYIKKFPGD-NVPPG-  890
              RP FSS+CRILRYIK+++VINP   H + P  + VDYCDIEAG++KKF  + NV    
Sbjct  496  TQRPNFSSICRILRYIKRLIVINPHLAHSEIPSIVQVDYCDIEAGFMKKFVSEANVAVTP  555

Query  891  VSEIPFQMFAYKLVEKEKTLGNDGFA  968
            VS+IPFQ+F+Y+L EKEK   NDG +
Sbjct  556  VSQIPFQLFSYRLAEKEKL--NDGIS  579



>ref|XP_010545236.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Tarenaya hassleriana]
Length=711

 Score =   391 bits (1004),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 205/376 (55%), Positives = 265/376 (70%), Gaps = 21/376 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F +R F+G++ +L  EI++++ L HPN+LQY CGFYDEERKE FLVMELM K L  ++KE
Sbjct  262   FTVRHFFGDLESLGSEISSLLLLCHPNILQYLCGFYDEERKECFLVMELMHKDLLSYMKE  321

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             N G R+R  FSIPV +D+MLQIARGMEYLHS +I HG+LNP+NILL+  S   E YFH+K
Sbjct  322   NCGPRRRYLFSIPVVIDIMLQIARGMEYLHSNDILHGDLNPTNILLKERSH-TEGYFHAK  380

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQ-PRGSSKSGAKFSEKADVY  539
             +SGFGLS +K+    R   R S   DPVIWYAPEVL E EQ P G  KS  KF+ KADVY
Sbjct  381   ISGFGLSSVKA----RPLARPSTP-DPVIWYAPEVLTELEQDPDGIPKS--KFTHKADVY  433

Query  540   SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
             SF M+CF+++TGK PFE+G   LQGDKM  ++  GERPLFP+P PKYL +LI++CWH+ P
Sbjct  434   SFAMVCFELITGKVPFEDGH--LQGDKMTKNIRMGERPLFPFPSPKYLVSLIKRCWHSDP  491

Query  720   NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPGVSE  899
             + RP FSS+CRILRYIKK LV+NP+HGHP    PLVD  D+EA +++KFP +     VS+
Sbjct  492   SQRPTFSSICRILRYIKKFLVVNPDHGHPQMQNPLVDCWDLEARFLRKFPVEGHVTPVSQ  551

Query  900   IPFQMFAYKLVEKEKTLGN--DGFAVRARDDHLVSMDDLCLVPNNGTRGRLSTCSEIIDR  1073
             IPFQ+FAY++ EKEKT  +  +G +  +     VS+ +   VP   T+   S C + I  
Sbjct  552   IPFQIFAYRIAEKEKTSSSSKEGNSETSETSESVSVVEDPPVPLRDTK---SVCLDTI--  606

Query  1074  NDLGTFADQRSAISEI  1121
                  ++D RS  SE+
Sbjct  607   ---SEYSDTRSVYSEV  619



>ref|XP_007040439.1| Kinase family protein, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOY24940.1| Kinase family protein, putative isoform 3, partial [Theobroma 
cacao]
Length=680

 Score =   389 bits (1000),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 202/387 (52%), Positives = 266/387 (69%), Gaps = 25/387 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F LR F+GE+     EI+T++SLSHPN+LQY CGFYDEE+KE  LV+ELM+K L  ++KE
Sbjct  257   FVLRHFFGEVEPSCSEISTLLSLSHPNILQYLCGFYDEEKKEVMLVLELMNKDLSCYMKE  316

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             N G R+R+ FS PV VD+MLQIARGMEYLHS+ I HGELNPSNI L+  ++  E +FH K
Sbjct  317   NCGSRRRILFSFPVVVDLMLQIARGMEYLHSQKIRHGELNPSNIFLKARNNT-EGFFHLK  375

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             +SG+GLS +K++ +  + P+     +P IWYAPEVL EQEQP   + S  K++EKADVYS
Sbjct  376   ISGYGLSPVKTRSSPNSSPKPIEP-NPFIWYAPEVLLEQEQPGNITIS--KYTEKADVYS  432

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGMLCFQ+LTGK PFE+G   LQG+KM  ++ AGERPLFPY  PKYL NL ++CWHT PN
Sbjct  433   FGMLCFQLLTGKVPFEDGH--LQGEKMSRNIRAGERPLFPYTAPKYLVNLTKRCWHTDPN  490

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNV--PPGVS  896
              RP FSS+ RILRYIKK LV+NP+   P+   P+ DYC+IEA ++KKF  +    P  V+
Sbjct  491   QRPSFSSISRILRYIKKYLVMNPDRDQPEMQSPVADYCEIEAWFLKKFTANGTFSPLSVA  550

Query  897   EIPFQMFAYKLVEKEKTLGNDG---------FAVRARDDHLVSMDDLCLVPNNG---TRG  1040
             +IPFQMFAY+L EK+K++ N            A   RD++  +++D  +  +     +  
Sbjct  551   QIPFQMFAYRLAEKDKSILNTQDKNGELASEAASICRDENNSTVEDPLIAASETKSVSSD  610

Query  1041  RLSTCSEIIDRNDLGTFADQRSAISEI  1121
               S CS+I        ++D RS  SEI
Sbjct  611   VKSVCSDI-----KSVYSDIRSVCSEI  632



>ref|XP_010689812.1| PREDICTED: mitogen-activated protein kinase kinase kinase 12-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=799

 Score =   392 bits (1008),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 192/326 (59%), Positives = 243/326 (75%), Gaps = 8/326 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+GE   L  EI+++MSLSHPNV  Y CGF+DEE+KE F+VMELMSK L+ +IKE
Sbjct  258  FVLRHFFGESSLLNSEISSLMSLSHPNVGHYLCGFHDEEKKEYFVVMELMSKDLNSYIKE  317

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G ++RM FS P AVD+MLQIARGMEYLHS+ I+HG+LNPSN+L++P +S  E YFH+K
Sbjct  318  VCGSKRRMPFSFPAAVDIMLQIARGMEYLHSKKIYHGDLNPSNVLIKPRNSSSEGYFHAK  377

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAK-FSEKADVY  539
            +SGFGL  +K+  +  + P  +G     IW+APEVL EQE+   SS    K +SEKADVY
Sbjct  378  ISGFGLKGVKTVASRTSSPNQNGIQPSFIWHAPEVLIEQEKAGSSSGKDFKYYSEKADVY  437

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SFGMLCF++LTGK PFE+G   LQGDKM  ++ AGERPLFP+ LPKY  NL ++CW T P
Sbjct  438  SFGMLCFEVLTGKVPFEDGH--LQGDKMSRNIKAGERPLFPFALPKYFANLTKRCWQTDP  495

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPL-VDYCDIEAGYIKKFPGD-NVPPG-  890
              RP FSS+CRILRYIK+++VINP   H + P  + VDYCDIEAG++KKF  + NV    
Sbjct  496  TQRPNFSSICRILRYIKRLIVINPHLAHSEIPSIVQVDYCDIEAGFMKKFVSEANVAVTP  555

Query  891  VSEIPFQMFAYKLVEKEKTLGNDGFA  968
            VS+IPFQ+F+Y+L EKEK   NDG +
Sbjct  556  VSQIPFQLFSYRLAEKEKL--NDGIS  579



>ref|XP_004300853.1| PREDICTED: uncharacterized protein LOC101304004 [Fragaria vesca 
subsp. vesca]
Length=876

 Score =   394 bits (1011),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 205/377 (54%), Positives = 264/377 (70%), Gaps = 23/377 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA+R F+GE+  +R EI+T++SLSHPNVLQY CGFYDE++KE FLVMELMSK L  ++KE
Sbjct  260   FAMRHFFGELEPMRSEISTLLSLSHPNVLQYLCGFYDEDKKECFLVMELMSKDLRCYMKE  319

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             N G R+++ FS+PV VD+MLQIARGMEYLHSR I+HG+LNP NI L+  SS  E +F +K
Sbjct  320   NCGARRQILFSLPVVVDIMLQIARGMEYLHSRKIYHGDLNPFNIFLKARSST-EGFFQAK  378

Query  363   VSGFGLSMMKSQYTFRNC---PRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKAD  533
             VSGFGLS ++++ T+RN     +    +DP+IW APEVLAEQEQ  G++   +KF+E AD
Sbjct  379   VSGFGLSSLQNKPTYRNSQQQQQQKNEIDPLIWCAPEVLAEQEQT-GNTNVRSKFTENAD  437

Query  534   VYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHT  713
             VYSFGMLCF++LTGK PFE+    LQGDKM  ++ AG RPLFP+P PKYL NL ++CW T
Sbjct  438   VYSFGMLCFELLTGKIPFEDSH--LQGDKMSQTIRAGGRPLFPFPSPKYLVNLTKRCWQT  495

Query  714   SPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP--GDNVPP  887
              P+ R  F+S+CRILRYIKK L +NP+   P    P  DYC+IEA + K++   G     
Sbjct  496   DPSQRLSFASICRILRYIKKFLSMNPDVDQPILQSPPTDYCEIEAWFQKQYKAGGHADAA  555

Query  888   GVSEIPFQMFAYKLVEKEKTLGNDGFAVRARDDHLVSMDDLCLVPNNGTRGRLSTCSEII  1067
              VS+IPFQMF+Y+L EKEKT G     +RA  +  +SM D   V ++ TR   S CS   
Sbjct  556   SVSQIPFQMFSYRLGEKEKTPG----LIRAEAEANISMSDSLTVIDD-TR---SFCS---  604

Query  1068  DRNDLGTFADQRSAISE  1118
                D  +  D RS  SE
Sbjct  605   ---DARSLYDVRSVFSE  618



>ref|XP_007040437.1| Kinase family protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007040438.1| Kinase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY24938.1| Kinase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY24939.1| Kinase family protein, putative isoform 1 [Theobroma cacao]
Length=721

 Score =   389 bits (1000),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 202/387 (52%), Positives = 266/387 (69%), Gaps = 25/387 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F LR F+GE+     EI+T++SLSHPN+LQY CGFYDEE+KE  LV+ELM+K L  ++KE
Sbjct  257   FVLRHFFGEVEPSCSEISTLLSLSHPNILQYLCGFYDEEKKEVMLVLELMNKDLSCYMKE  316

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             N G R+R+ FS PV VD+MLQIARGMEYLHS+ I HGELNPSNI L+  ++  E +FH K
Sbjct  317   NCGSRRRILFSFPVVVDLMLQIARGMEYLHSQKIRHGELNPSNIFLKARNNT-EGFFHLK  375

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             +SG+GLS +K++ +  + P+     +P IWYAPEVL EQEQP   + S  K++EKADVYS
Sbjct  376   ISGYGLSPVKTRSSPNSSPKPIEP-NPFIWYAPEVLLEQEQPGNITIS--KYTEKADVYS  432

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGMLCFQ+LTGK PFE+G   LQG+KM  ++ AGERPLFPY  PKYL NL ++CWHT PN
Sbjct  433   FGMLCFQLLTGKVPFEDGH--LQGEKMSRNIRAGERPLFPYTAPKYLVNLTKRCWHTDPN  490

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNV--PPGVS  896
              RP FSS+ RILRYIKK LV+NP+   P+   P+ DYC+IEA ++KKF  +    P  V+
Sbjct  491   QRPSFSSISRILRYIKKYLVMNPDRDQPEMQSPVADYCEIEAWFLKKFTANGTFSPLSVA  550

Query  897   EIPFQMFAYKLVEKEKTLGNDG---------FAVRARDDHLVSMDDLCLVPNNG---TRG  1040
             +IPFQMFAY+L EK+K++ N            A   RD++  +++D  +  +     +  
Sbjct  551   QIPFQMFAYRLAEKDKSILNTQDKNGELASEAASICRDENNSTVEDPLIAASETKSVSSD  610

Query  1041  RLSTCSEIIDRNDLGTFADQRSAISEI  1121
               S CS+I        ++D RS  SEI
Sbjct  611   VKSVCSDI-----KSVYSDIRSVCSEI  632



>emb|CBI40479.3| unnamed protein product [Vitis vinifera]
Length=614

 Score =   384 bits (987),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 196/348 (56%), Positives = 248/348 (71%), Gaps = 21/348 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FALR FYGEI  L PEI+ ++SLSHPN+++  CGF DEE++E FLVMELM K L  H+KE
Sbjct  191   FALRHFYGEIEPLVPEISQLLSLSHPNIMRLLCGFIDEEKRECFLVMELMYKDLCSHLKE  250

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G R+R+ FS+PVAVD+MLQ+ARGMEYLHS+ I+HG+LNPSNIL++  S   E Y H+K
Sbjct  251   ICGPRRRLPFSLPVAVDLMLQVARGMEYLHSKKIYHGDLNPSNILVKARSISTEGYLHAK  310

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGA-KFSEKADVY  539
             VSGFGLS  K+    +  P  +  + P IW+APEVLA+QEQ     K+G  K++EKADVY
Sbjct  311   VSGFGLSSTKN-LNQKTSPNQAVNL-PFIWHAPEVLADQEQ---LGKTGNFKYTEKADVY  365

Query  540   SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
             SFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP   PKY+TNL +KCWHT P
Sbjct  366   SFGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPSNSPKYITNLTKKCWHTDP  423

Query  720   NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPG--DNVPPGV  893
             N RP FSS+CRILRY K  L +NP+H  PD P PLVD+CDIEAG +K  P    + P  +
Sbjct  424   NQRPSFSSICRILRYTKWFLAMNPDHSQPDAPVPLVDFCDIEAGLLKTIPSWRSSDPLPI  483

Query  894   SEIPFQMFAYKLVEKEKT----------LGNDGFAVRARDDHLVSMDD  1007
             S+IPFQ+F Y+ VEKEK            G+DG++    D+ L  +DD
Sbjct  484   SDIPFQIFVYRAVEKEKLHAIPKQKSSESGSDGYST-CGDEPLTIIDD  530



>ref|XP_010261489.1| PREDICTED: light-sensor Protein kinase [Nelumbo nucifera]
Length=687

 Score =   385 bits (989),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 195/351 (56%), Positives = 253/351 (72%), Gaps = 24/351 (7%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F LR F+G I  L PEI+ + ++SHPN+L + C F DEE+KE FLV ELM+K L  ++KE
Sbjct  262   FVLRHFFGNIELLIPEISRLSAMSHPNILNFLCSFCDEEKKECFLVTELMTKDLSNYMKE  321

Query  183   NSGQRKRMS-FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
              +  RKR+  FS+PVAVD+MLQIARGMEYLHS+NI+HG+LNPSNIL+R  +   E + H+
Sbjct  322   ITQPRKRVVPFSLPVAVDLMLQIARGMEYLHSQNIYHGDLNPSNILVRARNVYPEGHLHA  381

Query  360   KVSGFGLSMMKSQYTFRN-CPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADV  536
             KVSGFGLS +K     RN C +   G  PVIWY PEVLAEQEQ    +    K++EKADV
Sbjct  382   KVSGFGLSSIKDNP--RNPCQQNGNGALPVIWYGPEVLAEQEQT--GNNCNCKYTEKADV  437

Query  537   YSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTS  716
             YSFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PKYLTNL ++CWH+ 
Sbjct  438   YSFGMICFELLTGKVPFEDSH--LQGDKMSRNVRAGERPLFPFTAPKYLTNLTKRCWHSD  495

Query  717   PNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPG----DNVP  884
             P+ RP FSS+CRILRYIK+ L++NP++  PD P P++DYC++EAG +KKFP     D   
Sbjct  496   PSQRPSFSSICRILRYIKRFLLMNPDNNQPDPPLPVIDYCEVEAGLLKKFPSWGNPDTAA  555

Query  885   PGVSEIPFQMFAYKLVEKEKT----------LGNDGFAVRARDDHLVSMDD  1007
             P VS+IPFQMFAY+++EKEKT           G+DG +V   D++   +DD
Sbjct  556   P-VSQIPFQMFAYRVIEKEKTSLSLKDRSSESGSDGTSV-CGDENASIVDD  604



>ref|XP_002280598.2| PREDICTED: mitogen-activated protein kinase kinase kinase 7 [Vitis 
vinifera]
 emb|CAN60248.1| hypothetical protein VITISV_039398 [Vitis vinifera]
Length=685

 Score =   385 bits (988),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 196/348 (56%), Positives = 248/348 (71%), Gaps = 21/348 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FALR FYGEI  L PEI+ ++SLSHPN+++  CGF DEE++E FLVMELM K L  H+KE
Sbjct  262   FALRHFYGEIEPLVPEISQLLSLSHPNIMRLLCGFIDEEKRECFLVMELMYKDLCSHLKE  321

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G R+R+ FS+PVAVD+MLQ+ARGMEYLHS+ I+HG+LNPSNIL++  S   E Y H+K
Sbjct  322   ICGPRRRLPFSLPVAVDLMLQVARGMEYLHSKKIYHGDLNPSNILVKARSISTEGYLHAK  381

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGA-KFSEKADVY  539
             VSGFGLS  K+    +  P  +  + P IW+APEVLA+QEQ     K+G  K++EKADVY
Sbjct  382   VSGFGLSSTKN-LNQKTSPNQAVNL-PFIWHAPEVLADQEQ---LGKTGNFKYTEKADVY  436

Query  540   SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
             SFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP   PKY+TNL +KCWHT P
Sbjct  437   SFGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPSNSPKYITNLTKKCWHTDP  494

Query  720   NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPG--DNVPPGV  893
             N RP FSS+CRILRY K  L +NP+H  PD P PLVD+CDIEAG +K  P    + P  +
Sbjct  495   NQRPSFSSICRILRYTKWFLAMNPDHSQPDAPVPLVDFCDIEAGLLKTIPSWRSSDPLPI  554

Query  894   SEIPFQMFAYKLVEKEKT----------LGNDGFAVRARDDHLVSMDD  1007
             S+IPFQ+F Y+ VEKEK            G+DG++    D+ L  +DD
Sbjct  555   SDIPFQIFVYRAVEKEKLHAIPKQKSSESGSDGYST-CGDEPLTIIDD  601



>ref|XP_006444885.1| hypothetical protein CICLE_v10023409mg [Citrus clementina]
 ref|XP_006491235.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Citrus sinensis]
 gb|ESR58125.1| hypothetical protein CICLE_v10023409mg [Citrus clementina]
 gb|KDO86404.1| hypothetical protein CISIN_1g038696mg [Citrus sinensis]
Length=683

 Score =   384 bits (986),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 190/318 (60%), Positives = 239/318 (75%), Gaps = 11/318 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G+I  L PEI++++SLSHPN++ + CGF DEE+KE FL+MELMS+ L  +IKE
Sbjct  259  FALRHFFGDIEPLVPEISSLLSLSHPNIMHFLCGFTDEEKKECFLIMELMSRDLCSYIKE  318

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
                RKR+ FS+PVAVD+MLQIARGMEYLHS+ I+HG LNPSNILL+P  +  E Y H+K
Sbjct  319  ICCPRKRIPFSLPVAVDLMLQIARGMEYLHSKKIYHGNLNPSNILLKPRGASTEGYLHAK  378

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGLS +K+       P  SG   P IW+APEVL E EQ   +S S  K+SEK+DVYS
Sbjct  379  ISGFGLSSVKNFGP--KSPSQSGTTHPFIWHAPEVLEENEQTESASNS--KYSEKSDVYS  434

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CF+ILTGK PFE+    LQGDKM  ++ AGERPLFP+  PKY+TNL ++CWH  PN
Sbjct  435  FGMICFEILTGKVPFEDAH--LQGDKMSRNIRAGERPLFPFHSPKYVTNLTKRCWHADPN  492

Query  723  ARPGFSSVCRILRYIKKVLVINPEHG-HPDCPPPLVDYCDIEAGYIKKFPG---DNVPPG  890
             RP FSS+CRILRYIK+ +++NP +   PD P PLVDY DIE+  ++KFP     NV P 
Sbjct  493  QRPSFSSICRILRYIKRFIMMNPHYNSQPDPPMPLVDYSDIESRLLRKFPSWETHNVLP-  551

Query  891  VSEIPFQMFAYKLVEKEK  944
            +SEIPFQMF Y++VEKEK
Sbjct  552  ISEIPFQMFVYRVVEKEK  569



>emb|CDP08715.1| unnamed protein product [Coffea canephora]
Length=605

 Score =   379 bits (974),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 185/320 (58%), Positives = 235/320 (73%), Gaps = 14/320 (4%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G+I  L P I+  ++L+HPN++   C F DEERKE FLVMELM++ L  HIKE
Sbjct  187  FALRHFFGDIEPLFPAISQELALTHPNIMHIFCAFTDEERKECFLVMELMNRDLSSHIKE  246

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G RKR+ FS+PVAVD+MLQIARGMEYLHS+ I+HG+LNPSNIL++  +   + Y H+K
Sbjct  247  ICGPRKRIPFSLPVAVDLMLQIARGMEYLHSKKIYHGDLNPSNILVKSRNINTDGYLHAK  306

Query  363  VSGFGL--SMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADV  536
            V  FGL  S+   Q +  N      G  PVIWYAPEVLA+QEQ   +  S  K++EKADV
Sbjct  307  VCAFGLPSSVSLPQKSNSN----QNGQLPVIWYAPEVLADQEQSGNADNS--KYTEKADV  360

Query  537  YSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTS  716
            YSFGM+CF++LTGK PFE+G   LQGDKM  ++ AGERPLFP+ LPKYLTNL +KCWH  
Sbjct  361  YSFGMICFELLTGKVPFEDGH--LQGDKMSRNIRAGERPLFPFHLPKYLTNLTKKCWHDD  418

Query  717  PNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPG---DNVPP  887
            PN RP F+S+CRILRYIK+ L++NP+H  P+ P PLVDY +IE   ++ FP     N+ P
Sbjct  419  PNQRPSFASICRILRYIKRFLLMNPDHSQPETPVPLVDYSEIETVILRSFPSWAESNILP  478

Query  888  GVSEIPFQMFAYKLVEKEKT  947
             +SEIPFQMF Y++ EKEK+
Sbjct  479  -ISEIPFQMFVYRVAEKEKS  497



>ref|XP_006839188.1| hypothetical protein AMTR_s00097p00141680 [Amborella trichopoda]
 gb|ERN01757.1| hypothetical protein AMTR_s00097p00141680 [Amborella trichopoda]
Length=647

 Score =   380 bits (975),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 235/320 (73%), Gaps = 8/320 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA+R F+ E+  L PEI+ + SL HPN++   CGF D+ERKE FLVMELM++ L  +IKE
Sbjct  256  FAVRHFHAEVEPLIPEISLLSSLMHPNIMHILCGFVDKERKECFLVMELMNRDLSNYIKE  315

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G RKR+ F++PV VDVMLQIARGMEYLHSR I+HG LNPSNIL+R  +   E + H K
Sbjct  316  TCGPRKRVPFTLPVTVDVMLQIARGMEYLHSRKIYHGNLNPSNILVRVRNPSSEGHLHVK  375

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            ++GFGL+ +K+  +  +  + +   DPVIWYAPEVL EQEQ  G+  S +K++EKADVYS
Sbjct  376  ITGFGLTSVKNSTSKNSANQPT--TDPVIWYAPEVLQEQEQ--GNPTSPSKYTEKADVYS  431

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF++LTGK PFEEG   LQGDKM  +L AGERPLFP+P PKYLT L +KCW   PN
Sbjct  432  FSMICFELLTGKLPFEEGH--LQGDKMSRNLRAGERPLFPFPSPKYLTALTKKCWQDDPN  489

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGVS  896
             RP FSS+CR LRYIK+ LV+N +H  PD P PL+DY D+EA + K+    G+     VS
Sbjct  490  QRPNFSSICRTLRYIKRFLVMNQDHDQPDAPLPLIDYMDLEANFSKRLLGCGEEFTESVS  549

Query  897  EIPFQMFAYKLVEKEKTLGN  956
             IPFQMFAY+++E++KT+ N
Sbjct  550  LIPFQMFAYRVIERQKTMVN  569



>ref|XP_010441344.1| PREDICTED: serine/threonine-protein kinase PKH2-like [Camelina 
sativa]
Length=714

 Score =   382 bits (980),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/316 (57%), Positives = 238/316 (75%), Gaps = 7/316 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+ ++  L  EI+++++L H N+LQY CGFYDEERKE FLVMELM K L  ++KE
Sbjct  262  FALRHFFSDLEPLSSEISSLLALCHSNILQYLCGFYDEERKECFLVMELMHKDLQSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQ+ARGMEYLH  +IFHG+LNP NILL+  S   + YFH+K
Sbjct  322  NCGPRRRYLFSVPVVIDIMLQVARGMEYLHGNDIFHGDLNPMNILLKERSHT-DGYFHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGLS +K+Q + R+  R  G  DPVIWYAPEVLAE EQ        +K + KADVYS
Sbjct  381  ISGFGLSCVKAQSS-RSSSRP-GTPDPVIWYAPEVLAEMEQDLNGKTPKSKLTHKADVYS  438

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CF+++TGK PFE+    LQG++M  ++  GERPLFP+P PKYL +LI++CWH+ P+
Sbjct  439  FGMVCFELITGKVPFEDSH--LQGEQMAINIRMGERPLFPFPSPKYLVSLIKRCWHSEPS  496

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD--NVPPGVS  896
             RP FSSVCRILRY KK LV+NP+HGHP    PLVD  D+EA +++KFPGD  +    V+
Sbjct  497  QRPNFSSVCRILRYFKKFLVVNPDHGHPQMQTPLVDCWDLEARFLRKFPGDVGSHTASVN  556

Query  897  EIPFQMFAYKLVEKEK  944
             IPFQ+++Y+++E+EK
Sbjct  557  LIPFQLYSYRVLEREK  572



>ref|XP_010447859.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Camelina sativa]
Length=711

 Score =   381 bits (978),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/316 (56%), Positives = 237/316 (75%), Gaps = 10/316 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+ ++  L  EI+++++L H N+LQY CGFYDEERKE FLVMELM K +  ++KE
Sbjct  262  FALRHFFSDLEPLSSEISSLLALCHSNILQYLCGFYDEERKECFLVMELMRKDMQSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQ+ARGMEYLH  +IFHG+LNP NILL+  S   + YFH+K
Sbjct  322  NCGPRRRYLFSVPVVIDIMLQVARGMEYLHGNDIFHGDLNPMNILLKERSHT-DGYFHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGLS +K++ + R      G  DPVIWYAPEVLAE EQ        +K + KADVYS
Sbjct  381  ISGFGLSSVKARSSSR-----PGSPDPVIWYAPEVLAEMEQDLNGKIPKSKLTHKADVYS  435

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF+++TGK PFE+    LQG++M  ++  GERPLFP+P PKYL +LI++CWH+ P+
Sbjct  436  FAMVCFELITGKVPFEDSH--LQGEQMAINIRMGERPLFPFPSPKYLVSLIKRCWHSEPS  493

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD--NVPPGVS  896
             RP FSSVCRILRYIKK LV+NP+HGHP    PLVD  D+EA +++KFPGD  +    V+
Sbjct  494  QRPNFSSVCRILRYIKKFLVVNPDHGHPQMQTPLVDCWDLEARFLRKFPGDAGSHTASVN  553

Query  897  EIPFQMFAYKLVEKEK  944
            +IPFQ+++Y+++E+EK
Sbjct  554  QIPFQLYSYRVLEREK  569



>ref|XP_006283223.1| hypothetical protein CARUB_v10004253mg [Capsella rubella]
 gb|EOA16121.1| hypothetical protein CARUB_v10004253mg [Capsella rubella]
Length=714

 Score =   381 bits (978),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/316 (57%), Positives = 237/316 (75%), Gaps = 7/316 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F +R F+ ++  L  EI+++++L H N+LQY CGFYDEERKE FLVMELM K L  ++KE
Sbjct  262  FTVRHFFSDLEPLSSEISSLLALCHSNILQYLCGFYDEERKECFLVMELMHKDLQSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQIARGMEYLH  +IFHG+LNP NILL+  S   E YFH+K
Sbjct  322  NCGPRRRYLFSVPVVIDIMLQIARGMEYLHGNDIFHGDLNPLNILLKERSHT-EGYFHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGLS +K+Q + R+  R  G  DPVIWYAPEVLAE EQ    +   +K + KADVYS
Sbjct  381  ISGFGLSSVKAQSS-RSSSRP-GTPDPVIWYAPEVLAEMEQDLNGTTPKSKLTHKADVYS  438

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF+++TGK PFE+    LQG++M  ++  GERPLFP+P PKYL +LI++CWH+ P+
Sbjct  439  FAMVCFELITGKVPFEDSH--LQGEQMAINIRMGERPLFPFPSPKYLVSLIKRCWHSEPS  496

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD--NVPPGVS  896
             RP FSS+CRILRYIKK LV+NP+HGHP    PLVD  D+EA +++KFP D  +    V+
Sbjct  497  QRPNFSSICRILRYIKKFLVVNPDHGHPQMQTPLVDCWDLEARFLRKFPSDAGSHTASVN  556

Query  897  EIPFQMFAYKLVEKEK  944
            +IPFQ+F+Y++ E+EK
Sbjct  557  QIPFQLFSYRVSEREK  572



>ref|XP_010095716.1| Light-sensor Protein kinase [Morus notabilis]
 gb|EXB61986.1| Light-sensor Protein kinase [Morus notabilis]
Length=647

 Score =   379 bits (972),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 192/353 (54%), Positives = 259/353 (73%), Gaps = 26/353 (7%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA R F+G+   L PEI++++SLSHPN++ + CGF DEE+KE FL+MELMSK L  +IKE
Sbjct  260   FASRHFFGDAERLMPEISSLLSLSHPNIVNFLCGFADEEKKEWFLIMELMSKDLFSYIKE  319

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRP----MSSPGETY  350
               G RKR+ FS+PVAVD+MLQIARGMEYLHS+ I+HG+LNPSNIL+R     +S+ G   
Sbjct  320   TCGPRKRVPFSLPVAVDLMLQIARGMEYLHSKQIYHGDLNPSNILVRARGNGISTEGSQS  379

Query  351   FHSKVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKA  530
               +KVSGFGL+ +   +T ++    +G + P IWYAPEVL EQEQ +G+++S +K++EK+
Sbjct  380   -QAKVSGFGLTSV-GNFTQKSSSSQNGTL-PFIWYAPEVLEEQEQ-KGTAES-SKYTEKS  434

Query  531   DVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWH  710
             DVYSFGM+CF++LTGK PFE+G   LQGDKM  ++ AGERPLFP+  PKY+TNL +KCWH
Sbjct  435   DVYSFGMVCFELLTGKVPFEDGH--LQGDKMSRNIRAGERPLFPFQAPKYVTNLTKKCWH  492

Query  711   TSPNARPGFSSVCRILRYIKKVLVINPEHG-HPDCPPPLVDYCDIEAGYIKKFP---GDN  878
             T PN RP FSS CRILRYIKK + +NP++   PD P PL+DYCDIE+G ++ FP      
Sbjct  493   TDPNQRPSFSSSCRILRYIKKFIAMNPDYNTQPDPPVPLLDYCDIESGLLRSFPYWGSSE  552

Query  879   VPPGVSEIPFQMFAYKLVEKEKT----------LGNDGFAVRARDDHLVSMDD  1007
                 VS+IPFQMF Y+++EKEKT           G+D  ++   D++++++DD
Sbjct  553   QSLSVSQIPFQMFVYRVLEKEKTSASLKDNSEESGSDAASI-CGDENVITIDD  604



>gb|AAG51718.1|AC066689_17 phytochrome, putative; 80131-78152 [Arabidopsis thaliana]
Length=636

 Score =   378 bits (971),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 181/316 (57%), Positives = 234/316 (74%), Gaps = 6/316 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+G++  L  EI++++SL H N+LQY CGFYDEERKE  LVMELM K L  ++KE
Sbjct  239  FVLRHFFGDLEPLNAEISSLLSLCHSNILQYLCGFYDEERKECSLVMELMHKDLKSYMKE  298

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQIARGMEYLHS  IFHG+LNP NILL+  S   E YFH+K
Sbjct  299  NCGPRRRYLFSVPVVIDIMLQIARGMEYLHSNEIFHGDLNPMNILLKERSHT-EGYFHAK  357

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGL+ +K+Q   R   R +   DPVIWYAPEVLAE EQ    +   +KF+ KADVYS
Sbjct  358  ISGFGLTSVKNQSFSRASSRPTTP-DPVIWYAPEVLAEMEQDLKGTAPRSKFTHKADVYS  416

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF+++TGK PFE+    LQGDKM  ++  GERPLFP+P PKYL +LI++CWH+ P+
Sbjct  417  FAMVCFELITGKVPFEDDH--LQGDKMAKNIRTGERPLFPFPSPKYLVSLIKRCWHSEPS  474

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG--VS  896
             RP FSS+CRILRYIKK LV+NP+HGH     PLVD  D+EA ++KKF  ++      V+
Sbjct  475  QRPTFSSICRILRYIKKFLVVNPDHGHLQIQNPLVDCWDLEARFLKKFSMESGSHAGSVT  534

Query  897  EIPFQMFAYKLVEKEK  944
            +IPFQ+++Y++ EKEK
Sbjct  535  QIPFQLYSYRIAEKEK  550



>ref|XP_011022552.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Populus euphratica]
 ref|XP_011022554.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Populus euphratica]
Length=713

 Score =   379 bits (974),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 187/317 (59%), Positives = 237/317 (75%), Gaps = 8/317 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+ +   L  EI+ ++SLSHPN++QY CGFYDE +KE FLVMELM+K    +IKE
Sbjct  259  FALRHFFHDFEPLNSEISMLLSLSHPNIVQYLCGFYDENKKECFLVMELMTKDFYSYIKE  318

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            NS  +KR+ F +P  VD+MLQIARGME+LHSR I+ G+ NPSN+LL+P  S  E YFH K
Sbjct  319  NSSPKKRVLFPLPTVVDIMLQIARGMEFLHSRKIYVGDFNPSNVLLKPRKS-TEGYFHVK  377

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGL+ +K+  +  + P  S  VD  IW+APEVLAEQEQ R +  S  K++EKADVYS
Sbjct  378  VSGFGLTSVKNHSSRHSSPEPS-PVDTCIWHAPEVLAEQEQARNA--SSRKYTEKADVYS  434

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGMLCFQ+LTGK PFE+G   LQGD+M++++ AGERPLFP   PKYL +L +KCWHT P+
Sbjct  435  FGMLCFQLLTGKLPFEDGH--LQGDQMINNIRAGERPLFPSLSPKYLVSLTKKCWHTEPS  492

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNV--PPGVS  896
             RP FSS+CR+LRYIKK LV+NP  G P    P VD+ D+E G++KK  G+     P VS
Sbjct  493  YRPTFSSICRVLRYIKKFLVMNPNDGQPYIQSPPVDFYDLEVGFLKKCQGEVTCELPSVS  552

Query  897  EIPFQMFAYKLVEKEKT  947
            +IPFQMF+Y+L+EKEKT
Sbjct  553  QIPFQMFSYRLIEKEKT  569



>ref|XP_011037745.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7 [Populus 
euphratica]
Length=690

 Score =   379 bits (972),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 180/317 (57%), Positives = 243/317 (77%), Gaps = 9/317 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             ALR F+G+I  L PEI++++SLSHPN+LQ+ CGF DEE+KE FLVMELM++ L   I+E
Sbjct  259  LALRHFFGDIEPLFPEISSLLSLSHPNILQFFCGFTDEEKKECFLVMELMTRDLCSCIRE  318

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G RKR+ FS+P+AVD+MLQI+RGMEYLHS+ I+HG LNPSNIL++P +   E Y H+K
Sbjct  319  TCGPRKRIPFSLPIAVDLMLQISRGMEYLHSKEIYHGNLNPSNILVKPRNITSEGYLHAK  378

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGLS +K+ +T +N    +  +   IWYAPE+L E+EQ  GS K+ +K++EKADVYS
Sbjct  379  VSGFGLSSIKN-FTPKNSSNQNETLS-FIWYAPEILEEKEQT-GSEKN-SKYTEKADVYS  434

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CFQ+LTGK PFE+    LQGD M  +++AGERPLFP+  PKY+TNL ++CWHT PN
Sbjct  435  FGMVCFQLLTGKVPFEDSH--LQGDNMSRNILAGERPLFPFYSPKYVTNLTKRCWHTDPN  492

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGH-PDCPPPLVDYCDIEAGYIKKFPGDNVPPG--V  893
             RP FSS+CRILRY+K+ L++NP++   P+ P P++DY D+E   ++KFP  +      V
Sbjct  493  QRPSFSSICRILRYVKRFLIMNPDYNREPETPMPVIDYGDMETKLLRKFPSWDTAESSMV  552

Query  894  SEIPFQMFAYKLVEKEK  944
            ++IPFQMF Y++VEKEK
Sbjct  553  AQIPFQMFVYRVVEKEK  569



>ref|XP_002303628.2| hypothetical protein POPTR_0003s13680g [Populus trichocarpa]
 gb|EEE78607.2| hypothetical protein POPTR_0003s13680g [Populus trichocarpa]
Length=713

 Score =   379 bits (973),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 187/317 (59%), Positives = 237/317 (75%), Gaps = 8/317 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+ +   L  EI+ ++SLSHPN++QY CGFYDE +KE FLVMELM+K    +IKE
Sbjct  259  FALRHFFHDFEPLNSEISMLLSLSHPNIVQYLCGFYDENKKECFLVMELMTKDFYSYIKE  318

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            NS  +KR+ F +P  VD+MLQIARGME+LHSR I+ G+ NPSN+LL+P  S  E YFH K
Sbjct  319  NSSPKKRVLFPLPTVVDIMLQIARGMEFLHSRKIYVGDFNPSNVLLKPRKS-TEGYFHVK  377

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGL+ +K+  +  + P  S  VD  IW+APEVLAEQEQ R +  S  K++EKADVYS
Sbjct  378  VSGFGLTSVKNHSSRHSSPEPS-PVDTCIWHAPEVLAEQEQARNA--SSKKYTEKADVYS  434

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGMLCFQ+LTGK PFE+G   LQGD+M++++ AGERPLFP   PKYL +L +KCWHT P+
Sbjct  435  FGMLCFQLLTGKLPFEDGH--LQGDQMINNIRAGERPLFPSLSPKYLVSLTKKCWHTEPS  492

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNV--PPGVS  896
             RP F S+CR+LRYIKK LV+NP  G P    P VD+ D+EAG++KK  G+     P VS
Sbjct  493  YRPTFLSICRVLRYIKKFLVMNPNDGQPYIQSPPVDFYDLEAGFLKKCQGEVTCDLPSVS  552

Query  897  EIPFQMFAYKLVEKEKT  947
            +IPFQMF+Y+L+EKEKT
Sbjct  553  QIPFQMFSYRLIEKEKT  569



>ref|XP_002320182.1| hypothetical protein POPTR_0014s09090g [Populus trichocarpa]
 gb|EEE98497.1| hypothetical protein POPTR_0014s09090g [Populus trichocarpa]
Length=634

 Score =   375 bits (964),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 180/317 (57%), Positives = 243/317 (77%), Gaps = 9/317 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             ALR F+G+I  L PEI++++SLSHPN+LQ+ CGF DEE+KE FLVMELM++ L   I+E
Sbjct  259  LALRHFFGDIEPLFPEISSLLSLSHPNILQFFCGFTDEEKKECFLVMELMTRDLCSCIRE  318

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G RKR+ FS+P+AVD+MLQI+RGMEYLHS+ I+HG LNPSNIL++P +   E Y H+K
Sbjct  319  TCGPRKRIPFSLPIAVDLMLQISRGMEYLHSKEIYHGNLNPSNILVKPRNITSEGYLHAK  378

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGLS +K+ +T +N    +  +   IWYAPE+L E+EQ  GS K+ +K++EKADVYS
Sbjct  379  VSGFGLSSIKN-FTPKNSSNQNETLS-FIWYAPEILEEKEQT-GSEKN-SKYTEKADVYS  434

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CFQ+LTGK PFE+    LQGD M  +++AGERPLFP+  PKY+TNL ++CWHT PN
Sbjct  435  FGMVCFQLLTGKVPFEDSH--LQGDNMSRNILAGERPLFPFYSPKYVTNLTKRCWHTDPN  492

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGH-PDCPPPLVDYCDIEAGYIKKFPGDNVPPG--V  893
             RP FSS+CRILRY+K+ L++NP++   P+ P P++DY D+E   ++KFP  +      V
Sbjct  493  QRPSFSSICRILRYVKRFLIMNPDYNREPEPPMPVIDYGDMETKLLRKFPSWDTAESSMV  552

Query  894  SEIPFQMFAYKLVEKEK  944
            ++IPFQMF Y++VEKEK
Sbjct  553  AQIPFQMFVYRVVEKEK  569



>ref|NP_564829.1| putative serine/threonine/tyrosine kinase [Arabidopsis thaliana]
 ref|NP_001031229.1| putative serine/threonine/tyrosine kinase [Arabidopsis thaliana]
 gb|AAL11555.1|AF424561_1 At1g64300/F15H21_13 [Arabidopsis thaliana]
 gb|AAM98332.1| At1g64300/F15H21_13 [Arabidopsis thaliana]
 gb|AEE34223.1| protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE34224.1| protein kinase-like protein [Arabidopsis thaliana]
Length=717

 Score =   378 bits (970),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 181/316 (57%), Positives = 234/316 (74%), Gaps = 6/316 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+G++  L  EI++++SL H N+LQY CGFYDEERKE  LVMELM K L  ++KE
Sbjct  262  FVLRHFFGDLEPLNAEISSLLSLCHSNILQYLCGFYDEERKECSLVMELMHKDLKSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQIARGMEYLHS  IFHG+LNP NILL+  S   E YFH+K
Sbjct  322  NCGPRRRYLFSVPVVIDIMLQIARGMEYLHSNEIFHGDLNPMNILLKERSHT-EGYFHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGL+ +K+Q   R   R +   DPVIWYAPEVLAE EQ    +   +KF+ KADVYS
Sbjct  381  ISGFGLTSVKNQSFSRASSRPTTP-DPVIWYAPEVLAEMEQDLKGTAPRSKFTHKADVYS  439

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF+++TGK PFE+    LQGDKM  ++  GERPLFP+P PKYL +LI++CWH+ P+
Sbjct  440  FAMVCFELITGKVPFEDDH--LQGDKMAKNIRTGERPLFPFPSPKYLVSLIKRCWHSEPS  497

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG--VS  896
             RP FSS+CRILRYIKK LV+NP+HGH     PLVD  D+EA ++KKF  ++      V+
Sbjct  498  QRPTFSSICRILRYIKKFLVVNPDHGHLQIQNPLVDCWDLEARFLKKFSMESGSHAGSVT  557

Query  897  EIPFQMFAYKLVEKEK  944
            +IPFQ+++Y++ EKEK
Sbjct  558  QIPFQLYSYRIAEKEK  573



>ref|XP_004516399.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
isoform X1 [Cicer arietinum]
Length=682

 Score =   376 bits (966),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 194/344 (56%), Positives = 243/344 (71%), Gaps = 15/344 (4%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F +R F G+I AL PEI  ++SLSHPN++   CGF DEERKE FL+MELMSK+L  HIKE
Sbjct  259   FVIRHFSGDIDALEPEIKELLSLSHPNIMDCLCGFTDEERKECFLLMELMSKTLSTHIKE  318

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G RKR+ F + VA+D+MLQIARGMEYLH + ++HGELNPSNIL++P S+  E Y H+K
Sbjct  319   IHGPRKRIPFLLHVAIDLMLQIARGMEYLHLKKVYHGELNPSNILVKPRSTSPEGYLHAK  378

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             VSGFGLS +K      N  +   G    IWY+PEVL EQEQ  GSS S  K++EK+D+YS
Sbjct  379   VSGFGLSSVKDLNQKGNANQ--NGTLSFIWYSPEVLEEQEQSGGSSIS--KYTEKSDMYS  434

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CF++LTGK PFE+    LQG+KM  ++ AGERPLFP   PKYL NL +KCWHT PN
Sbjct  435   FGMVCFELLTGKVPFEDSH--LQGEKMSRNIRAGERPLFPLNSPKYLINLTKKCWHTDPN  492

Query  723   ARPGFSSVCRILRYIKKVLVINPEHG-HPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGV  893
              RP FSS+CR+LRYIK+ L +NP +   PD P P VDYCDIE+  ++KFP  G +    +
Sbjct  493   QRPNFSSICRVLRYIKRFLALNPGYNKEPDPPMPPVDYCDIESAILRKFPSWGSSESSPI  552

Query  894   SEIPFQMFAYKLVEKEK--TLGND----GFAVRARDDHLVSMDD  1007
             S IPFQMF+Y++VE+EK  T   D    G  V A  D LV+  D
Sbjct  553   SNIPFQMFSYRVVEREKISTCCKDNSESGSDVSACGDDLVTSGD  596



>ref|XP_010418486.1| PREDICTED: serine/threonine-protein kinase Nek4-like isoform 
X1 [Camelina sativa]
 ref|XP_010418487.1| PREDICTED: serine/threonine-protein kinase Nek4-like isoform 
X2 [Camelina sativa]
Length=713

 Score =   377 bits (967),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 179/316 (57%), Positives = 233/316 (74%), Gaps = 6/316 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+G++  L  EI++++SL H N+LQY CGFYDEERKE  LVMELM K L  ++KE
Sbjct  260  FVLRHFFGDLEPLNAEISSLLSLCHSNILQYLCGFYDEERKECSLVMELMHKDLKSYMKE  319

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQIARGMEYLHS  IFHG+LNP NILL+  S   E YFH+K
Sbjct  320  NCGPRRRYLFSVPVVIDIMLQIARGMEYLHSNEIFHGDLNPMNILLKERSHT-EGYFHAK  378

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGL+ +K+Q   R   R +   DP+IWYAPEVL+E EQ    +   +KF+ KADVYS
Sbjct  379  ISGFGLTSVKNQSFSRASSRPTTP-DPIIWYAPEVLSEMEQDLKGTAPRSKFTHKADVYS  437

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF+++TGK PFE+    LQGD M  ++  GERPLFP+P PKYL +LI++CWH+ PN
Sbjct  438  FAMVCFELITGKVPFEDSH--LQGDHMAKNIRTGERPLFPFPSPKYLVSLIKRCWHSQPN  495

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG--VS  896
             RP FSS+CRILRYIKK LV+NP+HGH     PLVD  D+EA ++KKF  ++      V+
Sbjct  496  QRPTFSSICRILRYIKKFLVVNPDHGHLQIQNPLVDCWDLEARFLKKFSMESGSHAGSVT  555

Query  897  EIPFQMFAYKLVEKEK  944
            +IPFQ+++Y++ EKEK
Sbjct  556  QIPFQLYSYRVTEKEK  571



>ref|XP_010473689.1| PREDICTED: serine/threonine-protein kinase Nek4-like [Camelina 
sativa]
Length=713

 Score =   376 bits (966),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 179/316 (57%), Positives = 233/316 (74%), Gaps = 6/316 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+G++  L  EI++++SL H N+LQY CGFYDEERKE  LVMELM K L  ++KE
Sbjct  260  FVLRHFFGDLEPLNAEISSLLSLCHSNILQYLCGFYDEERKECSLVMELMHKDLKSYMKE  319

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQIARGMEYLHS  IFHG+LNP NILL+  S   E YFH+K
Sbjct  320  NCGPRRRYLFSVPVVIDIMLQIARGMEYLHSNEIFHGDLNPMNILLKERSHT-EGYFHAK  378

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGL+ +K+Q   R   R +   DP+IWYAPEVL+E EQ    +   +KF+ KADVYS
Sbjct  379  ISGFGLTSVKNQSFSRASSRPTTP-DPIIWYAPEVLSEMEQDLKGTAPRSKFTHKADVYS  437

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF+++TGK PFE+    LQGD M  ++  GERPLFP+P PKYL +LI++CWH+ PN
Sbjct  438  FAMVCFELITGKVPFEDSH--LQGDHMAKNIRTGERPLFPFPSPKYLVSLIKRCWHSQPN  495

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG--VS  896
             RP FSS+CRILRYIKK LV+NP+HGH     PLVD  D+EA ++KKF  ++      V+
Sbjct  496  QRPTFSSICRILRYIKKFLVVNPDHGHLQIQNPLVDCWDLEARFLKKFSMESGSHAGSVT  555

Query  897  EIPFQMFAYKLVEKEK  944
            +IPFQ+++Y++ EKEK
Sbjct  556  QIPFQLYSYRVTEKEK  571



>ref|XP_010674040.1| PREDICTED: uncharacterized protein LOC104890305 [Beta vulgaris 
subsp. vulgaris]
Length=679

 Score =   374 bits (961),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 189/375 (50%), Positives = 262/375 (70%), Gaps = 29/375 (8%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F LR   G+I +L PEI+ ++SLSHPN+LQ+ CGF D+E+KE FLV E MS++L +H+KE
Sbjct  259   FVLRHIKGDIESLIPEISQLLSLSHPNILQFLCGFVDDEKKECFLVTEQMSRNLGIHVKE  318

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
                 RKR+  S+PVAVDVMLQIARGMEYLHS+ I+HG+L PSNIL +P ++  E + H K
Sbjct  319   FYNPRKRLPLSLPVAVDVMLQIARGMEYLHSKKIYHGDLKPSNILTKPRNNSSEGFVHVK  378

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             V+ FGLS + S+         S  V   IW++PEVL EQE+ +G  +  AK++EK+DVYS
Sbjct  379   VTRFGLSTLTSKNQ-----NLSEEVS-YIWHSPEVLTEQEELKGVPE--AKYTEKSDVYS  430

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PKY+TNL R+CWH+ P+
Sbjct  431   FGMICFELLTGKVPFEDAH--LQGDKMSRNIRAGERPLFPHHCPKYVTNLTRRCWHSDPD  488

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPG--DNVP-PGV  893
              RP F S+CRILRYIK+ L++NPE+ HP+ P PLVDYCDIE+G++K+FP   ++ P P V
Sbjct  489   QRPTFPSICRILRYIKRFLMMNPEYSHPNNPVPLVDYCDIESGFLKRFPSWINSEPYPPV  548

Query  894   SEIPFQMFAYKLVEKEKTL--------GNDGFAVRARDDHLVSMDDLCLV--------PN  1025
             SEIPFQ+FAY+++E+EK +             A  + D+H+ + ++  +         P+
Sbjct  549   SEIPFQIFAYRVMEREKCISYIKDTSESGSEVAYTSGDEHMTTANETLISVVEKKNPKPD  608

Query  1026  NGTRGRLSTCSEIID  1070
               T+ RLS  +  +D
Sbjct  609   EYTKRRLSLNNRSLD  623



>ref|XP_010430555.1| PREDICTED: serine/threonine-protein kinase Nek4-like [Camelina 
sativa]
Length=713

 Score =   375 bits (964),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 178/316 (56%), Positives = 232/316 (73%), Gaps = 6/316 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+G++  L  EI++++SL H N+LQY CGFYDEERKE  LVMELM K L  ++KE
Sbjct  260  FVLRHFFGDLEPLNAEISSLLSLCHSNILQYLCGFYDEERKECSLVMELMHKDLKSYMKE  319

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQIARGMEYLHS  IFHG+LNP NI L+  S   E YFH+K
Sbjct  320  NCGPRRRYLFSVPVVIDIMLQIARGMEYLHSNEIFHGDLNPMNIFLKERSHT-EGYFHAK  378

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGL+ +K+Q   R   R +   DP+IWYAPEVL+E EQ    +   +KF+ KADVYS
Sbjct  379  ISGFGLTSVKNQSFSRASSRPTTP-DPIIWYAPEVLSEMEQDLKGTAPRSKFTHKADVYS  437

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF+++TGK PFE+    LQGD M  ++  GERPLFP+P PKYL +LI++CWH+ PN
Sbjct  438  FAMVCFELITGKVPFEDSH--LQGDHMAKNIRTGERPLFPFPSPKYLVSLIKRCWHSQPN  495

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG--VS  896
             RP FSS+CRILRYIKK LV+NP+HGH     PLVD  D+EA ++KKF  ++      V+
Sbjct  496  QRPTFSSICRILRYIKKFLVVNPDHGHLQIQNPLVDCWDLEARFLKKFSMESGSHAGSVT  555

Query  897  EIPFQMFAYKLVEKEK  944
            +IPFQ+++Y++ EKEK
Sbjct  556  QIPFQLYSYRITEKEK  571



>ref|NP_198988.1| protein kinase [Arabidopsis thaliana]
 dbj|BAB08932.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED94717.1| protein kinase [Arabidopsis thaliana]
Length=711

 Score =   375 bits (963),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 179/317 (56%), Positives = 235/317 (74%), Gaps = 11/317 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+ ++  L  EI+++++L H N+LQY CGFYDEERKE FLVMELM K L  ++KE
Sbjct  262  FALRHFFSDLEPLSSEISSLLALCHSNILQYLCGFYDEERKECFLVMELMHKDLQSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FSIPV +D+MLQIARGMEYLH  +IFHG+LNP NI L+  S   E YFH+K
Sbjct  322  NCGPRRRYLFSIPVVIDIMLQIARGMEYLHGNDIFHGDLNPMNIHLKERSHT-EGYFHAK  380

Query  363  VSGFGL-SMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVY  539
            + GFGL S++K+Q + +      G  DPVIWYAPEVLAE EQ        +K + KADVY
Sbjct  381  ICGFGLSSVVKAQSSSK-----PGTPDPVIWYAPEVLAEMEQDLNGKTPKSKLTHKADVY  435

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SF M+CF+++TGK PFE+    LQG+ M  ++  GERPLFP+P PKYL +LI++CWH+ P
Sbjct  436  SFAMVCFELITGKVPFEDSH--LQGEPMTINIRMGERPLFPFPSPKYLVSLIKRCWHSEP  493

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD--NVPPGV  893
            + RP FSS+CRILRYIKK LV+NP+HGHP    PLVD  D+EA +++KFPGD  +    V
Sbjct  494  SQRPNFSSICRILRYIKKFLVVNPDHGHPQMQTPLVDCWDLEARFLRKFPGDAGSHTASV  553

Query  894  SEIPFQMFAYKLVEKEK  944
            ++IPFQ+++Y+++EKEK
Sbjct  554  NQIPFQLYSYRVLEKEK  570



>ref|XP_002887904.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64163.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=715

 Score =   375 bits (963),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 180/316 (57%), Positives = 234/316 (74%), Gaps = 6/316 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+G++  L  EI++++SL H N+LQY CGFYDEERKE  LVMELM K L  ++KE
Sbjct  262  FVLRHFFGDLEPLNAEISSLLSLCHSNILQYLCGFYDEERKECSLVMELMHKDLKSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQIARGMEYLHS  IFHG+LNP NILL+  S   E YFH+K
Sbjct  322  NCGPRRRYLFSVPVVIDIMLQIARGMEYLHSNEIFHGDLNPMNILLKERSHT-EGYFHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGL+ +K+Q   R   R +   DPVIWYAPEVLAE EQ    +   +KF+ KADVYS
Sbjct  381  ISGFGLTSVKNQSFSRASSRPTTP-DPVIWYAPEVLAEMEQDLKGTAPRSKFTHKADVYS  439

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF+++TGK PFE+    LQG+KM  ++  GERPLFP+P PKYL +LI++CWH+ P+
Sbjct  440  FAMVCFELITGKVPFEDDH--LQGEKMAKNIRTGERPLFPFPSPKYLVSLIKRCWHSEPS  497

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG--VS  896
             RP FSS+CRILRYIKK LV+NP+HGH     PLVD  D+EA ++KKF  ++      V+
Sbjct  498  QRPTFSSICRILRYIKKFLVVNPDHGHLQIQNPLVDCWDLEARFLKKFSMESGSHAGSVT  557

Query  897  EIPFQMFAYKLVEKEK  944
            +IPFQ+++Y++ EKEK
Sbjct  558  QIPFQLYSYRIAEKEK  573



>gb|KCW77427.1| hypothetical protein EUGRSUZ_D01773, partial [Eucalyptus grandis]
Length=629

 Score =   372 bits (956),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 244/346 (71%), Gaps = 20/346 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F +   +GE G  + EI+T++SLSHPNVL Y C F DEE+ E FLV EL++KSL  HIKE
Sbjct  262   FVMHHLFGEAGPSKGEISTLLSLSHPNVLHYFCAFCDEEKNECFLVAELINKSLACHIKE  321

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             NS  ++R+ FS+ V VD+M+QIARG+EYLHS+ I+HG+LNP+ ILL+P  +  E Y++ K
Sbjct  322   NSNPKRRVLFSLLVVVDIMIQIARGLEYLHSQKIYHGDLNPTKILLKP-RTISEGYYYVK  380

Query  363   VSGFGLS--MMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADV  536
             V+G+G S  + ++ ++F N        +P+IWYAPEVL E E+P G SKS  K+SEKADV
Sbjct  381   VAGYGSSGALDRNSHSFPN----QDSTNPLIWYAPEVLTEMEKPEGDSKS--KYSEKADV  434

Query  537   YSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTS  716
             YSFGM+CFQ+LTGK PFEEG   L+GDKM  ++ AGERPLF +P P+YL N  R+CW T 
Sbjct  435   YSFGMICFQLLTGKIPFEEGH--LEGDKMSRNIRAGERPLFSFPSPRYLVNFTRRCWQTE  492

Query  717   PNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPGVS  896
             P+ RP FSS+CRILRYIKK LV+NP++GHP+   P VD CDIEAG+ +KF        V+
Sbjct  493   PSLRPSFSSICRILRYIKKFLVMNPDNGHPELQSPPVDCCDIEAGFQRKFSASGNSIAVT  552

Query  897   EIPFQMFAYKLVEKEKTLGNDGFAV---------RARDDHLVSMDD  1007
             +IPF MFAYKL E +KT  +    +           +D++L++ DD
Sbjct  553   QIPFHMFAYKLAELDKTRLSTKVGISETASEVETTCKDENLLAEDD  598



>ref|XP_006301064.1| hypothetical protein CARUB_v10021457mg [Capsella rubella]
 gb|EOA33962.1| hypothetical protein CARUB_v10021457mg [Capsella rubella]
Length=715

 Score =   375 bits (962),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 177/316 (56%), Positives = 232/316 (73%), Gaps = 6/316 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+G++  L  EI++++SL H N+LQY CGFYDEERKE  LVMELM K L  ++KE
Sbjct  262  FVLRHFFGDLEPLNTEISSLLSLCHSNILQYLCGFYDEERKECSLVMELMHKDLKSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+ V +D+MLQIARGMEYLHS  IFHG+LNP NILL+  S   E YFH+K
Sbjct  322  NCGPRRRYLFSVTVVIDIMLQIARGMEYLHSNEIFHGDLNPMNILLKERSHT-EGYFHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGL+ +K+Q   R   R +   DP+IWYAPEVLAE E+    +   +KF+ KADVYS
Sbjct  381  ISGFGLTSVKNQSFSRASSRPTTP-DPIIWYAPEVLAEMEKDLKGTAPRSKFTHKADVYS  439

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF+++TGK PFE+    LQGD M  ++  GERPLFP+P PKYL +LI++CWH+ PN
Sbjct  440  FAMVCFELITGKVPFEDSH--LQGDNMAKNIRTGERPLFPFPSPKYLVSLIKRCWHSEPN  497

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG--VS  896
             RP FSS+CRILRYIKK LV+NP+ GH     PL+D CD+EA ++KKF  ++      V+
Sbjct  498  QRPTFSSICRILRYIKKFLVVNPDQGHLQIQNPLIDCCDLEARFLKKFSLESGSHAGSVT  557

Query  897  EIPFQMFAYKLVEKEK  944
            +IPFQ+++Y++ EKEK
Sbjct  558  QIPFQLYSYRITEKEK  573



>ref|XP_010553553.1| PREDICTED: serine/threonine-protein kinase MARK2-like [Tarenaya 
hassleriana]
 ref|XP_010553554.1| PREDICTED: serine/threonine-protein kinase MARK2-like [Tarenaya 
hassleriana]
Length=713

 Score =   374 bits (960),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 202/375 (54%), Positives = 262/375 (70%), Gaps = 18/375 (5%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA+R F+G++  L  EI++++SLSHPN+LQY  GFYDEERKE FLVMELM K L  ++KE
Sbjct  263   FAVRHFFGDLEPLSLEISSLLSLSHPNILQYLSGFYDEERKECFLVMELMHKDLLSYMKE  322

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             +SG R+R  FSIPV +D+MLQ+ARGMEYLHS++I HG+LNP+NILLR  S   E YFH+K
Sbjct  323   HSGPRRRYLFSIPVVIDIMLQVARGMEYLHSKDILHGDLNPTNILLRERSH-SEGYFHAK  381

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQ-PRGSSKSGAKFSEKADVY  539
             +SGFGLS +K Q T   C       DPVIWYAPEVL E EQ P G  +S  KF+ KADVY
Sbjct  382   ISGFGLSSVKMQST--RCSTRPNTPDPVIWYAPEVLTELEQDPYGIPRS--KFTHKADVY  437

Query  540   SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
             SF M+CF+++TGK PFE+G   LQG++M  ++  GERPLFP+P PKYL +LI++CW + P
Sbjct  438   SFAMVCFELITGKVPFEDGH--LQGERMAKNIRMGERPLFPFPSPKYLVDLIKRCWSSEP  495

Query  720   NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPGVSE  899
             + RP FSSVCRILRYIKK LV+NP+HGHP    PLVD  D+E  +++ FP +     V++
Sbjct  496   SQRPTFSSVCRILRYIKKFLVVNPDHGHPQMQSPLVDCWDLEVRFLRMFPVEGHANPVTQ  555

Query  900   IPFQMFAYKLVEKEKTL--GNDGFAVRARDDHLVSMDDLCLVPNNGTRGRLSTCSEIIDR  1073
             IPFQ+FAY++ EKEKT     +G +  +     VSM +   VP   T+   S C + I  
Sbjct  556   IPFQIFAYRVAEKEKTFPSSKEGNSEASETSESVSMVEDPPVPLRDTK---SLCLDTI--  610

Query  1074  NDLGTFADQRSAISE  1118
                  ++D RS  SE
Sbjct  611   ---SEYSDTRSVYSE  622



>ref|XP_009336247.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Pyrus x bretschneideri]
 ref|XP_009336248.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Pyrus x bretschneideri]
Length=741

 Score =   374 bits (960),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 194/375 (52%), Positives = 254/375 (68%), Gaps = 14/375 (4%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA+R F+G+I  L  EI+T+++LSHPNVLQY  GFYDEE+KE FLVMELM+K L  ++KE
Sbjct  262   FAMRHFFGDIEPLNSEISTLLALSHPNVLQYLSGFYDEEKKECFLVMELMNKDLRCYMKE  321

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             N G R+++ FSIPV VD+MLQIARGMEYLHSR I+HGELNP N+ L+  S   E YF  K
Sbjct  322   NCGVRRQVLFSIPVVVDIMLQIARGMEYLHSRKIYHGELNPLNVFLKARSCT-EGYFQVK  380

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             VSGFGLS ++   T+R   +    ++P+IW APEVLAEQEQP   +K   K++EKADVYS
Sbjct  381   VSGFGLSSVRKP-TYRK-SQQKNEINPLIWCAPEVLAEQEQP--GNKGLTKYTEKADVYS  436

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             F MLCF+ILTGK PFE+    LQGDKM +++ AG RPLFPYP PKYL NL ++CWH+ P 
Sbjct  437   FAMLCFEILTGKVPFEDSH--LQGDKMSNTIRAGGRPLFPYPSPKYLVNLTKRCWHSDPT  494

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVP--PGVS  896
              R  FSS+CR+LRYIKK L +NP    P    P +DYC+IE+ ++K            +S
Sbjct  495   QRLSFSSICRVLRYIKKFLTLNPYDDQPLLQSPPMDYCEIESWFLKNSSAAEYADLSSIS  554

Query  897   EIPFQMFAYKLVEKEKTLGNDGFAVRARDDHLVSMDDLCLVPNNGTRGRLSTCSEIIDRN  1076
             ++PFQMF+Y+L EKEKT   D   VR+ D    +   +C    N   G++ T S  +  +
Sbjct  555   QLPFQMFSYRLGEKEKT-SPDIVRVRSLDSLSDTASAIC--KQNSPNGKVDTVS--VAED  609

Query  1077  DLGTFADQRSAISEI  1121
                  ++ RS  S++
Sbjct  610   PFVPLSESRSVCSDV  624



>ref|XP_006391646.1| hypothetical protein EUTSA_v10023305mg [Eutrema salsugineum]
 gb|ESQ28932.1| hypothetical protein EUTSA_v10023305mg [Eutrema salsugineum]
Length=714

 Score =   373 bits (957),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/316 (57%), Positives = 231/316 (73%), Gaps = 6/316 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+G++  L  EI++++SL H N+LQY CGFYDEERKE  LVMELM K L  ++KE
Sbjct  262  FVLRHFFGDLEPLAEEISSLLSLCHSNILQYLCGFYDEERKEISLVMELMHKDLKSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQIARGMEYLHS  IFHG+LNP NILL+  S   E YFH+K
Sbjct  322  NCGPRRRYLFSVPVVIDIMLQIARGMEYLHSNEIFHGDLNPMNILLKERSHT-EGYFHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGL  +K+Q   R   R +   DPVIWYAPEVLAE +Q        +KF+ KADVYS
Sbjct  381  ISGFGLISVKTQSFTRASSRPTTP-DPVIWYAPEVLAEMDQDLKGRAPRSKFTHKADVYS  439

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF+++TGK PFE+    LQGDKM  ++  GERPLFP+P PKYL +LI++CWHT P+
Sbjct  440  FAMVCFELITGKVPFEDSH--LQGDKMAKNIRNGERPLFPFPSPKYLVSLIKRCWHTEPS  497

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGVS  896
             RP FSS+CRILRYIKK LV+NP+HGH     PLVD  D+EA +++KF     +    V+
Sbjct  498  QRPTFSSICRILRYIKKFLVVNPDHGHIQIQNPLVDCWDLEARFLRKFSLESGSHAESVT  557

Query  897  EIPFQMFAYKLVEKEK  944
            +IPFQ+++Y++ EKEK
Sbjct  558  QIPFQLYSYRIAEKEK  573



>ref|XP_010053169.1| PREDICTED: uncharacterized protein LOC104441681 [Eucalyptus grandis]
Length=722

 Score =   373 bits (957),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 244/346 (71%), Gaps = 20/346 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F +   +GE G  + EI+T++SLSHPNVL Y C F DEE+ E FLV EL++KSL  HIKE
Sbjct  262   FVMHHLFGEAGPSKGEISTLLSLSHPNVLHYFCAFCDEEKNECFLVAELINKSLACHIKE  321

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             NS  ++R+ FS+ V VD+M+QIARG+EYLHS+ I+HG+LNP+ ILL+P  +  E Y++ K
Sbjct  322   NSNPKRRVLFSLLVVVDIMIQIARGLEYLHSQKIYHGDLNPTKILLKP-RTISEGYYYVK  380

Query  363   VSGFGLS--MMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADV  536
             V+G+G S  + ++ ++F N        +P+IWYAPEVL E E+P G SKS  K+SEKADV
Sbjct  381   VAGYGSSGALDRNSHSFPN----QDSTNPLIWYAPEVLTEMEKPEGDSKS--KYSEKADV  434

Query  537   YSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTS  716
             YSFGM+CFQ+LTGK PFEEG   L+GDKM  ++ AGERPLF +P P+YL N  R+CW T 
Sbjct  435   YSFGMICFQLLTGKIPFEEGH--LEGDKMSRNIRAGERPLFSFPSPRYLVNFTRRCWQTE  492

Query  717   PNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPGVS  896
             P+ RP FSS+CRILRYIKK LV+NP++GHP+   P VD CDIEAG+ +KF        V+
Sbjct  493   PSLRPSFSSICRILRYIKKFLVMNPDNGHPELQSPPVDCCDIEAGFQRKFSASGNSIAVT  552

Query  897   EIPFQMFAYKLVEKEKTLGNDGFAV---------RARDDHLVSMDD  1007
             +IPF MFAYKL E +KT  +    +           +D++L++ DD
Sbjct  553   QIPFHMFAYKLAELDKTRLSTKVGISETASEVETTCKDENLLAEDD  598



>ref|XP_008239072.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Prunus mume]
Length=738

 Score =   373 bits (958),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 233/320 (73%), Gaps = 15/320 (5%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G++  L  EI+T++SLSHP+VLQY CGFYDEE+KE FLVMELMSK L  ++KE
Sbjct  261  FALRHFFGDLEPLNSEISTLLSLSHPHVLQYLCGFYDEEKKECFLVMELMSKDLRCYMKE  320

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+++ FSIPV VD+MLQIARGMEYLHSR I+HGELNP N+ L+  S   E YF  K
Sbjct  321  NRGARRQVLFSIPVVVDIMLQIARGMEYLHSRKIYHGELNPCNVFLKARSCT-EGYFQVK  379

Query  363  VSGFGLSMM---KSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKAD  533
            VSGFGLS +    S+Y+     +    ++P+IW APEVLAEQEQP  + ++  K++EKAD
Sbjct  380  VSGFGLSSVHKPTSRYS-----QQQNEINPLIWCAPEVLAEQEQPGNNRRT--KYTEKAD  432

Query  534  VYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHT  713
            VYSF MLCF++LTGK PFE+    LQGDKM  ++ AG RPLFP+P PKYL NL ++CWHT
Sbjct  433  VYSFAMLCFELLTGKVPFEDSH--LQGDKMSRTIRAGGRPLFPFPSPKYLVNLTKRCWHT  490

Query  714  SPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKK--FPGDNVPP  887
             P+ R  FSS+CRILRYIK  L +NP+   P    P +DYC+IE  ++K     G     
Sbjct  491  DPSQRLTFSSICRILRYIKNFLTLNPDDDQPILQSPPMDYCEIETWFLKNSSAAGYADLS  550

Query  888  GVSEIPFQMFAYKLVEKEKT  947
             +S++PFQMF+Y+L EKEKT
Sbjct  551  SISQLPFQMFSYRLGEKEKT  570



>ref|XP_002509924.1| serine-threonine protein kinase, putative [Ricinus communis]
 gb|EEF51311.1| serine-threonine protein kinase, putative [Ricinus communis]
Length=714

 Score =   372 bits (956),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 184/317 (58%), Positives = 234/317 (74%), Gaps = 8/317 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+ +I  L  EI+ ++SLSHPN++QY CGFYDEE+KE FLVMELMSK L  ++KE
Sbjct  260  FALRHFFEDIEPLNSEISVLLSLSHPNIVQYLCGFYDEEKKECFLVMELMSKDLYAYMKE  319

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            NS  R+++ F +P+ VD+MLQ+ARGME+LHSR I+ G+LNP+NI L+P  S  E YFH K
Sbjct  320  NSSSRRQVLFPLPIVVDIMLQVARGMEFLHSRKIYVGDLNPTNIFLKPRKST-EGYFHVK  378

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGL+ +++  + R+        DP IW+APEVLAE+EQ    S S  K SEKADVYS
Sbjct  379  VSGFGLTYIENPSS-RHSSSNQNAFDPCIWHAPEVLAEREQT--GSPSTRKHSEKADVYS  435

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGMLCFQ+LTGK PFE+G   LQGD+M  ++ AGERPLFP   PKYL NL +KCWHT PN
Sbjct  436  FGMLCFQLLTGKLPFEDGH--LQGDQMAKNIRAGERPLFPSLSPKYLVNLTKKCWHTDPN  493

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPG--DNVPPGVS  896
             RP FSS+ R+LRYIKK LV+NP  G      P VDY ++EAG++K++PG  +     VS
Sbjct  494  YRPSFSSISRVLRYIKKYLVMNPVDGQLVMQSPPVDYSELEAGFLKRYPGEMNGGLASVS  553

Query  897  EIPFQMFAYKLVEKEKT  947
            +IPFQMF Y++ EKE+T
Sbjct  554  QIPFQMFVYRISEKERT  570



>gb|KDP25332.1| hypothetical protein JCGZ_20488 [Jatropha curcas]
Length=693

 Score =   371 bits (952),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 177/315 (56%), Positives = 235/315 (75%), Gaps = 6/315 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+ +   L  EI+T++SLSHPN+LQY CGFYDEE+KE FLVMELMSK L  ++KE
Sbjct  260  FVLRHFFEDFEPLSTEISTLLSLSHPNILQYLCGFYDEEKKECFLVMELMSKDLYAYMKE  319

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            NS  R+++ F +P+ VD+MLQ+ARGME+LH+R I+ G+LNP+NI L+P  S  E YFH K
Sbjct  320  NSSSRRQVLFHLPIVVDIMLQVARGMEFLHARKIYVGDLNPTNIFLKPRKST-EGYFHVK  378

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGL+ +++ ++ ++ P     +DP IWYAPEVLAE+E+  GSS    K+SEKADVYS
Sbjct  379  ISGFGLNSVEN-HSSQHTPLNQNALDPCIWYAPEVLAEKEKI-GSS-CIRKYSEKADVYS  435

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGMLCF++LTGK  FE+G   LQG++M  ++ AGERPLFP   PKYL NL +KCWH  P+
Sbjct  436  FGMLCFELLTGKLAFEDGH--LQGEQMTKNIRAGERPLFPSLSPKYLVNLTKKCWHNEPS  493

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPGVSEI  902
             RP FSS+CR+LRY+KK L +NP +G P    P +DY ++EAG++KK     +  GV++I
Sbjct  494  CRPSFSSICRVLRYVKKFLAMNPSNGQPVMQSPPLDYYELEAGFLKKHATGEMKCGVTQI  553

Query  903  PFQMFAYKLVEKEKT  947
            PFQMF Y + EKEKT
Sbjct  554  PFQMFVYTVSEKEKT  568



>ref|XP_009352367.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7 [Pyrus 
x bretschneideri]
Length=705

 Score =   371 bits (952),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 181/317 (57%), Positives = 235/317 (74%), Gaps = 9/317 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA+R F+G+I  L  EI+T+++LSHPNVLQY  GFYDEE+KE FLVMELM+K L  ++KE
Sbjct  262  FAMRHFFGDIEPLNSEISTLLTLSHPNVLQYLSGFYDEEKKECFLVMELMNKDLRCYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+++ FS+PV VD+MLQIARGMEYLHSR I+HGELNP N+ L+  S   E YFH K
Sbjct  322  NCGARRQVLFSLPVVVDIMLQIARGMEYLHSRKIYHGELNPLNVFLKARSCT-EGYFHVK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGLS ++   T+R   +    ++P+IW APEVLAEQEQP   +K  +K++EKADVYS
Sbjct  381  VSGFGLSCVRKP-TYRK-SQQQNEINPLIWCAPEVLAEQEQP--GNKGRSKYTEKADVYS  436

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F MLCF++LTGK PFE+    LQGDKM +++ AG RPLFPYP PKYL NL ++CWH+ P+
Sbjct  437  FAMLCFELLTGKVPFEDSH--LQGDKMSNTIRAGGRPLFPYPSPKYLVNLTKRCWHSDPS  494

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVP--PGVS  896
             R  FSS+CR+LRYIKK L +NP+   P    P +DYC+IE+ ++K            +S
Sbjct  495  QRLSFSSICRVLRYIKKFLTLNPDDDQPILQSPPMDYCEIESWFLKNSSAALYADLSSIS  554

Query  897  EIPFQMFAYKLVEKEKT  947
            ++PFQMF+Y+L EKEKT
Sbjct  555  QLPFQMFSYRLGEKEKT  571



>ref|XP_008437968.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Cucumis melo]
Length=678

 Score =   369 bits (948),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 241/320 (75%), Gaps = 15/320 (5%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA+R F+GEI +L PEI+ ++SLSHPN+ ++ CGF DEE+KE FL+MELMS+ L  ++KE
Sbjct  259  FAMRHFFGEIESLIPEISILLSLSHPNITRFLCGFTDEEKKECFLIMELMSRDLSSYVKE  318

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G RKR+ F +PVA+D+MLQIARGMEYLHS+ ++HG+LNP NIL++P +   + Y H +
Sbjct  319  ICGPRKRIPFPLPVALDLMLQIARGMEYLHSKKVYHGDLNPCNILVKPRAYSTDGYVHGQ  378

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGL  +K    F+N    +  + P IWYAPEVL EQ+Q  GS++S +K++EK+DVYS
Sbjct  379  VSGFGLPAVK----FKNSSNQNESL-PFIWYAPEVLEEQDQS-GSAES-SKYTEKSDVYS  431

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+ +PKY+TNL ++CWHT PN
Sbjct  432  FGMVCFEVLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPHSMPKYVTNLTKRCWHTDPN  489

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPP-PLVDYCDIEAGYIKKFP----GDNVPP  887
             RP F+S+CRILRY K+ + +NP++     P  P VDYCDIE+G +++ P     D   P
Sbjct  490  QRPSFTSICRILRYTKRFVAMNPDYNSQTDPAMPTVDYCDIESGLLRRLPPCGISDAASP  549

Query  888  GVSEIPFQMFAYKLVEKEKT  947
             +++IPFQMFAY++VEKE+ 
Sbjct  550  -ITDIPFQMFAYRIVEKERA  568



>ref|XP_009377265.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Pyrus x bretschneideri]
Length=685

 Score =   369 bits (946),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 186/347 (54%), Positives = 248/347 (71%), Gaps = 20/347 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA R   GE+  L PEI+++ SLSHPN++ + CGF DEE+   FL+MELMSK L  +IKE
Sbjct  261   FASRHVIGEVETLLPEISSLSSLSHPNIVHFLCGFTDEEKXXXFLIMELMSKDLCSYIKE  320

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G RKR+ FS+PVA+D+MLQIARGMEYLHS+ I+HG+LNPSNIL++      E Y  +K
Sbjct  321   ICGPRKRLPFSLPVAIDLMLQIARGMEYLHSKKIYHGDLNPSNILVKTRGISTEGYLQAK  380

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             VSGFGL+ +KS  T +N    +G + P+IWYAPEVL EQEQ + + K   K+SEK+DVYS
Sbjct  381   VSGFGLTSVKSP-TQKNTSNQNGSL-PLIWYAPEVLEEQEQGKSTEK---KYSEKSDVYS  435

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+   +Y+TNL +KCWH+ P 
Sbjct  436   FGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFYSLRYVTNLTKKCWHSDPY  493

Query  723   ARPGFSSVCRILRYIKKVLVINPEHG-HPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGV  893
              RP FSS+CRILRYIK+ L +NP++    D P P+VDYC+IE+G +KK P  G + P  +
Sbjct  494   QRPSFSSICRILRYIKRFLAMNPDYNSQLDPPVPMVDYCEIESGLLKKIPSWGTSEPSPI  553

Query  894   SEIPFQMFAYKLVEKEKT---------LGNDGFAVRARDDHLVSMDD  1007
             S+IPFQMF Y++ E+E+T          G+DG ++   D+ +V  DD
Sbjct  554   SQIPFQMFVYRIAERERTSSSLKDTSESGSDGASI-CGDEIVVPADD  599



>ref|XP_007210709.1| hypothetical protein PRUPE_ppa024039mg [Prunus persica]
 gb|EMJ11908.1| hypothetical protein PRUPE_ppa024039mg [Prunus persica]
Length=738

 Score =   369 bits (948),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 233/320 (73%), Gaps = 15/320 (5%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G++  L  EI+T++SLSHP+VLQY CGFYDEE+KE FLVMELMSK L  ++KE
Sbjct  261  FALRHFFGDLEPLNSEISTLLSLSHPHVLQYLCGFYDEEKKECFLVMELMSKDLRCYMKE  320

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+++ FSIPV VD+MLQIARGMEYLHSR I+HGELNP N+ L+  S   E YF  K
Sbjct  321  NRGARRQVLFSIPVVVDIMLQIARGMEYLHSRKIYHGELNPCNVFLKARSCT-EGYFQVK  379

Query  363  VSGFGLSMM---KSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKAD  533
            VSGFGLS +    S+Y+     +    ++P+IW APEVLAEQEQP  + ++  K++EKAD
Sbjct  380  VSGFGLSSVHKPTSRYS-----QQQNEINPLIWCAPEVLAEQEQPGNNRRT--KYTEKAD  432

Query  534  VYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHT  713
            VYSF MLCF++LTGK PFE+    LQGDKM  ++ AG RPLFP+P PKYL NL ++CWHT
Sbjct  433  VYSFAMLCFELLTGKVPFEDSH--LQGDKMSRTIKAGGRPLFPFPSPKYLVNLTKRCWHT  490

Query  714  SPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKK--FPGDNVPP  887
             P+ R  FSS+CRILRYIK  L +NP+   P    P +DYC+IE  ++K     G     
Sbjct  491  DPSQRLTFSSICRILRYIKNFLTLNPDDDQPILQSPPMDYCEIETWFLKNSSAAGYADLS  550

Query  888  GVSEIPFQMFAYKLVEKEKT  947
             +S++PFQMF+Y+L EKEKT
Sbjct  551  SISQLPFQMFSYRLGEKEKT  570



>ref|XP_007219478.1| hypothetical protein PRUPE_ppa021542mg [Prunus persica]
 gb|EMJ20677.1| hypothetical protein PRUPE_ppa021542mg [Prunus persica]
Length=689

 Score =   368 bits (944),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 185/345 (54%), Positives = 247/345 (72%), Gaps = 19/345 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA R F+G+I  L PEI++++SLSHPN++ + CGF DEE+KE FL+MELMS+ L  HIKE
Sbjct  261   FASRHFFGDIEPLLPEISSLLSLSHPNIVHFLCGFTDEEKKECFLIMELMSRDLCSHIKE  320

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G RKR+ FS+PVAVD+MLQIARGMEYLHS+ I+HGELNP NIL++      + Y  +K
Sbjct  321   ICGPRKRLPFSLPVAVDLMLQIARGMEYLHSKKIYHGELNPCNILVKARGISTDGYLQAK  380

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             VSGFGL+  KS  + +N    +G + P IWYAPEVL E EQ + S K   K++EK+DVYS
Sbjct  381   VSGFGLTSAKSP-SQKNLSNQNGSL-PFIWYAPEVLEEHEQTKSSEK---KYTEKSDVYS  435

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CF++LTGK PFE+    LQG+KM  ++ AGERPLFP+   +Y+TNL +KCWH+ PN
Sbjct  436   FGMVCFELLTGKVPFEDSH--LQGEKMSRNIRAGERPLFPFYSLRYVTNLTKKCWHSDPN  493

Query  723   ARPGFSSVCRILRYIKKVLVINPEHG-HPDCPPPLVDYCDIEAGYIKKFPGDNV--PPGV  893
              RP FSS+CRILRYIK+ L +NP++    D P P+VDYC+IE+G ++K P       P V
Sbjct  494   LRPSFSSICRILRYIKRFLAMNPDYNSQLDPPVPMVDYCEIESGILRKIPSWKSCEQPPV  553

Query  894   SEIPFQMFAYKLVEKEKTL-------GNDGFAVRARDDHLVSMDD  1007
             S+IPFQMF Y++ E+E+T        G+DG ++    D +V+  D
Sbjct  554   SQIPFQMFVYRIAERERTTLKDTSESGSDGASICG--DEMVTTPD  596



>emb|CBI34452.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   364 bits (935),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 188/317 (59%), Positives = 229/317 (72%), Gaps = 28/317 (9%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+GEI  L  EI++++SLSHPN++QY CGFYDEE+KE  LVME+M+K L   IKE
Sbjct  180  FALRQFFGEIEPLNSEISSLLSLSHPNIMQYLCGFYDEEKKECLLVMEMMNKDLHSQIKE  239

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N GQR+R+ F +PV VD+MLQIARGMEYLHS  ++HG+LNPSNI L+  +S  E YFH+K
Sbjct  240  NCGQRRRILFPLPVMVDLMLQIARGMEYLHSVKVYHGDLNPSNIFLKARNSSTEGYFHAK  299

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGLS +K+ +TF        G DP+IW+APEVLAEQEQ  GSS S +KFSEKADVYS
Sbjct  300  VSGFGLSSIKN-HTFSRSSPGQNGTDPLIWHAPEVLAEQEQ-LGSSCS-SKFSEKADVYS  356

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGMLCF++LTGK                       RPLFP+P  KYL NL ++CWHT P 
Sbjct  357  FGMLCFELLTGK-----------------------RPLFPFPSHKYLANLAKRCWHTDPV  393

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGVS  896
             RP FSS+CRILRYIK+ LV NP+H  P+   P VDY ++EAG++KK    G   P  VS
Sbjct  394  QRPSFSSICRILRYIKRFLVQNPDHSQPELTQPPVDYFELEAGFVKKLTVEGQLDPMPVS  453

Query  897  EIPFQMFAYKLVEKEKT  947
            +IPFQMFAY+LVEKEKT
Sbjct  454  QIPFQMFAYRLVEKEKT  470



>ref|XP_008392447.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7 [Malus 
domestica]
 ref|XP_008392448.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7 [Malus 
domestica]
Length=747

 Score =   369 bits (947),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 181/317 (57%), Positives = 232/317 (73%), Gaps = 9/317 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA+R F+G+I  L  EI+T+++LSHPNVLQY  GFYDEE+KE FLVMELM+K L  ++KE
Sbjct  262  FAMRHFFGDIEPLNSEISTLLTLSHPNVLQYLSGFYDEEKKECFLVMELMNKDLRCYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+++ FS+PV VD+MLQIARGMEYLHSR I+HGELNP N+ L+  S   E YFH K
Sbjct  322  NCGARRQVLFSLPVVVDIMLQIARGMEYLHSRKIYHGELNPLNVFLKARSCT-EGYFHVK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGLS ++   T+R   +    ++P+IW APEVLAEQEQP   +K  +K++EKADVYS
Sbjct  381  VSGFGLSCVRKP-TYRK-SQQQNEINPLIWCAPEVLAEQEQP--GNKGRSKYTEKADVYS  436

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F MLCF++LTGK PFE+    LQGDKM +++ AG RPLFPYP PKYL NL ++CWH+ P+
Sbjct  437  FAMLCFELLTGKVPFEDSH--LQGDKMSNTIRAGGRPLFPYPSPKYLVNLTKRCWHSDPS  494

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVP--PGVS  896
             R  FSS+CR LRYIKK L +NP    P    P  DYC+IE+ ++K            +S
Sbjct  495  QRLSFSSICRXLRYIKKFLTLNPXDDQPJLQSPXXDYCEIESWFLKNSSAAXYXDLSSIS  554

Query  897  EIPFQMFAYKLVEKEKT  947
            ++PFQMF+Y+L EKEKT
Sbjct  555  QLPFQMFSYRLGEKEKT  571



>ref|XP_009349671.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Pyrus x bretschneideri]
 ref|XP_009349672.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Pyrus x bretschneideri]
Length=741

 Score =   369 bits (946),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 193/375 (51%), Positives = 252/375 (67%), Gaps = 14/375 (4%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA+R F+G+I  L  EI+T+++LSHPNVLQY  GFYDEE+KE FLVMELM+K L  ++KE
Sbjct  262   FAMRHFFGDIEPLNSEISTLLTLSHPNVLQYLSGFYDEEKKECFLVMELMNKDLRCYMKE  321

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             N G R+++ FSIPV VD+MLQIARGMEYLHSR I+HGELNP N+ L+  S   E YF  K
Sbjct  322   NCGARRQVLFSIPVVVDIMLQIARGMEYLHSRKIYHGELNPLNVFLKARSCT-EGYFQVK  380

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             VSGFGLS ++   T+R   +    ++P+IW APEVLAEQEQP   +K   K++EKADVYS
Sbjct  381   VSGFGLSSVRKP-TYRK-SQQKNEINPLIWCAPEVLAEQEQP--GNKGLTKYTEKADVYS  436

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             F MLCF+ILTGK PFE+    LQGDKM +++ AG RPLFP P PKYL NL ++CWH+ P 
Sbjct  437   FAMLCFEILTGKVPFEDSH--LQGDKMSNTIRAGGRPLFPDPSPKYLVNLTKRCWHSDPT  494

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVP--PGVS  896
              R  FSS+CR+LRYIKK L +NP    P    P +DYC+IE+ ++K            +S
Sbjct  495   QRLSFSSICRVLRYIKKFLTLNPYDDQPLLQSPPMDYCEIESWFLKNSSAAEYADLSSIS  554

Query  897   EIPFQMFAYKLVEKEKTLGNDGFAVRARDDHLVSMDDLCLVPNNGTRGRLSTCSEIIDRN  1076
             ++PFQMF+Y+L EKEKT   D   VR+ D    +   +C        G++ T S  I  +
Sbjct  555   QLPFQMFSYRLGEKEKT-SPDIVRVRSLDSLSDTASAIC--KQKSPNGKVDTVS--IAED  609

Query  1077  DLGTFADQRSAISEI  1121
                  ++ RS  S++
Sbjct  610   PFVPLSESRSVCSDV  624



>ref|XP_004134312.1| PREDICTED: light-sensor Protein kinase-like [Cucumis sativus]
 ref|XP_004155893.1| PREDICTED: light-sensor Protein kinase-like [Cucumis sativus]
 gb|KGN56464.1| hypothetical protein Csa_3G120430 [Cucumis sativus]
Length=678

 Score =   366 bits (940),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/319 (54%), Positives = 239/319 (75%), Gaps = 13/319 (4%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA+R F+GEI +L PEI+ ++SLSHPN+ ++ CGF DEE+KE FL+MELMS+ L  ++KE
Sbjct  259  FAMRHFFGEIESLIPEISMLLSLSHPNITRFLCGFTDEEKKECFLIMELMSRDLSGYVKE  318

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G RKR+ F++PVA+D+MLQIARGMEYLHS+ ++HG+LNP NIL++P +   + Y H +
Sbjct  319  ICGPRKRIPFTLPVALDLMLQIARGMEYLHSKKVYHGDLNPCNILVKPRAYSTDGYVHGQ  378

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGL  +K    F+N    +  + P IWYAPEVL EQ+Q  GS++S  K++EK+DVYS
Sbjct  379  VSGFGLPAVK----FKNSSNQNESL-PFIWYAPEVLEEQDQS-GSAES-CKYTEKSDVYS  431

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+ +PKY+TNL ++CW T PN
Sbjct  432  FGMVCFEVLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPHSMPKYVTNLTKRCWQTDPN  489

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPP-PLVDYCDIEAGYIKKFPGDNVPPG---  890
             RP F+S+CRILRY K+ + +NP++     P  P VDYCDIE+G +++ P   +      
Sbjct  490  QRPSFTSICRILRYTKRFVAMNPDYNSQTDPAMPTVDYCDIESGLLRRLPSCGISDAASP  549

Query  891  VSEIPFQMFAYKLVEKEKT  947
            +++IPFQMFAY++VEKE+ 
Sbjct  550  ITDIPFQMFAYRVVEKERA  568



>ref|XP_009118811.1| PREDICTED: light-sensor Protein kinase [Brassica rapa]
Length=434

 Score =   358 bits (918),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 233/320 (73%), Gaps = 14/320 (4%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G+I AL P++ +++SLSHPN++ Y CGF DEE+KE FLVMELMSKSL  H+KE
Sbjct  49   FALRHFFGDIDALLPQVTSLLSLSHPNIVYYLCGFADEEKKECFLVMELMSKSLGTHVKE  108

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSS--PGET-YF  353
              G R++ + S+PVAVD+MLQ++RGMEYLHS+ ++HGELNPSNIL++P  S   G+  Y 
Sbjct  109  VCGPRRKNTLSLPVAVDLMLQVSRGMEYLHSKGVYHGELNPSNILVKPRRSNQTGDGHYL  168

Query  354  HSKVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKAD  533
            H K+ GFGL+ +K  ++F++   +S    P IWY+PEVL EQEQ      S  K++EK+D
Sbjct  169  HGKICGFGLTSVKG-FSFKSA--SSNESFPFIWYSPEVLEEQEQ----GGSSLKYTEKSD  221

Query  534  VYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHT  713
            VYSFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PK++TNL ++CWH 
Sbjct  222  VYSFGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFHSPKFITNLTKRCWHA  279

Query  714  SPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPP--  887
             PN RP FSS+ R+LRYIK+ L +NPE        P VDYC+IE   +KK   +      
Sbjct  280  DPNQRPSFSSISRVLRYIKRFLALNPECQQDTLVSPPVDYCEIETKLLKKLSWEKTTELV  339

Query  888  GVSEIPFQMFAYKLVEKEKT  947
             VS++PFQMFAY++VE+ KT
Sbjct  340  QVSQVPFQMFAYRVVEQAKT  359



>gb|KDP28518.1| hypothetical protein JCGZ_14289 [Jatropha curcas]
Length=692

 Score =   366 bits (940),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 185/348 (53%), Positives = 245/348 (70%), Gaps = 18/348 (5%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
              A+R F+G+I +L PEI++++SLSHPN++   CGF DEE+KE FLVMELMS+ L  + +E
Sbjct  259   LAMRHFFGDIQSLVPEISSLLSLSHPNIMHSFCGFTDEEKKECFLVMELMSRDLYSYNRE  318

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G RKR+ FS+PVAVD+MLQIARGMEYLHS+ I+HG LNP NIL++P +   E Y  +K
Sbjct  319   ICGPRKRVPFSLPVAVDLMLQIARGMEYLHSKKIYHGSLNPFNILVKPRNISTEGYLQAK  378

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             VSGFGLS +K +++ +N    +G + P IWYAPEVL EQEQ  GS+++ ++++EK+DVYS
Sbjct  379   VSGFGLSSVK-KFSTKNSLNQNGNLLPFIWYAPEVLEEQEQT-GSARN-SQYTEKSDVYS  435

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CFQILTGK PFE+    LQGDKM  ++ AGERPLFP   PKY+TNL +KCW   PN
Sbjct  436   FGMICFQILTGKVPFEDSH--LQGDKMSRNIRAGERPLFPLNSPKYVTNLTKKCWQADPN  493

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPP-PLVDYCDIEAGYIKKFPG---DNVPPG  890
              RP FSS+CRILRY+K+ L +NP++     PP P VDY DIE+    KFP     +    
Sbjct  494   QRPSFSSICRILRYMKRFLAMNPDYNREIDPPMPAVDYGDIESILRSKFPCWDETDSSST  553

Query  891   VSEIPFQMFAYKLVEKEKTL---------GNDGFAVRARDDHLVSMDD  1007
             + +IPFQMF Y++ EKEK           G+D  A  + D++  S DD
Sbjct  554   IKQIPFQMFVYRVFEKEKLRATQKETSESGSDDKASVSGDENFNSTDD  601



>gb|KEH18707.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=682

 Score =   365 bits (938),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 185/344 (54%), Positives = 235/344 (68%), Gaps = 15/344 (4%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F LR   G+  AL  EI  ++SLSHPN++   CGF DEE+KE FL+MELMSK+L  HIKE
Sbjct  260   FVLRQCSGDTDALESEIKELLSLSHPNIMDCLCGFTDEEKKECFLLMELMSKTLSNHIKE  319

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G RKR+ F + VAVD+MLQIARGMEY+HS+ ++HGELNPSNIL++P S+  E Y H K
Sbjct  320   VYGPRKRLPFLLHVAVDIMLQIARGMEYIHSKKVYHGELNPSNILVKPRSTSPEGYLHCK  379

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             VSGFGL  +K      N  +   G    IWY+PEVL EQE   G S S  K++EK+DVYS
Sbjct  380   VSGFGLPSVKDLNQKGNANQ--NGTLSFIWYSPEVLEEQEHSGGVSIS--KYTEKSDVYS  435

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CF++LTGK PFE+    LQG+KM  ++ AGERPLFP   PKY+ NL ++CWHT PN
Sbjct  436   FGMVCFELLTGKVPFEDSH--LQGEKMSRNIRAGERPLFPLNSPKYVINLTKRCWHTDPN  493

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPP-PLVDYCDIEAGYIKKFP--GDNVPPGV  893
              RP FSS+CR+LRY+K+ LV+NP +     PP PLVDYCDIE+  ++KFP  G +    +
Sbjct  494   QRPNFSSICRVLRYVKRFLVLNPGYNRETDPPVPLVDYCDIESALLRKFPSWGSSELSPI  553

Query  894   SEIPFQMFAYKLVEKEKT------LGNDGFAVRARDDHLVSMDD  1007
             S IPFQMFAY+++E+EK           G    A  D LV+  D
Sbjct  554   SNIPFQMFAYRVIEREKVRTCSRDFSESGSDASACGDELVTSGD  597



>ref|XP_011093433.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7 [Sesamum 
indicum]
Length=680

 Score =   364 bits (935),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 177/316 (56%), Positives = 228/316 (72%), Gaps = 7/316 (2%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR FYG++  L P+I+   +LSHPN+L   C F DEE+KE  LVMELM++ L  +IKE
Sbjct  261  FALRHFYGDVETLVPDISKEAALSHPNILHILCAFTDEEKKECHLVMELMNRDLSSYIKE  320

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G RKR+ F++PVAVD+MLQIARGMEYLHS+ I+HGELNPSNIL++  ++  + Y H+K
Sbjct  321  ICGPRKRIPFTLPVAVDLMLQIARGMEYLHSKKIYHGELNPSNILIKARNTGTDGYLHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGLS   S  T R  P +  G  P IW+APEVLAEQEQ        +K +EK+DVYS
Sbjct  381  VSGFGLSSSISSLTPRT-PTSQNGQLPFIWHAPEVLAEQEQ--FGVGENSKHTEKSDVYS  437

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PKY+TNL +KCWH  P 
Sbjct  438  FGMICFELLTGKVPFEDTH--LQGDKMSRNIRAGERPLFPFHSPKYITNLTKKCWHIDPG  495

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPG--DNVPPGVS  896
             RP FSS+CRILRY K  LV+NPE+  PD P P +D+ D+EAG ++  P   ++    VS
Sbjct  496  QRPSFSSICRILRYTKHFLVMNPEYSQPDAPMPPIDFSDLEAGMLRSIPSVVNSKLLSVS  555

Query  897  EIPFQMFAYKLVEKEK  944
            +IPF MF Y+++E+EK
Sbjct  556  QIPFHMFVYRVMEREK  571



>ref|XP_009757710.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Nicotiana sylvestris]
Length=688

 Score =   363 bits (933),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 234/324 (72%), Gaps = 19/324 (6%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR  +G+I  L PEI   +SLSHPN++   CGF DEE++E FL+MELM+K L  +IKE
Sbjct  267  FCLRHLFGDIKPLIPEITQELSLSHPNIMHISCGFTDEEKRECFLIMELMNKDLSSYIKE  326

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G RKR+ FS+PVA+D++LQIARGMEYLHS+ ++HGEL+PSNIL++  +   E Y H+K
Sbjct  327  ICGPRKRVPFSLPVAIDLLLQIARGMEYLHSKKVYHGELSPSNILVKARNITTEGYLHAK  386

Query  363  VSGFG----LSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGA-KFSEK  527
            V GFG    + + +  +  +N      G  P IW+APEVLAEQEQ   S   G+ K++EK
Sbjct  387  VCGFGSSCSIKLPQKAHVSQN-----NGTLPFIWFAPEVLAEQEQ---SGDGGSIKYTEK  438

Query  528  ADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCW  707
            +DVYSFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PKY+T+L +KCW
Sbjct  439  SDVYSFGMICFEVLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFHSPKYVTSLTKKCW  496

Query  708  HTSPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP----GD  875
            HT P  RP FSS+CR+LRYIK+ LV+NPEHG  D P P VDY +IEA  ++ FP     +
Sbjct  497  HTDPYQRPSFSSICRVLRYIKRFLVMNPEHGQQDSPLPPVDYAEIEAAILRSFPFLGNSE  556

Query  876  NVPPGVSEIPFQMFAYKLVEKEKT  947
            + P  V++IPFQMFAY++ EKEK+
Sbjct  557  SDPLPVTQIPFQMFAYRVTEKEKS  580



>ref|XP_009377877.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Pyrus x bretschneideri]
Length=683

 Score =   363 bits (932),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 245/347 (71%), Gaps = 20/347 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA R F+GEI  L PEI+ ++SLSHPN++ + CGF DEE+KE FL+MELMS+ L  +IKE
Sbjct  260   FASRHFFGEIEPLLPEISLLLSLSHPNIVLFPCGFTDEEKKECFLIMELMSRDLCSYIKE  319

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G RKR+ FS+PVA+D+MLQIARGMEYLHS+ I+HG+L+PSNIL++P     E Y  +K
Sbjct  320   ICGPRKRLPFSLPVAIDLMLQIARGMEYLHSKKIYHGDLDPSNILVKPRGISTEGYLQAK  379

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             VSGFGL+ +    +    P    G    IWYAPEVL EQEQ + + K   K++EK+DVYS
Sbjct  380   VSGFGLASV--NISNHKNPSNQSGSLSFIWYAPEVLEEQEQGKSTEK---KYAEKSDVYS  434

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+   + + NL +KCWH+ PN
Sbjct  435   FGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFYSLRNVANLTKKCWHSDPN  492

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHP-DCPPPLVDYCDIEAGYIKKFP--GDNVPPGV  893
              RP FSS+CRILRYIK+ L +NP++ +  D P P+VDYC+IE+G ++K P  G   P  +
Sbjct  493   QRPSFSSICRILRYIKRFLAMNPDYNNQLDPPVPMVDYCEIESGLLRKIPSWGSFEPSPI  552

Query  894   SEIPFQMFAYKLVEKEKT---------LGNDGFAVRARDDHLVSMDD  1007
             S+IPFQMF Y++ E+E+T          G+DG ++   D+ +V  DD
Sbjct  553   SQIPFQMFVYRIAERERTSSSLKDTSESGSDGASI-CGDEIVVPADD  598



>ref|XP_002868578.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44837.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=715

 Score =   364 bits (934),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 193/376 (51%), Positives = 257/376 (68%), Gaps = 15/376 (4%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA+R F+ ++  L  EI++++SL H N+LQY CGFYDEERKE FLVMELM K L  ++KE
Sbjct  262   FAVRHFFSDLEPLSSEISSLLSLCHSNILQYLCGFYDEERKECFLVMELMHKDLQSYMKE  321

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             N G R+R  FSIPV +D+MLQIARGMEYLH  +IFHG+LNP NI L+  S   E YFH+K
Sbjct  322   NCGPRRRYLFSIPVVIDIMLQIARGMEYLHGNDIFHGDLNPMNIHLKERSHT-EGYFHAK  380

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             +SGFGLS +    + R+  +  G  DPVIWYAPEVLAE EQ        +K + KADVYS
Sbjct  381   ISGFGLSSVVKAQSSRSSSKP-GTPDPVIWYAPEVLAEMEQDLNGKTPKSKLTHKADVYS  439

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             F M+CF+++TGK PFE+    LQG+ M  ++  GERPLFP+P PKYL +LI++CWH+ P+
Sbjct  440   FAMVCFELITGKVPFEDSH--LQGEPMAINIRMGERPLFPFPSPKYLVSLIKRCWHSEPS  497

Query  723   ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD--NVPPGVS  896
              RP FSS+CRILRYIKK LV+NP+HGHP    PLVD  D+EA +++KFPGD  +    V+
Sbjct  498   QRPNFSSICRILRYIKKFLVVNPDHGHPQMQTPLVDCWDLEARFLRKFPGDAGSHTASVN  557

Query  897   EIPFQMFAYKLVEKEKTLGNDGFAVRARD--DHLVSMDDLCLVPNNGTRGRLSTCSEIID  1070
             +IPFQ+++Y++ E+EK   N   +  A D  + +  ++D    P N    R  T S  +D
Sbjct  558   QIPFQLYSYRVSEREKMNPNSKESSEASDQSESVSVVED----PPNAIIAR-DTKSLCLD  612

Query  1071  RNDLGTFADQRSAISE  1118
                +  ++D RS  SE
Sbjct  613   --TISEYSDTRSVYSE  626



>emb|CDY38007.1| BnaCnng08680D [Brassica napus]
Length=445

 Score =   353 bits (906),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 172/318 (54%), Positives = 229/318 (72%), Gaps = 14/318 (4%)
 Frame = +3

Query  9    LRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKENS  188
            +R F+G+I AL P++ +++SLSHPN++ Y CGF DEE+KE FLVMELMSKSL  H+KE  
Sbjct  22   IRHFFGDIDALLPQVTSLLSLSHPNIVYYLCGFADEEKKECFLVMELMSKSLGTHVKEVC  81

Query  189  GQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSP---GETYFHS  359
            G R++ + S+PVAVD+MLQI+RGMEYLHS+ ++HGELNPSNIL++P  S    G  Y H 
Sbjct  82   GPRRKNTLSLPVAVDLMLQISRGMEYLHSKGVYHGELNPSNILVKPRRSNQTGGGYYLHG  141

Query  360  KVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVY  539
            K+ GFGLS +K  ++F++   +S    P IWY+PEVL EQEQ      S  K++EK+DVY
Sbjct  142  KICGFGLSSVKG-FSFKSA--SSNESFPFIWYSPEVLEEQEQ----GGSSLKYTEKSDVY  194

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+   K++TNL ++CWH  P
Sbjct  195  SFGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFHSRKFITNLTKRCWHADP  252

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPP--GV  893
            N RP FSS+ R+LRYIK+ L +NPE        P VDYC+IE   +KK   +       V
Sbjct  253  NQRPSFSSISRVLRYIKRFLALNPECQQDTLVSPPVDYCEIETKLLKKLSWEKTTELVQV  312

Query  894  SEIPFQMFAYKLVEKEKT  947
            S++PFQMFAY++VE+ KT
Sbjct  313  SQVPFQMFAYRVVEQAKT  330



>gb|EYU32213.1| hypothetical protein MIMGU_mgv1a021687mg [Erythranthe guttata]
Length=688

 Score =   361 bits (927),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 176/319 (55%), Positives = 232/319 (73%), Gaps = 11/319 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA+R F+G++  L PEI+   +LSHPNV+ + CGF DEE+KE +LVMELM++ L  +IKE
Sbjct  267  FAIRHFFGDVEQLVPEISADFTLSHPNVMHFLCGFADEEKKECYLVMELMNRDLSSYIKE  326

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPG-ETYFHS  359
              G RKR+ F +PVAVD+MLQIARGMEYLHS+ I+HGELNPSNIL++  S  G E Y H+
Sbjct  327  TCGPRKRIPFPLPVAVDLMLQIARGMEYLHSKKIYHGELNPSNILIKSRSIAGTEGYLHA  386

Query  360  KVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQP-RGSSKSGAKFSEKADV  536
            +VSGFGLS   S  T    P +     P IWY+PEVLAEQ++   G  +   K++EK+DV
Sbjct  387  RVSGFGLSSSISSLT-EKTPVSR----PFIWYSPEVLAEQDEWFGGDDRISLKYTEKSDV  441

Query  537  YSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTS  716
            YSFGM+CF++LTGK PFE+    LQG+KM  ++ AGERPLFP+  PKY+TNL +KCW T 
Sbjct  442  YSFGMICFEVLTGKVPFEDTH--LQGEKMSRNIRAGERPLFPFHSPKYITNLTKKCWATD  499

Query  717  PNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPG  890
            PN RPGFSS+CRILRY K+ L +NPEH   D P P +D+ +IE G ++ FP  G++    
Sbjct  500  PNQRPGFSSICRILRYAKRFLAMNPEHSQIDAPMPPIDFGEIELGIVRGFPLIGNSNLVS  559

Query  891  VSEIPFQMFAYKLVEKEKT  947
            + +IPFQMFAY++ E+E+ 
Sbjct  560  IWQIPFQMFAYRVTERERA  578



>ref|XP_008364823.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
kinase kinase 7-like [Malus domestica]
Length=685

 Score =   361 bits (926),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 245/347 (71%), Gaps = 20/347 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA R   GE+  L PEI+++  LSHPN++ + CGF DEE+KE FL+MELMSK L  +IKE
Sbjct  261   FASRHLIGEVETLLPEISSLSLLSHPNIVHFLCGFTDEEKKECFLIMELMSKDLCSYIKE  320

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G RKR+ FS+P A+D+MLQIARGMEYLHS+ I+HG+LNPSNIL++      E Y  +K
Sbjct  321   ICGPRKRLPFSLPAAIDLMLQIARGMEYLHSKKIYHGDLNPSNILVKARGISTEGYLQAK  380

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             VSGFGL+ +KS  T ++    +G + P+IWYAPEVL EQE  + + K   K++EK+DVYS
Sbjct  381   VSGFGLTSVKSP-TQKSTSNQNGSL-PLIWYAPEVLEEQEHGKSTEK---KYAEKSDVYS  435

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+   +Y+TNL +KCWH+ P 
Sbjct  436   FGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFYSLRYVTNLTKKCWHSDPY  493

Query  723   ARPGFSSVCRILRYIKKVLVINPEHG-HPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGV  893
              RP FSS+CRILRYIK+ L +NP++    D P P+VDYC+IE+  +KK P  G + P   
Sbjct  494   QRPSFSSICRILRYIKRFLAMNPDYNSQLDPPVPMVDYCEIESVLLKKIPSWGTSEPSPJ  553

Query  894   SEIPFQMFAYKLVEKEKT---------LGNDGFAVRARDDHLVSMDD  1007
             S+IPFQMF Y++ E+E+T          G+DG ++   D+ +V  DD
Sbjct  554   SQIPFQMFVYRIAERERTSSSLKDTSESGSDGASI-CGDEIVVPADD  599



>ref|XP_008349540.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Malus domestica]
Length=685

 Score =   360 bits (925),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 245/347 (71%), Gaps = 20/347 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA R   GE+  L PEI+++  LSHPN++ + CGF DEE+KE FL+MELMSK L  +IKE
Sbjct  261   FASRHLIGEVETLLPEISSLSLLSHPNIVHFLCGFTDEEKKECFLIMELMSKDLCSYIKE  320

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G RKR+ FS+P A+D+MLQIARGMEYLHS+ I+HG+LNPSNIL++      E Y  +K
Sbjct  321   ICGPRKRLPFSLPAAIDLMLQIARGMEYLHSKKIYHGDLNPSNILVKARGISTEGYLQAK  380

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             VSGFGL+ +KS  T ++    +G + P+IWYAPEVL EQE  + + K   K++EK+DVYS
Sbjct  381   VSGFGLTSVKSP-TQKSTSNQNGSL-PLIWYAPEVLEEQEHGKSTEK---KYAEKSDVYS  435

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+   +Y+TNL +KCWH+ P 
Sbjct  436   FGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFYSLRYVTNLTKKCWHSDPY  493

Query  723   ARPGFSSVCRILRYIKKVLVINPEHG-HPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGV  893
              RP FSS+CRILRYIK+ L +NP++    D P P+VDYC+IE+  +KK P  G + P   
Sbjct  494   QRPSFSSICRILRYIKRFLAMNPDYNSQLDPPVPMVDYCEIESVLLKKIPSWGTSEPSPJ  553

Query  894   SEIPFQMFAYKLVEKEKT---------LGNDGFAVRARDDHLVSMDD  1007
             S+IPFQMF Y++ E+E+T          G+DG ++   D+ +V  DD
Sbjct  554   SQIPFQMFVYRIAERERTSSSLKDTSESGSDGASI-CGDEIVVPADD  599



>ref|XP_009620502.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Nicotiana tomentosiformis]
 ref|XP_009620510.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Nicotiana tomentosiformis]
Length=688

 Score =   360 bits (924),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/323 (53%), Positives = 230/323 (71%), Gaps = 17/323 (5%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR  +G+I  L PEI   + LSHPN++   CGF D+E++E FL+MELM+K L  +IKE
Sbjct  267  FCLRHLFGDIKPLIPEITQELCLSHPNIMHISCGFTDDEKRECFLIMELMNKDLSSYIKE  326

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G RKR+ FS+PVA+D++LQIARGMEYLHS+ ++HGEL+PSNIL++  +   E Y H+K
Sbjct  327  ICGPRKRVPFSLPVAIDLLLQIARGMEYLHSKKVYHGELSPSNILVKARNITTEGYLHAK  386

Query  363  VSGFG----LSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKA  530
            V GFG    + + +  +  +N      G  P IW+APEVLAEQEQ         K++EK+
Sbjct  387  VCGFGSSCSIKLPQKAHVSQN-----NGTLPFIWFAPEVLAEQEQT--GDGGSIKYTEKS  439

Query  531  DVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWH  710
            DVYSFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PKY+T+L +KCWH
Sbjct  440  DVYSFGMICFEVLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFHSPKYVTSLTKKCWH  497

Query  711  TSPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP----GDN  878
            T P  RP FSS+CR+LRY+K+ LV+NPEHG  D P P VDY +IEA  ++ FP     ++
Sbjct  498  TDPYQRPSFSSICRVLRYVKRFLVMNPEHGQQDSPLPPVDYGEIEAAILRSFPFLGNSES  557

Query  879  VPPGVSEIPFQMFAYKLVEKEKT  947
             P  V++IPFQMFAY++ EKEK+
Sbjct  558  DPQPVTQIPFQMFAYRVTEKEKS  580



>ref|XP_010924823.1| PREDICTED: uncharacterized protein LOC105047554 isoform X2 [Elaeis 
guineensis]
Length=676

 Score =   358 bits (918),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 226/320 (71%), Gaps = 9/320 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA++   GEI  L  EI+ + S++HPNV+ Y   FYDEE+KEGFL+M+LMSK L  HIKE
Sbjct  254  FAVKHVIGEIEPLMNEISLLSSINHPNVMHYMYSFYDEEKKEGFLLMDLMSKDLSSHIKE  313

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
                R+R+ F + VAVD+MLQIARGMEYLHSR I+HG+LN SN+L+R  +S  + Y H K
Sbjct  314  ICSSRRRIPFPVMVAVDIMLQIARGMEYLHSRKIYHGDLNFSNVLVRLRNSSPDGYLHVK  373

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            ++GFGLS +K+     N    +  ++  IWYAPEVL EQEQ   +  S  K++EKADVYS
Sbjct  374  IAGFGLSALKNSKFSAN---QAATMNSCIWYAPEVLLEQEQSGDAGSS--KYTEKADVYS  428

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP   PKYLTNL ++CWH  P+
Sbjct  429  FAMICFELLTGKVPFEDNH--LQGDKMSKNIRAGERPLFPSQSPKYLTNLTKRCWHADPS  486

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGVS  896
             RP FSS+CR+LRY+K+ L++NP+HG PD   P VDY DIE    K+F          VS
Sbjct  487  QRPSFSSLCRVLRYVKRFLILNPDHGRPDSVVPPVDYLDIETSLSKRFTNWARKETIQVS  546

Query  897  EIPFQMFAYKLVEKEKTLGN  956
            EIPFQM+AY+++E+EKT  N
Sbjct  547  EIPFQMYAYRVIEREKTSAN  566



>ref|XP_010053791.1| PREDICTED: uncharacterized protein LOC104442157 [Eucalyptus grandis]
 gb|KCW78144.1| hypothetical protein EUGRSUZ_D02347 [Eucalyptus grandis]
Length=678

 Score =   358 bits (918),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 183/348 (53%), Positives = 242/348 (70%), Gaps = 23/348 (7%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FALR  +G    L PEI+ + +LSHPN+L + C F DEE+KE F+V ELM++ L  +IKE
Sbjct  260   FALRHLFGNTETLVPEISLIHTLSHPNILHFLCSFLDEEKKECFVVTELMNRDLGSYIKE  319

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G RKR+ FS+PVA+D+M QIARGMEYLHS+ I+HG+LNPS +LLR   S GE Y  +K
Sbjct  320   ICGPRKRIPFSLPVAIDLMFQIARGMEYLHSKKIYHGDLNPSRVLLRARGSSGEGYLQAK  379

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             VSGFGLS  K+  + +  P +  G   +IW++PEVLAE E+  GS++   K +EK+DVYS
Sbjct  380   VSGFGLSSCKN--SSQKTPLSQDG---IIWHSPEVLAENEET-GSTRD-TKHTEKSDVYS  432

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PKYLTNL ++CWH  PN
Sbjct  433   FGMICFELLTGKVPFEDAH--LQGDKMSRNIRAGERPLFPFHSPKYLTNLTKRCWHIDPN  490

Query  723   ARPGFSSVCRILRYIKKVLVINPE-HGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG--V  893
              RP FSS+CRILRY+K+ L +NP+    PD P P VDY DIE+  +KKFP    P    V
Sbjct  491   QRPSFSSICRILRYVKRFLAMNPDCSSQPDQPMPSVDYHDIESRLLKKFPSWESPNQLPV  550

Query  894   SEIPFQMFAYKLVEKEKT----------LGNDGFAVRARDDHLVSMDD  1007
             S++PFQMFAY++ E+EK+           G++G +V   D+   S+DD
Sbjct  551   SDVPFQMFAYRVAEREKSGACLKENNSESGSEGASV-CGDEVTTSLDD  597



>ref|XP_010924822.1| PREDICTED: tyrosine-protein kinase ABL1-like isoform X1 [Elaeis 
guineensis]
Length=736

 Score =   358 bits (919),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 226/320 (71%), Gaps = 9/320 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA++   GEI  L  EI+ + S++HPNV+ Y   FYDEE+KEGFL+M+LMSK L  HIKE
Sbjct  254  FAVKHVIGEIEPLMNEISLLSSINHPNVMHYMYSFYDEEKKEGFLLMDLMSKDLSSHIKE  313

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
                R+R+ F + VAVD+MLQIARGMEYLHSR I+HG+LN SN+L+R  +S  + Y H K
Sbjct  314  ICSSRRRIPFPVMVAVDIMLQIARGMEYLHSRKIYHGDLNFSNVLVRLRNSSPDGYLHVK  373

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            ++GFGLS +K+     N    +  ++  IWYAPEVL EQEQ   +  S  K++EKADVYS
Sbjct  374  IAGFGLSALKNSKFSAN---QAATMNSCIWYAPEVLLEQEQSGDAGSS--KYTEKADVYS  428

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP   PKYLTNL ++CWH  P+
Sbjct  429  FAMICFELLTGKVPFEDNH--LQGDKMSKNIRAGERPLFPSQSPKYLTNLTKRCWHADPS  486

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGVS  896
             RP FSS+CR+LRY+K+ L++NP+HG PD   P VDY DIE    K+F          VS
Sbjct  487  QRPSFSSLCRVLRYVKRFLILNPDHGRPDSVVPPVDYLDIETSLSKRFTNWARKETIQVS  546

Query  897  EIPFQMFAYKLVEKEKTLGN  956
            EIPFQM+AY+++E+EKT  N
Sbjct  547  EIPFQMYAYRVIEREKTSAN  566



>ref|XP_009140115.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103864115 
[Brassica rapa]
Length=709

 Score =   357 bits (917),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 175/316 (55%), Positives = 233/316 (74%), Gaps = 11/316 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F +R F+ ++  L  EI+++++L HPNV QY CGFYDEERKE FLVMELM K L  ++KE
Sbjct  262  FVVRHFFSDLEPLSSEISSLLALCHPNVHQYLCGFYDEERKECFLVMELMHKDLQSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+ V VD+M+QIARGMEYLH  +IFHG+LNP+NILL+      E YFH+K
Sbjct  322  NCGPRRRYLFSVSVVVDIMMQIARGMEYLHGNDIFHGDLNPTNILLKERCHT-EGYFHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +S FGLS +KSQ +  +        DPVIWYAPEVLAE EQ  G+    +K + KADVYS
Sbjct  381  ISCFGLSSVKSQSSSSSRASTH---DPVIWYAPEVLAEMEQ--GTKTLKSKLTHKADVYS  435

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CF+++TGK PFE+    LQG++M  ++  GERPLFP+P PKYL +LI++CWH+ P+
Sbjct  436  FGMVCFELITGKVPFEDSH--LQGEQMAINIRMGERPLFPFPSPKYLVSLIKRCWHSEPS  493

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD--NVPPGVS  896
             RP FSS+CRI  YIKK LV+NP+ GHP    PLVD  D+EA Y++KFPGD  +    V+
Sbjct  494  QRPNFSSICRI-XYIKKFLVVNPDQGHPQIQTPLVDCWDLEARYLRKFPGDLGSHLASVT  552

Query  897  EIPFQMFAYKLVEKEK  944
            +IPFQ+++Y+++E+EK
Sbjct  553  QIPFQLYSYRVLEREK  568



>ref|XP_010326856.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Solanum lycopersicum]
Length=690

 Score =   356 bits (913),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 228/318 (72%), Gaps = 8/318 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR  +G+I  L P+I+  + LSHPN++   CGF DEE++E FL+MELMSK L  +IKE
Sbjct  268  FCLRHLFGDIKPLIPDISRELHLSHPNIMHISCGFTDEEKRECFLIMELMSKDLSSYIKE  327

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G RKR+ FS+PVA+D++LQIARGMEYLHS+ I+HGELNPSN+L++  +   E Y H+K
Sbjct  328  ICGPRKRVPFSLPVAIDLLLQIARGMEYLHSKKIYHGELNPSNVLIKARNVSAEGYLHAK  387

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            V GFG S   +     N  + +G + P IW++PEVLAEQEQ    +    K++EK+DVYS
Sbjct  388  VCGFGSSCSINLPQKANVNQNNGTL-PFIWFSPEVLAEQEQ--SGNGGNIKYTEKSDVYS  444

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PKY+T+L ++CWHT P 
Sbjct  445  FGMICFEVLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFHSPKYVTSLTKRCWHTDPY  502

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP---GDNVPPGV  893
             RP FSS+CR+LRY+K+ LV+NPEH   D P P VDY +IEA   +  P    D+ P  V
Sbjct  503  QRPSFSSICRVLRYVKRFLVMNPEHSQQDSPLPPVDYGEIEAVIFRSIPLGNCDSDPLPV  562

Query  894  SEIPFQMFAYKLVEKEKT  947
            ++IPF MFAY++ EKEK+
Sbjct  563  TQIPFHMFAYRVTEKEKS  580



>ref|NP_171652.1| putative serine/threonine/tyrosine kinase [Arabidopsis thaliana]
 gb|AEE27287.1| putative serine/threonine/tyrosine kinase [Arabidopsis thaliana]
Length=470

 Score =   349 bits (895),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 233/328 (71%), Gaps = 12/328 (4%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G+I AL P+I  ++SLSHPN++ Y CGF DEE+KE FLVMELM K+L MHIKE
Sbjct  52   FALRHFFGDIDALLPQITPLLSLSHPNIVYYLCGFTDEEKKECFLVMELMRKTLGMHIKE  111

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSS-PGETYFHS  359
              G RK+ + S+PVAVD+MLQIA GMEYLHS+ I+HGELNPSNIL++P S+  G+ Y   
Sbjct  112  VCGPRKKNTLSLPVAVDLMLQIALGMEYLHSKRIYHGELNPSNILVKPRSNQSGDGYLLG  171

Query  360  KVSGFGLSMMKSQYTFRNCPRASGGVD-PVIWYAPEVLAEQEQPRGSSKSGAKFSEKADV  536
            K+ GFGL+ +K  ++ ++    S   + P IWY+PEVL EQEQ    +    K+S+K+DV
Sbjct  172  KIFGFGLNSVKG-FSSKSASLTSQNENFPFIWYSPEVLEEQEQ--SGTAGSLKYSDKSDV  228

Query  537  YSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTS  716
            YSFGM+ F++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PK++TNL ++CWH  
Sbjct  229  YSFGMVSFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFNSPKFITNLTKRCWHAD  286

Query  717  PNARPGFSSVCRILRYIKKVLVINPE-HGHPDCPP---PLVDYCDIEAGYIKKFPGDNVP  884
            PN RP FSS+ RILRYIK+ L +NPE +      P   P VDYC+IE   ++K   ++  
Sbjct  287  PNQRPTFSSISRILRYIKRFLALNPECYSSSQQDPSIAPTVDYCEIETKLLQKLSWESTE  346

Query  885  -PGVSEIPFQMFAYKLVEKEKTLGNDGF  965
               VS++PFQMFAY++VE+ KT   D  
Sbjct  347  LTKVSQVPFQMFAYRVVERAKTCEKDNL  374



>ref|XP_003548520.1| PREDICTED: uncharacterized protein LOC100813704 [Glycine max]
 gb|KHN15959.1| Light-sensor Protein kinase [Glycine soja]
Length=682

 Score =   355 bits (912),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 174/318 (55%), Positives = 228/318 (72%), Gaps = 9/318 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F +R F G+I AL PEI  ++SLSHPN++   CGF DEE+KE FLVMELMSK+L  HIKE
Sbjct  259  FVIRHFSGDIEALEPEIIELLSLSHPNIMDSLCGFTDEEKKECFLVMELMSKTLSTHIKE  318

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G RKR+ F + VA+D+MLQIARGMEYLHS+ ++HGELNPS+IL+RP  +  E Y H+K
Sbjct  319  IHGPRKRIPFLLHVAIDLMLQIARGMEYLHSKKVYHGELNPSSILVRPRGTSQEGYLHAK  378

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            V GFGL+ +K      N  +   G  P IWY+PEVL EQ+   G + S  K++EK+DVYS
Sbjct  379  VMGFGLTSVKDLTQKGNTNQ--NGTPPFIWYSPEVLEEQDHSGGEANS--KYTEKSDVYS  434

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CF++LTGK PFE+    LQG+KM  ++ AGERPLFP   PKY+ NL ++CWH  P+
Sbjct  435  FGMVCFELLTGKVPFEDSH--LQGEKMSRNIRAGERPLFPPNSPKYVINLTKRCWHIDPH  492

Query  723  ARPGFSSVCRILRYIKKVLVINPEH-GHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGV  893
             RP F+++CR+LRYIK+ L +NP +   P+ P P VDYCDIE+  ++KFP  G +  P V
Sbjct  493  QRPSFATICRVLRYIKRFLALNPGYSNQPEPPVPPVDYCDIESVLLRKFPSWGGSESPSV  552

Query  894  SEIPFQMFAYKLVEKEKT  947
               PFQMFAY+ +E+EK 
Sbjct  553  PITPFQMFAYQAIEREKV  570



>ref|XP_006418422.1| hypothetical protein EUTSA_v10009834mg [Eutrema salsugineum]
 gb|ESQ36775.1| hypothetical protein EUTSA_v10009834mg [Eutrema salsugineum]
Length=648

 Score =   354 bits (909),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 229/322 (71%), Gaps = 11/322 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G+I AL P++  ++SLSHPN++ Y CGF DEE+KE FLVMELMSK+L  HIKE
Sbjct  259  FALRHFFGDIDALLPQVTPLLSLSHPNIVYYLCGFADEEKKECFLVMELMSKTLGTHIKE  318

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPM--SSPGETYFH  356
              G RK+ + S+PVAVD+MLQIARGMEYLHS+ I+HGELNPSNIL++P   +  G+ Y  
Sbjct  319  VCGPRKKNTLSLPVAVDLMLQIARGMEYLHSKKIYHGELNPSNILVQPRRNNQSGDGYLQ  378

Query  357  SKVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADV  536
             K+SGFGL+ +K   +            P IWY+PE+L EQEQ    +    K++EK+DV
Sbjct  379  GKISGFGLNSVKGFSSKNASSTGQSESFPFIWYSPELLDEQEQ--SGTAGSIKYTEKSDV  436

Query  537  YSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTS  716
            YSFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PK++TNL ++CWH  
Sbjct  437  YSFGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFHSPKFITNLTKRCWHAD  494

Query  717  PNARPGFSSVCRILRYIKKVLVINPE-HGHPDCPPPL---VDYCDIEAGYIKKFPGDNVP  884
            PN RP FSS+ RILRYIK+ L +NPE H      PP+   VDYC+IE   ++K   ++  
Sbjct  495  PNQRPTFSSISRILRYIKRFLALNPECHSISQQDPPVSPPVDYCEIETKLLQKLSWESTE  554

Query  885  -PGVSEIPFQMFAYKLVEKEKT  947
               VS++PFQMF Y++VE+ KT
Sbjct  555  LHQVSQVPFQMFTYRVVERAKT  576



>ref|XP_009112819.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0278665 
[Brassica rapa]
Length=721

 Score =   356 bits (914),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 174/317 (55%), Positives = 228/317 (72%), Gaps = 9/317 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F G++  L  EI++++SL H N+LQY CGFYDEE+KE  LVMELM K L  ++KE
Sbjct  262  FVLRHFLGDLEPLDAEISSLLSLCHSNILQYLCGFYDEEKKECSLVMELMHKDLKSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQIARGMEYLHS  IFHG+LNP NILL+  S   E YFH+K
Sbjct  322  NCGPRRRYLFSVPVVIDIMLQIARGMEYLHSNEIFHGDLNPMNILLKERSHT-EGYFHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQP-RGSSKSGAKFSEKADVY  539
            +SGFGL+ +K   TF           PVIWYAPEVL E EQ  +G +   +KF+ KADVY
Sbjct  381  ISGFGLNSVK---TFTRASSRPTTPAPVIWYAPEVLTEMEQDLKGITVPRSKFTHKADVY  437

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SF M+CF+++TGK PFE+    LQGD+M  ++  G+RPLFP+P PKYL +LI++CWH+ P
Sbjct  438  SFAMVCFELITGKVPFEDSH--LQGDEMGKNIRRGDRPLFPFPSPKYLVSLIKRCWHSEP  495

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD--NVPPGV  893
            + RP FSS+CRILRY+KK LV+NP+ GH     PLVD  D+EA ++KKF  +  +    V
Sbjct  496  SQRPTFSSICRILRYVKKFLVVNPDQGHIQIQTPLVDCWDLEARFLKKFSIETGSHAESV  555

Query  894  SEIPFQMFAYKLVEKEK  944
             +IPFQ+++Y++ EKEK
Sbjct  556  MQIPFQLYSYRVAEKEK  572



>ref|XP_009112888.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Brassica rapa]
Length=714

 Score =   356 bits (913),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 173/317 (55%), Positives = 229/317 (72%), Gaps = 9/317 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+G++  L  EI++++SL H N+LQY CGFYD+E+KE  LVMELM K L  ++KE
Sbjct  262  FVLRHFFGDLEPLDAEISSLLSLCHSNILQYLCGFYDKEKKECSLVMELMHKDLKSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQIARGMEYLHS  IFHG+LNP NILL+  S   E YFH+K
Sbjct  322  NCGPRRRYLFSVPVVIDIMLQIARGMEYLHSNEIFHGDLNPMNILLKERSHT-EGYFHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQP-RGSSKSGAKFSEKADVY  539
            +SGFGL+ +K   TF           PVIWYAPEVL E EQ  +G +   +KF+ KADVY
Sbjct  381  ISGFGLNSVK---TFTRASSRPTTPAPVIWYAPEVLTEMEQDLKGITVPRSKFTHKADVY  437

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SF M+CF+++TGK PFE+    LQGD+M  ++  G+RPLFP+P PKYL +LI++CWH+ P
Sbjct  438  SFAMVCFELITGKVPFEDSH--LQGDEMGKNIRRGDRPLFPFPSPKYLVSLIKRCWHSEP  495

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD--NVPPGV  893
            + RP FSS+CRILRYIKK LV+NP+ GH     PLVD  D+EA +++KF  +  +    V
Sbjct  496  SQRPTFSSICRILRYIKKFLVVNPDQGHIQIQTPLVDCWDLEARFLRKFSIETGSHAESV  555

Query  894  SEIPFQMFAYKLVEKEK  944
             +IPFQ+++Y++ EKEK
Sbjct  556  MQIPFQLYSYRVAEKEK  572



>ref|XP_007135218.1| hypothetical protein PHAVU_010G111000g [Phaseolus vulgaris]
 gb|ESW07212.1| hypothetical protein PHAVU_010G111000g [Phaseolus vulgaris]
Length=679

 Score =   355 bits (910),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 180/344 (52%), Positives = 241/344 (70%), Gaps = 16/344 (5%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F +R F G+I AL+PEI  ++SLSHPN++   CGF DEE+KE FL+MELMSK+L  HIKE
Sbjct  259   FVIRHFTGDIEALQPEIIELLSLSHPNIMDCLCGFADEEKKECFLLMELMSKTLSTHIKE  318

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G R+R+ F + VAVD+MLQI RGMEYLHS+ ++HGELNPS+IL++P  +  E Y H+K
Sbjct  319   IHGPRRRIPFLLHVAVDLMLQIGRGMEYLHSKKLYHGELNPSSILVKPRGTSPEGYLHAK  378

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             V+GFGL+ +K     +       G  P IWY+PEVL EQE   G+S S  K++EK+DVYS
Sbjct  379   VTGFGLTSVKD--LNQKGTTNQNGTPPFIWYSPEVL-EQENSGGTSSS--KYTEKSDVYS  433

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CF++LTGK PFE+    LQG+KM  ++ AGERPLFP   PKY+ NL ++CWH  PN
Sbjct  434   FGMVCFELLTGKVPFEDSH--LQGEKMSRNIRAGERPLFPLNSPKYVINLTKRCWHIDPN  491

Query  723   ARPGFSSVCRILRYIKKVLVINPEH-GHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGV  893
              RP F+++CR+LRYIK+ L +NP +   P+ P P VDYCD+E+  +++FP  G +    V
Sbjct  492   QRPSFATICRVLRYIKRFLAMNPGYSSQPEPPLPPVDYCDVESVLLRRFPSWGSSESAPV  551

Query  894   SEIPFQMFAYKLVEKEK-TLG-----NDGFAVRARDDHLVSMDD  1007
             S+IPFQMFAY+++E+EK T G       G    A  D LV+  D
Sbjct  552   SKIPFQMFAYQVIEREKITTGCKENSESGSDASACGDELVTSGD  595



>ref|XP_008437376.1| PREDICTED: serine/threonine-protein kinase ULK1 [Cucumis melo]
 ref|XP_008437377.1| PREDICTED: serine/threonine-protein kinase ULK1 [Cucumis melo]
Length=710

 Score =   355 bits (910),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 183/366 (50%), Positives = 243/366 (66%), Gaps = 29/366 (8%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F +R F  E      E+  ++SL HPN+LQY CGF DEE+KE FL+ ELMSK L  ++K+
Sbjct  261   FGMRQFTAETEETESEVPILLSLLHPNILQYLCGFLDEEKKEYFLITELMSKDLSSYLKD  320

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             N+G R+R+ F + V+VD+MLQIARGMEYLHS+ I+HG+LNPSN+ ++P +S   +Y   K
Sbjct  321   NNGARRRVLFPLNVSVDIMLQIARGMEYLHSQMIYHGDLNPSNVFMKPRNSSEGSYL-VK  379

Query  363   VSGFGLSMMKSQYTFRNCPRASGG---VDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKAD  533
             V+GFGLS +K+     + PR S      +P IW+APEV+AEQEQ    + S  + +EKAD
Sbjct  380   VAGFGLSSIKN-----SPPRNSTNQLETNPFIWHAPEVMAEQEQQGPGTVSFFRKTEKAD  434

Query  534   VYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHT  713
             VYSFGMLCF++LTGK PFE+    LQG+KM  ++ AGERPLFP+P PKYL +L ++CWH+
Sbjct  435   VYSFGMLCFELLTGKVPFEDSH--LQGEKMSRNIRAGERPLFPFPTPKYLVSLTKRCWHS  492

Query  714   SPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPP--  887
              P+ R  FSS+CRILR +KK L +NPE   P+   P VDYCD+EAG  +KF  D V    
Sbjct  493   DPSQRLSFSSICRILRQVKKFLAMNPESNQPELQMPTVDYCDVEAGVARKFSSDGVGDLC  552

Query  888   GVSEIPFQMFAYKLVEKEKT----------------LGNDGFAVRARDDHLVSMDDLCLV  1019
              VS+IPFQMFAY+L EKEKT                +  D  A   RDD +  ++D   +
Sbjct  553   SVSQIPFQMFAYRLAEKEKTNPSKIKTWDSASDVVSISKDDCASIYRDDTVSVIEDPFTI  612

Query  1020  PNNGTR  1037
             P + TR
Sbjct  613   PASDTR  618



>ref|XP_007051620.1| F22L4.1 protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007051621.1| F22L4.1 protein, putative isoform 1 [Theobroma cacao]
 gb|EOX95777.1| F22L4.1 protein, putative isoform 1 [Theobroma cacao]
 gb|EOX95778.1| F22L4.1 protein, putative isoform 1 [Theobroma cacao]
Length=691

 Score =   354 bits (908),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/318 (55%), Positives = 229/318 (72%), Gaps = 9/318 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G++ A+ P+I++++SLSHPN+L + CGF D+E+KE  LVMELM+KSL  ++KE
Sbjct  267  FALRHFFGDVEAVAPDISSLLSLSHPNILHFLCGFTDDEKKECHLVMELMNKSLRNYVKE  326

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G RKR+ F + VAVD+MLQIARGMEYLHS  I+HG+LNPSNI ++      E Y  +K
Sbjct  327  ICGPRKRVPFPLAVAVDLMLQIARGMEYLHSNKIYHGDLNPSNIHVKSRGMFTEGYMQAK  386

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGLS +      +N         P IW+APEVL EQEQ    SK  +K++EKADVYS
Sbjct  387  VSGFGLSSI-VHLPQKNTLMNQNETLPFIWHAPEVLEEQEQ--TGSKGNSKYTEKADVYS  443

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CFQ+LTGK PFE+    LQGDKM  ++ AGERPLFP+  PK +TNL +KCWH  PN
Sbjct  444  FGMICFQLLTGKVPFEDSH--LQGDKMSPNIRAGERPLFPFQSPKCVTNLTKKCWHADPN  501

Query  723  ARPGFSSVCRILRYIKKVLVINPEH--GHPDCPPPLVDYCDIEAGYIKKFPGDNV--PPG  890
             RP F S+CRILRY+K+ L++NP++     + P P+VDYCDIE+   +KFP      P  
Sbjct  502  LRPSFLSICRILRYVKRSLLMNPDYYNNQSELPMPVVDYCDIESKLQRKFPTWEASNPLP  561

Query  891  VSEIPFQMFAYKLVEKEK  944
            +S+IPFQMF Y+++EKEK
Sbjct  562  ISQIPFQMFVYRVLEKEK  579



>ref|XP_010915694.1| PREDICTED: uncharacterized protein LOC105040733 [Elaeis guineensis]
Length=683

 Score =   353 bits (907),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 186/366 (51%), Positives = 241/366 (66%), Gaps = 32/366 (9%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA+  F+G+I  L+ EI+ V SL HPNV+Q    F DEER+E FLVMELMSK L  +IKE
Sbjct  255   FAVGHFFGDIEPLKQEISPVSSLRHPNVMQIMYAFSDEERRELFLVMELMSKDLSSYIKE  314

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
                 ++R+ F + VAVD+MLQIARGMEYLHS  I+HG+LNPSNIL++P +S  + Y H K
Sbjct  315   ICSTKRRLPFPLLVAVDIMLQIARGMEYLHSCGIYHGDLNPSNILVKPRNSNPDGYLHVK  374

Query  363   VSGFGLSMMKSQYTFRNCPRAS---GGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKAD  533
             + G GL  +K        PRAS      D  IWYAPEVL+EQEQ   +  + +K +EKAD
Sbjct  375   IQGIGLPSLKK-------PRASTNQTATDSCIWYAPEVLSEQEQ--STEPNVSKCTEKAD  425

Query  534   VYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHT  713
             VYSF M+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+P PKYLTNL ++CW  
Sbjct  426   VYSFAMICFEVLTGKIPFEDDH--LQGDKMSRNIRAGERPLFPFPSPKYLTNLTKRCWQA  483

Query  714   SPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG-  890
              P+ RP FSSVCR+LRYIK+ L++NP+ G PD P P VDY D+EA   +KF         
Sbjct  484   DPSQRPSFSSVCRVLRYIKRFLIMNPDRGQPDLPAPPVDYFDLEAKLSRKFTTWATAEAL  543

Query  891   -VSEIPFQMFAYKLVEKEKTLGNDGFAVRARDDHLVSMDDLCLVPNNGTRGRLSTCSEII  1067
              VSE+PFQMFAY+++E+E+T  N  F  R+ +              +G+ G  STC +  
Sbjct  544   TVSEVPFQMFAYRVMERERT--NLNFRERSSE--------------SGSEGATSTCGDEN  587

Query  1068  DRNDLG  1085
               N +G
Sbjct  588   GFNLIG  593



>ref|XP_010914091.1| PREDICTED: serine/threonine-protein kinase HSL1-like [Elaeis 
guineensis]
 ref|XP_010914100.1| PREDICTED: serine/threonine-protein kinase HSL1-like [Elaeis 
guineensis]
Length=676

 Score =   353 bits (906),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 223/320 (70%), Gaps = 9/320 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA++   GEI  L  EI+ + S++HPNV+ Y   FYDEE+KEGFLVM+LMSK L  HIKE
Sbjct  254  FAVKHVIGEIEPLMNEISLLTSINHPNVMHYMYSFYDEEKKEGFLVMDLMSKDLSNHIKE  313

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
                R+R+ F   VAVD+MLQI RGMEYLHSR I+HG+LNPSN+L+R  SS  + Y H K
Sbjct  314  ICSSRRRIPFPPLVAVDIMLQIVRGMEYLHSRKIYHGDLNPSNVLVRTRSSSPDGYLHVK  373

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            ++GFGLS +K+    +     +  ++P IWYAPEVL EQE       S +K++EKADVYS
Sbjct  374  IAGFGLSPLKNS---KVSATQAATMNPCIWYAPEVLLEQE--LSGEASSSKYTEKADVYS  428

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PKYLT L ++CWH  P+
Sbjct  429  FGMICFELLTGKIPFEDNH--LQGDKMSKNIRAGERPLFPFQSPKYLTGLTKRCWHADPS  486

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGVS  896
             RP FSS+CR+LRY K+ L++NP  G PD   P VDY DIE    K+F          VS
Sbjct  487  QRPSFSSLCRVLRYTKRFLIMNPNQGQPDSMVPPVDYFDIEMSLSKRFTNWARKETIQVS  546

Query  897  EIPFQMFAYKLVEKEKTLGN  956
            EIPFQM+AY+++E+EKT  N
Sbjct  547  EIPFQMYAYRVIEREKTSVN  566



>ref|XP_004308323.1| PREDICTED: uncharacterized protein LOC101300294 [Fragaria vesca 
subsp. vesca]
Length=696

 Score =   353 bits (905),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 171/320 (53%), Positives = 230/320 (72%), Gaps = 10/320 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F GEI  L PEI++++SLSHPN++   CGF DEE+KE FL+MELMS+ L  +IKE
Sbjct  260  FALRQFNGEIEPLLPEISSLLSLSHPNLVHCLCGFTDEEKKECFLIMELMSRDLGSYIKE  319

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G +KR+ F++ VA+D+MLQIARGMEYLHS+ I+HGELN  NIL++      E +  +K
Sbjct  320  ICGPKKRIPFTLHVAIDLMLQIARGMEYLHSKKIYHGELNTCNILVKARGISTEGFLQAK  379

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +S FGL+ +++  T +N P    G  PVIWY+PEVL  QE    S K   K++EK+DVYS
Sbjct  380  ISDFGLTSVRNS-TQKN-PSNQNGSPPVIWYSPEVLEAQEHSESSEK---KYTEKSDVYS  434

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CFQ+LTGK PFE+    LQGDKM  ++ AGERPLFP+   +Y+TNL ++CWH  PN
Sbjct  435  FGMICFQLLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFYSLRYVTNLTKRCWHAEPN  492

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPP-PLVDYCDIEAGYIKKFP--GDNVPPGV  893
             RP FSS+CRILRY+K+ L +NP++     PP P+VDYCDIE+G ++KFP  G +    +
Sbjct  493  QRPSFSSICRILRYVKRFLAMNPDYDSQQDPPVPIVDYCDIESGVLRKFPSWGSSDQLAL  552

Query  894  SEIPFQMFAYKLVEKEKTLG  953
            S+IPF M  Y++ EK++  G
Sbjct  553  SQIPFHMLVYRIAEKDRNSG  572



>ref|XP_008791458.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7 [Phoenix 
dactylifera]
Length=677

 Score =   352 bits (903),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 173/322 (54%), Positives = 226/322 (70%), Gaps = 12/322 (4%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA++   GEI  L  EI+ + S++HPNV+ Y   FYDEE+KE FLV +LMSK L  HIKE
Sbjct  254  FAVKHVIGEIEPLMNEISLLSSINHPNVMHYMYSFYDEEKKEAFLVTDLMSKDLSSHIKE  313

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
                R+R+ F + VAVD+MLQIARGMEYLHSR I+HG+LN SN+L+R  +S  + Y H K
Sbjct  314  ICSSRRRIPFPLLVAVDIMLQIARGMEYLHSRKIYHGDLNLSNVLVRARNSSPDGYLHVK  373

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            ++GFGLS +K+     N    +  ++  IWYAPEVL EQEQ       G+K++EKADVYS
Sbjct  374  IAGFGLSPLKNSKASGN---QAAAMNSCIWYAPEVLLEQEQ--SGDAGGSKYTEKADVYS  428

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PKYLTNL ++CWH  P+
Sbjct  429  FAMICFEVLTGKVPFEDNH--LQGDKMSKNIRAGERPLFPFQSPKYLTNLTKRCWHADPS  486

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPD--CPPPLVDYCDIEAGYIKKFP--GDNVPPG  890
             RP FSS+CR+LRY+K+ L++NP+HG PD    PP VDY DI+    K+F          
Sbjct  487  QRPSFSSLCRVLRYVKRFLILNPDHGQPDSVVVPP-VDYFDIDTSLSKRFTNWARKETIQ  545

Query  891  VSEIPFQMFAYKLVEKEKTLGN  956
            VSEIPFQM+AY++V++EKT  N
Sbjct  546  VSEIPFQMYAYRVVDREKTSAN  567



>ref|XP_006339677.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Solanum tuberosum]
Length=687

 Score =   352 bits (902),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/319 (53%), Positives = 228/319 (71%), Gaps = 9/319 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR  +G+I  L P+I+  + LSHPN++   CGF DEE++E FL+MELMSK L   IKE
Sbjct  266  FCLRHLFGDIKPLIPDISQELHLSHPNIMHISCGFTDEEKRECFLIMELMSKDLSSCIKE  325

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
              G RKR+ FS+PVA+D++LQIARGMEYLHS+ I+HGEL+PSN+L++  +   E Y H+K
Sbjct  326  ICGPRKRVPFSLPVAIDLLLQIARGMEYLHSKKIYHGELSPSNVLVKARNVSTEGYLHAK  385

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            V GFG S   +     N  + +G + P IW++PEVLAEQEQ    +    K++EK+DVYS
Sbjct  386  VCGFGSSCSINLPQKANVNQNNGTL-PFIWFSPEVLAEQEQ--SGNGGNIKYTEKSDVYS  442

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PKY+T+L ++CWHT P 
Sbjct  443  FGMICFEVLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFHSPKYVTSLTKRCWHTDPY  500

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP----GDNVPPG  890
             RP FSS+CR+LRY+K+ LV+NPEH   D P P VDY +IE   ++ FP     ++ P  
Sbjct  501  QRPSFSSICRVLRYVKRFLVMNPEHSQQDSPLPPVDYGEIETVILRSFPFLGNSESDPLP  560

Query  891  VSEIPFQMFAYKLVEKEKT  947
            V++IPF MFAY++ EKEK+
Sbjct  561  VTQIPFHMFAYRVTEKEKS  579



>ref|XP_006405314.1| hypothetical protein EUTSA_v10027660mg [Eutrema salsugineum]
 gb|ESQ46767.1| hypothetical protein EUTSA_v10027660mg [Eutrema salsugineum]
Length=715

 Score =   352 bits (904),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 231/320 (72%), Gaps = 17/320 (5%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA+R F+ ++  L  EI++++SL H N+LQY CGFYDEERKE FLVMELM K L  ++KE
Sbjct  262  FAVRHFFSDLEPLSSEISSLLSLCHSNILQYLCGFYDEERKECFLVMELMHKDLQSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+ V VD+MLQIARGMEYLH  +IFHG+LNP N+LL+  S   + YFH+K
Sbjct  322  NCGPRRRYLFSVSVVVDIMLQIARGMEYLHGNDIFHGDLNPMNVLLKERSHT-DGYFHAK  380

Query  363  VSGFGL--SMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADV  536
            +SGFGL      S  T  N P      DPVIWYAPEVLAE E  +   KS  K + KADV
Sbjct  381  ISGFGLSSVKSCSSSTRPNTP------DPVIWYAPEVLAEMETGKNDQKS--KLTHKADV  432

Query  537  YSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTS  716
            YSF M+CF+++TGK PFE+    LQG+KM  ++  GERPLFP+P PKYL +LI++CWH+ 
Sbjct  433  YSFAMVCFELITGKVPFEDSH--LQGEKMAINIRMGERPLFPFPSPKYLVSLIKRCWHSE  490

Query  717  PNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVP----  884
            P+ RP FSSVCRILRYIKK LV+N +HGHP    PLVD  D+EA +++KFPGD+      
Sbjct  491  PSQRPNFSSVCRILRYIKKFLVVNQDHGHPQMQTPLVDCWDLEAKFLRKFPGDHSSGCHI  550

Query  885  PGVSEIPFQMFAYKLVEKEK  944
              V++IPFQ+++Y++ E+EK
Sbjct  551  ASVTQIPFQLYSYRVSEREK  570



>ref|XP_009410857.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7 [Musa 
acuminata subsp. malaccensis]
Length=683

 Score =   351 bits (901),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 226/320 (71%), Gaps = 8/320 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F+++   GEI  L  EI+ + S++HPNV++Y   F DEE+KE ++VMELMSK L  +I E
Sbjct  255  FSVKHVIGEIEPLMSEISLLSSITHPNVVRYMYSFVDEEKKESYMVMELMSKDLCSYINE  314

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             S  R+++ F + VAVD M QIARGMEYLH +NI+HG+LNPSNIL++  +S  + Y H K
Sbjct  315  ISSTRRKVPFPLLVAVDTMHQIARGMEYLHGKNIYHGDLNPSNILVKTRNSSPDGYLHVK  374

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            V+GFGLS +K+     N   A+   +P IWYAPEVL EQE   G S S +K +EKADVYS
Sbjct  375  VTGFGLSSVKNSKPSANQAPAT---NPCIWYAPEVLLEQETS-GESGSASKCTEKADVYS  430

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F MLCF++LTGK PFE+    LQGDKM  ++ AG RPLFP+  PK+LTNL ++CWH  P+
Sbjct  431  FSMLCFELLTGKIPFEDDH--LQGDKMSKNIRAGARPLFPFHSPKFLTNLTKRCWHADPS  488

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGVS  896
             RP FSS+CR+LRYIK+ LV+NP+H  PD P P VDY D+E    KKF        P VS
Sbjct  489  QRPSFSSICRVLRYIKRFLVMNPDHSQPDAPMPPVDYFDLETSLSKKFASWARKDTPRVS  548

Query  897  EIPFQMFAYKLVEKEKTLGN  956
            EIPFQM+AY++VE+EKT  N
Sbjct  549  EIPFQMYAYRVVEREKTSAN  568



>ref|XP_004143955.1| PREDICTED: uncharacterized protein LOC101209943 [Cucumis sativus]
 ref|XP_004161472.1| PREDICTED: uncharacterized protein LOC101223325 [Cucumis sativus]
 gb|KGN50033.1| hypothetical protein Csa_5G151000 [Cucumis sativus]
Length=711

 Score =   352 bits (903),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 185/367 (50%), Positives = 243/367 (66%), Gaps = 30/367 (8%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             F +R F  E      E+  ++SL HPN+LQY CGF DEE+KE FLV ELMSK L  ++K+
Sbjct  261   FGMRQFTAETEETESEVPILLSLLHPNILQYLCGFLDEEKKEYFLVTELMSKDLSSYMKD  320

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             N+G R+R+ F + V+VD+MLQIARGMEYLHS+ I+HG+LNPSN+ ++P +S   +Y   K
Sbjct  321   NNGARRRLLFPLHVSVDIMLQIARGMEYLHSQMIYHGDLNPSNVFMKPRNSSEGSYL-VK  379

Query  363   VSGFGLSMMKSQYTFRNCPRASGG---VDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKAD  533
             VSGFGLS +K+     + PR S      +P IW+APEV+AEQEQ    + S  + +EKAD
Sbjct  380   VSGFGLSSVKN-----SPPRNSTNQLETNPFIWHAPEVMAEQEQQAPGTVSFFRKTEKAD  434

Query  534   VYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHT  713
             VYSFGMLCF++LTGK PFE+    LQG+KM  ++ AGERPLFP+P PKYL +L ++CWH+
Sbjct  435   VYSFGMLCFELLTGKVPFEDSH--LQGEKMSRNIRAGERPLFPFPTPKYLVSLTKRCWHS  492

Query  714   SPNARPGFSSVCRILRYIKKVLVINP-EHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPP-  887
              P+ R  FSS+CRILR +KK L +NP E   P+   P VDYCD+EAG  +KF  D V   
Sbjct  493   DPSQRLSFSSICRILRQVKKFLAMNPAESNQPELQMPTVDYCDVEAGVARKFSSDGVGDL  552

Query  888   -GVSEIPFQMFAYKLVEKEKT----------------LGNDGFAVRARDDHLVSMDDLCL  1016
               VS+IPFQMFAY+L EKEKT                +  D  A   RDD +  ++D   
Sbjct  553   CSVSQIPFQMFAYRLAEKEKTNPSKIKTWDSASDVVSISKDDCASIYRDDTVSVIEDPFT  612

Query  1017  VPNNGTR  1037
             +P + TR
Sbjct  613   IPASDTR  619



>emb|CAA73313.1| hypothetical protein [Arabidopsis thaliana]
Length=677

 Score =   351 bits (900),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 178/328 (54%), Positives = 236/328 (72%), Gaps = 12/328 (4%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G+I AL P+I  ++SLSHPN++ Y CGF DEE+KE FLVMELM K+L MHIKE
Sbjct  259  FALRHFFGDIDALLPQITPLLSLSHPNIVYYLCGFTDEEKKECFLVMELMRKTLGMHIKE  318

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSS-PGETYFHS  359
              G RK+ + S+PVAVD+MLQIA GMEYLHS+ I+HGELNPSNIL++P S+  G+ Y   
Sbjct  319  VCGPRKKNTLSLPVAVDLMLQIALGMEYLHSKRIYHGELNPSNILVKPRSNQSGDGYLLG  378

Query  360  KVSGFGLSMMKSQYTFRNCPRASGGVD-PVIWYAPEVLAEQEQPRGSSKSGAKFSEKADV  536
            K+ GFGL+ +K  ++ ++    S   + P IWY+PEVL EQEQ  G++ S  K+S+K+DV
Sbjct  379  KIFGFGLNSVKG-FSSKSASLTSQNENFPFIWYSPEVLEEQEQS-GTAGS-LKYSDKSDV  435

Query  537  YSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTS  716
            YSFGM+ F++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PK++TNL ++CWH  
Sbjct  436  YSFGMVSFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFNSPKFITNLTKRCWHAD  493

Query  717  PNARPGFSSVCRILRYIKKVLVINPE-HGHPDCPP---PLVDYCDIEAGYIKKFPGDNVP  884
            PN RP FSS+ RILRYIK+ L +NPE +      P   P VDYC+IE   ++K   ++  
Sbjct  494  PNQRPTFSSISRILRYIKRFLALNPECYSSSQQDPSIAPTVDYCEIETKLLQKLSWESTE  553

Query  885  -PGVSEIPFQMFAYKLVEKEKTLGNDGF  965
               VS++PFQMFAY++VE+ KT   D  
Sbjct  554  LTKVSQVPFQMFAYRVVERAKTCEKDNL  581



>gb|KFK42533.1| hypothetical protein AALP_AA1G006700 [Arabis alpina]
Length=644

 Score =   348 bits (894),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 229/324 (71%), Gaps = 15/324 (5%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F G+I AL P++  ++SLSHPN++ Y CGF DEE+KE FLVMELMSK+L MHIKE
Sbjct  211  FALRHFLGDIDALLPQVTPLLSLSHPNIVYYLCGFTDEEKKECFLVMELMSKTLGMHIKE  270

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSS--PGETYFH  356
              G RK+ + S+PVAVD+MLQIARGMEYLHS+ I+HGELNPSNIL++P  +   G+ Y H
Sbjct  271  VCGPRKKNTLSLPVAVDLMLQIARGMEYLHSKRIYHGELNPSNILVKPRRNNPSGDGYLH  330

Query  357  SKVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGA-KFSEKAD  533
             K+ GFGL+ +K        P +     P IWY+PEVL EQEQ   S  +G  K+++K+D
Sbjct  331  GKILGFGLNSVKGFSCKVASPTSHNANFPFIWYSPEVLEEQEQ---SGTAGCLKYTDKSD  387

Query  534  VYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHT  713
            VYSF M+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+   K++TNL ++CWH 
Sbjct  388  VYSFAMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFHSHKFVTNLTKRCWHA  445

Query  714  SPNARPGFSSVCRILRYIKKVLVINPE-----HGHPDCP-PPLVDYCDIEAGYIKKFPGD  875
             P  RP FSS+ RILRYI++ + +NPE         D P  PLVDYC+IE   ++K   +
Sbjct  446  DPTQRPTFSSITRILRYIRRFIALNPECHSSSSSQQDLPVAPLVDYCEIETKLLQKLSWE  505

Query  876  NVPPG-VSEIPFQMFAYKLVEKEK  944
            +     VS++PFQMFAY++VE+ K
Sbjct  506  SSELTLVSQVPFQMFAYRVVEQAK  529



>ref|XP_006303540.1| hypothetical protein CARUB_v10010980mg [Capsella rubella]
 gb|EOA36438.1| hypothetical protein CARUB_v10010980mg [Capsella rubella]
Length=648

 Score =   347 bits (890),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 229/328 (70%), Gaps = 23/328 (7%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G+I AL P+I  ++SLSHPN++ Y CGF DEE+KE FLV ELMSK+L MHIKE
Sbjct  259  FALRHFFGDIDALLPQITPLLSLSHPNIVYYLCGFTDEEKKECFLVTELMSKTLGMHIKE  318

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILL--RPMSSPGETYFH  356
              G RK+ + S+PVAVD+MLQIA GMEYLHS+ I+HGELNPSNIL+  R ++  G+ Y H
Sbjct  319  VCGPRKKNTLSLPVAVDLMLQIALGMEYLHSKKIYHGELNPSNILVKSRKLNQSGDGYLH  378

Query  357  SKVSGFGLSMMKSQYTFRNCPRASGGVD------PVIWYAPEVLAEQEQPRGSSKSGAKF  518
             K+ GFGL+ +K        P  S  +       P IWY+PEVL EQEQ    +    K+
Sbjct  379  GKIFGFGLNSVK------GFPGKSASLTGQNENFPFIWYSPEVLEEQEQ--SGTVGSFKY  430

Query  519  SEKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIR  698
            ++K+DVYSFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  P+ +TNL +
Sbjct  431  TDKSDVYSFGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFHSPRLITNLTK  488

Query  699  KCWHTSPNARPGFSSVCRILRYIKKVLVINPE-HGHPDCPPPL---VDYCDIEAGYIKKF  866
            +CWH  PN RP FSS+ RILRYIK+ L +N E H      PP+   VDYC+IE   ++K 
Sbjct  489  RCWHADPNQRPTFSSISRILRYIKRFLALNQECHSSSQQDPPIAPPVDYCEIETKLLQKL  548

Query  867  PGDNVP-PGVSEIPFQMFAYKLVEKEKT  947
              ++     VS++PFQMFAY++VE+ KT
Sbjct  549  SWESTELTQVSQVPFQMFAYRVVERAKT  576



>ref|XP_008376057.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Malus domestica]
Length=683

 Score =   348 bits (892),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 246/347 (71%), Gaps = 20/347 (6%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA R F+GEI  L  EI+ ++SLSHPN++ + CGF DEE+KE FL+MELMS+ L  +IK 
Sbjct  260   FASRHFFGEIEPLLXEISLLLSLSHPNIVLFPCGFTDEEKKECFLIMELMSRDLCSYIKA  319

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G RKR+ FS+PVA+D+MLQIARGMEYLHS+ I+HG+L+PSN+L++      E Y  +K
Sbjct  320   ICGPRKRLPFSLPVAIDLMLQIARGMEYLHSKKIYHGDLDPSNVLVKARGISTEGYLQAK  379

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             VSGFGL+ + +    +N P    G    IWYAPEVL EQEQ + + K   K++EK+DVYS
Sbjct  380   VSGFGLASVNTS-NHKN-PSNQNGSLSFIWYAPEVLEEQEQGKSTEK---KYAEKSDVYS  434

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+   +Y+TNL +KCWH+ PN
Sbjct  435   FGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFYXLRYVTNLTKKCWHSDPN  492

Query  723   ARPGFSSVCRILRYIKKVLVINPEHG-HPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGV  893
              RP FSS+CRILRYIK+ L +NP++    D P P+VDYC+IE+G ++K P  G + P  +
Sbjct  493   QRPSFSSICRILRYIKRFLAMNPDYNSQLDPPVPMVDYCEIESGLLRKIPSWGSSEPSPI  552

Query  894   SEIPFQMFAYKLVEKEKT---------LGNDGFAVRARDDHLVSMDD  1007
             S+IPFQMF Y++ E+E+T          G+DG ++   D+ +V  DD
Sbjct  553   SQIPFQMFVYRIAERERTSSSLKDTSESGSDGASI-CGDEIVVPADD  598



>ref|XP_002532661.1| serine-threonine protein kinase, putative [Ricinus communis]
 gb|EEF29734.1| serine-threonine protein kinase, putative [Ricinus communis]
Length=685

 Score =   348 bits (892),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 229/322 (71%), Gaps = 15/322 (5%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             A+R F+G+I  L PEI++++SLSHPN+  + CGF DEE+KE FLVMELMS+ +  +IKE
Sbjct  259  LAIRHFFGDIQPLVPEISSLLSLSHPNISYFFCGFTDEEKKECFLVMELMSRDMCSYIKE  318

Query  183  NSGQRKR-MSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
              G RKR + FS+PVAVD+MLQIARGMEYLHS+ I+HG+LNPSNIL++P S+  E Y H 
Sbjct  319  ICGPRKRSLPFSLPVAVDIMLQIARGMEYLHSKKIYHGDLNPSNILVKPRSTT-EGYVHV  377

Query  360  KVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVY  539
            KVSGFGLS      +F+  P    G    IWYAPEVL EQEQ    S   +K++EK+DVY
Sbjct  378  KVSGFGLS------SFKKNPSKQNGTLSFIWYAPEVLEEQEQT--GSAPNSKYTEKSDVY  429

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SFGM+CF ILTGK PF++    LQG+KM  ++ AGERPLFP   PKY+TNL ++CW   P
Sbjct  430  SFGMVCFGILTGKVPFDDSH--LQGEKMSRNIRAGERPLFPLNSPKYVTNLTKRCWQADP  487

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGHPDCP-PPLVDYCDIEAGYIKKFPGDNVPPG--  890
            N RP FSS+CRILRY K+ L +NP++     P  P VDY D+++  ++K+P  +      
Sbjct  488  NQRPSFSSICRILRYTKRFLAMNPDYNRELDPLMPAVDYVDMDSKLLRKYPSWDAADSSQ  547

Query  891  VSEIPFQMFAYKLVEKEKTLGN  956
            +++IPFQMF  +++EKEKT  N
Sbjct  548  IAQIPFQMFVCRVIEKEKTRVN  569



>ref|XP_010474742.1| PREDICTED: light-sensor Protein kinase-like isoform X1 [Camelina 
sativa]
Length=488

 Score =   341 bits (875),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 173/328 (53%), Positives = 231/328 (70%), Gaps = 19/328 (6%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G+I AL P++  ++SLSHPN++ Y CGF DEE+KE FLV ELMSK+L  HIKE
Sbjct  52   FALRHFFGDIDALLPQVTQLLSLSHPNIVYYLCGFTDEEKKECFLVTELMSKTLGTHIKE  111

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSS----PGETY  350
              G RK+ + S+PVAVD+MLQIA GMEYLHS+ I+HGELNPSNIL++P  S     G  +
Sbjct  112  VCGPRKKNTLSLPVAVDLMLQIALGMEYLHSKKIYHGELNPSNILVKPRRSYQYGDGYHH  171

Query  351  FHSKVSGFGLSMMKSQYTFRNCPRASGGVD--PVIWYAPEVLAEQEQPRGSSKSGA-KFS  521
             H K+ GFGL+ +K  ++ +     +G  +  P IWY+PEVL EQEQ   S  +G+ K++
Sbjct  172  LHGKIFGFGLNSVKG-FSSKISASLTGQNENFPFIWYSPEVLEEQEQ---SGTAGSLKYT  227

Query  522  EKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRK  701
            +K+DVYSFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFPY  P+ +TNL ++
Sbjct  228  DKSDVYSFGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPYHSPRLITNLTKR  285

Query  702  CWHTSPNARPGFSSVCRILRYIKKVLVINPE-HGHPDCPPPL----VDYCDIEAGYIKKF  866
            CWH  PN RP FSS+ RILRYIK+ + +N E H      PP+    VDYC+IE   + K 
Sbjct  286  CWHADPNQRPTFSSISRILRYIKRFIALNQECHSSSQQDPPINASPVDYCEIETKLLHKL  345

Query  867  PGDNVP-PGVSEIPFQMFAYKLVEKEKT  947
              +      VS++PFQMFAY++VE+ +T
Sbjct  346  SWETTELTQVSQVPFQMFAYRVVERART  373



>ref|XP_008783955.1| PREDICTED: serine/threonine-protein kinase PLK4-like [Phoenix 
dactylifera]
Length=683

 Score =   345 bits (886),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 222/320 (69%), Gaps = 16/320 (5%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA+  F+G+I  L+ EI+ V SL HP+++     F DEERKE FLVMELMSK L  +IKE
Sbjct  255  FAVGHFFGDIEPLKQEISLVSSLRHPHIMHIMYAFSDEERKELFLVMELMSKDLSSYIKE  314

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
                ++R+ F + VAVD+MLQIARGMEYLHSR IFHG+LNPSNIL++P +S  + + H K
Sbjct  315  ICSTKRRLPFPLLVAVDIMLQIARGMEYLHSRGIFHGDLNPSNILVKPRNSNPDGHLHVK  374

Query  363  VSGFGLSMMKSQYTFRNCPRAS---GGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKAD  533
            + G GL  +K        PR S      D  IWYAPEVL+EQEQ   +  S +K +EKAD
Sbjct  375  IQGIGLPSLKK-------PRDSTNQTATDSCIWYAPEVLSEQEQ--SAEPSVSKCTEKAD  425

Query  534  VYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHT  713
            VYSF M+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP P PKYLTNL ++CW  
Sbjct  426  VYSFAMICFEVLTGKIPFEDDH--LQGDKMSRNIRAGERPLFPLPSPKYLTNLTKRCWQA  483

Query  714  SPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG-  890
             P+ RP FSS+CR+LRYIK+ L++NP+ G PD P P VDY D+EA   K F         
Sbjct  484  DPSQRPSFSSICRVLRYIKRFLIMNPDRGQPDLPAPPVDYFDLEATLSKGFTTWATAEAL  543

Query  891  -VSEIPFQMFAYKLVEKEKT  947
             VSE+PFQMFAY+++E+E+T
Sbjct  544  TVSEVPFQMFAYRVMERERT  563



>emb|CDY34416.1| BnaA09g11580D [Brassica napus]
Length=751

 Score =   347 bits (889),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 171/317 (54%), Positives = 224/317 (71%), Gaps = 19/317 (6%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+G++  L  EI++++SL H N+LQY CGFYDEE+KE  LVMELM K L  ++KE
Sbjct  309  FVLRHFFGDLEPLDAEISSLLSLCHSNILQYLCGFYDEEKKECSLVMELMHKDLKSYMKE  368

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQIARGMEYLHS  IFHG+LNP NILL+  S   E YFH+K
Sbjct  369  NCGPRRRYLFSVPVVIDIMLQIARGMEYLHSNEIFHGDLNPMNILLKERSHT-EGYFHAK  427

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQP-RGSSKSGAKFSEKADVY  539
            +SGF  S           P       PVIWYAPEVL E EQ  +G +   +KF+ KADVY
Sbjct  428  ISGFASSR----------PTTPA---PVIWYAPEVLTEMEQDLKGITVPRSKFTHKADVY  474

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SF M+CF+++TGK PFE+    LQGD+M  ++  G+RPLFP+P PKYL +LI++CWH+ P
Sbjct  475  SFAMVCFELITGKVPFEDSH--LQGDEMGKNIRRGDRPLFPFPSPKYLVSLIKRCWHSEP  532

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD--NVPPGV  893
            + RP FSS+CRILRYIKK LV+NP+ GH     PLVD  D+EA +++KF  +  +    V
Sbjct  533  SQRPTFSSICRILRYIKKFLVVNPDQGHIQIQTPLVDCWDLEARFLRKFSIETGSHAESV  592

Query  894  SEIPFQMFAYKLVEKEK  944
             +IPFQ+++Y++ EKEK
Sbjct  593  MQIPFQLYSYRVAEKEK  609



>ref|XP_004511529.1| PREDICTED: serine/threonine-protein kinase dst1-like [Cicer arietinum]
Length=899

 Score =   350 bits (897),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 235/332 (71%), Gaps = 24/332 (7%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+GE  A   EI+ ++SL HPN+L+Y CGFYDEE+KE  LVMELM+K L  ++KE
Sbjct  271  FALRHFHGEREAHEEEISNLLSLYHPNILEYLCGFYDEEKKEFSLVMELMNKDLWTYMKE  330

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+++ FSIPV VD+MLQ+ARG+E+LHS+ I+HG+LNP NILLR  +S G  YF +K
Sbjct  331  NCGPRRQILFSIPVVVDLMLQMARGIEFLHSKKIYHGDLNPCNILLRARNSEG--YFLAK  388

Query  363  VSGFGLSMMKS-------QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSK--SGAK  515
            V GFGLS +KS       + +  N P  S  ++P IWYAPEVL E EQ +G++K  +  K
Sbjct  389  VVGFGLSSVKSSDNNNINKTSPTNNP-TSEEINPSIWYAPEVLTEIEQ-KGNAKASTSCK  446

Query  516  FSEKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLI  695
            +SEKAD YSFGM+CF++LTGK PFE+    LQGD+   +L AGERPLFPY  PKYL +LI
Sbjct  447  YSEKADAYSFGMICFELLTGKVPFEDNH--LQGDRTNQNLKAGERPLFPYHSPKYLVSLI  504

Query  696  RKCWHTSPNARPGFSSVCRILRYIKKVL-------VINPEHGHPDCPPPLVDYCDIEAGY  854
            +KCW T P+ RP FSS+CRILRY KK L       +INPE    +   P VD CDIE  +
Sbjct  505  KKCWQTDPSQRPTFSSICRILRYTKKFLSMNNEYAMINPELNQLELQNPPVDCCDIEGFF  564

Query  855  IKKFPGDNVP--PGVSEIPFQMFAYKLVEKEK  944
            +K FP + +     VS+IP++MFAYK+VEK K
Sbjct  565  LKNFPMERICNMSSVSQIPYEMFAYKVVEKGK  596



>ref|XP_003611022.1| Integrin-linked protein kinase [Medicago truncatula]
 gb|AES93980.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=893

 Score =   349 bits (896),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 181/330 (55%), Positives = 231/330 (70%), Gaps = 21/330 (6%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F GE  A   EI+ ++SLSHPN+LQY CGFYDEE+KE  LV ELM+K L  +++E
Sbjct  270  FALRHFLGEREAYENEISNLLSLSHPNILQYLCGFYDEEKKEFSLVTELMNKDLWTYMRE  329

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+++ FSIPV VD+MLQ+ARG+EYLHS+NI+HG LNP NILLR  +S  E YF +K
Sbjct  330  NCGPRRQILFSIPVVVDLMLQMARGIEYLHSKNIYHGNLNPCNILLRARNS-QEGYFQAK  388

Query  363  VSGFGLSMMKSQYTFRNCPRAS-------GGVDPVIWYAPEVLAEQEQPRGSSKSGAKFS  521
            V GFGLS +++   + N  R+S         ++P+IWYAPEVL E EQ + +  S  K+S
Sbjct  389  VVGFGLSSVENGEIY-NASRSSPTHNPIGEEINPIIWYAPEVLTELEQMKNAFTS-CKYS  446

Query  522  EKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRK  701
            EKAD YSFGM+CF++LTGK PFE+    LQG +   ++ AGERPLFPY  PKYL +LI+K
Sbjct  447  EKADAYSFGMICFELLTGKIPFEDNH--LQGIRTNQNIKAGERPLFPYRSPKYLVSLIKK  504

Query  702  CWHTSPNARPGFSSVCRILRYIKKVL-------VINPEHGHPDCPPPLVDYCDIEAGYIK  860
            CW T P+ RP FSS+CRILRYIKK L       +INPE    +   P VD CDIE  ++K
Sbjct  505  CWQTDPSQRPSFSSICRILRYIKKFLSMNTEYVLINPELNQLELQNPPVDCCDIEGIFLK  564

Query  861  KFPGDNV--PPGVSEIPFQMFAYKLVEKEK  944
             FP +       VS+IP++MFAYK+VEK K
Sbjct  565  SFPMERTYNMSFVSQIPYEMFAYKVVEKGK  594



>gb|AAF81305.1|AC061957_1 Contains similarity to a photoreceptor from Ceratodon purpureus 
gb|Y10901 and contains an eukaryotic protein kinase PF|00069 
domain. ESTs gb|N96753, gb|AI993724 come from this gene 
[Arabidopsis thaliana]
Length=1025

 Score =   352 bits (903),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 233/328 (71%), Gaps = 12/328 (4%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G+I AL P+I  ++SLSHPN++ Y CGF DEE+KE FLVMELM K+L MHIKE
Sbjct  583  FALRHFFGDIDALLPQITPLLSLSHPNIVYYLCGFTDEEKKECFLVMELMRKTLGMHIKE  642

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSS-PGETYFHS  359
              G RK+ + S+PVAVD+MLQIA GMEYLHS+ I+HGELNPSNIL++P S+  G+ Y   
Sbjct  643  VCGPRKKNTLSLPVAVDLMLQIALGMEYLHSKRIYHGELNPSNILVKPRSNQSGDGYLLG  702

Query  360  KVSGFGLSMMKSQYTFRNCPRASGGVD-PVIWYAPEVLAEQEQPRGSSKSGAKFSEKADV  536
            K+ GFGL+ +K  ++ ++    S   + P IWY+PEVL EQEQ    +    K+S+K+DV
Sbjct  703  KIFGFGLNSVKG-FSSKSASLTSQNENFPFIWYSPEVLEEQEQ--SGTAGSLKYSDKSDV  759

Query  537  YSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTS  716
            YSFGM+ F++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PK++TNL ++CWH  
Sbjct  760  YSFGMVSFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFNSPKFITNLTKRCWHAD  817

Query  717  PNARPGFSSVCRILRYIKKVLVINPE-HGHPDCPP---PLVDYCDIEAGYIKKFPGDNVP  884
            PN RP FSS+ RILRYIK+ L +NPE +      P   P VDYC+IE   ++K   ++  
Sbjct  818  PNQRPTFSSISRILRYIKRFLALNPECYSSSQQDPSIAPTVDYCEIETKLLQKLSWESTE  877

Query  885  -PGVSEIPFQMFAYKLVEKEKTLGNDGF  965
               VS++PFQMFAY++VE+ KT   D  
Sbjct  878  LTKVSQVPFQMFAYRVVERAKTCEKDNL  905



>ref|XP_002889366.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65625.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=970

 Score =   350 bits (898),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 173/329 (53%), Positives = 234/329 (71%), Gaps = 14/329 (4%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G+I  L P++  ++SLSHPN++ Y CGF DEE+KE FLVMELMSK+L MHIKE
Sbjct  530  FALRHFFGDIDTLLPKVTPLLSLSHPNIVYYLCGFTDEEKKECFLVMELMSKTLGMHIKE  589

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMS-SPGETYFHS  359
              G RK+ + S+PVAVD+MLQIA GMEYLHS+ I+HGELNPSNIL++P S   G+ Y   
Sbjct  590  VCGPRKKNTLSLPVAVDLMLQIALGMEYLHSKRIYHGELNPSNILVKPRSHQSGDGYLLG  649

Query  360  KVSGFGLSMMKSQYTFRNCPRASGGVD-PVIWYAPEVLAEQEQPRGSSKSGAKFSEKADV  536
            K+ GFGL+ +K  ++ ++    S   + P IWY+PEVL EQEQ    +    K+++K+DV
Sbjct  650  KIFGFGLNSVKG-FSSKSASLTSQNENFPFIWYSPEVLEEQEQ--SGTAGSLKYTDKSDV  706

Query  537  YSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTS  716
            YSFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PK++TNL ++CWH  
Sbjct  707  YSFGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFNSPKFITNLTKRCWHAD  764

Query  717  PNARPGFSSVCRILRYIKKVLVINPEH-----GHPDCPPPLVDYCDIEAGYIKKFPGDNV  881
            PN RP FSS+ R+LRYIK+ L +NPE+       P   PP VDY +IE+  ++K   ++ 
Sbjct  765  PNQRPTFSSISRVLRYIKRFLALNPEYHSSSQQDPSIAPP-VDYWEIESKLLQKLSWEST  823

Query  882  P-PGVSEIPFQMFAYKLVEKEKTLGNDGF  965
                VS++PFQMFAY++VE+ +T   D  
Sbjct  824  ELTQVSQVPFQMFAYRVVERAQTCKKDNL  852



>emb|CDY38181.1| BnaA09g12080D [Brassica napus]
Length=711

 Score =   343 bits (881),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 170/317 (54%), Positives = 223/317 (70%), Gaps = 19/317 (6%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F G++  L  EI++++SL H N+LQY CGFYD+E+KE  LVMELM K L  ++KE
Sbjct  262  FVLRHFLGDLEPLDAEISSLLSLCHSNILQYLCGFYDKEKKECSLVMELMHKDLKSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQIARGMEYLHS  IFHG+LNP NILL+  S   E YFH+K
Sbjct  322  NCGPRRRYLFSVPVVIDIMLQIARGMEYLHSNEIFHGDLNPMNILLKERSHT-EGYFHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQP-RGSSKSGAKFSEKADVY  539
            +SGF  S           P       PVIWYAPEVL E EQ  +G +   +KF+ KADVY
Sbjct  381  ISGFASSR----------PTTPA---PVIWYAPEVLTEMEQDLKGITVPRSKFTHKADVY  427

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SF M+CF+++TGK PFE+    LQGD+M  ++  G+RPLFP+P PKYL +LI++CWH+ P
Sbjct  428  SFAMVCFELITGKVPFEDSH--LQGDEMGKNIRRGDRPLFPFPSPKYLVSLIKRCWHSEP  485

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD--NVPPGV  893
            + RP FSS+CRILRY+KK LV+NP+ GH     PLVD  D+EA ++KKF  +  +    V
Sbjct  486  SQRPTFSSICRILRYVKKFLVVNPDQGHIQIQTPLVDCWDLEARFLKKFSIETGSHAESV  545

Query  894  SEIPFQMFAYKLVEKEK  944
             +IPFQ+++Y++ EKEK
Sbjct  546  MQIPFQLYSYRVAEKEK  562



>ref|XP_010474743.1| PREDICTED: uncharacterized protein LOC104754290 isoform X2 [Camelina 
sativa]
Length=693

 Score =   343 bits (879),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 172/325 (53%), Positives = 230/325 (71%), Gaps = 15/325 (5%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G+I AL P++  ++SLSHPN++ Y CGF DEE+KE FLV ELMSK+L  HIKE
Sbjct  259  FALRHFFGDIDALLPQVTQLLSLSHPNIVYYLCGFTDEEKKECFLVTELMSKTLGTHIKE  318

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSS----PGETY  350
              G RK+ + S+PVAVD+MLQIA GMEYLHS+ I+HGELNPSNIL++P  S     G  +
Sbjct  319  VCGPRKKNTLSLPVAVDLMLQIALGMEYLHSKKIYHGELNPSNILVKPRRSYQYGDGYHH  378

Query  351  FHSKVSGFGLSMMKSQYTFRNCPRASGGVD--PVIWYAPEVLAEQEQPRGSSKSGAKFSE  524
             H K+ GFGL+ +K  ++ +     +G  +  P IWY+PEVL EQEQ  G++ S  K+++
Sbjct  379  LHEKIFGFGLNSVKG-FSSKISASLTGQNENFPFIWYSPEVLEEQEQS-GTAGS-LKYTD  435

Query  525  KADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKC  704
            K+DVYSFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFPY  P+ +TNL ++C
Sbjct  436  KSDVYSFGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPYHSPRLITNLTKRC  493

Query  705  WHTSPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPP---PLVDYCDIEAGYIKKFPGD  875
            WH  PN RP FSS+ RILRYIK+ + +N E+     PP     VDYC+IE   + K   +
Sbjct  494  WHADPNQRPTFSSISRILRYIKRFIALNQEYDSQQDPPINASPVDYCEIETKLLHKLSWE  553

Query  876  NVP-PGVSEIPFQMFAYKLVEKEKT  947
                  VS++PFQMFAY++VE+ +T
Sbjct  554  TTELTQVSQVPFQMFAYRVVERART  578



>ref|XP_008798680.1| PREDICTED: tyrosine-protein kinase ABL1-like [Phoenix dactylifera]
Length=642

 Score =   341 bits (875),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 224/321 (70%), Gaps = 11/321 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA++   GEI  L  EI+ + S++HPNV+     FYDEE+KEGFLV++LMSK L  HIKE
Sbjct  255  FAVKHVIGEIEPLMNEISLLTSINHPNVMHCMYSFYDEEKKEGFLVLDLMSKDLSDHIKE  314

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
                R+R+ F + VAVDVMLQIARGMEYLHSR I HG+LNPSN+L+R  S   + Y H K
Sbjct  315  ICSSRRRIPFPLLVAVDVMLQIARGMEYLHSRKIHHGDLNPSNVLVRTRSYSPDGYLHVK  374

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSG-AKFSEKADVY  539
            ++GFGLS +K      N    S  ++  IW APEVL EQ+    S ++G +K++EKADVY
Sbjct  375  ITGFGLSPLKKSKVSAN---QSATMNSCIWCAPEVLLEQDL---SGEAGSSKYTEKADVY  428

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  PKYLT+L ++CWH +P
Sbjct  429  SFGMICFELLTGKIPFEDNH--LQGDKMSKNIRAGERPLFPFQCPKYLTSLTKRCWHANP  486

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGV  893
            + RP FSS+CR+LRY K+ L++NP H  PD   P VDY DIE    K+F          V
Sbjct  487  SQRPSFSSLCRVLRYTKRFLIMNPNHDQPDPVVPPVDYFDIETSLSKRFTNWARKETIQV  546

Query  894  SEIPFQMFAYKLVEKEKTLGN  956
            SEIPFQM+AY+++E+EKT  N
Sbjct  547  SEIPFQMYAYRVIEREKTSLN  567



>ref|XP_010480291.1| PREDICTED: CBL-interacting serine/threonine-protein kinase 20-like 
[Camelina sativa]
Length=693

 Score =   342 bits (878),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 169/324 (52%), Positives = 224/324 (69%), Gaps = 13/324 (4%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G+I AL P++  ++SLSHPN++ Y CGF DEE+KE FLV ELMSK+L  HIKE
Sbjct  259  FALRHFFGDIDALLPQVTQLLSLSHPNIVYYLCGFTDEEKKECFLVTELMSKTLGTHIKE  318

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSS----PGETY  350
              G RK+ + S+PVAVD+MLQIA GMEYLHS+ I+HGELNPSNIL++P  S     G  +
Sbjct  319  VCGPRKKNTLSLPVAVDLMLQIALGMEYLHSKKIYHGELNPSNILVKPRRSNQYGDGYHH  378

Query  351  FHSKVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKA  530
             H K+ GFGL+ +K   +            P IWY+PEVL EQEQ    +    K+++K+
Sbjct  379  LHEKIFGFGLNSVKGFSSKSASLTGQNENFPFIWYSPEVLEEQEQ--SGTAGSLKYTDKS  436

Query  531  DVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWH  710
            DVYSFGM+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP+  P+ +TNL ++CWH
Sbjct  437  DVYSFGMVCFELLTGKVPFEDSH--LQGDKMSRNIRAGERPLFPFHSPRLITNLTKRCWH  494

Query  711  TSPNARPGFSSVCRILRYIKKVLVINPE-HGHPDCPPPL---VDYCDIEAGYIKKFPGDN  878
              P+ RP FSS+ RILRYIK+ L +N E H      PP+   VDYC+IE   ++K   + 
Sbjct  495  ADPDQRPTFSSISRILRYIKRFLALNQECHSSSQQDPPIASPVDYCEIETKLLQKLSWET  554

Query  879  VP-PGVSEIPFQMFAYKLVEKEKT  947
                 VS++PFQMFAY++VE+ +T
Sbjct  555  TELTQVSQVPFQMFAYRVVERART  578



>emb|CDY25576.1| BnaC09g12010D [Brassica napus]
Length=910

 Score =   347 bits (890),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 171/317 (54%), Positives = 223/317 (70%), Gaps = 19/317 (6%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F LR F+G++  L  EI++++SL H N+LQY CGFYDEE+KE  LVMELM K L  ++KE
Sbjct  568  FVLRHFFGDLEPLDAEISSLLSLCHSNILQYLCGFYDEEKKECSLVMELMHKDLKSYMKE  627

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+PV +D+MLQIARGMEYLHS  IFHG+LNP NILL+  S   E YFH+K
Sbjct  628  NCGPRRRYLFSVPVVIDIMLQIARGMEYLHSNEIFHGDLNPMNILLKERSHT-EGYFHAK  686

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQP-RGSSKSGAKFSEKADVY  539
            +SGF  S           P       PVIWYAPEVL E EQ  +G +   +KF+ KADVY
Sbjct  687  ISGFASSR----------PTTPA---PVIWYAPEVLTEMEQDLKGITVPRSKFTHKADVY  733

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SF M+CF+++TGK PFE+    LQGD+M  ++  G+RPLFP+P PKYL +LIR+CWH+ P
Sbjct  734  SFAMVCFELITGKVPFEDSH--LQGDEMGKNIRRGDRPLFPFPSPKYLVSLIRRCWHSEP  791

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD--NVPPGV  893
            + RP FSS+CRILRY+KK LV+NP+ GH     PLVD  D+E  ++KKF  +  +    V
Sbjct  792  SQRPTFSSICRILRYVKKFLVVNPDQGHIQIQTPLVDCWDLETRFLKKFSIETGSHAESV  851

Query  894  SEIPFQMFAYKLVEKEK  944
             +IPFQ+++Y++ EKEK
Sbjct  852  MQIPFQLYSYRVAEKEK  868



>ref|XP_009415712.1| PREDICTED: uncharacterized protein LOC103996521 [Musa acuminata 
subsp. malaccensis]
Length=686

 Score =   340 bits (873),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 221/320 (69%), Gaps = 13/320 (4%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA++   GE+  L PEI+ + SLSH NV+ Y   F DEE+KE  LVM+LMSK L  +IKE
Sbjct  255  FAVKHVIGEMEPLMPEISLLSSLSHTNVVHYMYSFVDEEKKECMLVMDLMSKDLSSYIKE  314

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
                R+++ F + VAVD MLQIARGMEYLHS+NI+HG+LNPSNIL++  S+  + + H+K
Sbjct  315  ICSTRRKVPFPLVVAVDTMLQIARGMEYLHSKNIYHGDLNPSNILVKTRSASPDGHLHAK  374

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            V+GFGLS +K     +     +      IWYAPEVL EQE       S AK +EKADVYS
Sbjct  375  VTGFGLSPVKHS---KPTATQAAATQSCIWYAPEVLLEQES------SSAKCTEKADVYS  425

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CF++LTGK PFE+    LQGDKM  S+  GERP FP   PKYL NL ++CWH  P+
Sbjct  426  FGMICFELLTGKLPFEDNH--LQGDKMSKSIRGGERPSFPGQYPKYLINLAKRCWHGDPS  483

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGVS  896
             RPGF+S+CR LRY+K+ +V+NP+HG PD P P VDY +++    K+F   G    P VS
Sbjct  484  QRPGFNSICRALRYMKRFMVMNPDHGQPDAPMPPVDYFELDMSLCKRFTNWGRKDVPRVS  543

Query  897  EIPFQMFAYKLVEKEKTLGN  956
            EIPFQM+AY++VE+E+T  N
Sbjct  544  EIPFQMYAYRVVERERTSAN  563



>ref|XP_009396649.1| PREDICTED: tyrosine-protein kinase ABL1-like [Musa acuminata 
subsp. malaccensis]
Length=687

 Score =   338 bits (867),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 173/320 (54%), Positives = 222/320 (69%), Gaps = 8/320 (3%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FA++   GEI  L   I+ + S+SH NV  Y   F DEE+KE FL+MELM+K L  +IKE
Sbjct  255  FAVKHVIGEIEPLMSVISLLSSVSHTNVAYYVYSFVDEEKKECFLLMELMTKDLSSYIKE  314

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
             S  R+++ F + VAVD+MLQIARGMEYLHS+NI+HG+LNPSNIL++  +S  + Y H K
Sbjct  315  ISSTRRKVLFPLLVAVDIMLQIARGMEYLHSKNIYHGDLNPSNILVKTRNSSPDGYLHVK  374

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            V+G GLS MK+   + N    +   +P IWYAPEVL EQE+  G S  G+K +EKADVYS
Sbjct  375  VTGCGLSPMKNSKPWAN---QAAATNPCIWYAPEVLLEQERS-GESSGGSKCTEKADVYS  430

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF++LTGK PFE+    LQGDKM  ++ AG RPLF    PKYLT L ++CW T P+
Sbjct  431  FAMICFELLTGKIPFEDDH--LQGDKMSKNIRAGVRPLFACQSPKYLTTLTKRCWQTDPS  488

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP--GDNVPPGVS  896
             RP FSS+CR+LRYIK+ LV+NP+H  PD P P  DY D+E    K+F   G    P VS
Sbjct  489  QRPSFSSICRVLRYIKRFLVMNPDHSQPDAPMPPADYYDLEISLCKRFTNWGRKDVPRVS  548

Query  897  EIPFQMFAYKLVEKEKTLGN  956
            EIPFQM+AY++ E+EKT  N
Sbjct  549  EIPFQMYAYRVAEREKTSTN  568



>ref|XP_003538680.1| PREDICTED: uncharacterized protein LOC100778844 [Glycine max]
 gb|KHN35066.1| Light-sensor Protein kinase [Glycine soja]
Length=864

 Score =   340 bits (871),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 174/331 (53%), Positives = 223/331 (67%), Gaps = 17/331 (5%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F GE  A   E++T++SLSHPN+LQY CGFYDEE+KE  LVMELM+K L  ++K+
Sbjct  256  FALRHFQGERQAHEAEVSTLLSLSHPNILQYLCGFYDEEKKEYSLVMELMNKDLWTYMKD  315

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+++ FS+PV VD+MLQ+ARGMEYLHS+ IFHG LNP NILL+P +S  E YF +K
Sbjct  316  NCGPRRQILFSVPVVVDLMLQMARGMEYLHSKKIFHGHLNPCNILLKPRNS-QEGYFQAK  374

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            VSGFGLS + +     +   A    DP+ W+APEVL E EQ   +  +    SEKAD YS
Sbjct  375  VSGFGLSSVNNININSD---AHEDHDPLTWFAPEVLTELEQTPDAYANSTCTSEKADAYS  431

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CF++LTGK PFE+    L+G +   ++ AGERPLFPY  PKYL +LI+KCW T P 
Sbjct  432  FGMICFELLTGKVPFEDNH--LRGARTSQNIKAGERPLFPYRSPKYLVSLIKKCWQTDPA  489

Query  723  ARPGFSSVCRILRYIKKVLVINPE--------HGHPDCPPPLVDYCDIEAGYIKKFPGDN  878
             RP FSS+CRILRY KK L +N E        +   +   P VD CDIE  ++K F  + 
Sbjct  490  QRPTFSSICRILRYTKKFLAMNTESHIMNPELNNQIELQAPPVDCCDIETTFLKGFSMER  549

Query  879  VPPG---VSEIPFQMFAYKLVEKEKTLGNDG  962
               G   VS+IP++MFAYK+ EK K   N+ 
Sbjct  550  TTSGVFAVSQIPYEMFAYKVAEKLKINPNNS  580



>ref|XP_008233214.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Prunus mume]
Length=663

 Score =   329 bits (844),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 172/345 (50%), Positives = 230/345 (67%), Gaps = 40/345 (12%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
             FA R F+G+I  L PEI++++SLSHPN++ + CGF                      IKE
Sbjct  261   FASRHFFGDIEPLLPEISSLLSLSHPNIVHFLCGF---------------------TIKE  299

Query  183   NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
               G RKR  FS+PVAVD+MLQIARGMEYLHS+ I+HGELNPSNIL++      + Y  +K
Sbjct  300   ICGPRKRFPFSLPVAVDLMLQIARGMEYLHSKKIYHGELNPSNILVKARGISTDGYLQAK  359

Query  363   VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
             VSGFGL+  KS  + +N    +G + P IWYAPEVL E EQ + S K   K++EK+DVYS
Sbjct  360   VSGFGLTSAKSP-SQKNLSNQNGSL-PFIWYAPEVLEEHEQTKSSEK---KYTEKSDVYS  414

Query  543   FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
             FGM+CF++LTGK PFE+    LQG+KM  ++ AGERPLFP+   +Y+TNL +KCWH+ PN
Sbjct  415   FGMVCFELLTGKVPFEDSH--LQGEKMSRNIRAGERPLFPFYSLRYVTNLTKKCWHSDPN  472

Query  723   ARPGFSSVCRILRYIKKVLVINPEHG-HPDCPPPLVDYCDIEAGYIKKFPGDNV--PPGV  893
              RP FSS+CRILRYIK+ L +NP++    D P P+VDYC+IE+G ++K P       P V
Sbjct  473   LRPSFSSICRILRYIKRFLAMNPDYNSQLDPPVPMVDYCEIESGILRKIPSWKSCEQPPV  532

Query  894   SEIPFQMFAYKLVEKEKTL-------GNDGFAVRARDDHLVSMDD  1007
             S+IPFQMF Y++ E+E+T        G+DG ++    D +V+  D
Sbjct  533   SQIPFQMFVYRIAERERTTLKDTSESGSDGASICG--DEMVTTPD  575



>ref|XP_007158560.1| hypothetical protein PHAVU_002G162700g [Phaseolus vulgaris]
 gb|ESW30554.1| hypothetical protein PHAVU_002G162700g [Phaseolus vulgaris]
Length=864

 Score =   327 bits (839),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 171/326 (52%), Positives = 220/326 (67%), Gaps = 26/326 (8%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F GE  A + E+++++SLSHPN++QY CGFYDE ++E  LVMELM K L  +++E
Sbjct  260  FALRNFQGEREAHQGEVSSLLSLSHPNIVQYLCGFYDEVKQEFSLVMELMKKDLWTYMRE  319

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+++ FS+PV VD+MLQ+ARGMEYLHS+NI HG+LNP NI L+  +S  E YF +K
Sbjct  320  NCGPRRQILFSVPVVVDLMLQMARGMEYLHSQNISHGQLNPLNIHLKSRNSQ-EGYFQAK  378

Query  363  VSGFGLSMMKSQYTFRNCPRASGGV---DPVIWYAPEVLAEQEQPRGSSKSGAKFSEKAD  533
            V+GF LS      +  N    +G +    P  WYAPEVL   EQ +    S    +EKAD
Sbjct  379  VAGFALS------SVNNGSADTGAIHDFSPFTWYAPEVLTRLEQTQNVLCSS---TEKAD  429

Query  534  VYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHT  713
             YSFGM+CF++LTGK PFEE     QGD+MV ++  GERPLFPY  PKYL +LI+KCW T
Sbjct  430  AYSFGMICFELLTGKVPFEENH--FQGDRMVQNIEVGERPLFPYHSPKYLVSLIKKCWQT  487

Query  714  SPNARPGFSSVCRILRYIKKVL-------VINPEHGHPDCPPPLVDYCDIEAGYIKKFPG  872
             P  RP FSS+CRILRY KK L       V NPE    + PP  VD C+IE  ++K F  
Sbjct  488  DPAQRPSFSSICRILRYTKKFLTMNSESQVTNPELNVLEAPP--VDCCEIETMFLKSFST  545

Query  873  D--NVPPGVSEIPFQMFAYKLVEKEK  944
            +  +    VS+IP++MFAYK+VEKEK
Sbjct  546  ERSSCVSAVSQIPYEMFAYKVVEKEK  571



>ref|XP_009395061.1| PREDICTED: tyrosine-protein kinase ABL1-like [Musa acuminata 
subsp. malaccensis]
Length=680

 Score =   317 bits (812),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 160/323 (50%), Positives = 218/323 (67%), Gaps = 21/323 (7%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F ++   G+  +L  EI+ + S++HPNV+QY   F DEE+KE  ++MEL+SK L  +I+E
Sbjct  257  FVVKHVIGDTASLTNEISILSSIAHPNVMQYMYCFTDEEKKECLMLMELISKDLSCYIRE  316

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
                R+++   + VAVD MLQIARGMEYLHS+ I+HG+LNPSNI ++  +   + Y H+K
Sbjct  317  VCSTRRKV-LPLLVAVDTMLQIARGMEYLHSKQIYHGDLNPSNIFVKARNPSPDGYLHAK  375

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQP-RGSSKSGAKFSEKADVY  539
            V G GLS           P  +      IW++PEVL EQEQ   GSS S +K +EKADVY
Sbjct  376  VGGLGLS-----------PATNSKASSCIWHSPEVLLEQEQTGDGSSSSSSKRTEKADVY  424

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SF M+CF++LTGK PFE+    LQGDKM  ++ AGERPLFP   PKYL  L R+CWH+ P
Sbjct  425  SFAMICFELLTGKVPFEDNH--LQGDKMSKNIRAGERPLFPSQSPKYLVTLTRRCWHSDP  482

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP----GDNVPP  887
            + RP FSSVCR+LRY+K+ LV+NP+H  PD  PP VDY D+E+   K+F     GD +  
Sbjct  483  SQRPSFSSVCRVLRYLKRFLVLNPDHSQPDPTPPPVDYFDLESSLSKRFANWARGDLLR-  541

Query  888  GVSEIPFQMFAYKLVEKEKTLGN  956
              SE+PFQM+A++++E+E+T  N
Sbjct  542  -ASEVPFQMYAFRVLERERTSAN  563



>ref|XP_003569381.1| PREDICTED: uncharacterized protein LOC100834316 [Brachypodium 
distachyon]
Length=681

 Score =   315 bits (806),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/341 (49%), Positives = 219/341 (64%), Gaps = 22/341 (6%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIK  179
            FA+  F G   A+  E+A + S++HPNV      F+DEERKE F+VM +LM+K L  +IK
Sbjct  259  FAVNHFIGGGEAVSAEVALLSSVAHPNVAHASYCFHDEERKEYFVVMDQLMAKDLGSYIK  318

Query  180  ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
            E S  R+R  F++ VAVD+MLQIARGMEYLH + I+HGELNPSN+L++P   P   Y H 
Sbjct  319  EMSSPRRRTPFTLAVAVDIMLQIARGMEYLHGKKIYHGELNPSNVLVKP-RQPDGGYVHV  377

Query  360  KVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVY  539
            KV+GFG S         N   A+G  +  IWYAPEVL  +  P   ++  A+ +EKADVY
Sbjct  378  KVAGFGQSDGTKASANAN---ANGDDNTCIWYAPEVLKPEGVPVADAE--ARCTEKADVY  432

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SF M+CF++LTGK PFE+    LQGDK   ++ AGERPLFP+  PKYLT L ++CWH  P
Sbjct  433  SFSMICFELLTGKVPFEDNH--LQGDKTSKNIRAGERPLFPFQTPKYLTALTKRCWHADP  490

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGH----------PDCP-PPLVDYCDIEAGYIKKF  866
              RPGFSSVCR+LRY+K+ LV+NPE  +           D P  P VDY D+E   +++ 
Sbjct  491  AQRPGFSSVCRVLRYVKRFLVMNPEKENQQQQQQAGQQADAPVAPPVDYLDVEMQLLRRL  550

Query  867  PGDNVPPG--VSEIPFQMFAYKLVEKEKTLGNDGFAVRARD  983
            P      G  VS++PFQMFAY++VE+EKT        RA D
Sbjct  551  PAWQRGEGARVSDVPFQMFAYRVVEREKTAATVHAKDRASD  591



>ref|XP_010523184.1| PREDICTED: LOW QUALITY PROTEIN: G protein-coupled receptor kinase 
7A [Tarenaya hassleriana]
Length=700

 Score =   311 bits (796),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 161/324 (50%), Positives = 215/324 (66%), Gaps = 43/324 (13%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR FYG++ AL PE++ ++SLSHP++    CGF DEE KE FL+MELMS++L  H+KE
Sbjct  269  FALRQFYGDMEALLPEVSQLLSLSHPHIENSLCGFTDEESKECFLIMELMSRTLCTHVKE  328

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPM---SSPGET-Y  350
              G RK+ + S+P AVD+MLQIARGMEYLHS+ I+HGELNPSNIL++P    + PG+  Y
Sbjct  329  VYGLRKKNTVSLPAAVDLMLQIARGMEYLHSKRIYHGELNPSNILVKPKGNNTHPGDAHY  388

Query  351  FHSKVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKA  530
             H+++SGFGL+ +K  ++ +  P       P IWYAPEVL EQEQ    +    K+++K+
Sbjct  389  LHARISGFGLNSVKG-FSHKAAPSGQNESFPFIWYAPEVLEEQEQ--SGTAGTLKYTDKS  445

Query  531  DVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWH  710
            DVYSFGM+CF++LTGK PFE+                              ++L ++CWH
Sbjct  446  DVYSFGMICFELLTGKVPFED------------------------------SHLTKRCWH  475

Query  711  TSPNARPGFSSVCRILRYIKKVLVINPEHGHP---DCP-PPLVDYCDIEAGYIKKFPGDN  878
            T PN RP FSS+CRILRYIK+ L +NPE GH    D P  P VDY +IE    +K   ++
Sbjct  476  TDPNQRPSFSSICRILRYIKRFLALNPE-GHSSQQDTPFAPGVDYHEIETKLSQKLSWES  534

Query  879  VP-PGVSEIPFQMFAYKLVEKEKT  947
               P VS+IPFQMFAY++VE+EKT
Sbjct  535  TDIPAVSQIPFQMFAYRVVEREKT  558



>ref|XP_006644379.1| PREDICTED: LOW QUALITY PROTEIN: mitogen-activated protein kinase 
kinase kinase 7-like [Oryza brachyantha]
Length=695

 Score =   309 bits (792),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 219/328 (67%), Gaps = 21/328 (6%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIK  179
            FA++ F G+I A   E+A + S+ HPNV      F+DEE+KE  +VM +LMSK L  ++K
Sbjct  256  FAVKHFIGDIDAAGAEVALLSSVVHPNVAYAAYCFHDEEKKEYLVVMDQLMSKDLGSYVK  315

Query  180  ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
            E S  R+R+ F + VAVD+MLQIARGM YLH++ I+HGELNP N+L++P   P   Y H 
Sbjct  316  EVSCPRRRIPFPLVVAVDIMLQIARGMAYLHAKKIYHGELNPCNVLVKP-RQPDGGYVHV  374

Query  360  KVSGF---GLSMMKSQYTFRNCPRASG-GVD-PVIWYAPEVLAEQEQPRGSSKSGAKFSE  524
            KV+GF   G++   ++ +      A+G G D   IWYAPEVL    +P G + + A+ +E
Sbjct  375  KVAGFERPGITAGGAKASANGNATANGNGNDHSCIWYAPEVL----RPDGIADAAARCTE  430

Query  525  KADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKC  704
            KADVYSF M+CF++LTGK PFE+    LQGDK   ++ AGERPLFP+  PKYLT L ++C
Sbjct  431  KADVYSFAMICFELLTGKVPFEDNH--LQGDKTSKNICAGERPLFPFQAPKYLTALTKRC  488

Query  705  WHTSPNARPGFSSVCRILRYIKKVLVINPE------HGHPDCPPPLVDYCDIEAGYIKKF  866
            WH  P  RP F+S+CR+LRY+K+ L++NPE       G PD P P VDY DIEA  +K+ 
Sbjct  489  WHADPAQRPAFASICRVLRYVKRFLILNPEQQPGEPQGQPDAPGPPVDYLDIEAQLLKRL  548

Query  867  PG--DNVPPGVSEIPFQMFAYKLVEKEK  944
            P         V+++PFQMF+Y+++E+EK
Sbjct  549  PAWQRGEAARVADVPFQMFSYRVMEREK  576



>gb|AAU05456.1| At1g01450 [Arabidopsis thaliana]
 gb|AAU45207.1| At1g01450 [Arabidopsis thaliana]
Length=433

 Score =   301 bits (771),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/328 (49%), Positives = 215/328 (66%), Gaps = 40/328 (12%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            FALR F+G+I AL P+I  ++SLSHPN++ Y CGF DEE+KE FLVMELM K+L MHIKE
Sbjct  52   FALRHFFGDIDALLPQITPLLSLSHPNIVYYLCGFTDEEKKECFLVMELMRKTLGMHIKE  111

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSS-PGETYFHS  359
              G RK+ + S+PVAVD+MLQIA GMEYLHS+ I+HGELNPSNIL++P S+  G+ Y   
Sbjct  112  VCGPRKKNTLSLPVAVDLMLQIALGMEYLHSKRIYHGELNPSNILVKPRSNQSGDGYLLG  171

Query  360  KVSGFGLSMMKSQYTFRNCPRASGGVD-PVIWYAPEVLAEQEQPRGSSKSGAKFSEKADV  536
            K+ GFGL+ +K  ++ ++    S   + P IWY+PEVL EQEQ  G++ S  K+S+K+DV
Sbjct  172  KIFGFGLNSVKG-FSSKSASLTSQNENFPFIWYSPEVLEEQEQS-GTAGS-LKYSDKSDV  228

Query  537  YSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTS  716
            YSFGM+ F++LTGK PFE+                              ++L ++CWH  
Sbjct  229  YSFGMVSFELLTGKVPFED------------------------------SHLTKRCWHAD  258

Query  717  PNARPGFSSVCRILRYIKKVLVINPE-HGHPDCPP---PLVDYCDIEAGYIKKFPGDNVP  884
            PN RP FSS+ RILRYIK+ L +NPE +      P   P VDYC+IE   ++K   ++  
Sbjct  259  PNQRPTFSSISRILRYIKRFLALNPECYSSSQQDPSIAPTVDYCEIETKLLQKLSWESTE  318

Query  885  -PGVSEIPFQMFAYKLVEKEKTLGNDGF  965
               VS++PFQMFAY++VE+ KT   D  
Sbjct  319  LTKVSQVPFQMFAYRVVERAKTCEKDNL  346



>gb|EMS45702.1| Light-sensor Protein kinase [Triticum urartu]
Length=664

 Score =   303 bits (777),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 218/337 (65%), Gaps = 30/337 (9%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIK  179
            FA++ F G+  A+  EI  + S++HPNV      F+DEERKE F+VM +LM+K L  ++K
Sbjct  254  FAMKHFIGDGEAVGAEIELLASVAHPNVAHATYCFHDEERKEYFVVMDQLMAKDLGSYVK  313

Query  180  ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
            E S  R+R  F + VA+D+MLQIARGMEYLH++ ++HGELNPSN+L+RP  + G  Y   
Sbjct  314  EVSCPRRRTPFPVIVAIDIMLQIARGMEYLHAKGMYHGELNPSNVLVRPRQADG-GYVQV  372

Query  360  KVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVY  539
            KV+GFG S +            +G  +  IWYAPEVL  +      + + ++ +EKADVY
Sbjct  373  KVTGFGQSGIAMGANV------NGDDNACIWYAPEVLKPE-----VAGAESRRTEKADVY  421

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SF M+CF++LTGK PFE+    LQGDK   ++ AGERPLFP+  PKYLT L ++CWH  P
Sbjct  422  SFAMICFELLTGKVPFEDNH--LQGDKTSKNIRAGERPLFPFQTPKYLTALTKRCWHADP  479

Query  720  NARPGFSSVCRILRYIKKVLVINPEHGH-------PDCPPPLVDYCDIEAGYIKKFPGDN  878
              RPGFSSVCR+LRY+K+ LV+NPE          P  PP  VDY D+E   +++ P   
Sbjct  480  EQRPGFSSVCRVLRYVKRFLVMNPEQQQQAAQGDEPVVPP--VDYLDLEMQLLRRLPAWQ  537

Query  879  VPPG--VSEIPFQMFAYKLVEKEKTLGNDGFAVRARD  983
               G  VS++PFQMFAYK++E+EK  G      +ARD
Sbjct  538  RGEGARVSDVPFQMFAYKVLEREKIAG----VAQARD  570



>dbj|BAJ99445.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04394.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=664

 Score =   303 bits (776),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 164/336 (49%), Positives = 219/336 (65%), Gaps = 27/336 (8%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIK  179
            FA++ F G+  A+  EI  + S++HPNV      F+DEERKE F+VM +LM+K L  ++K
Sbjct  254  FAMKHFIGDGEAVGAEIEILASVAHPNVAHAIYCFHDEERKEHFVVMDQLMAKDLGSYVK  313

Query  180  ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
            E S  R+R  F + VA+D+MLQIARGM+YLH++ I+HGELNPSN+L++P    G  Y   
Sbjct  314  EVSCPRRRTPFPVIVAIDIMLQIARGMDYLHAKGIYHGELNPSNVLVKPRQPEG-GYVQV  372

Query  360  KVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVY  539
            KV+GFG      Q         +G  +  IWYAPEVL  +      + +G++ +EKADVY
Sbjct  373  KVTGFG------QSGNAMGANVNGDDNACIWYAPEVLKPE-----VADAGSRGTEKADVY  421

Query  540  SFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            SF M+CF++LTGK PFE+    LQGDK   ++ AGERPLFP+  PKYLT L ++CWH  P
Sbjct  422  SFAMICFELLTGKVPFEDNH--LQGDKTSKNIRAGERPLFPFQTPKYLTALTKRCWHADP  479

Query  720  NARPGFSSVCRILRYIKKVLVINPE-----HGHPDCP-PPLVDYCDIEAGYIKKFPGDNV  881
              RPGFSSV R+LRY+K+ LV+NPE      G  D P  P VDY D+E   ++K P    
Sbjct  480  EQRPGFSSVSRVLRYVKRFLVMNPEQQQQQAGQGDAPIAPPVDYLDVEMQLLRKLPAWQR  539

Query  882  PPG--VSEIPFQMFAYKLVEKEKTLGNDGFAVRARD  983
              G  VS++PFQMFAYK++E+EKT G     V+ARD
Sbjct  540  GEGGRVSDVPFQMFAYKVLEREKTAG----VVQARD  571



>ref|XP_008656656.1| PREDICTED: uncharacterized protein LOC103636079 [Zea mays]
Length=683

 Score =   300 bits (768),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 174/382 (46%), Positives = 225/382 (59%), Gaps = 45/382 (12%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIK  179
             FA++ F G+  A   E++ + S++HPNV      F+DEERKE F+VM +LM K L  ++K
Sbjct  257   FAVKHFIGDSEA---EVSMLSSVAHPNVAHAAYCFHDEERKEYFVVMDQLMVKDLASYVK  313

Query  180   ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
             E S  R+R+ F + VAVD+MLQIARGME+LHS+ I+HGELNPSN+L++P    G  Y H 
Sbjct  314   EMSSPRRRIPFPLVVAVDIMLQIARGMEHLHSKKIYHGELNPSNVLVKPRQPDG--YVHV  371

Query  360   KVSGF---GLSMMKSQYTFRNCPRAS----GGVDPVIWYAPEVLAEQEQPRGSSKSGAKF  518
             KV+GF   G     ++ +      AS    GG D  IWYAPEVL  QE       S  + 
Sbjct  372   KVAGFERRGAVTNGAKASANGSGNASAAGSGGDDTCIWYAPEVLEHQE-------SRDRH  424

Query  519   SEKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIR  698
             +EKADVYSF M+CF++LTGK PFE+    LQGDK   ++ AGERPLFP+  PKYL  L +
Sbjct  425   TEKADVYSFAMICFELLTGKVPFEDNH--LQGDKTSKNIRAGERPLFPFQAPKYLVALTK  482

Query  699   KCWHTSPNARPGFSSVCRILRYIKKVLVINPEHGHPD----CPPPLVDYCDIEAGYIKKF  866
             +CWH  P  RP F+SVCR+LRY+K+ LV+NPE            P  DY DIEA  +++ 
Sbjct  483   RCWHADPAQRPPFASVCRVLRYVKRFLVMNPEQQQGQADAPPAVPAADYLDIEAQLLRRI  542

Query  867   P----GDNVPPGVSEIPFQMFAYKLVEKEKTLGNDGFAVRARD-----DHLVS-------  998
             P    G   PP V ++PFQMFAY+ VE+EKT G      R  D     D L         
Sbjct  543   PAWQRGQGAPPRVVDVPFQMFAYRAVEREKTAGAHASRDRVTDSGSEEDSLCGDENGVGA  602

Query  999   ---MDDLCLVPNNGTRGRLSTC  1055
                 DD   V N   R R  +C
Sbjct  603   TTPDDDASTVSNGTVRSRPDSC  624



>gb|AFW83300.1| putative DUF1221-domain containing protein kinase family protein 
[Zea mays]
Length=711

 Score =   301 bits (770),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 174/382 (46%), Positives = 225/382 (59%), Gaps = 45/382 (12%)
 Frame = +3

Query  3     FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIK  179
             FA++ F G+  A   E++ + S++HPNV      F+DEERKE F+VM +LM K L  ++K
Sbjct  257   FAVKHFIGDSEA---EVSMLSSVAHPNVAHAAYCFHDEERKEYFVVMDQLMVKDLASYVK  313

Query  180   ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
             E S  R+R+ F + VAVD+MLQIARGME+LHS+ I+HGELNPSN+L++P    G  Y H 
Sbjct  314   EMSSPRRRIPFPLVVAVDIMLQIARGMEHLHSKKIYHGELNPSNVLVKPRQPDG--YVHV  371

Query  360   KVSGF---GLSMMKSQYTFRNCPRAS----GGVDPVIWYAPEVLAEQEQPRGSSKSGAKF  518
             KV+GF   G     ++ +      AS    GG D  IWYAPEVL  QE       S  + 
Sbjct  372   KVAGFERRGAVTNGAKASANGSGNASAAGSGGDDTCIWYAPEVLEHQE-------SRDRH  424

Query  519   SEKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIR  698
             +EKADVYSF M+CF++LTGK PFE+    LQGDK   ++ AGERPLFP+  PKYL  L +
Sbjct  425   TEKADVYSFAMICFELLTGKVPFEDNH--LQGDKTSKNIRAGERPLFPFQAPKYLVALTK  482

Query  699   KCWHTSPNARPGFSSVCRILRYIKKVLVINPEHGHPD----CPPPLVDYCDIEAGYIKKF  866
             +CWH  P  RP F+SVCR+LRY+K+ LV+NPE            P  DY DIEA  +++ 
Sbjct  483   RCWHADPAQRPPFASVCRVLRYVKRFLVMNPEQQQGQADAPPAVPAADYLDIEAQLLRRI  542

Query  867   P----GDNVPPGVSEIPFQMFAYKLVEKEKTLGNDGFAVRARD-----DHLVS-------  998
             P    G   PP V ++PFQMFAY+ VE+EKT G      R  D     D L         
Sbjct  543   PAWQRGQGAPPRVVDVPFQMFAYRAVEREKTAGAHASRDRVTDSGSEEDSLCGDENGVGA  602

Query  999   ---MDDLCLVPNNGTRGRLSTC  1055
                 DD   V N   R R  +C
Sbjct  603   TTPDDDASTVSNGTVRSRPDSC  624



>gb|EAY75006.1| hypothetical protein OsI_02905 [Oryza sativa Indica Group]
Length=694

 Score =   300 bits (768),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 213/329 (65%), Gaps = 17/329 (5%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIK  179
            FA++ F G+  A   E+A + S++HPNV      F+DEE+KE F+VM +LM+K L  ++K
Sbjct  254  FAMKHFIGDTDAAGAEVALLCSVAHPNVAHAAYCFHDEEKKEYFVVMDQLMAKDLGSYVK  313

Query  180  ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
            E S  R+R+ F + VAVD+MLQIARGMEYLH++ I HGELNPSN+L++P   P   Y H 
Sbjct  314  EVSCPRRRIPFPLVVAVDIMLQIARGMEYLHAKRINHGELNPSNVLVKP-RQPDGGYVHV  372

Query  360  KVSGFG--LSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKAD  533
            KV+G+G    +            A+G  +  IWYAPEVL  +      + +  + +EKAD
Sbjct  373  KVAGYGQPAGITAGGAKASANGNANGNDNSCIWYAPEVL--RSDGVADAAAAGRCTEKAD  430

Query  534  VYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHT  713
            VYSF M+CF++LTGK PFE+    LQGDK   ++ AGERPLFP+  PKYLT L ++CWH 
Sbjct  431  VYSFAMICFELLTGKVPFEDNH--LQGDKTSKNICAGERPLFPFQAPKYLTALTKRCWHA  488

Query  714  SPNARPGFSSVCRILRYIKKVLVINPEHGHP------DCPPPLVDYCDIEAGYIKKFPG-  872
             P  RP F+S+CR+LRY+K+ L++NPE          D P P VDY DIEA  +KK P  
Sbjct  489  DPAQRPAFASICRVLRYVKRFLILNPEQQQQQQGQTDDAPKPAVDYLDIEAQLLKKLPAW  548

Query  873  --DNVPPGVSEIPFQMFAYKLVEKEKTLG  953
                  P V+++PFQMFAY+++E+EK  G
Sbjct  549  RRGGEAPRVADVPFQMFAYRVMEREKAAG  577



>emb|CDY27699.1| BnaUnng00490D [Brassica napus]
Length=680

 Score =   298 bits (762),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 209/316 (66%), Gaps = 40/316 (13%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F +R F+ ++  L  EI+++++L H N+ QY CGFY+EERKE FLVMELM K L  ++KE
Sbjct  262  FVVRHFFSDLEPLSSEISSLLALCHSNIHQYLCGFYEEERKECFLVMELMHKDLQSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+ V VD+M+QIARGMEYLH  +IFHG+LNP+NILL+      E YFH+K
Sbjct  322  NCGPRRRYLFSVSVVVDIMMQIARGMEYLHGNDIFHGDLNPTNILLKERCHT-EGYFHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +SGFGLS +KSQ +  +        DPVIWYAPEVLAE EQ  G+    +K + KADVYS
Sbjct  381  ISGFGLSSVKSQSSSSSRASTH---DPVIWYAPEVLAEMEQ--GTKTPKSKLTHKADVYS  435

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            F M+CF+++TGK PFE+    LQG++M  ++  GERPLFP+P PKYL             
Sbjct  436  FAMVCFELITGKVPFEDSH--LQGEQMAVNIRMGERPLFPFPSPKYL-------------  480

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD--NVPPGVS  896
                              LV+NP+HGHP    PLVD  DIEA Y++KFPGD  +    V+
Sbjct  481  -----------------FLVVNPDHGHPQIQIPLVDCWDIEARYLRKFPGDLGSHVASVN  523

Query  897  EIPFQMFAYKLVEKEK  944
            +IPFQ+++Y+++E+EK
Sbjct  524  QIPFQLYSYRVLEREK  539



>ref|NP_001043605.1| Os01g0621600 [Oryza sativa Japonica Group]
 dbj|BAB21072.1| phytochrome / protein kinase-like [Oryza sativa Japonica Group]
 dbj|BAF05519.1| Os01g0621600 [Oryza sativa Japonica Group]
 gb|EAZ12727.1| hypothetical protein OsJ_02647 [Oryza sativa Japonica Group]
Length=695

 Score =   296 bits (758),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 212/330 (64%), Gaps = 18/330 (5%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIK  179
            FA++ F G+  A   E+A + S++HPNV      F+DEE+KE F+VM +LM+K L  ++K
Sbjct  254  FAMKHFIGDTDAAGAEVALLCSVAHPNVAHAAYCFHDEEKKEYFVVMDQLMAKDLGSYVK  313

Query  180  ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
            E S  R+R+ F + VAVD+MLQIARGMEYLH++ I HGELNPSN+L++P   P   Y H 
Sbjct  314  EVSCPRRRIPFPLVVAVDIMLQIARGMEYLHAKRINHGELNPSNVLVKP-RQPDGGYVHV  372

Query  360  KVSGFG--LSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKAD  533
            KV+G+G    +            A+G  +  IWYAPEVL  +      + +  + +EKAD
Sbjct  373  KVAGYGQPAGITAGGAKASANGNANGNDNSCIWYAPEVL--RSDGVADAAAAGRCTEKAD  430

Query  534  VYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHT  713
            VYSF M+CF++LTGK PFE+    LQGDK   ++ AGERPLFP+  PKYLT L ++CWH 
Sbjct  431  VYSFAMICFELLTGKVPFEDNH--LQGDKTSKNICAGERPLFPFQAPKYLTALTKRCWHA  488

Query  714  SPNARPGFSSVCRILRYIKKVLVINPEHGHP-------DCPPPLVDYCDIEAGYIKKFPG  872
             P  R  F+S+CR+LRY+K+ L++NPE           D P P VDY DIEA  +KK P 
Sbjct  489  DPAQRLAFASICRVLRYVKRFLILNPEQQQQQQQGQTDDAPKPAVDYLDIEAQLLKKLPA  548

Query  873  ---DNVPPGVSEIPFQMFAYKLVEKEKTLG  953
                   P V+++PFQMFAY+++E+EK  G
Sbjct  549  WQRGGEAPRVADVPFQMFAYRVMEREKAAG  578



>ref|XP_004969200.1| PREDICTED: uncharacterized protein LOC101780302 isoform X2 [Setaria 
italica]
Length=685

 Score =   291 bits (746),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 160/334 (48%), Positives = 214/334 (64%), Gaps = 29/334 (9%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIK  179
            FA++ F G+  A   E A + S++HPNV      F DE+RKE F+VM +LM+K L  ++K
Sbjct  256  FAVKHFIGDAEA---EAALLSSVAHPNVAHAAYCFRDEDRKEYFVVMDQLMAKDLGSYVK  312

Query  180  ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
            E S  R+R+ F + VAVD+MLQIARGME+LH++ I+HGELNPSN+L++P    G  Y H 
Sbjct  313  EVSCPRRRVPFPLVVAVDIMLQIARGMEHLHAKKIYHGELNPSNVLVKPRQPDG--YVHV  370

Query  360  KVSGFGLSMM-----KSQYTFRNCPRASGGVD-PVIWYAPEVLAEQEQPRGSSKSGAKFS  521
            KV+GF  S       K+         A+GG D   IWYAPEVL ++     S    A+ +
Sbjct  371  KVAGFEWSGTVTTGGKASANGSANANATGGGDYTCIWYAPEVLEKE-----SGDPSARRT  425

Query  522  EKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRK  701
            EKADVYSFGM+CF++LTGK PFE+    LQGDK   ++ AGERPLFP+  PKYL +L ++
Sbjct  426  EKADVYSFGMICFELLTGKVPFEDNH--LQGDKTSKNIRAGERPLFPFQAPKYLVSLTKR  483

Query  702  CWHTSPNARPGFSSVCRILRYIKKVLVINP--EHGHPD--CPPPLVDYCDIEAGYIKKFP  869
            CWH  P  RP F+SVCR+LRY+K+ LV+NP  + G  D     P  DY DIEA  +++ P
Sbjct  484  CWHADPEQRPPFASVCRVLRYVKRFLVMNPDQQQGQTDAPPAAPPADYLDIEAQLLRRIP  543

Query  870  ------GDNVPPGVSEIPFQMFAYKLVEKEKTLG  953
                  G      V+++PFQMFAY+ VE+EK  G
Sbjct  544  AWQRGEGAAAAARVADVPFQMFAYRAVEREKAAG  577



>ref|XP_004969199.1| PREDICTED: uncharacterized protein LOC101780302 isoform X1 [Setaria 
italica]
Length=707

 Score =   292 bits (747),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 160/334 (48%), Positives = 214/334 (64%), Gaps = 29/334 (9%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIK  179
            FA++ F G+  A   E A + S++HPNV      F DE+RKE F+VM +LM+K L  ++K
Sbjct  256  FAVKHFIGDAEA---EAALLSSVAHPNVAHAAYCFRDEDRKEYFVVMDQLMAKDLGSYVK  312

Query  180  ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
            E S  R+R+ F + VAVD+MLQIARGME+LH++ I+HGELNPSN+L++P    G  Y H 
Sbjct  313  EVSCPRRRVPFPLVVAVDIMLQIARGMEHLHAKKIYHGELNPSNVLVKPRQPDG--YVHV  370

Query  360  KVSGFGLSMM-----KSQYTFRNCPRASGGVD-PVIWYAPEVLAEQEQPRGSSKSGAKFS  521
            KV+GF  S       K+         A+GG D   IWYAPEVL ++     S    A+ +
Sbjct  371  KVAGFEWSGTVTTGGKASANGSANANATGGGDYTCIWYAPEVLEKE-----SGDPSARRT  425

Query  522  EKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRK  701
            EKADVYSFGM+CF++LTGK PFE+    LQGDK   ++ AGERPLFP+  PKYL +L ++
Sbjct  426  EKADVYSFGMICFELLTGKVPFEDNH--LQGDKTSKNIRAGERPLFPFQAPKYLVSLTKR  483

Query  702  CWHTSPNARPGFSSVCRILRYIKKVLVINP--EHGHPD--CPPPLVDYCDIEAGYIKKFP  869
            CWH  P  RP F+SVCR+LRY+K+ LV+NP  + G  D     P  DY DIEA  +++ P
Sbjct  484  CWHADPEQRPPFASVCRVLRYVKRFLVMNPDQQQGQTDAPPAAPPADYLDIEAQLLRRIP  543

Query  870  ------GDNVPPGVSEIPFQMFAYKLVEKEKTLG  953
                  G      V+++PFQMFAY+ VE+EK  G
Sbjct  544  AWQRGEGAAAAARVADVPFQMFAYRAVEREKAAG  577



>ref|XP_002440343.1| hypothetical protein SORBIDRAFT_09g029990 [Sorghum bicolor]
 gb|EES18773.1| hypothetical protein SORBIDRAFT_09g029990 [Sorghum bicolor]
Length=745

 Score =   290 bits (743),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 214/332 (64%), Gaps = 38/332 (11%)
 Frame = +3

Query  3    FALRTFYG-EIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHI  176
            FA++ F G +  A+  E A + S++HPNV      F+DE+++E FLVM +LM+K L  H+
Sbjct  254  FAVKHFVGADADAVGAEAALLTSVAHPNVAHCRYCFHDEDKREFFLVMDQLMTKDLASHV  313

Query  177  KENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFH  356
            KE +  ++R+ F + V VDVMLQIARGMEYLHSR I+HG+LNPSN+L+R  +   + + H
Sbjct  314  KEVNNAKRRVPFPLAVVVDVMLQIARGMEYLHSRKIYHGDLNPSNVLVR--TRHADAHLH  371

Query  357  SKVSGFGLSMMK-SQYTFRNCPRASGGV--------DPVIWYAPEVLAEQEQPRGSSKSG  509
             KV+GFG S    +    R  PRAS           +P IWYAPEV  EQE         
Sbjct  372  VKVAGFGQSAATVAAANPRPSPRASAKAANATVAASNPCIWYAPEVF-EQE--------A  422

Query  510  AKFSEKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTN  689
            AK +EKADVYSFGM+CF++LTGK PFE+    LQG+ M  ++  GERPLFP+  PKYLT+
Sbjct  423  AKCTEKADVYSFGMVCFELLTGKIPFEDNH--LQGEHMSKNIRTGERPLFPFQAPKYLTS  480

Query  690  LIRKCWHTSPNARPGFSSVCRILRYIKKVLVINPEHG-HPDCP-----PPLVDYCDIEAG  851
            L ++CWH  P  RP F+S+CR+LRY+K+ +V+NP     PD        P VDY D+E+G
Sbjct  481  LTKRCWHGDPAQRPAFASICRVLRYVKRFVVMNPAPAEQPDATPPPPPVPPVDYLDVESG  540

Query  852  YIKKFPGDNVPPGVSEIPFQMFAYKLVEKEKT  947
                    N  P VS++PFQMFAY+++EKE+ 
Sbjct  541  --------NAAPRVSDVPFQMFAYRVMEKERN  564



>gb|AFW81274.1| putative DUF1221-domain containing protein kinase family protein 
[Zea mays]
Length=660

 Score =   287 bits (735),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 206/325 (63%), Gaps = 47/325 (14%)
 Frame = +3

Query  60   VMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIKENSGQRKRMSFSIPVAVDV  236
            + S++HPNV      F+DE++KE FLVM ++M+K L  H+KE +  ++R+ F + V VDV
Sbjct  276  LTSVAHPNVAHCRYCFHDEDKKEFFLVMDQVMTKDLATHVKEANSGKRRVPFPLVVVVDV  335

Query  237  MLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFG-----LSMMKSQY  401
            MLQIARGMEYLHSRNI+HG+L PSN+L+R  +   + + H KV+GFG      +   + +
Sbjct  336  MLQIARGMEYLHSRNIYHGDLTPSNVLVR--TRHADAHLHVKVAGFGQHAAAAAAAAAGH  393

Query  402  TFRNCPRASGGVD-----PVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQI  566
              R  PRAS         P IWYAPEVL +QE         AK +EKADVYSFGM+CF++
Sbjct  394  CHRPSPRASAKASNATSAPCIWYAPEVLEQQE--------AAKRTEKADVYSFGMVCFEL  445

Query  567  LTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSV  746
            LTGK PFE+    LQG+ M  ++ AGERPLFP+  PKYLT+L R+CWH  P  RP F+SV
Sbjct  446  LTGKVPFEDNH--LQGEHMSKNIRAGERPLFPFQAPKYLTSLTRRCWHGDPAQRPSFASV  503

Query  747  CRILRYIKKVLVINPEHGHPDCPPP-------------LVDYCDIEAGYIKKFPG-----  872
            CR+LRY+K+ +V+N        P P              VDY DIEA   ++FP      
Sbjct  504  CRVLRYVKRFVVMNVN------PAPAEQPDAAVPPPVPAVDYLDIEASLQRRFPAWQPGS  557

Query  873  DNVPPGVSEIPFQMFAYKLVEKEKT  947
             N  P VS++PFQMFAY++ EKE++
Sbjct  558  GNAAPRVSDVPFQMFAYRVAEKERS  582



>gb|EMT32473.1| Light-sensor Protein kinase [Aegilops tauschii]
Length=718

 Score =   288 bits (738),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 163/385 (42%), Positives = 223/385 (58%), Gaps = 72/385 (19%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIK  179
            FA++ F G+  A+  E+  + S++HPNV      F+DEERKE F+VM +LM+K L  ++K
Sbjct  254  FAMKHFIGDGEAVGAEVELLASVAHPNVAHATYCFHDEERKEYFVVMDQLMAKDLGSYVK  313

Query  180  ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
            E S  R+R  F + VA+D+MLQIARGMEYLH++ I+HGELNPSN+L+R +  P   Y   
Sbjct  314  EVSCPRRRTPFPVIVAIDIMLQIARGMEYLHAKGIYHGELNPSNVLVR-LRQPDGGYVQV  372

Query  360  KVSGFGLS-------------------------MMKSQYTFRNCPRASGGV---------  437
            KV+GFG S                          ++ ++     P   G V         
Sbjct  373  KVTGFGQSGIAMGANVNGDDNACIWVQAHREGRRVQLRHDLLRAPDRQGPVRGQPPGFGQ  432

Query  438  -------------DPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGK  578
                         +  IWYAPEVL  +      + +G++ +EKADVYSF M+CF++LTGK
Sbjct  433  SGIAMGANVNGDDNACIWYAPEVLKPE-----VADAGSRRTEKADVYSFAMICFELLTGK  487

Query  579  APFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRIL  758
             PFE+    LQGDK   ++ AGERPLFP+  PKYLT L ++CWH  P  RPGFSSVCR+L
Sbjct  488  VPFEDNH--LQGDKTSKNIRAGERPLFPFQTPKYLTALTKRCWHADPEQRPGFSSVCRVL  545

Query  759  RYIKKVLVINPEH--------GHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG--VSEIPF  908
            RY+K+ LV+NPE           P  PP  VDY D+E   +++ P      G  V ++PF
Sbjct  546  RYVKRFLVMNPEQQQQQAAQGDEPVVPP--VDYLDVEMQLLRRLPAWQRGEGARVPDLPF  603

Query  909  QMFAYKLVEKEKTLGNDGFAVRARD  983
            QMFAYK++E+EKT G     V+A+D
Sbjct  604  QMFAYKVLEREKTAG----VVQAKD  624



>ref|XP_008656084.1| PREDICTED: uncharacterized protein LOC103635406 [Zea mays]
Length=715

 Score =   288 bits (737),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 206/325 (63%), Gaps = 47/325 (14%)
 Frame = +3

Query  60   VMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIKENSGQRKRMSFSIPVAVDV  236
            + S++HPNV      F+DE++KE FLVM ++M+K L  H+KE +  ++R+ F + V VDV
Sbjct  276  LTSVAHPNVAHCRYCFHDEDKKEFFLVMDQVMTKDLATHVKEANSGKRRVPFPLVVVVDV  335

Query  237  MLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFG-----LSMMKSQY  401
            MLQIARGMEYLHSRNI+HG+L PSN+L+R  +   + + H KV+GFG      +   + +
Sbjct  336  MLQIARGMEYLHSRNIYHGDLTPSNVLVR--TRHADAHLHVKVAGFGQHAAAAAAAAAGH  393

Query  402  TFRNCPRASGGVD-----PVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQI  566
              R  PRAS         P IWYAPEVL +QE         AK +EKADVYSFGM+CF++
Sbjct  394  CHRPSPRASAKASNATSAPCIWYAPEVLEQQE--------AAKRTEKADVYSFGMVCFEL  445

Query  567  LTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSV  746
            LTGK PFE+    LQG+ M  ++ AGERPLFP+  PKYLT+L R+CWH  P  RP F+SV
Sbjct  446  LTGKVPFEDNH--LQGEHMSKNIRAGERPLFPFQAPKYLTSLTRRCWHGDPAQRPSFASV  503

Query  747  CRILRYIKKVLVINPEHGHPDCPPP-------------LVDYCDIEAGYIKKFPG-----  872
            CR+LRY+K+ +V+N        P P              VDY DIEA   ++FP      
Sbjct  504  CRVLRYVKRFVVMNVN------PAPAEQPDAAVPPPVPAVDYLDIEASLQRRFPAWQPGS  557

Query  873  DNVPPGVSEIPFQMFAYKLVEKEKT  947
             N  P VS++PFQMFAY++ EKE++
Sbjct  558  GNAAPRVSDVPFQMFAYRVAEKERS  582



>ref|XP_002458176.1| hypothetical protein SORBIDRAFT_03g028250 [Sorghum bicolor]
 gb|EES03296.1| hypothetical protein SORBIDRAFT_03g028250 [Sorghum bicolor]
Length=689

 Score =   286 bits (731),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 157/328 (48%), Positives = 210/328 (64%), Gaps = 26/328 (8%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIK  179
            FA++ F G+  A   E++ + S++HPNV      F+DEERKE F++M +LM+K L  ++K
Sbjct  262  FAVKHFIGDADA---EVSMLSSVAHPNVAHAAYCFHDEERKEYFVIMDQLMAKDLGSYVK  318

Query  180  ENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHS  359
            E S  R+R+ F + VAV +MLQIARGMEYLH+  I+HGELNPSN+L++P   P + Y H 
Sbjct  319  EMSSPRRRIPFPLVVAVHIMLQIARGMEYLHANKIYHGELNPSNVLVKPRQQP-DGYVHV  377

Query  360  KVSGFG------LSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFS  521
            KV+GF        +  K+          +GG D  IWYAPEVL  Q        S  + +
Sbjct  378  KVAGFERPAGTVTNGAKASANGNANAAGAGGDDTCIWYAPEVLEHQ-------GSRDRHT  430

Query  522  EKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRK  701
            EKADVYSF M+CF++LTGK PFE+    LQGDK   ++ AGERPLFP+  PKYL  L ++
Sbjct  431  EKADVYSFAMICFELLTGKVPFEDNH--LQGDKTSKNIRAGERPLFPFQAPKYLVALTKR  488

Query  702  CWHTSPNARPGFSSVCRILRYIKKVLVINPE--HGHPDCPPPLVDYCDIEAGYIKKFP--  869
            CWH  P  RP F+SVCR+LRY+K+ LV+NPE          P  DY DIEA  +++ P  
Sbjct  489  CWHADPAQRPPFASVCRVLRYVKRFLVMNPEPQQADAPPAAPAADYLDIEAQLLRRIPAW  548

Query  870  --GDNVPPGVSEIPFQMFAYKLVEKEKT  947
              G   PP V+++PFQMFAY+ VE+EKT
Sbjct  549  QRGQGAPPRVADVPFQMFAYRAVEREKT  576



>emb|CDY49880.1| BnaA04g11340D [Brassica napus]
Length=672

 Score =   285 bits (730),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 202/316 (64%), Gaps = 48/316 (15%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F +R F+ ++  L  EI+++++L HPNV QY CGFYDEERKE FLVMELM K L  ++KE
Sbjct  262  FVVRHFFSDLEPLSSEISSLLALCHPNVHQYLCGFYDEERKECFLVMELMHKDLQSYMKE  321

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
            N G R+R  FS+ V VD+M+QIARGMEYLH  +IFHG+LNP+NILL+      E YFH+K
Sbjct  322  NCGPRRRYLFSVSVVVDIMMQIARGMEYLHGNDIFHGDLNPTNILLKERCHT-EGYFHAK  380

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYS  542
            +S FGLS +KSQ +  +        DPVIWYAPEVLAE EQ  G+    +K + KADVYS
Sbjct  381  ISCFGLSSVKSQSSSSSRASTH---DPVIWYAPEVLAEMEQ--GTKTLKSKLTHKADVYS  435

Query  543  FGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPN  722
            FGM+CF+++TGK PFE+    LQG++M  ++  GERPLFP+P PKYL             
Sbjct  436  FGMVCFELITGKVPFEDSH--LQGEQMAINIRMGERPLFPFPSPKYL-------------  480

Query  723  ARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGD--NVPPGVS  896
                                     GHP    PLVD  D+EA Y++KFPGD  +    V+
Sbjct  481  -------------------------GHPQIQIPLVDCWDLEARYLRKFPGDLGSHMASVT  515

Query  897  EIPFQMFAYKLVEKEK  944
            +IPFQ+++Y++ E+EK
Sbjct  516  QIPFQLYSYRVSEREK  531



>ref|XP_006396707.1| hypothetical protein EUTSA_v10029146mg [Eutrema salsugineum]
 gb|ESQ38160.1| hypothetical protein EUTSA_v10029146mg [Eutrema salsugineum]
Length=589

 Score =   278 bits (711),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 149/308 (48%), Positives = 197/308 (64%), Gaps = 48/308 (16%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKENSGQRKRMSFSI  218
            L  EI+++++L H N+LQY CG YDEE KE FLVMELM K L  ++KEN G R+R  FS+
Sbjct  198  LSSEISSLLALFHSNILQYLCGLYDEEMKECFLVMELMHKYLQSYMKENCGPRRRYLFSV  257

Query  219  PVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQ  398
             V                               LR   + G  YFH+K+SGFGLS +KS 
Sbjct  258  SV-------------------------------LRRSHTDG--YFHAKISGFGLSSVKSC  284

Query  399  YTFR--NCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILT  572
             +    N P      DPVIWYAPEVLAE EQ +G +   +K + KADVYSF M+CF+++T
Sbjct  285  SSSSRPNTP------DPVIWYAPEVLAEMEQ-QGKTDPKSKLTHKADVYSFAMVCFELIT  337

Query  573  GKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCR  752
            GK PFE+    LQG+KM  ++  GERPLF +P PKYL +LI++CWHT P+ RP FSS+CR
Sbjct  338  GKVPFEDSH--LQGEKMAINIRMGERPLFSFPSPKYLVSLIKRCWHTEPSQRPNFSSICR  395

Query  753  ILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNV----PPGVSEIPFQMFA  920
            ILRYIKK LV+N +HGHP     LVD  D+EA +++KFPGD+        V++IPFQ+++
Sbjct  396  ILRYIKKFLVVNQDHGHPQMQTLLVDCWDLEARFLRKFPGDHSSGCHAASVTQIPFQLYS  455

Query  921  YKLVEKEK  944
            Y++ E+EK
Sbjct  456  YRVFEREK  463



>ref|XP_004963555.1| PREDICTED: uncharacterized protein LOC101774845 [Setaria italica]
Length=658

 Score =   276 bits (707),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 154/332 (46%), Positives = 219/332 (66%), Gaps = 31/332 (9%)
 Frame = +3

Query  3    FALRTFYG-EIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHI  176
            FA++ F G +  A+  E+  +  +SHPNV      F+DE+++E FL+M ELM+K L  H+
Sbjct  254  FAVKHFVGADADAVGAEVPLLTLVSHPNVAHCRYCFHDEDKREFFLLMDELMTKDLASHV  313

Query  177  KENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFH  356
            KE +  ++R+   + V VD MLQIARGMEYLHS+ I+HG+LNP+N+L++  +   + + H
Sbjct  314  KEVNSAKRRVPLPLVVVVDAMLQIARGMEYLHSKKIYHGDLNPTNVLVK--ARHADAHLH  371

Query  357  SKVSGFGLSMMKSQYTFRNCPRASGGVD---------PVIWYAPEVLAEQEQPRGSSKSG  509
             KV+GFG S++ +  + R  PRAS   +         P IWYAPEVL EQE         
Sbjct  372  VKVTGFGQSVVAAA-SPRPSPRASANANANNASAAANPCIWYAPEVL-EQE--------A  421

Query  510  AKFSEKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTN  689
            A+ SEKADVYSF M+CF++LTGK PFE+    LQG+ M  ++ AGERPLFP+  PKYLT+
Sbjct  422  ARCSEKADVYSFAMVCFELLTGKIPFEDNH--LQGEHMSKNIRAGERPLFPFQAPKYLTS  479

Query  690  LIRKCWHTSPNARPGFSSVCRILRYIKKVLVIN---PEHGHPDCPPPLVDYCDIEAGYIK  860
            L ++CWH  P  RP F+S+CR+LRY+K+ LV+N    +      P P VDY ++EA  ++
Sbjct  480  LTKRCWHGDPAQRPAFASICRVLRYVKRFLVLNPAPADQPDAPPPLPPVDYLEVEASLLR  539

Query  861  KFP---GDNVPPGVSEIPFQMFAYKLVEKEKT  947
            +FP     +  P VS++PFQMFAY++VEKE+T
Sbjct  540  RFPAWQAGSAAPRVSDVPFQMFAYRVVEKERT  571



>ref|XP_003565830.1| PREDICTED: mitogen-activated protein kinase kinase kinase 7-like 
[Brachypodium distachyon]
Length=741

 Score =   248 bits (632),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 195/311 (63%), Gaps = 30/311 (10%)
 Frame = +3

Query  72   SHPNVLQYHCGFYDEERKEGFLVM--ELMSKSLDMHIKENSGQRKRMSFSIPVAVDVMLQ  245
            +HPNV      F DEE++E F+VM  +LM+K L  ++KE   +R+     + V VD MLQ
Sbjct  286  AHPNVAGCRFCFQDEEKRELFVVMDDQLMTKDLGSYVKEQVSKRRATPMPLVVVVDAMLQ  345

Query  246  IARGMEYLHSRNIFHGELNPSNILLRPM--SSPGETYFHSKVSGFG------LSMMKSQY  401
            IARGME+LH++ IFHGEL+P+N+L++P   +S    Y   KV+GF        S  +   
Sbjct  346  IARGMEHLHAKKIFHGELSPANVLVKPRHGNSADAGYLLVKVAGFNREPAVPASPTRKTS  405

Query  402  TFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKA  581
               N   A+  V+P IWYAPEVL ++ + R         +EKADVYSF M+CF+++TGK 
Sbjct  406  APANNANANASVNPCIWYAPEVLEQETEKR---------TEKADVYSFAMICFELITGKI  456

Query  582  PFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILR  761
            PFE+    LQG+ M  ++ AGERPLFP+   K LT L R+CW   P  RP F S+CR+LR
Sbjct  457  PFEDHH--LQGEHMSKNIRAGERPLFPFNSHKQLTGLTRRCWQADPAQRPAFGSICRVLR  514

Query  762  YIKKVLVINPEHGH------PDCPPPL--VDYCDIEAGYIKKFPG-DNVPPGVSEIPFQM  914
            Y+K+ LV+NP+         P  P P+  VDY DIEA  ++KFP  +   P V+++PFQM
Sbjct  515  YVKRFLVMNPQPDQQQQPDSPTMPMPMPAVDYLDIEALLLRKFPAWEGAAPRVADVPFQM  574

Query  915  FAYKLVEKEKT  947
            +AY+++EK+++
Sbjct  575  YAYRVMEKDRS  585



>gb|EAY99213.1| hypothetical protein OsI_21171 [Oryza sativa Indica Group]
Length=702

 Score =   244 bits (623),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/294 (44%), Positives = 186/294 (63%), Gaps = 30/294 (10%)
 Frame = +3

Query  75   HPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIKENSGQRKRMSFSIPVAVDVMLQIA  251
            HPNV      F+DEE++E ++VM +LMSK L  ++KE +  ++R    + V VD MLQIA
Sbjct  286  HPNVAHCRYCFHDEEKRELYMVMDQLMSKDLGSYVKEVNSAKRRAPLPLVVVVDTMLQIA  345

Query  252  RGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYTFRNCPRASG  431
             GM +LHS  ++HG LNPSN+L++P    G+ Y H KV+GF    +    T       + 
Sbjct  346  CGMAHLHSNKMYHGNLNPSNVLVKPRH--GDAYLHVKVAGF----VSGSGT-------AN  392

Query  432  GVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAPFEEGERPLQ  611
              +P IW APEV+  +          A  +EK DVYSFGM+CF+++TGK PFE+    LQ
Sbjct  393  AANPCIWCAPEVVGNE----------AAATEKGDVYSFGMICFELITGKIPFEDNH--LQ  440

Query  612  GDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRYIKKVLVI-N  788
            G+ M  ++ AGERPLFP+  PKYLT+L R+CWH     RP F S+CR+LRY+K+ LV+ N
Sbjct  441  GENMSKNIRAGERPLFPFQSPKYLTSLTRRCWHGEAAQRPPFHSICRVLRYVKRFLVMNN  500

Query  789  PEH--GHPDCPPPLVDYCDIEAGYIKKFPGDNVPPGVSEIPFQMFAYKLVEKEK  944
            PE          P VDY D+EA  +++FP +    GV+++PF+M+AY+++E++K
Sbjct  501  PEQAAADAAGAGPAVDYLDMEAQLLRRFP-EWEGNGVADVPFEMYAYRVMERDK  553



>ref|NP_001056458.1| Os05g0585800 [Oryza sativa Japonica Group]
 gb|AAT47067.1| putative protein kinase family protein [Oryza sativa Japonica 
Group]
 dbj|BAF18372.1| Os05g0585800 [Oryza sativa Japonica Group]
 dbj|BAG97943.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64854.1| hypothetical protein OsJ_19711 [Oryza sativa Japonica Group]
Length=699

 Score =   243 bits (621),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/294 (44%), Positives = 186/294 (63%), Gaps = 30/294 (10%)
 Frame = +3

Query  75   HPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIKENSGQRKRMSFSIPVAVDVMLQIA  251
            HPNV      F+DEE++E ++VM +LMSK L  ++KE +  ++R    + V VD MLQIA
Sbjct  286  HPNVAHCRYCFHDEEKRELYMVMDQLMSKDLGSYVKEVNSAKRRAPLPLVVVVDTMLQIA  345

Query  252  RGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYTFRNCPRASG  431
             GM +LHS  ++HG LNPSN++++P    G+ Y H KV+GF    +    T       + 
Sbjct  346  CGMAHLHSNKMYHGNLNPSNVIVKPRH--GDAYLHVKVAGF----VSGSGT-------AN  392

Query  432  GVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAPFEEGERPLQ  611
              +P IW APEV+  +          A  +EK DVYSFGM+CF+++TGK PFE+    LQ
Sbjct  393  AANPCIWCAPEVVGNE----------AAATEKGDVYSFGMICFELITGKIPFEDNH--LQ  440

Query  612  GDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRYIKKVLVI-N  788
            G+ M  ++ AGERPLFP+  PKYLT+L R+CWH     RP F S+CR+LRY+K+ LV+ N
Sbjct  441  GENMSKNIRAGERPLFPFQSPKYLTSLTRRCWHGEAAQRPPFHSICRVLRYVKRFLVMNN  500

Query  789  PEH--GHPDCPPPLVDYCDIEAGYIKKFPGDNVPPGVSEIPFQMFAYKLVEKEK  944
            PE          P VDY D+EA  +++FP +    GV+++PF+M+AY+++E++K
Sbjct  501  PEQAAADAAGAGPAVDYLDMEAQLLRRFP-EWEGNGVADVPFEMYAYRVMERDK  553



>ref|XP_006655640.1| PREDICTED: light-sensor Protein kinase-like [Oryza brachyantha]
Length=589

 Score =   203 bits (517),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 140/218 (64%), Gaps = 14/218 (6%)
 Frame = +3

Query  72   SHPNVLQYHCGFYDEERKEGFLVM-ELMSKSLDMHIKENSGQRKRMSFSIPVAVDVMLQI  248
            S P V      F+DEE++E F+VM +LMSK L  ++KE +  ++R+ F + V VD MLQI
Sbjct  276  SPPTVAPCRYCFHDEEKRELFVVMDQLMSKDLGCYVKEVTSAKRRVPFPLVVVVDTMLQI  335

Query  249  ARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYTFRNCPR-A  425
            ARGME LHS NI+HG LNPSN+L++P    G+ Y   KV+GFG    +S  +       A
Sbjct  336  ARGMEQLHSNNIYHGNLNPSNVLVKPRH--GDAYLQVKVAGFGHGHGQSAVSNSGTKAPA  393

Query  426  SGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAPFEEGERP  605
            +   +P IWYAPE L  +          A+ +EKADVYSFGM+CF++LTGK PFE+    
Sbjct  394  NANANPCIWYAPEALGNEPT--------ARCTEKADVYSFGMICFELLTGKIPFEDNH--  443

Query  606  LQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSP  719
            LQGD M  ++ AGERPLFP+  PKYLT L ++CWH  P
Sbjct  444  LQGDNMSKNIRAGERPLFPFQSPKYLTGLTKRCWHGEP  481



>ref|XP_002983016.1| hypothetical protein SELMODRAFT_117674, partial [Selaginella 
moellendorffii]
 gb|EFJ15825.1| hypothetical protein SELMODRAFT_117674, partial [Selaginella 
moellendorffii]
Length=316

 Score =   154 bits (388),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/253 (36%), Positives = 140/253 (55%), Gaps = 25/253 (10%)
 Frame = +3

Query  15   TFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKENSGQ  194
            +F  E+  L+     ++S  HP+VLQ   G+Y ++ K  +LVMELM + L   I++  G 
Sbjct  88   SFDKEVNILKE----LISEPHPSVLQM-IGYYQKDEK-AYLVMELMERDLANVIRKTRG-  140

Query  195  RKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGF  374
                S  +  ++D+MLQIA GM YLH +N+ H +L PSNIL++  +    T  + +++ F
Sbjct  141  ----SLQLLTSIDIMLQIASGMSYLHQKNVVHRDLKPSNILVKTQNHACTTCSNVRLTDF  196

Query  375  GLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGML  554
            G+S  KS +     P  S     + + APE+L            G K+S + DVYSFG+ 
Sbjct  197  GVS--KSNF-ISFAPDLSYQRGTIQYMAPEML-----------RGQKYSREVDVYSFGIT  242

Query  555  CFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPG  734
            CFQILTG  PF++  + L  DK+V ++  G RP  P   P  L  L+ +CW+ +P  RP 
Sbjct  243  CFQILTGTLPFQDDGKQLVADKLVETIEDGNRPDLPTGCPLELVALLNRCWNRNPKDRPT  302

Query  735  FSSVCRILRYIKK  773
            F  + R+L  +K+
Sbjct  303  FEHISRMLWSLKE  315



>ref|XP_001761872.1| predicted protein [Physcomitrella patens]
 gb|EDQ73313.1| predicted protein [Physcomitrella patens]
Length=235

 Score =   140 bits (353),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 124/226 (55%), Gaps = 26/226 (12%)
 Frame = +3

Query  210  FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMM  389
            F++ VA+D+MLQ+AR ME+LH   I HG+L  +N+L++P + PG   F  KVS FG +  
Sbjct  5    FNLVVAIDIMLQVARAMEHLHDFQIIHGDLRTANLLIKPSNFPGREKFQVKVSNFGQTKY  64

Query  390  KSQYTFRNCPRASG-GV---DPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLC  557
            K +   ++   A   GV   + ++W APE++ +Q         G + +  ADVYSFG++C
Sbjct  65   KLEGRSKSAHCAGKRGVKFDERILWRAPEIIGDQ------VGDGERLTASADVYSFGLIC  118

Query  558  FQILTGKAPFEEGERPLQGDKMVHSL----MAGERPLFPYPLPKYLTNLIRKCWHTSPNA  725
            ++ILT K P+        GD  + SL    ++GERP  P   P YL   I++CW   P  
Sbjct  119  YEILTAKLPY--------GDITLGSLSEKVISGERPELPSYCPDYLAECIQQCWVPVPED  170

Query  726  RPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKK  863
            RP F  VC  + Y KK++++     H    PP  D+ ++E   I K
Sbjct  171  RPTFGEVCARMAYYKKLILMRSTRKH--WYPP--DFIELEKILILK  212



>ref|XP_001774078.1| predicted protein [Physcomitrella patens]
 gb|EDQ61130.1| predicted protein [Physcomitrella patens]
Length=281

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 134/261 (51%), Gaps = 25/261 (10%)
 Frame = +3

Query  6    ALRTFYGEIG-ALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            A +TFY         E++ +  LSHPN++ +    Y E ++E  +VMELM   L   +++
Sbjct  33   AKKTFYAPSSPDFEQEVSILARLSHPNIVSFLS--YAEGKRECCMVMELMDHDLCGLMRK  90

Query  183  NSGQRKRMS--FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPG--ETY  350
               + K  S  FS+  AVD+MLQ+ RG+EYLH   I H  L   NIL++ +        Y
Sbjct  91   IMAKDKHRSSPFSMLEAVDLMLQVGRGIEYLHEMRIVHRGLKAMNILVKQVKGKDGRSWY  150

Query  351  FHSKVSGFGLSMMKSQ-YTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEK  527
              +KV+ FG+S  K +  T+ N    +G      W APE++ E + P G           
Sbjct  151  IWAKVAEFGMSKTKERSVTYSNQTLNTGTTR---WMAPEMMKETKYPFG-----------  196

Query  528  ADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCW  707
             DV SF M+C++ILTG  PF +     Q +++   ++ G+RP  P   P  L  LIR+CW
Sbjct  197  GDVCSFAMVCYEILTGDVPFYD---IAQHNEVKKKVLKGDRPGLPKDCPTSLERLIRRCW  253

Query  708  HTSPNARPGFSSVCRILRYIK  770
                +ARP F  +C  LR +K
Sbjct  254  SQDASARPRFDEICVELRNVK  274



>gb|EYU32409.1| hypothetical protein MIMGU_mgv11b017814mg, partial [Erythranthe 
guttata]
Length=318

 Score =   138 bits (348),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 88/136 (65%), Gaps = 14/136 (10%)
 Frame = +3

Query  750   RILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDN----VPPGVSEIPFQMF  917
             R+LRYIKK+LVINP+HGHPD PPPLVDYCD+EAGY+KKFP       + P V +IPFQMF
Sbjct  17    RVLRYIKKILVINPDHGHPDSPPPLVDYCDMEAGYLKKFPEKGGAGVLAPPVLQIPFQMF  76

Query  918   AYKLVEKEKTLGNDGFAVR----ARDDHLVSMDDLCLVPNNGTRGRLSTCSEIIDRNDLG  1085
              YK+VEKEK         R      +DH  +MDD  L P++    R S CSEIID  + G
Sbjct  77    TYKIVEKEKFYSKKWEIHRPASMFDEDH--NMDDFLLAPSD----RRSVCSEIIDTKNSG  130

Query  1086  TFADQRSAISEILQPK  1133
                D RS ISEI Q K
Sbjct  131   IAVDMRSVISEIPQRK  146



>sp|P25848.3|PHY1_CERPU RecName: Full=Light-sensor Protein kinase; Includes: RecName: 
Full=Phytochrome; Includes: RecName: Full=Protein kinase [Ceratodon 
purpureus]
 gb|AAB47762.1| phytochrome [Ceratodon purpureus]
Length=1307

 Score =   140 bits (353),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 94/270 (35%), Positives = 137/270 (51%), Gaps = 19/270 (7%)
 Frame = +3

Query  6     ALRTFYGEIGA-LRPEIATVMSLSHPNVLQYHCG-FYDEERKEGFLVMELMSKSLDMHIK  179
             A +TFYG      + E+  +  L HPN+    C   Y   R++  ++MELM   L   ++
Sbjct  1029  AKKTFYGRNNEDFKREVEILAELCHPNITSMFCSPLY---RRKCSIIMELMDGDLLALMQ  1085

Query  180   ENSGQRKRMS---FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGET-  347
                 + +      FSI   VD++LQ + GM YLH + I H +L   NIL++ +       
Sbjct  1086  RRLDRNEDHDSPPFSILEVVDIILQTSEGMNYLHEKGIIHRDLKSMNILVKSVKVTKSEI  1145

Query  348   -YFHSKVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVL-AEQEQPRGS-SKSGA--  512
              Y H KV+ FGLS  K   T  +    + G +   W APEV+    E   G  S  G   
Sbjct  1146  GYVHVKVADFGLSKTKDSSTRYSNQTWNRGTNR--WMAPEVINLGYESTEGEISFDGKVP  1203

Query  513   KFSEKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNL  692
             K+  K+DVYSFGM+C+++LTG  PF E + P    +MV   + G RP  P   P  L  L
Sbjct  1204  KYPLKSDVYSFGMVCYEVLTGDVPFPEEKNPNNVKRMV---LEGVRPDLPAHCPIELKAL  1260

Query  693   IRKCWHTSPNARPGFSSVCRILRYIKKVLV  782
             I  CW+  P  RP F+ +C+ L+Y+K +L+
Sbjct  1261  ITDCWNQDPLKRPSFAVICQKLKYLKYLLM  1290



>ref|XP_001776234.1| predicted protein [Physcomitrella patens]
 gb|EDQ59004.1| predicted protein [Physcomitrella patens]
Length=202

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 105/190 (55%), Gaps = 13/190 (7%)
 Frame = +3

Query  210  FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMM  389
            FS  VA+D++LQIA+GM YLHS++I H  L P NIL++ +++    Y H+K++ FG+S  
Sbjct  22   FSNIVAIDIILQIAKGMHYLHSQDIVHRNLEPDNILVK-ITNMEIGYVHAKLAVFGMSKT  80

Query  390  KSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRG----SSKSGAKFSEKADVYSFGMLC  557
            K      +C   +  +    + APEV+   EQ       +S    K+  K+DVYSFGM+C
Sbjct  81   KKS----SCSTQTLNIGTTRYMAPEVIKIHEQGSENHVLTSTYKQKYPSKSDVYSFGMVC  136

Query  558  FQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGF  737
            +QILTGK PF      L   +    + +GE P  P   P  L +LI  CW  +P  RP F
Sbjct  137  YQILTGKVPFSN----LSNIEAKIKIKSGECPSLPSHCPPILKSLIEDCWKFNPKDRPTF  192

Query  738  SSVCRILRYI  767
              +C  LR I
Sbjct  193  LEICNDLRCI  202



>emb|CAA71838.1| photoreceptor [Ceratodon purpureus]
Length=1299

 Score =   138 bits (347),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 135/270 (50%), Gaps = 19/270 (7%)
 Frame = +3

Query  6     ALRTFYGEIGA-LRPEIATVMSLSHPNVLQYHCG-FYDEERKEGFLVMELMSKSL-DMHI  176
             A +TFYG      + E+  +  L HPN+    C   Y   R++  ++MELM   L  +  
Sbjct  1021  AKKTFYGRDNEDFKREVEILAELCHPNITSMFCSPLY---RRKCSIIMELMDGDLLALMQ  1077

Query  177   KENSGQRKRMS--FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGET-  347
             +   G     S  FS    VD++LQ   GM YLH + I H +L   NIL++ +       
Sbjct  1078  RRLDGNEDHDSPPFSTLEVVDIILQTGEGMNYLHEKGIIHRDLKSMNILVKSVKVTKSEI  1137

Query  348   -YFHSKVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVL-AEQEQPRGS-SKSGA--  512
              Y H KV+ FGLS  K   T  +    + G +   W APEV+    E   G  S  G   
Sbjct  1138  GYVHVKVADFGLSKTKDSSTRYSNQTWNRGTNR--WMAPEVINLGYESTEGEISFDGKVP  1195

Query  513   KFSEKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNL  692
             K+  K+DVYSFGM+C+++LTG  PF E + P    +MV   + G RP  P   P  L  L
Sbjct  1196  KYPLKSDVYSFGMVCYEVLTGDVPFPEEKNPNNVKRMV---LEGVRPDLPAHCPIELKAL  1252

Query  693   IRKCWHTSPNARPGFSSVCRILRYIKKVLV  782
             I  CW+  P  RP F+ +C+ L+Y+K +L+
Sbjct  1253  ITDCWNQDPLKRPSFAVICQKLKYLKYLLM  1282



>ref|XP_001777649.1| predicted protein [Physcomitrella patens]
 gb|EDQ57551.1| predicted protein [Physcomitrella patens]
Length=233

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/247 (35%), Positives = 125/247 (51%), Gaps = 20/247 (8%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKENSGQRKRMS---  209
             + E+  +  L+HPN++       D  R    ++MELM   L  H+ ++    K+     
Sbjct  1    FKNEVEILAGLAHPNIVPLLGYAIDNNRYS--IIMELMDGDL-FHLMQDRMHHKKSHDGP  57

Query  210  FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSS-PGETYFHSKVSGFGLSM  386
            F+I  AVD+MLQI  GM YLH+  I H ++   NIL +      G  +  +K++ FGLS 
Sbjct  58   FTIFEAVDIMLQIGEGMVYLHNNKIVHRDVKSQNILFKKKKYIDGSEHICAKLADFGLSK  117

Query  387  MK-SQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAK-FSEKADVYSFGMLCF  560
             K +  TF N    +G      W APE+++     RG   S  K F  + DVYSFGMLC+
Sbjct  118  TKENSSTFSNQTPNTGTTR---WMAPELMS-----RGQVGSKVKSFPFQLDVYSFGMLCY  169

Query  561  QILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFS  740
            +ILTG  PF      ++  + V   + G RP  P   P  L  LI+ CWH   + RP FS
Sbjct  170  EILTGAVPFSNTCSHIEVKRKV---LDGVRPSLPEQCPDELKVLIQGCWHAEASLRPLFS  226

Query  741  SVCRILR  761
             +C+ LR
Sbjct  227  DICKSLR  233



>ref|XP_001773947.1| predicted protein [Physcomitrella patens]
 gb|EDQ61295.1| predicted protein [Physcomitrella patens]
Length=202

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 107/190 (56%), Gaps = 13/190 (7%)
 Frame = +3

Query  210  FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMM  389
            FS  V VD++LQIA GM  LHS++I H +L P+N+L++ +++    Y H+K++ FG+S  
Sbjct  22   FSNTVVVDIILQIAEGMVCLHSKDIVHRDLKPNNVLVK-ITNMEIGYVHAKLADFGMSKT  80

Query  390  KSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRG----SSKSGAKFSEKADVYSFGMLC  557
            K      +C   +  +    + A EV+   EQ       +S +  K+  K+DVYSFGM+C
Sbjct  81   KKS----SCSTQTLNIGTTRYMALEVIKIHEQGSENHVLTSTNKRKYPPKSDVYSFGMVC  136

Query  558  FQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGF  737
            +QILTGK PF +    L   +    + +GE P  PY  P  L +LI  CW  +P  RP F
Sbjct  137  YQILTGKVPFLD----LTNSEAKEKIKSGECPSLPYHCPPILKSLIEDCWKFNPKDRPTF  192

Query  738  SSVCRILRYI  767
              +C+ LR I
Sbjct  193  LEICKDLRCI  202



>ref|XP_001774434.1| predicted protein [Physcomitrella patens]
 gb|EDQ60797.1| predicted protein [Physcomitrella patens]
Length=202

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 107/190 (56%), Gaps = 13/190 (7%)
 Frame = +3

Query  210  FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMM  389
            FS  V VD++LQIA GM  LHS++I H +L P N+L++ +++    + H+K++ FG+S +
Sbjct  22   FSNIVVVDIILQIAEGMVCLHSKDIVHRDLKPENVLVK-ITNMETGHVHAKLADFGMSKI  80

Query  390  KSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRG----SSKSGAKFSEKADVYSFGMLC  557
            K      +C   +  +    + APEV+   EQ       +S +  K+  K+DVYSFGM+C
Sbjct  81   KKS----SCSTQTLNIGTTRYMAPEVIKIHEQGSENHMLTSANKRKYPPKSDVYSFGMVC  136

Query  558  FQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGF  737
            +QILTGK PF +    L   +    + +GE P  P+  P  L  LI  CW  +P  RP F
Sbjct  137  YQILTGKIPFFD----LSNSEAKKKIKSGECPSLPHHCPPILKKLIEDCWKFNPKDRPTF  192

Query  738  SSVCRILRYI  767
              +C+ LR I
Sbjct  193  IEICKDLRCI  202



>ref|XP_001774439.1| predicted protein [Physcomitrella patens]
 gb|EDQ60802.1| predicted protein [Physcomitrella patens]
Length=200

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 107/188 (57%), Gaps = 13/188 (7%)
 Frame = +3

Query  210  FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMM  389
            FS  V VD++LQIA GM  LHS++I H +L P N+L++ +++    + H+K++ FG+S +
Sbjct  22   FSNIVVVDIILQIAEGMVCLHSKDIVHRDLKPDNVLVK-ITNMETGHVHAKLADFGMSKI  80

Query  390  KSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRG----SSKSGAKFSEKADVYSFGMLC  557
            K      +C   +  +    + APEV+   E+       +S +  K+  K+DVYSFGM+C
Sbjct  81   KKS----SCSTQTLNIGTTRYMAPEVIKIYEKGSENHMLTSANKRKYPPKSDVYSFGMVC  136

Query  558  FQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGF  737
            +QILTGK PF +    L   +    + +GE P  P+  P  L NLI  CW  +P  RP F
Sbjct  137  YQILTGKIPFFD----LSNSEAKKKIKSGECPSLPHHCPPILKNLIEDCWKFNPKDRPTF  192

Query  738  SSVCRILR  761
              +C+ LR
Sbjct  193  IEICKDLR  200



>ref|XP_001783695.1| predicted protein [Physcomitrella patens]
 gb|EDQ51467.1| predicted protein [Physcomitrella patens]
Length=202

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 107/191 (56%), Gaps = 15/191 (8%)
 Frame = +3

Query  210  FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGET-YFHSKVSGFGLSM  386
            FS  V VD++LQIA GM  LHS++I H +L P+N+L++ ++   ET + H+K++ FG+S 
Sbjct  22   FSNIVVVDIILQIAEGMVCLHSKDIVHRDLKPNNVLVKIINM--ETGHVHAKLADFGMSK  79

Query  387  MKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRG----SSKSGAKFSEKADVYSFGML  554
             K      +C      +    + APE++   EQ       +S +  K+  K+DVYSFGM+
Sbjct  80   TKKS----SCSTQILNIGTTRYMAPEMIKIHEQRSENHALTSSNKRKYLPKSDVYSFGMV  135

Query  555  CFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPG  734
            C+Q+LTGK PF      L   K    + +GE P  P+  P  L +LI  CW  +P  RP 
Sbjct  136  CYQVLTGKVPFSN----LSNSKAKKKIKSGECPSLPHHCPSILKSLIEVCWKFNPKDRPT  191

Query  735  FSSVCRILRYI  767
            F  +C+ LR I
Sbjct  192  FLEICKDLRCI  202



>ref|XP_001783992.1| predicted protein [Physcomitrella patens]
 gb|EDQ51217.1| predicted protein [Physcomitrella patens]
Length=202

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 108/191 (57%), Gaps = 15/191 (8%)
 Frame = +3

Query  210  FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGET-YFHSKVSGFGLSM  386
            FS  V VD++LQIA GM  LHS++I H +L P+N+L++ +    ET + H+K++ FG+S 
Sbjct  22   FSNIVVVDIILQIAEGMVCLHSKDIVHRDLKPNNVLVKIIDM--ETGHVHAKLADFGMSK  79

Query  387  MKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRG----SSKSGAKFSEKADVYSFGML  554
             K      +C   +  +    + APE++   EQ       +S +  K+  K+DVYSFGM+
Sbjct  80   TKKS----SCSTQTLNIGTTRYMAPELIKIHEQGSENHVLTSANKRKYPPKSDVYSFGMV  135

Query  555  CFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPG  734
            C+QILTGK PF +    L   +    + +G+ P  P+  P  L +LI  CW  +P  RP 
Sbjct  136  CYQILTGKVPFSD----LTNSEAKKKIKSGKYPSLPHHCPPVLKSLIEDCWKFNPKDRPT  191

Query  735  FSSVCRILRYI  767
            F  +C+ LR I
Sbjct  192  FLEICKDLRCI  202



>ref|XP_001775413.1| predicted protein [Physcomitrella patens]
 gb|EDQ59742.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   128 bits (322),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 133/257 (52%), Gaps = 19/257 (7%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKENSGQRKRMS-FSIPV  224
            E+  +  L HPN++Q + G++ EER   +L+MELM  +L  H+  N  +  RMS   +  
Sbjct  17   EVRILSKLHHPNIIQLY-GYFIEERTL-YLIMELMESNLCTHVMGNQWREVRMSPHFLHA  74

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRP-----MSSPGETYFHSKVSGFGLSMM  389
            A D MLQIA+GM YLHS+ + H +L   N+L++P     + S G  Y   K++ FG++  
Sbjct  75   AFDCMLQIAKGMRYLHSKGMAHRDLKGLNVLVKPSENRELQSKG--YLTVKLTDFGMAKA  132

Query  390  KSQYTFRNCPRASGGVDPVIWYAPEVLA--EQEQPRGSSKSGAKFSE-KADVYSFGMLCF  560
              Q++       + G     W APE+      + P+ +     K+   KADVYSFGM+C+
Sbjct  133  NLQHSTYTAQSMNVGTPA--WKAPELFKWYSSDSPKHNLPRERKYYPFKADVYSFGMVCY  190

Query  561  QILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKY---LTNLIRKCWHTSPNARP  731
            +IL G  PF   E           +  G RP  P    K    L++ I+ CW T P  RP
Sbjct  191  EILCGSIPF-SNETLTPRSVFYAKVKGGIRPELPEESLKVVPGLSDYIKLCWDTDPCRRP  249

Query  732  GFSSVCRILRYIKKVLV  782
             F ++C+ +R+ +  L+
Sbjct  250  DFVNICKRIRHFRDYLL  266



>ref|XP_001755795.1| predicted protein [Physcomitrella patens]
 gb|EDQ79468.1| predicted protein [Physcomitrella patens]
Length=271

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/263 (32%), Positives = 131/263 (50%), Gaps = 34/263 (13%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSL-DMHIKENSGQRKRMS--  209
             R E++ + +L HPNV++  C +  E++    ++ME + KSL ++ +    G     +  
Sbjct  14   FREEVSDMAALDHPNVVRIICCW--EDKNYVSILMEPLRKSLHNLLLNYKDGTHAPSAPT  71

Query  210  -FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLR---PMSSPG------------  341
             F+I  +VD+MLQIA G+ Y+HS+N  H ++   N+L++   P++S              
Sbjct  72   PFTILNSVDIMLQIAEGVRYVHSKNFTHLDIMSLNVLVQFADPITSTDVKDSDTVTISSR  131

Query  342  ETYFHSKVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFS  521
             T F  K++ FGL  + ++       R S  V    W APE      + R    S     
Sbjct  132  STSFTVKLADFGLKRIINE----KGRRTSNSVKTA-WTAPEAY----KLRKGEDSAWFHP  182

Query  522  EKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRK  701
             KADVYSF + C +ILTG  PF         D    ++  G+RP  P   P+ L  LI +
Sbjct  183  RKADVYSFAITCSEILTGDHPFAH----FNADYNFDAVKDGDRPRLPGETPRRLAALIHR  238

Query  702  CWHTSPNARPGFSSVCRILRYIK  770
            CWH +P  RP F+++C  LR+IK
Sbjct  239  CWHRNPQLRPDFTAICTELRFIK  261



>gb|KHN06285.1| hypothetical protein glysoja_021123 [Glycine soja]
Length=221

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 95/174 (55%), Gaps = 40/174 (23%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE  182
            F +R F  +I AL PEI  ++SLSHPN++    GF DEE+KE FL               
Sbjct  87   FVIRHFSCDIEALEPEIIELLSLSHPNIMDSLFGFTDEEKKECFL---------------  131

Query  183  NSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSK  362
                                 IARGMEYLHS+ ++HGELNPS+IL++P  +  E Y H+K
Sbjct  132  ---------------------IARGMEYLHSKKVYHGELNPSSILVKPRGTSPEGYLHAK  170

Query  363  VSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSE  524
            V+GFGL+ +K      N  +   G  P IWY+PEVL EQ+   G++ S  K++E
Sbjct  171  VTGFGLTSVKDLNQKGNTNQ--NGTPPFIWYSPEVLEEQDHSGGAANS--KYTE  220



>ref|XP_001755793.1| predicted protein [Physcomitrella patens]
 gb|EDQ79466.1| predicted protein [Physcomitrella patens]
Length=225

 Score =   121 bits (303),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 111/203 (55%), Gaps = 24/203 (12%)
 Frame = +3

Query  210  FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLR----------PMSSPGETYFHS  359
            FSI  AVD+MLQ+A G+ YLHS+++ H ++   N+LL+          P S+     F +
Sbjct  25   FSITQAVDLMLQLAEGVRYLHSKHLAHRDIKSGNVLLQFADPKHGTTEPWSNGNTCPFIA  84

Query  360  KVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQ--EQPRGSSKSGAKFSEKAD  533
            KV+ FGL+ +K+  T R       G  P  W APE    +  ++P  SS+       K D
Sbjct  85   KVADFGLTKIKNTSTHRGHQTLMTGTRP--WMAPEAYKYEWTDEPTPSSRY---HPMKLD  139

Query  534  VYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHT  713
            VY FG++C +IL+G       E P Q      ++ AGERP  P  +P+ L  LI+ CWH 
Sbjct  140  VYGFGIMCCEILSG-------EEPYQKLPSYAAVKAGERPKLPDYIPERLAALIQLCWHG  192

Query  714  SPNARPGFSSVCRILRYIKKVLV  782
            +P  RP F+++C  LR+IK +L+
Sbjct  193  NPRMRPVFTTICTELRFIKGLLL  215



>ref|XP_001752225.1| predicted protein [Physcomitrella patens]
 gb|EDQ82958.1| predicted protein [Physcomitrella patens]
Length=227

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 120/237 (51%), Gaps = 20/237 (8%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKE---NSGQRKRMSFSI  218
            E A + ++ HPNV++     +  ++K G LVMELM   L   I     N G   R  F +
Sbjct  7    EAAILATVQHPNVVRMIGCAFLAKQKSGLLVMELMEHDLRTVIDNRCPNPGT-GRSPFPL  65

Query  219  PVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQ  398
             VA+D+M QIA GM+YL    I H  L   NIL+   +     Y+ +K++ FG++  + Q
Sbjct  66   IVAIDIMFQIAEGMQYLREHKILHRGLKAKNILV---NRCKRDYYIAKLADFGIAKAR-Q  121

Query  399  YTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGK  578
             +  N      G  P  W APEV  E +      ++   +   ADVYSF M C++ILTGK
Sbjct  122  LSTNNVMTKMAGTTP--WRAPEVFNEPDL-----ETSHYYQWPADVYSFAMTCYEILTGK  174

Query  579  APFEEGERPLQGDKMVHSLMAGER-PLFPYPLPKYLTNLIRKCWHTSPNARPGFSSV  746
             PF+     +   K+  S++A ER  L    +   L +LI +CW T P  RP ++ +
Sbjct  175  IPFD----GVPNGKIFKSILANERLSLEGVFMSHVLKDLIERCWATDPKERPSWAEI  227



>ref|XP_002983141.1| hypothetical protein SELMODRAFT_117448 [Selaginella moellendorffii]
 gb|EFJ15950.1| hypothetical protein SELMODRAFT_117448 [Selaginella moellendorffii]
Length=301

 Score =   122 bits (307),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 141/268 (53%), Gaps = 21/268 (8%)
 Frame = +3

Query  3    FALRTFYGEIGALRPEIATVMSLSHPNVLQY--HCGF-YDEERKEGFLVMELMSKSLDMH  173
            +AL+ F  +   +R E A  + L HP+++Q   H     D + K G L+  + + +L+ +
Sbjct  23   YALKLFKDDASFVR-EAALHLQLQHPHIVQVLGHVELKRDSDLKYGLLLELMEAGNLESY  81

Query  174  IKENSGQRKRMS--FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLR--PMSSPG  341
            I + S QR   +  FS  V VD+MLQIARG++YLHS  I H ++ PSNILL   P SSP 
Sbjct  82   INK-SKQRSGFAPPFSALVCVDMMLQIARGLKYLHSLQIIHRDVKPSNILLTRAPGSSPS  140

Query  342  ETYFHSKVSGFGLS-MMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKF  518
                  K++ FG +  ++         R +G      + APEV+       G  +  A++
Sbjct  141  GLLL--KLADFGTAKTVECSDQAHTSKRGTG-----FYRAPEVMVPDRG--GGDEFCARY  191

Query  519  SEKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMA-GERPLFPYPLPKYLTNLI  695
            + KADVYSFGM C+ ILTG+ PF E  R +   K+  S M  G RP  P  +   L  ++
Sbjct  192  TLKADVYSFGMTCYSILTGEVPFCE-TRGVDIKKIKGSWMKPGVRPSLPGYVNTLLGGVV  250

Query  696  RKCWHTSPNARPGFSSVCRILRYIKKVL  779
            ++CW ++P  R  F  +C  L  I+  L
Sbjct  251  QQCWSSNPEMRQCFQEICWELECIRCYL  278



>ref|XP_001781141.1| predicted protein [Physcomitrella patens]
 gb|EDQ54009.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   118 bits (296),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 127/245 (52%), Gaps = 26/245 (11%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQY-HCGFYDEERKEGFLVMELMSKSLDMHIKENSGQRKRMSFSIP-  221
            E A + ++ HPNV++    GF D+ R  G LVMELM   L   I     +    S   P 
Sbjct  37   EAAILATVQHPNVVRLIGFGFIDKNRT-GLLVMELMDHDLRTVIDNRIRELGPGSCPFPT  95

Query  222  -VAVDVMLQIARGMEYLHSRNIFHGELNPSNILL---RPMSS-PG---ETYFHSKVSGFG  377
             VA+D++LQIA+ M++L    + H +L   NIL+   +P+++ PG   +  + +K+S FG
Sbjct  96   IVALDIILQIAQAMKHLRDLKVLHRDLKAKNILVNICKPLNTNPGRDSQDTYVAKLSDFG  155

Query  378  LSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLC  557
            L+  + + ++    R +G      W APEV   Q+     ++   ++   ADVYSF M C
Sbjct  156  LAKCRPEVSWVTT-RMAGTTG---WRAPEVFHVQD-----TEVAPEYKWPADVYSFAMTC  206

Query  558  FQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFP--YPLPKYLTNLIRKCWHTSPNARP  731
            ++ILTG  PF           +   +M GERP FP    +P+ L  LI KCW T P+ RP
Sbjct  207  YEILTGLLPFIG----CPNGSIHEKVMRGERPPFPEKQDIPEILKGLINKCWATDPDDRP  262

Query  732  GFSSV  746
             F  +
Sbjct  263  TFDEI  267



>dbj|BAJ93315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=350

 Score =   114 bits (286),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 84/275 (31%), Positives = 132/275 (48%), Gaps = 33/275 (12%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSKSLDMHIKENSGQRKRMSFSIPV  224
            E+A ++ L H N++ +       ++   F ++ E M+      +++   Q++  S  I +
Sbjct  95   EVALLLRLRHHNIVSFVAAC---KKPPVFCIITEYMAGG---SLRKYLHQQEPHSVPIQL  148

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
             + + L IARGM YLHS+ I H +L   N+LL      GE     KV+ FG+S ++SQ  
Sbjct  149  VLQLALDIARGMSYLHSQGILHRDLKSENVLL------GED-MSVKVADFGISCLESQ--  199

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
               C    G      W APE++ E+   R           K DVYSFG++ ++ILT   P
Sbjct  200  ---CGSGKGFTGTYRWMAPEMIKEKNHTR-----------KVDVYSFGIVLWEILTALVP  245

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY  764
            F E   P Q    V   +   RP  P   P  +++LI +CW T+P+ RP F  +  +L  
Sbjct  246  FSEMT-PEQAAIAV--ALKNARPPLPASCPVAMSHLISQCWATNPDKRPQFDDIVVVLEG  302

Query  765  IKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP  869
             K+ L  +P       PPPL D+   +   ++ FP
Sbjct  303  YKEALDNDPSFFLSYVPPPLHDHQHHQQSLLRCFP  337



>dbj|BAJ94289.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=366

 Score =   114 bits (285),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 84/275 (31%), Positives = 132/275 (48%), Gaps = 33/275 (12%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSKSLDMHIKENSGQRKRMSFSIPV  224
            E+A ++ L H N++ +       ++   F ++ E M+      +++   Q++  S  I +
Sbjct  111  EVALLLRLRHHNIVSFVAAC---KKPPVFCIITEYMAGG---SLRKYLHQQEPHSVPIQL  164

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
             + + L IARGM YLHS+ I H +L   N+LL      GE     KV+ FG+S ++SQ  
Sbjct  165  GLQLALDIARGMSYLHSQGILHRDLKSENVLL------GED-MSVKVADFGISCLESQ--  215

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
               C    G      W APE++ E+   R           K DVYSFG++ ++ILT   P
Sbjct  216  ---CGSGKGFTGTYRWMAPEMIKEKNHTR-----------KVDVYSFGIVLWEILTALVP  261

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY  764
            F E   P Q    V   +   RP  P   P  +++LI +CW T+P+ RP F  +  +L  
Sbjct  262  FSEMT-PEQAAIAV--ALKNARPPLPASCPVAMSHLISQCWATNPDKRPQFDDIVVVLEG  318

Query  765  IKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP  869
             K+ L  +P       PPPL D+   +   ++ FP
Sbjct  319  YKEALDNDPSFFLSYVPPPLHDHQHHQQSLLRCFP  353



>ref|XP_001780791.1| predicted protein [Physcomitrella patens]
 gb|EDQ54430.1| predicted protein [Physcomitrella patens]
Length=222

 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 117/223 (52%), Gaps = 23/223 (10%)
 Frame = +3

Query  150  MSKSLDMHIKENSGQRKRMS------FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSN  311
            M K L   + + S  RK+        FS   AV +MLQI  GM+Y+HS+ I H +L   N
Sbjct  1    MHKDLSTVLSDISRYRKQKGLTPTRPFSDVQAVALMLQIGEGMKYIHSKGIAHRDLKSLN  60

Query  312  ILLR---PMSSPGETYFHSKVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQE  482
            +L+    P S P       K++ FGL+  K+     +    + G +   W APEV+   +
Sbjct  61   VLVNLADPSSRPFSKIRSVKIADFGLAKTKNASQTYSNQTVNRGTNK--WMAPEVIEFGD  118

Query  483  QPRGSSKSGAKFS-EKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVH-SLMAGE-RP  653
            + R      ++F+  KADVYSF ++C++ILTGK P+ +     Q D+++   + AG  RP
Sbjct  119  KKR------SRFNPRKADVYSFAIICWEILTGKLPYFD---IYQTDRLIKDQVKAGTLRP  169

Query  654  LFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRYIKKVLV  782
                  P  L  LI++CWH   + RP F  +C+ LRYIK +L+
Sbjct  170  NLSKECPPKLAALIKRCWHPISHERPLFPEICKELRYIKGLLL  212



>ref|XP_001765777.1| predicted protein [Physcomitrella patens]
 gb|EDQ69368.1| predicted protein [Physcomitrella patens]
Length=245

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 122/256 (48%), Gaps = 26/256 (10%)
 Frame = +3

Query  36   ALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKENSGQRKRMSFS  215
            A+  E   +  LSHPN+++ +C    E+R+E  +VME    +L   I+E      R S S
Sbjct  6    AIIKEAGILGGLSHPNIIKLYCCGLSEKRRELEIVMERGKMTLFDMIRE------RGSLS  59

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSP---GETYFHSKVSGFGLSM  386
              +A+D++LQIA GM Y+H   + H +L   N+++  +  P      + + K+  FG S 
Sbjct  60   NEIAIDIILQIASGMCYMHDMKVAHRDLKSDNVIVNSIDIPEVDDLEFVYVKLLDFGSSK  119

Query  387  MKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSE----KADVYSFGML  554
            ++ +   + C R S       + APE +          K G    E    KADV+SFGML
Sbjct  120  IEVKNIPQVCTRGS-IFGTFGYIAPEAMI---------KKGESLQEVDALKADVFSFGML  169

Query  555  CFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPG  734
            C +I++   PF  G   +  D    ++   +RP  P   PK L  LI  CW   P  RP 
Sbjct  170  CSEIISELKPFGNG---IGYDAYQKNIKRDKRPDLPKTCPKELKLLIEDCWSLDPLRRPT  226

Query  735  FSSVCRILRYIKKVLV  782
            F  +   L  +KK L+
Sbjct  227  FLEIYTRLTMLKKKLL  242



>ref|XP_010270066.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010270067.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   111 bits (278),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 131/265 (49%), Gaps = 49/265 (18%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSK-SLDMHIKENSGQRKRMSF  212
             + E+  +  L HPN++Q+       +R   + ++ E MS+ +L M++     +++  S 
Sbjct  118  FKSEVDLLSRLLHPNIVQFIAAC---KRPPVYCIITEYMSQGTLRMYL----NKKEPYSL  170

Query  213  SIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMK  392
            SI   + + L I+RGM+YLHS+ + H +L  +N+LL             KV+ FG S ++
Sbjct  171  SIETILRLALDISRGMQYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLE  223

Query  393  SQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILT  572
            +Q     C  + G +    W APE++ E++           +++K DVYSFG++ +++ T
Sbjct  224  TQ-----CRASKGNMGTYRWMAPEMIKEKQ-----------YTKKVDVYSFGIVLWELTT  267

Query  573  GKAPFEEGERPLQG-----DKMV-----------HSLMAGERPLFPYPLPKYLTNLIRKC  704
               PF+ G  P+Q      +K+V           H LM  ERP  P      L NLIR+C
Sbjct  268  ALLPFQ-GMTPVQAAFAVSEKVVVLHQGGPWVLNHYLMENERPQLPASCQPALANLIRRC  326

Query  705  WHTSPNARPGFSSVCRILRYIKKVL  779
            W  +P+ RP FS +   L    K +
Sbjct  327  WSANPSKRPDFSYIVAALEKYDKCV  351



>gb|ABK06447.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=356

 Score =   111 bits (277),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  87   FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  140

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  141  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  193

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  194  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  237

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  238  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  294

Query  756  L  758
            L
Sbjct  295  L  295



>ref|XP_001783338.1| predicted protein [Physcomitrella patens]
 gb|EDQ51833.1| predicted protein [Physcomitrella patens]
Length=195

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 101/191 (53%), Gaps = 23/191 (12%)
 Frame = +3

Query  210  FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMM  389
            FSI  A D++LQIA G+ YLHSRN+ H           P      T F +K++ FGLS +
Sbjct  18   FSIVQAADLILQIAEGLRYLHSRNLIH-----------PKIITETTPFVAKIADFGLSKV  66

Query  390  KSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQIL  569
            K+  T R     +  +D   W APE       P  +S +     +K DVYSF ++ ++IL
Sbjct  67   KNASTMRG--HLTLNLDTTRWMAPEA------PHSTSTADRFHPKKLDVYSFAIVWYEIL  118

Query  570  TGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVC  749
            TG  PF +    +   +++  + AG R   P  +P  L  L+++CW+  P  RP F+++C
Sbjct  119  TGDEPFAD----VLKTEVLARVKAGLRANLPDGVPGRLAVLMQECWNGDPLLRPNFAAIC  174

Query  750  RILRYIKKVLV  782
              LR+IK +L+
Sbjct  175  TELRFIKGLLL  185



>ref|XP_003564407.1| PREDICTED: serine/threonine-protein kinase HT1-like [Brachypodium 
distachyon]
Length=370

 Score =   111 bits (277),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 83/260 (32%), Positives = 124/260 (48%), Gaps = 33/260 (13%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSKSLDMHIKENSGQRKRMSFSIPV  224
            E+A ++ L H N++ +       ++   F ++ E M+      +++   Q++  S  I +
Sbjct  115  EVALLLRLRHQNIISFVAAC---KKPPVFCIITEYMAGG---SLRKYLHQQEPYSVPIEL  168

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
             + + L IARGM YLHS+ I H +L   NILL      GE     KV+ FG+S ++SQ  
Sbjct  169  VLKLALDIARGMSYLHSQGILHRDLKSENILL------GED-MSVKVADFGISCLESQ--  219

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
               C    G      W APE++ E+   R           K DVYSFG++ ++ILT   P
Sbjct  220  ---CGSGKGFTGTYRWMAPEMIKEKNHTR-----------KVDVYSFGIVLWEILTSLVP  265

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY  764
            F E   P Q    V   +   RP  P   P  +++LI +CW T+P  RP F  +  IL  
Sbjct  266  FSEMT-PEQAAIAVA--LKNARPPLPASCPLAMSHLISQCWATNPERRPQFDDIVAILES  322

Query  765  IKKVLVINPEHGHPDCPPPL  824
             K+ L  +P       PPPL
Sbjct  323  YKEALDEDPSFFLSYIPPPL  342



>ref|XP_006391896.1| hypothetical protein EUTSA_v10023512mg [Eutrema salsugineum]
 gb|ESQ29182.1| hypothetical protein EUTSA_v10023512mg [Eutrema salsugineum]
Length=391

 Score =   111 bits (277),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  132  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  185

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  186  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  238

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  239  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  282

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  I
Sbjct  283  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAI  339

Query  756  L  758
            L
Sbjct  340  L  340



>ref|XP_002888028.1| hypothetical protein ARALYDRAFT_475103 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64287.1| hypothetical protein ARALYDRAFT_475103 [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  87   FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  140

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  141  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  193

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  194  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  237

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  238  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  294

Query  756  L  758
            L
Sbjct  295  L  295



>ref|NP_176430.1| protein high leaf temperature 1 [Arabidopsis thaliana]
 gb|AEE33962.1| protein high leaf temperature [Arabidopsis thaliana]
Length=345

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  87   FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  140

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  141  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  193

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  194  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  237

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  238  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  294

Query  756  L  758
            L
Sbjct  295  L  295



>ref|XP_009113082.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
Length=388

 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  130  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  183

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  184  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  236

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  237  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  280

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  281  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  337

Query  756  L  758
            L
Sbjct  338  L  338



>emb|CDY19547.1| BnaC09g13560D [Brassica napus]
Length=387

 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  130  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  183

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  184  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  236

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  237  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  280

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  281  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  337

Query  756  L  758
            L
Sbjct  338  L  338



>emb|CDY63734.1| BnaCnng42530D [Brassica napus]
Length=386

 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  128  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  181

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  182  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  234

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  235  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  278

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  279  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  335

Query  756  L  758
            L
Sbjct  336  L  336



>gb|KFK35905.1| hypothetical protein AALP_AA4G051600 [Arabis alpina]
Length=390

 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  132  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  185

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  186  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  238

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  239  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  282

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  283  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  339

Query  756  L  758
            L
Sbjct  340  L  340



>ref|XP_010430294.1| PREDICTED: serine/threonine-protein kinase HT1 [Camelina sativa]
Length=390

 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  132  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  185

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  186  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  238

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  239  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  282

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  283  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  339

Query  756  L  758
            L
Sbjct  340  L  340



>ref|XP_010418233.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=390

 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  132  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  185

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  186  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  238

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  239  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  282

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  283  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  339

Query  756  L  758
            L
Sbjct  340  L  340



>emb|CDY12945.1| BnaA09g13290D [Brassica napus]
Length=388

 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  130  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  183

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  184  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  236

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  237  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  280

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  281  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  337

Query  756  L  758
            L
Sbjct  338  L  338



>emb|CDY03279.1| BnaC09g10690D [Brassica napus]
Length=390

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  132  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  185

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  186  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  238

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  239  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  282

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  283  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  339

Query  756  L  758
            L
Sbjct  340  L  340



>ref|XP_010473458.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=390

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 125/250 (50%), Gaps = 51/250 (20%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQY---------HCGFYDEERKEGFLVMELMSK-SLDMHIKENS  188
             + E+A +  L HPN++Q+         +C           ++ E MS+ +L M++    
Sbjct  132  FKSEVALLSRLFHPNIVQFIAACKKPPVYC-----------IITEYMSQGNLRMYL----  176

Query  189  GQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVS  368
             +++  S SI   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+
Sbjct  177  NKKEPYSLSIETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVA  229

Query  369  GFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFG  548
             FG S +++Q     C  A G +    W APE++  +E+P         ++ K DVYSFG
Sbjct  230  DFGTSCLETQ-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFG  273

Query  549  MLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNAR  728
            ++ +++ T   PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ R
Sbjct  274  IVLWELTTALLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKR  330

Query  729  PGFSSVCRIL  758
            P FS++  +L
Sbjct  331  PDFSNIVAVL  340



>ref|XP_010270068.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X2 [Nelumbo 
nucifera]
Length=369

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/249 (30%), Positives = 125/249 (50%), Gaps = 35/249 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSK-SLDMHIKENSGQRKRMSF  212
             + E+  +  L HPN++Q+       +R   + ++ E MS+ +L M++     +++  S 
Sbjct  118  FKSEVDLLSRLLHPNIVQFIAAC---KRPPVYCIITEYMSQGTLRMYL----NKKEPYSL  170

Query  213  SIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMK  392
            SI   + + L I+RGM+YLHS+ + H +L  +N+LL             KV+ FG S ++
Sbjct  171  SIETILRLALDISRGMQYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLE  223

Query  393  SQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILT  572
            +Q     C  + G +    W APE++ E++           +++K DVYSFG++ +++ T
Sbjct  224  TQ-----CRASKGNMGTYRWMAPEMIKEKQ-----------YTKKVDVYSFGIVLWELTT  267

Query  573  GKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCR  752
               PF +G  P+Q    V      ERP  P      L NLIR+CW  +P+ RP FS +  
Sbjct  268  ALLPF-QGMTPVQAAFAVSE--KNERPQLPASCQPALANLIRRCWSANPSKRPDFSYIVA  324

Query  753  ILRYIKKVL  779
             L    K +
Sbjct  325  ALEKYDKCV  333



>sp|Q2MHE4.1|HT1_ARATH RecName: Full=Serine/threonine-protein kinase HT1; AltName: Full=High 
leaf temperature protein 1 [Arabidopsis thaliana]
 dbj|BAE75921.1| HT1 protein kinase [Arabidopsis thaliana]
Length=390

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  132  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  185

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  186  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  238

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  239  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  282

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  283  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  339

Query  756  L  758
            L
Sbjct  340  L  340



>ref|XP_009112690.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
Length=390

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  132  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  185

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  186  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  238

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  239  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  282

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  283  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  339

Query  756  L  758
            L
Sbjct  340  L  340



>ref|XP_006302349.1| hypothetical protein CARUB_v10020429mg [Capsella rubella]
 gb|EOA35247.1| hypothetical protein CARUB_v10020429mg [Capsella rubella]
Length=391

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  133  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  186

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  187  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  239

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  240  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  283

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  284  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  340

Query  756  L  758
            L
Sbjct  341  L  341



>emb|CDP04467.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 122/241 (51%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  123  FKSEVALLSRLYHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  176

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  SN+LL             KV+ FG S +++
Sbjct  177  TETILRLALDISRGMEYLHSQGVIHRDLKSSNLLL-------NDEMRVKVADFGTSCLET  229

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  230  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  273

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +PN RP FS +   
Sbjct  274  LLPF-QGMTPVQAAFAVAE--KNERPPMPASCQPVLAHLIKRCWVANPNKRPDFSEIVSA  330

Query  756  L  758
            L
Sbjct  331  L  331



>gb|EMT06203.1| Serine/threonine-protein kinase HT1 [Aegilops tauschii]
Length=365

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 82/274 (30%), Positives = 123/274 (45%), Gaps = 30/274 (11%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKENSGQRKRMSFSIPVA  227
            E+A ++ L H N+L        +      +   +   SL  ++     Q++  S  I + 
Sbjct  109  EVALLLRLRHHNILSVFVAACKKPPVFCIITEYMAGGSLRKYLH----QQEPHSVPIELV  164

Query  228  VDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYTF  407
            + + L IARGM YLHS+ I H +L   N+LL      GE     KV+ FG+S ++SQ   
Sbjct  165  LKLALDIARGMSYLHSQGILHRDLKSENVLL------GED-MSVKVADFGISCLESQ---  214

Query  408  RNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAPF  587
              C    G      W APE++ E+   R           K DVYSFG++ ++ILT   PF
Sbjct  215  --CGSGKGFTGTYRWMAPEMIKEKTHTR-----------KVDVYSFGIVLWEILTALVPF  261

Query  588  EEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRYI  767
             E   P Q    V   +   RP  P   P  +++LI +CW T+P  RP F  +  +L   
Sbjct  262  SEMT-PEQAAIAVA--LKNARPPLPASCPVAMSHLISQCWATNPERRPQFDDIVTVLEGY  318

Query  768  KKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFP  869
            K+ L  +P       PPP       +   ++ FP
Sbjct  319  KEALDNDPSFFLSYIPPPTHHQHQHQQSLLRCFP  352



>emb|CDY39795.1| BnaA09g10470D [Brassica napus]
Length=390

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 125/241 (52%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  132  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  185

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            +   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  186  VETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  238

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  239  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  282

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  283  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSENPSKRPDFSNIVAV  339

Query  756  L  758
            L
Sbjct  340  L  340



>ref|XP_001758080.1| predicted protein [Physcomitrella patens]
 gb|EDQ76902.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 118/240 (49%), Gaps = 19/240 (8%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKEN---SGQRKRMS  209
            L  E+  +  L HP++ +   GF  +  K  FL MELM   L   +++    +       
Sbjct  7    LLKEVGCLEGLRHPHITRL-VGFGQDNEKSIFL-MELMDGDLRDFMRQKLQFAPTPNSRP  64

Query  210  FSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGF-GLSM  386
            F+    +D++ QIA+GM Y+H +   HG+L  SN+L++      + Y   K+S   G   
Sbjct  65   FNRSEELDIITQIAKGMYYMHQQGYVHGDLKCSNLLVKNC----DQYLEVKISDLRGSQK  120

Query  387  MKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQI  566
            +  ++      +AS    P  W APE +AE     G  +   +  +K+DVYSFGM C++I
Sbjct  121  LDKEWDPVAFKQASLTRRPR-WTAPEAIAEY----GGLQPSKESLKKSDVYSFGMTCYEI  175

Query  567  LTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSV  746
            +TGK PF+     ++ D ++  +  G RP  P  L K L  LI  CW   P  RP F ++
Sbjct  176  VTGKYPFD----GIKDDHLLKQIEEGFRPELPEDLDKSLKGLITTCWDKEPRIRPSFENI  231



>gb|EYU33864.1| hypothetical protein MIMGU_mgv1a017667mg [Erythranthe guttata]
Length=373

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 124/241 (51%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  122  FKSEVALLSRLYHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  175

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            +   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  176  VETILRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  228

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  229  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YARKVDVYSFGIVLWELTTA  272

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP F+ + R 
Sbjct  273  LLPF-QGMTPVQAAFAVSE--KNERPPLPASCQPALAHLIKRCWAANPSKRPDFNEIVRA  329

Query  756  L  758
            L
Sbjct  330  L  330



>ref|XP_001777764.1| predicted protein [Physcomitrella patens]
 gb|EDQ57426.1| predicted protein [Physcomitrella patens]
Length=920

 Score =   112 bits (281),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 137/291 (47%), Gaps = 45/291 (15%)
 Frame = +3

Query  33   GALRPEIATVMSLSHPNVLQYH---------CGFYDEER----KEGFLVMELMSKSL---  164
              +R E   +    HP ++Q++           F D       K+  ++MELM   L   
Sbjct  253  SVVRKEATCLSQFQHPYIVQFYHYWEASKSIVNFQDNPSTGPAKKSHILMELMDDDLYTY  312

Query  165  ---DMHIKENSGQRKR------MSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNIL  317
                +   E  G  +R      M  +  V +D+M+Q+ + M +++ + + H +L P N+L
Sbjct  313  THPSLETAEPVGINRRAESPPAMPIAENVGIDLMIQVTKAMCHMNGKGVVHRDLKPQNVL  372

Query  318  LR--------PMSSPGETYFHSKVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLA  473
            ++         +S+ G  +  +K++ FGL+  K+       P  +  V   I+ APE+  
Sbjct  373  IKYVRGEEAPELSARG--HLRAKLADFGLA--KTTAMSSALPTLTAYVGTKIYAAPEIFL  428

Query  474  EQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERP  653
            +       + S  +F  +ADV+SFG++  +IL+GKAPF + E+ LQ  ++   + +G RP
Sbjct  429  K------DAISDRRFPRRADVWSFGIMLNEILSGKAPFPQLEKGLQMKELPARIKSGLRP  482

Query  654  LFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY--IKKVLVINPEHG  800
              P   P YL  +I  CW   P  RP F  + R+LR   ++ + +I  +H 
Sbjct  483  ALPDNCPTYLKTIIESCWQLRPQRRPSFQDLWRMLRVAQVRNLGIIKRDHN  533



>ref|XP_004508863.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cicer arietinum]
Length=356

 Score =   108 bits (271),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 123/258 (48%), Gaps = 31/258 (12%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKENSGQRKRMSFSIPVA  227
            E+A +  L HPN++ +  G   +      +V  L   SL  +++    Q+   S  + + 
Sbjct  108  EVALLFRLRHPNIIAF-VGACKKPPVFCIIVEYLSGGSLRKYLQ----QQGPHSVPLTLV  162

Query  228  VDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYTF  407
            +++ L IARGM+YLHS+ I H +L   N+LL       +     KV+ FG+S ++SQ   
Sbjct  163  LELALDIARGMQYLHSKGILHRDLKSENLLL-------DEDMCVKVADFGISCLESQ---  212

Query  408  RNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAPF  587
              C  A G      W APE++ E+           + ++K DVYSF ++ ++++TG  PF
Sbjct  213  --CGSAKGFTGTYRWMAPEMIKEK-----------RHTKKVDVYSFAIVLWELITGLIPF  259

Query  588  EEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRYI  767
            E          + H      RP  P   P   ++LI++CW ++PN RP F  +  IL   
Sbjct  260  ENMTPEQAAYAVTHK---NARPPLPSDCPLAFSHLIKRCWSSNPNKRPHFDEIVSILERY  316

Query  768  KKVLVINPEHGHPDCPPP  821
             + L  +PE      P P
Sbjct  317  TESLEQDPEFFSTYKPSP  334



>ref|XP_002455332.1| hypothetical protein SORBIDRAFT_03g008630 [Sorghum bicolor]
 gb|EES00452.1| hypothetical protein SORBIDRAFT_03g008630 [Sorghum bicolor]
Length=369

 Score =   108 bits (270),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 80/250 (32%), Positives = 124/250 (50%), Gaps = 35/250 (14%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSK-SLDMHIKENSGQRKRMSFSIP  221
            E+A ++ L HPN++ +       ++   F ++ E M+  SL  +++    Q++  S  + 
Sbjct  114  EVALLLRLHHPNIISFVAAC---KKPPVFCIITEFMAGGSLRKYLR----QQEPHSVPLK  166

Query  222  VAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQY  401
            + + + L IARGM YLHS+ I H +L   NILL      GE     KV+ FG+S ++SQ 
Sbjct  167  LVLKLALDIARGMSYLHSQGILHRDLKSENILL------GED-MSVKVADFGISCLESQ-  218

Query  402  TFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKA  581
                C    G      W APE++ E+   R           K DVYSFG++ ++ILT   
Sbjct  219  ----CGSGKGFTGTYRWMAPEMIKEKHHTR-----------KVDVYSFGIVMWEILTALV  263

Query  582  PFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILR  761
            PF +   P Q    V   +   RP  P   P  +++LI +CW T+P+ RP F  +  IL 
Sbjct  264  PFSDMT-PEQA--AVAVALKNARPPLPASCPVAISHLIMQCWATNPDKRPQFDDIVAILE  320

Query  762  YIKKVLVINP  791
              K+ L  +P
Sbjct  321  SYKEALDEDP  330



>ref|XP_004967953.1| PREDICTED: serine/threonine-protein kinase HT1-like [Setaria 
italica]
Length=374

 Score =   108 bits (270),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 79/249 (32%), Positives = 122/249 (49%), Gaps = 33/249 (13%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSKSLDMHIKENSGQRKRMSFSIPV  224
            E+A ++ L HPN++ +       ++   F ++ E M+      +++   Q++  S  I +
Sbjct  114  EVALLLRLHHPNIISFVAAC---KKPPVFCIITEYMAGG---SLRKYLHQQEPHSVPIEL  167

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
             + + L IARGM YLHS+ I H +L   NILL      GE     KV+ FG+S ++SQ  
Sbjct  168  VLKLSLDIARGMSYLHSQGILHRDLKSENILL------GED-MSVKVADFGISCLESQ--  218

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
               C    G      W APE++ E+   R           K DVYSFG++ ++ILT   P
Sbjct  219  ---CGSGKGFTGTYRWMAPEMIKEKHHTR-----------KVDVYSFGIVMWEILTALVP  264

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY  764
            F +   P Q    V   +   RP  P   P  +++LI +CW T+P+ RP F  +  IL  
Sbjct  265  FSDMT-PEQA--AVAVALKNTRPPLPASCPVAISHLIMQCWATNPDKRPQFDDIVAILES  321

Query  765  IKKVLVINP  791
             K+ L  +P
Sbjct  322  YKEALDEDP  330



>ref|XP_006643652.1| PREDICTED: serine/threonine-protein kinase HT1-like [Oryza brachyantha]
Length=366

 Score =   108 bits (270),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 77/249 (31%), Positives = 122/249 (49%), Gaps = 33/249 (13%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSKSLDMHIKENSGQRKRMSFSIPV  224
            E+A ++ L HPN++ +       ++   F ++ E M+      +++   Q++  S  I +
Sbjct  110  EVALLLRLRHPNIISFVAAC---KKPPVFCIITEYMAGG---SLRKYLHQQEPHSVPIEL  163

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
             + + L+IARGM YLHS+ I H +L   NILL       +     KV+ FG+S ++SQ  
Sbjct  164  VLKLALEIARGMSYLHSQGILHRDLKSENILL-------DGDMSVKVADFGISCLESQ--  214

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
               C    G      W APE++ E+   R           K DVYSFG++ ++ILT   P
Sbjct  215  ---CGNGKGFTGTYRWMAPEMIKEKHHTR-----------KVDVYSFGIVLWEILTALVP  260

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY  764
            F E   P Q    V   +   RP  P   P  +++LI +CW T+P+ RP F  +  IL  
Sbjct  261  FSEMT-PEQA--AVAVALKDSRPPLPPSCPVAISHLITQCWATNPDRRPQFDDIVAILES  317

Query  765  IKKVLVINP  791
             ++ L  +P
Sbjct  318  YREALEEDP  326



>ref|NP_001130627.1| uncharacterized protein LOC100191726 [Zea mays]
 gb|ACG34640.1| HT1 protein kinase [Zea mays]
Length=368

 Score =   108 bits (270),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 122/249 (49%), Gaps = 33/249 (13%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSKSLDMHIKENSGQRKRMSFSIPV  224
            E+A ++ L HPN++ +       ++   F ++ E M+      +++   Q++  S  + +
Sbjct  114  EVALLLRLHHPNIISFVAAC---KKPPVFCIITEFMAGG---SLRKYLHQQEPHSVPLNL  167

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
             + + L IARGM YLHS+ I H +L   NILL      GE     KV+ FG+S ++SQ  
Sbjct  168  VLKLALDIARGMSYLHSQGILHRDLKSENILL------GED-MSVKVADFGISCLESQ--  218

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
               C    G      W APE++ E+   R           K DVYSFG++ ++ILT   P
Sbjct  219  ---CGSGKGFTGTYRWMAPEMIKEEHHTR-----------KVDVYSFGIVMWEILTALVP  264

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY  764
            F +   P Q    V   +   RP  P   P  +++LI +CW T+P+ RP F  +  IL  
Sbjct  265  FSDMT-PEQA--AVAVALKNARPPLPASCPVAISHLIMQCWATNPDKRPQFDDIVAILES  321

Query  765  IKKVLVINP  791
             K+ L  +P
Sbjct  322  YKEALDEDP  330



>gb|ACF78924.1| unknown [Zea mays]
 tpg|DAA53819.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=368

 Score =   108 bits (270),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 122/249 (49%), Gaps = 33/249 (13%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSKSLDMHIKENSGQRKRMSFSIPV  224
            E+A ++ L HPN++ +       ++   F ++ E M+      +++   Q++  S  + +
Sbjct  114  EVALLLRLHHPNIISFVAAC---KKPPVFCIITEFMAGG---SLRKYLHQQEPHSVPLNL  167

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
             + + L IARGM YLHS+ I H +L   NILL      GE     KV+ FG+S ++SQ  
Sbjct  168  VLKLALDIARGMSYLHSQGILHRDLKSENILL------GED-MSVKVADFGISCLESQ--  218

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
               C    G      W APE++ E+   R           K DVYSFG++ ++ILT   P
Sbjct  219  ---CGSGKGFTGTYRWMAPEMIKEEHHTR-----------KVDVYSFGIVMWEILTALVP  264

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY  764
            F +   P Q    V   +   RP  P   P  +++LI +CW T+P+ RP F  +  IL  
Sbjct  265  FSDMT-PEQA--AVAVALKNARPPLPASCPVAISHLIMQCWATNPDKRPQFDDIVAILES  321

Query  765  IKKVLVINP  791
             K+ L  +P
Sbjct  322  YKEALDEDP  330



>ref|XP_003523074.1| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
 gb|KHN05818.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=357

 Score =   108 bits (269),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 122/251 (49%), Gaps = 35/251 (14%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGFLVME--LMSKSLDMHIKENSGQRKRMSFSIP  221
            E++ ++ L HPN++ +       ++   F ++   L   SL   +         +   + 
Sbjct  107  EVSLLLRLGHPNIITFIAAC---KKPPVFCIITEYLAGGSLGKFLHHQQPNILPLKLVLK  163

Query  222  VAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQY  401
            +A+D    IARGM+YLHS+ I H +L   N+LL      GE     KV+ FG+S ++SQ 
Sbjct  164  LALD----IARGMKYLHSQGILHRDLKSENLLL------GED-MCVKVADFGISCLESQ-  211

Query  402  TFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKA  581
                C  A G      W APE++ E+             ++K DVYSFG++ +++LTGK 
Sbjct  212  ----CGSAKGFTGTYRWMAPEMIKEKHH-----------TKKVDVYSFGIVLWELLTGKT  256

Query  582  PFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILR  761
            PF+    P Q    V    A  RP  P   P   ++LI +CW ++P+ RP F  +  IL 
Sbjct  257  PFDN-MTPEQAAYAVSHKNA--RPPLPSKCPWAFSDLINRCWSSNPDKRPHFDEIVSILE  313

Query  762  YIKKVLVINPE  794
            Y  + L  +PE
Sbjct  314  YYTESLQQDPE  324



>gb|KHN19311.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=357

 Score =   108 bits (269),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 122/251 (49%), Gaps = 35/251 (14%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGFLVME--LMSKSLDMHIKENSGQRKRMSFSIP  221
            E++ ++ L HPN++ +       ++   F ++   L   SL   +         +   + 
Sbjct  107  EVSLLLRLGHPNIITFIAAC---KKPPVFCIITEYLAGGSLGKFLHHQQPNILPLKLVLK  163

Query  222  VAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQY  401
            +A+D    IARGM+YLHS+ I H +L   N+LL      GE     KV+ FG+S ++SQ 
Sbjct  164  LALD----IARGMKYLHSQGILHRDLKSENLLL------GED-MCVKVADFGISCLESQ-  211

Query  402  TFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKA  581
                C  A G      W APE++ E+             ++K DVYSFG++ +++LTGK 
Sbjct  212  ----CGSAKGFTGTYRWMAPEMIKEKHH-----------TKKVDVYSFGIVLWELLTGKT  256

Query  582  PFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILR  761
            PF+    P Q    V    A  RP  P   P   ++LI +CW ++P+ RP F  +  IL 
Sbjct  257  PFD-NMTPEQAAYAVSHKNA--RPPLPSECPWAFSDLINRCWSSNPDKRPHFDEIVSILE  313

Query  762  YIKKVLVINPE  794
            Y  + L  +PE
Sbjct  314  YYTESLQQDPE  324



>ref|XP_001762830.1| predicted protein [Physcomitrella patens]
 gb|EDQ72331.1| predicted protein [Physcomitrella patens]
Length=201

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 98/202 (49%), Gaps = 29/202 (14%)
 Frame = +3

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLR-------PMSSPGETYFHSKVSGFGLS  383
            A+ +MLQIA GME LH + I H +L  SN+L++       P      + F   V+ +  S
Sbjct  16   AISIMLQIANGMEQLHRKGILHKDLKTSNVLIKLDVKKRNPPDPRHASEFSCVVADYECS  75

Query  384  MMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQ  563
            +              G +    W APEVL         +   + F+E+ DVYSF M C++
Sbjct  76   V--------------GVMGTGFWRAPEVLVAV---MDGNLDPSVFTEEVDVYSFAMTCYE  118

Query  564  ILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSS  743
            ILTG  PFE+       D    +++ G RP  P+P+   LT L+ +CWH++P  RP F  
Sbjct  119  ILTGCIPFEDLH-----DSYYDAVLNGRRPELPHPMNSRLTELLCRCWHSNPLERPSFEE  173

Query  744  VCRILRYIKKVLVINPEHGHPD  809
            +   L  I++  ++  E   P+
Sbjct  174  IRIALETIQRSCIVISETPSPN  195



>ref|XP_009627519.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
Length=376

 Score =   108 bits (269),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 122/241 (51%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  124  FKSEVALLSRLYHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  177

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  SN+LL             KV+ FG S +++
Sbjct  178  TETVLRLALDISRGMEYLHSQGVIHRDLKSSNLLLNDA-------MRVKVADFGTSCLET  230

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  231  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  274

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP F+ +   
Sbjct  275  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQLALAHLIKRCWAANPSKRPDFTHIVSA  331

Query  756  L  758
            L
Sbjct  332  L  332



>ref|XP_009768184.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Nicotiana sylvestris]
Length=376

 Score =   107 bits (268),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 122/241 (51%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  124  FKSEVALLSRLYHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  177

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  SN+LL             KV+ FG S +++
Sbjct  178  TETVLRLALDISRGMEYLHSQGVIHRDLKSSNLLLNDA-------MRVKVADFGTSCLET  230

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  231  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  274

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP F+ +   
Sbjct  275  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWAANPSKRPDFTHIVSA  331

Query  756  L  758
            L
Sbjct  332  L  332



>ref|XP_003608966.1| Fibroblast growth factor receptor [Medicago truncatula]
Length=391

 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/249 (29%), Positives = 121/249 (49%), Gaps = 31/249 (12%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKENSGQRKRMSFSIPVA  227
            E+A +  L HPN++ +  G   +      +   +   SL  ++     Q+   S  + + 
Sbjct  107  EVALLFRLRHPNIISF-VGACKKPPVFCIITEYMAGGSLRKYLL----QQGPHSVPLKLV  161

Query  228  VDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYTF  407
            +++ L IARGM+YLHS+ I H +L   N+LL       +     KV+ FG+S ++SQ   
Sbjct  162  LELALDIARGMQYLHSQGILHRDLKSENLLL-------DEEMCVKVADFGISCLESQ---  211

Query  408  RNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAPF  587
              C  A G      W APE++ E+           + ++K DVYSF ++ ++++TG  PF
Sbjct  212  --CGSAKGFTGTYRWMAPEMIREK-----------RHTKKVDVYSFAIVLWELITGLTPF  258

Query  588  EEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRYI  767
            +          + H      RP  P   P  ++NLI++CW ++PN RP F+ + +IL   
Sbjct  259  DNMTPEQAAYAVTHK---NARPPLPPDCPLAISNLIKRCWSSNPNKRPHFTEIVKILEKY  315

Query  768  KKVLVINPE  794
               L  +PE
Sbjct  316  TDSLEQDPE  324



>gb|KEH31846.1| tyrosine kinase family protein [Medicago truncatula]
Length=355

 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 123/251 (49%), Gaps = 35/251 (14%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF--LVMELMSKSLDMHIKENSGQRKRMSFSIP  221
            E+A +  L HPN++     F    +K     ++ E M+      +++   Q+   S  + 
Sbjct  107  EVALLFRLRHPNII----SFVGACKKPPVFCIITEYMAGG---SLRKYLLQQGPHSVPLK  159

Query  222  VAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQY  401
            + +++ L IARGM+YLHS+ I H +L   N+LL       +     KV+ FG+S ++SQ 
Sbjct  160  LVLELALDIARGMQYLHSQGILHRDLKSENLLL-------DEEMCVKVADFGISCLESQ-  211

Query  402  TFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKA  581
                C  A G      W APE++ E+           + ++K DVYSF ++ ++++TG  
Sbjct  212  ----CGSAKGFTGTYRWMAPEMIREK-----------RHTKKVDVYSFAIVLWELITGLT  256

Query  582  PFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILR  761
            PF+          + H      RP  P   P  ++NLI++CW ++PN RP F+ + +IL 
Sbjct  257  PFDNMTPEQAAYAVTHK---NARPPLPPDCPLAISNLIKRCWSSNPNKRPHFTEIVKILE  313

Query  762  YIKKVLVINPE  794
                 L  +PE
Sbjct  314  KYTDSLEQDPE  324



>ref|XP_009780566.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
Length=374

 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 122/241 (51%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+  +  L HPN++Q+      ++     ++ME MS+ +L M++     +++  S S
Sbjct  123  FKSEVRLLSRLYHPNIVQFIAAC--KKPPVYCIIMEYMSQGTLRMYL----NKKEPYSLS  176

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGM YLHS+ + H +L  SN+LL             KV+ FG S +++
Sbjct  177  IETILRLALDISRGMAYLHSQGVIHRDLKSSNLLL-------NDEMRVKVADFGTSCLET  229

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  230  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  273

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP F+ +   
Sbjct  274  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWAANPSKRPDFTDIVSA  330

Query  756  L  758
            L
Sbjct  331  L  331



>ref|XP_009626934.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
Length=374

 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 122/241 (51%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+  +  L HPN++Q+      ++     ++ME MS+ +L M++     +++  S S
Sbjct  123  FKSEVRLLSRLYHPNIVQFIAAC--KKPPVYCIIMEYMSQGTLRMYL----NKKEPYSLS  176

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGM YLHS+ + H +L  SN+LL             KV+ FG S +++
Sbjct  177  IETILRLALDISRGMAYLHSQGVIHRDLKSSNLLL-------NDEMRVKVADFGTSCLET  229

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  230  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  273

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP F+ +   
Sbjct  274  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWAANPSKRPDFTDIVSA  330

Query  756  L  758
            L
Sbjct  331  L  331



>ref|XP_001782419.1| predicted protein [Physcomitrella patens]
 gb|EDQ52754.1| predicted protein [Physcomitrella patens]
Length=202

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 95/185 (51%), Gaps = 13/185 (7%)
 Frame = +3

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
            AV +M QIA  ME LH + I H +L  SN+L+        ++      GF  ++   + +
Sbjct  12   AVLIMYQIAVAMEELHDQGILHRDLKASNVLVNVTEDDSYSFDPWHDDGFQCAVADFECS  71

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
                    G V    W APE+L E  +  G+      F+++ DVYS+ M C++ILTG  P
Sbjct  72   V-------GVVGTGYWRAPEIL-EVLKDHGNLHDQQIFTQQVDVYSYAMTCYEILTGCIP  123

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY  764
            FE+  RP    + V   +AGERP  P  +   L+ LI +CW   P+ RP F+ + +++  
Sbjct  124  FED--RPRTNPEFV---LAGERPQLPDHIHPELSKLISRCWSADPSQRPTFTDIVKVITE  178

Query  765  IKKVL  779
            I ++L
Sbjct  179  IDRLL  183



>ref|XP_002970550.1| hypothetical protein SELMODRAFT_37511, partial [Selaginella moellendorffii]
 gb|EFJ28680.1| hypothetical protein SELMODRAFT_37511, partial [Selaginella moellendorffii]
Length=166

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 93/184 (51%), Gaps = 25/184 (14%)
 Frame = +3

Query  228  VDVMLQIARGMEYLHSRNIFHGELNPSNILL------RPMSSPGETYFHSKVSGFGLSMM  389
            VD++LQIARG  +LH   + H +L P N+L+      R M +   T F    +GF  SM+
Sbjct  1    VDLLLQIARGTRFLHDHGVVHRDLKPQNVLVDFDGDDRRMVNVLLTDFGIARTGFD-SMV  59

Query  390  KSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQIL  569
                + R  PR         + APE++A      G       +S K DVYSFG+LC ++L
Sbjct  60   NDLTSLRGTPR---------YMAPEMMASAAAALGG------YSRKVDVYSFGVLCSEVL  104

Query  570  TGKAPFEEGERPLQGDKMVHSLM-AGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSV  746
            TG  PF  G++   G   V  ++ +G+RP  P   P  L +LI +CW     +RP FS +
Sbjct  105  TGSPPF--GDKRWLGINEVREMVDSGKRPELPASCPGELRDLITRCWSADAESRPAFSEI  162

Query  747  CRIL  758
             R L
Sbjct  163  EREL  166



>gb|AAF70839.1|AC003113_6 F24O1.13 [Arabidopsis thaliana]
Length=415

 Score =   107 bits (267),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 79/264 (30%), Positives = 129/264 (49%), Gaps = 54/264 (20%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQY--------HCGFYDEE-----------RKEGFL----VMEL  149
             + E+A +  L HPN++Q          C F+ +E           +  GF     + E 
Sbjct  132  FKSEVALLSRLFHPNIVQVCIVYLLIKTCSFHYQEVISLREKKNRAKIIGFRKYVSLQEY  191

Query  150  MSK-SLDMHIKENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRP  326
            MS+ +L M++     +++  S SI   + + L I+RGMEYLHS+ + H +L  +N+LL  
Sbjct  192  MSQGNLRMYL----NKKEPYSLSIETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL--  245

Query  327  MSSPGETYFHSKVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKS  506
                       KV+ FG S +++Q     C  A G +    W APE++  +E+P      
Sbjct  246  -----NDEMRVKVADFGTSCLETQ-----CREAKGNMGTYRWMAPEMI--KEKP------  287

Query  507  GAKFSEKADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLT  686
               ++ K DVYSFG++ +++ T   PF +G  P+Q    V      ERP  P      L 
Sbjct  288  ---YTRKVDVYSFGIVLWELTTALLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALA  341

Query  687  NLIRKCWHTSPNARPGFSSVCRIL  758
            +LI++CW  +P+ RP FS++  +L
Sbjct  342  HLIKRCWSENPSKRPDFSNIVAVL  365



>ref|XP_004236673.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
Length=377

 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 121/241 (50%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  125  FKSEVALLSRLYHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  178

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  SN+LL             KV+ FG S +++
Sbjct  179  TETILRLALDISRGMEYLHSQGVIHRDLKSSNLLL-------NDEMRVKVADFGTSCLET  231

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  232  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  275

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L  LI++CW  +P+ RP F+ +   
Sbjct  276  LLPF-QGMTPVQAAFAVAE--KNERPPMPASCQLALAQLIKRCWAANPSKRPDFTYIVSA  332

Query  756  L  758
            L
Sbjct  333  L  333



>ref|XP_006449834.1| hypothetical protein CICLE_v10015659mg [Citrus clementina]
 gb|ESR63074.1| hypothetical protein CICLE_v10015659mg [Citrus clementina]
Length=373

 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 121/241 (50%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  122  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  175

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  176  TETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDDMRVKVADFGTSCLET  228

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C    G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  229  Q-----CRETKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  272

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LIR+CW  +P+ RP FS +   
Sbjct  273  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIRRCWAANPSKRPDFSDIVSA  329

Query  756  L  758
            L
Sbjct  330  L  330



>ref|XP_006346769.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
tuberosum]
Length=377

 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 121/241 (50%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  125  FKSEVALLSRLYHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  178

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  SN+LL             KV+ FG S +++
Sbjct  179  TETILRLALDISRGMEYLHSQGVIHRDLKSSNLLL-------NDEMRVKVADFGTSCLET  231

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  232  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  275

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L  LI++CW  +P+ RP F+ +   
Sbjct  276  LLPF-QGMTPVQAAFAVAE--KNERPPMPASCQLALAQLIKRCWAANPSKRPDFTYIVSA  332

Query  756  L  758
            L
Sbjct  333  L  333



>ref|XP_006467353.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Citrus sinensis]
 ref|XP_006467354.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Citrus sinensis]
 ref|XP_006467355.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X3 
[Citrus sinensis]
Length=373

 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 121/241 (50%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  122  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  175

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  176  TETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDDMRVKVADFGTSCLET  228

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C    G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  229  Q-----CRETKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  272

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LIR+CW  +P+ RP FS +   
Sbjct  273  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIRRCWAANPSKRPDFSDIVSA  329

Query  756  L  758
            L
Sbjct  330  L  330



>ref|XP_001783922.1| predicted protein [Physcomitrella patens]
 gb|EDQ51267.1| predicted protein [Physcomitrella patens]
Length=221

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/240 (29%), Positives = 123/240 (51%), Gaps = 23/240 (10%)
 Frame = +3

Query  36   ALRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKENSGQRKRMSFS  215
             +  ++     L H N++Q+  G+   E ++  L+ME  S +L+ ++K +  +      S
Sbjct  2    VMEEQVEVFARLQHVNLVQF-IGYTVHENQQ-MLIMERGSANLETYLKRHGSK----PVS  55

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGE-TYFHSKVSGFGLSMMK  392
               A D++LQIA GM YLH +N+ HG+L  ++I+L         +    K++ +GLS ++
Sbjct  56   HLKAFDILLQIAEGMRYLHDQNVIHGDLKATDIILDATERKDNFSCVRVKLADYGLSKLR  115

Query  393  SQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILT  572
                    P ++   +P+ W  PEV   +      S S   +++  DVYSF ++ ++ILT
Sbjct  116  QSMR----PSSATYSNPMAWRPPEVYDYK------SDSIEMYTKYTDVYSFALVMYEILT  165

Query  573  GKAPFEEGERPLQGDKMVHSLMAGERPLFPYP--LPKYLTNLIRKCWHTSPNARPGFSSV  746
            G  P+E     L    ++ SL++G RP+       P YL+  +++CW T+P  RP F  +
Sbjct  166  GLKPYE----ALSPRDVLPSLLSGWRPVTNTESHCPVYLSTFMQQCWATNPKDRPLFPDI  221



>ref|XP_010090956.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
 gb|EXB41541.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
Length=376

 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 122/241 (51%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  125  FKSEVAFLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  178

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  179  TETILRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDDMRVKVADFGTSCLET  231

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C    G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  232  Q-----CRETKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  275

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS +  I
Sbjct  276  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWAANPSKRPDFSDIVSI  332

Query  756  L  758
            L
Sbjct  333  L  333



>gb|ETO10875.1| hypothetical protein RFI_26503 [Reticulomyxa filosa]
Length=384

 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 125/234 (53%), Gaps = 26/234 (11%)
 Frame = +3

Query  72   SHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFSIPVAVDVMLQI  248
            +HPNVL+Y+ GF    +K   LVME M   S+  ++  +S Q   +  S    + +  Q+
Sbjct  156  NHPNVLRYY-GFC---QKPLCLVMEYMDGGSVQEYLHHDSPQS--IQISSLQRLKIAKQV  209

Query  249  ARGMEYLHSRNIFHGELNPSNILLR-PMSSPGETYFHSKVSGFGLSMMKSQYTFRNCPRA  425
            A G+ +LH  NI H ++   N+L++ P + PG+  F   +S FG+S + ++ T+ N   +
Sbjct  210  ALGINHLHQHNIVHRDIAARNLLMKNPKTHPGD--FVIVISDFGMSQIMNEETYNNTYTS  267

Query  426  SGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAPFEEGERP  605
             G   P+ W APE L   E PR        FS K+DVYSFG+  +++LTG+ P+ + + P
Sbjct  268  IG---PLKWMAPETL--NEHPR--------FSTKSDVYSFGITLWELLTGQEPYADID-P  313

Query  606  LQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRYI  767
            L     V  ++A  RP     +   + +L+++CW   P+ RP F  +  +L  I
Sbjct  314  LNA--AVQVVVAQLRPTLYEFIDVKIQSLLKRCWDNDPSKRPDFPEIILLLEKI  365



>ref|XP_001308342.1| TKL family protein kinase [Trichomonas vaginalis G3]
 gb|EAX95412.1| TKL family protein kinase [Trichomonas vaginalis G3]
Length=1105

 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 100/197 (51%), Gaps = 30/197 (15%)
 Frame = +3

Query  168  MHIKENSGQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGET  347
            +H K+ + +      SI     + L +A GM+YLHS+N+ H +L   NILL   + P   
Sbjct  297  LHAKDANSRLTPTQLSI-----IALGVAYGMQYLHSQNMVHRDLKSLNILLDEDNLP---  348

Query  348  YFHSKVSGFGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEK  527
                K++ FG++  K+     N    SGG+    W APEVL  Q            F EK
Sbjct  349  ----KIADFGMARTKTS----NNEMVSGGIGTSQWMAPEVLMSQ-----------NFDEK  389

Query  528  ADVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCW  707
            +DVYS+G++ +++LTG  P+  G R +Q    V  +    RP  P   P+ L   IR CW
Sbjct  390  SDVYSYGIILWEMLTGDVPYR-GLRDIQVAMTV--INQNNRPKIPKSCPQNLAKFIRLCW  446

Query  708  HTSPNARPGFSSVCRIL  758
            H+ P+ RP F+++ + L
Sbjct  447  HSDPHKRPDFTTIVQTL  463



>dbj|BAD44848.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD44887.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|EAY72211.1| hypothetical protein OsI_00062 [Oryza sativa Indica Group]
 gb|EAZ10230.1| hypothetical protein OsJ_00060 [Oryza sativa Japonica Group]
Length=376

 Score =   106 bits (265),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/238 (32%), Positives = 117/238 (49%), Gaps = 33/238 (14%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSKSLDMHIKENSGQRKRMSFSIPV  224
            E+A ++ L HPN++ +       ++   F ++ E M+      +++   Q++  S  I +
Sbjct  113  EVALLLRLRHPNIISFVAAC---KKPPVFCIITEYMAGG---SLRKYLHQQEPHSVPIEL  166

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
             + + L+IARGM YLHS+ I H +L   NILL       +     KV+ FG+S ++SQ  
Sbjct  167  VLKLSLEIARGMSYLHSQGILHRDLKSENILL-------DGDMSVKVADFGISCLESQ--  217

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
               C    G      W APE++ E+   R           K DVYSFG++ ++ILT   P
Sbjct  218  ---CGSGKGFTGTYRWMAPEMIKEKHHTR-----------KVDVYSFGIVLWEILTALVP  263

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRIL  758
            F E   P Q    V   +   RP  P   P  +++LI +CW T+P+ RP F  +  IL
Sbjct  264  FSEMT-PEQA--AVAVALKNARPPLPPSCPVAISHLITQCWATNPDRRPQFDDIVAIL  318



>ref|XP_004501934.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cicer arietinum]
Length=350

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 123/251 (49%), Gaps = 35/251 (14%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGFLVME--LMSKSLDMHIKENSGQRKRMSFSIP  221
            E+A ++ L HPN++ +       ++   F ++   L   SL  ++     Q++  S    
Sbjct  106  EVACLLRLRHPNIITFIAAC---KKPPVFCIITEYLAGGSLRKYLH----QQEPHSVPHE  158

Query  222  VAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQY  401
            + + + L IARGMEYLHS+ I H +L   N+LL      GE     KV+ FG+S ++SQ 
Sbjct  159  LVLKLSLDIARGMEYLHSQGILHRDLKSENLLL------GED-MCVKVADFGISCLESQ-  210

Query  402  TFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKA  581
                C  A G      W APE++ E+             ++K DVYSFG++ +++LTG  
Sbjct  211  ----CGSAKGFTGTYRWMAPEMIKEKHH-----------TKKVDVYSFGIVLWELLTGLT  255

Query  582  PFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILR  761
            PF +   P Q    V    A  RP  P   P   +NLI +CW ++P  RP F  +  IL 
Sbjct  256  PF-DNMTPEQAAFAVSYKNA--RPPLPSECPCAFSNLINRCWSSNPKKRPHFVEIVTILE  312

Query  762  YIKKVLVINPE  794
            +  + +  +PE
Sbjct  313  HYTESIEQDPE  323



>gb|EMS58860.1| Serine/threonine-protein kinase HT1 [Triticum urartu]
Length=277

 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/249 (31%), Positives = 120/249 (48%), Gaps = 33/249 (13%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSKSLDMHIKENSGQRKRMSFSIPV  224
            E+A ++ L H N+L +       ++   F ++ E M+      +++   Q++  S  I +
Sbjct  22   EVALLLRLRHHNILSFVAAC---KKPPVFCIITEYMAGG---SLRKYLHQQEPHSVPIEL  75

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
             + + L IARGM YLHS+ I H +L   N+LL      GE     KV+ FG+S ++SQ  
Sbjct  76   VLKLALDIARGMSYLHSQGILHRDLKSENVLL------GED-MSVKVADFGISCLESQ--  126

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
               C    G      W APE++ E+   R           K DVYSFG++ ++ILT   P
Sbjct  127  ---CGSGKGFTGTYRWMAPEMIKEKNHTR-----------KVDVYSFGIVLWEILTALVP  172

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY  764
            F E   P Q    V   +   RP  P   P  +++LI +CW T+P  RP F  +  +L  
Sbjct  173  FSEMT-PEQAAIAVA--LKNARPPLPASCPVAMSHLISQCWATNPERRPQFDDIVMVLEG  229

Query  765  IKKVLVINP  791
             K+ L  +P
Sbjct  230  YKEALDNDP  238



>gb|KHN18460.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=352

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 127/266 (48%), Gaps = 35/266 (13%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSKSLDMHIKENSGQRKRMSFSIPV  224
            E+A +  L HPN++ +       ++   F ++ E +S      +++   Q    S  + V
Sbjct  106  EVALLFRLRHPNIITFVAAC---KKPPVFCIITEYLSGG---SLRKYLVQEGPHSVPLRV  159

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
             + + L IARGM+YLHS+ I H +L   N+LL      GE     KV+ FG+S ++SQ  
Sbjct  160  VLKLALDIARGMQYLHSQGILHRDLKSENLLL------GED-LCVKVADFGISCLESQ--  210

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
                  A G      W APE++ E+           + ++K DVYSF ++ +++LTG  P
Sbjct  211  ---TGSAKGFTGTYRWMAPEMIKEK-----------RHTKKVDVYSFAIVLWELLTGLTP  256

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY  764
            F+          + H     ERP  P   PK  ++LI +CW ++P+ RP F  +  IL  
Sbjct  257  FDNMTPEQAAYAVTHK---NERPPLPCDCPKAFSHLINRCWSSNPDKRPHFDEIVAILES  313

Query  765  IKKVLVINPEH--GHPDCPPPLVDYC  836
              + L  +PE    +  CP  ++  C
Sbjct  314  YTEALEQDPEFFSTYKPCPNNIILRC  339



>ref|XP_003528701.2| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
 gb|KHN28768.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=381

 Score =   106 bits (265),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 125/244 (51%), Gaps = 34/244 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  130  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  183

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  184  IETILRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  236

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            +     C    G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  237  R-----CRETKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  280

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSS-VCR  752
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS  VC 
Sbjct  281  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSANPSKRPDFSDIVCT  337

Query  753  ILRY  764
            + +Y
Sbjct  338  LEKY  341



>ref|XP_010678755.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=373

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/250 (30%), Positives = 123/250 (49%), Gaps = 33/250 (13%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSKSLDMHIKENSGQRKRMSFSIPV  224
            E+A +  L+HPN++ +   F   ++   F ++ E M+      +++   Q++  S  + +
Sbjct  125  EVALLFRLTHPNIITF---FAACKKPPVFCIITEYMAGG---SLRKYLHQQEPHSLPLDL  178

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
             + + L IARGM++LHS+ I H +L   N+LL             KV+ FG+S +++Q  
Sbjct  179  VMKLALDIARGMQFLHSQGILHRDLKSENLLL-------GNDMCVKVADFGISCLETQ--  229

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
               C  A G      W APE++ E+             ++K DVYSFG++ ++ILT   P
Sbjct  230  ---CGSAKGFTGTYRWMAPEMIKEEHH-----------TKKVDVYSFGIVLWEILTALTP  275

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY  764
            F+    P Q    V       RP  P   PK L+ LI++CW ++P+ RP F  +  IL  
Sbjct  276  FD-NMTPEQAAFAV--CQKNARPPVPTECPKALSRLIKRCWSSNPDKRPQFEEIVSILER  332

Query  765  IKKVLVINPE  794
              +    +PE
Sbjct  333  YSESFNRDPE  342



>ref|XP_011095979.1| PREDICTED: serine/threonine-protein kinase HT1 [Sesamum indicum]
Length=373

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 122/241 (51%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  122  FKSEVALLSRLYHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  175

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  176  TETILRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  228

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  229  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  272

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP         L +LI++CW  +P+ RP FS + R 
Sbjct  273  LLPF-QGMTPVQAAFAVAE--KNERPPLVASCQPALAHLIKRCWAANPSKRPDFSEIVRA  329

Query  756  L  758
            L
Sbjct  330  L  330



>gb|AES92694.2| Serine/Threonine-kinase HT1-like protein [Medicago truncatula]
Length=377

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 124/244 (51%), Gaps = 34/244 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  126  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  179

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  180  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  232

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            +     C    G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  233  R-----CRETKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  276

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS +   
Sbjct  277  LLPF-QGMTPVQAAFAVSE--KNERPPLPASCQPALAHLIKRCWSANPSKRPDFSYIVST  333

Query  756  L-RY  764
            L RY
Sbjct  334  LERY  337



>ref|XP_003550738.1| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
Length=352

 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 127/266 (48%), Gaps = 35/266 (13%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSKSLDMHIKENSGQRKRMSFSIPV  224
            E+A +  L HPN++ +       ++   F ++ E +S      +++   Q    S  + V
Sbjct  106  EVALLFRLRHPNIITFVAAC---KKPPVFCIITEYLSGG---SLRKYLVQEGPHSVPLRV  159

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
             + + L IARGM+YLHS+ I H +L   N+LL      GE     KV+ FG+S ++SQ  
Sbjct  160  VLKLALDIARGMQYLHSQGILHRDLKSENLLL------GED-LCVKVADFGISCLESQ--  210

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
                  A G      W APE++ E+           + ++K DVYSF ++ +++LTG  P
Sbjct  211  ---TGSAKGFTGTYRWMAPEMIKEK-----------RHTKKVDVYSFAIVLWELLTGLTP  256

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY  764
            F+          + H     ERP  P   PK  ++LI +CW ++P+ RP F  +  IL  
Sbjct  257  FDNMTPEQAAYAVTHK---NERPPLPCDCPKAFSHLINRCWSSNPDKRPHFDEIVAILES  313

Query  765  IKKVLVINPEH--GHPDCPPPLVDYC  836
              + L  +PE    +  CP  ++  C
Sbjct  314  YTEALEQDPEFFSTYKPCPNNIILRC  339



>ref|XP_006476768.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Citrus sinensis]
Length=362

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 125/260 (48%), Gaps = 35/260 (13%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGFLVME--LMSKSLDMHIKENSGQRKRMSFSIP  221
            E+A +  LSHPN++ +       ++   F ++   L   SL  ++     Q++  S  + 
Sbjct  106  EVALLFRLSHPNIITFVAAC---KKPPVFCIITEYLAGGSLRKYLH----QQEPYSVPLI  158

Query  222  VAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQY  401
            + + + L IARGM+YLHS+ I H +L   N+LL      GE     KV+ FG+S ++SQ 
Sbjct  159  LVLKLALDIARGMQYLHSQGILHRDLKSENLLL------GED-MCVKVADFGISCLESQ-  210

Query  402  TFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKA  581
                C  A G      W APE++ E+           + ++K DVYSFG++ +++LT   
Sbjct  211  ----CGSAKGFTGTYRWMAPEMIKEK-----------RHTKKVDVYSFGIVLWELLTALT  255

Query  582  PFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILR  761
            PF+    P Q    V       RP  P   PK  + LI +CW +SP+ RP F  +  IL 
Sbjct  256  PFD-NMTPEQAAFAV--CQKNARPPVPPTCPKAFSYLISRCWSSSPDRRPHFDQIVSILE  312

Query  762  YIKKVLVINPEHGHPDCPPP  821
               + L  +PE      P P
Sbjct  313  GYSESLEQDPEFFSSFIPSP  332



>ref|XP_001779657.1| predicted protein [Physcomitrella patens]
 gb|EDQ55568.1| predicted protein [Physcomitrella patens]
Length=155

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 86/172 (50%), Gaps = 20/172 (12%)
 Frame = +3

Query  255  GMEYLHSRNIFHGELNPSNILLRPMSSPG--ETYFHSKVSGFGLSMMKSQ-YTFRNCPRA  425
            GMEYLH   I H +L   NIL++ +        Y  +KV+ FGLS  K +  T+ N    
Sbjct  1    GMEYLHEMRIVHRDLKAMNILVKQVKGKDGRSWYIWAKVADFGLSKTKERSVTYSNQTLN  60

Query  426  SGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAPFEEGERP  605
            +G      W  PE++ E + P G            DVYSF M+C++ILTG  PF +    
Sbjct  61   TGTTR---WMPPEMIKETKYPFG-----------GDVYSFAMVCYEILTGDVPFYD---I  103

Query  606  LQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILR  761
             Q +++   ++ G+RP  P   P  L  LIR+CW    +ARP F  +C  LR
Sbjct  104  AQHNEVKKKVLKGDRPGLPKDCPTSLERLIRRCWSQDASARPRFDEICVELR  155



>gb|KHN49033.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=328

 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 115/237 (49%), Gaps = 34/237 (14%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKENSGQRKRMSFSIPVA  227
            E+  +  L H NV+++   + D +    + ++    +   + +  N+ + K    S+   
Sbjct  101  EVTHLPRLHHQNVVKFIGAYKDTD---FYCILTEYQQKGSLRVYLNNLESK--PISLKRV  155

Query  228  VDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYTF  407
            +D  L IARGMEY+H++ I H +L P N+L+      GE     K++ FG++   S+   
Sbjct  156  IDFALDIARGMEYIHAQGIIHRDLKPENVLV-----DGEIRL--KIADFGIACEASK---  205

Query  408  RNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAPF  587
              C    G      W APE++            G ++  K DVYSFG++ +++L+G  PF
Sbjct  206  --CDSLRGTYR---WMAPEMI-----------KGKRYGRKVDVYSFGLILWELLSGTVPF  249

Query  588  EEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRIL  758
             EG  P+Q    V       RP+ P   P  L++LI++CW   P  RP F  + R+L
Sbjct  250  -EGMNPIQVAVAVAD--RNSRPIIPSHCPHVLSDLIKQCWELKPEKRPEFCQIVRVL  303



>ref|XP_008440056.1| PREDICTED: serine/threonine-protein kinase HT1 [Cucumis melo]
Length=373

 Score =   105 bits (263),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/241 (30%), Positives = 122/241 (51%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  122  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  175

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  176  TETILRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  228

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  + G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  229  Q-----CQESKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  272

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS +   
Sbjct  273  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWAANPSKRPDFSDIVAA  329

Query  756  L  758
            L
Sbjct  330  L  330



>ref|XP_004507651.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Cicer arietinum]
Length=382

 Score =   105 bits (263),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 124/244 (51%), Gaps = 34/244 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  131  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  184

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  185  IETILRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  237

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            +     C    G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  238  R-----CRETKGNMGTYRWMAPEMI--KEKP---------YARKVDVYSFGIVLWELTTA  281

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS +   
Sbjct  282  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSANPSKRPDFSDIVST  338

Query  756  L-RY  764
            L RY
Sbjct  339  LERY  342



>ref|XP_011086225.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
Length=373

 Score =   105 bits (263),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 75/244 (31%), Positives = 121/244 (50%), Gaps = 34/244 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  122  FKREVALLSRLYHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  175

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  176  TETILRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  228

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C    G      W APE++ E+   R           K DVYSFG++ +++ T 
Sbjct  229  Q-----CRETKGNKGTYRWMAPEMIKEKPCTR-----------KVDVYSFGIVLWELTTA  272

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSS-VCR  752
              PF +G  P+Q    V      ERP  P      L +LI++CW T+P+ RP FS  VC 
Sbjct  273  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWATNPSKRPDFSEIVCA  329

Query  753  ILRY  764
            + +Y
Sbjct  330  LEKY  333



>ref|XP_007209317.1| hypothetical protein PRUPE_ppa007935mg [Prunus persica]
 gb|EMJ10516.1| hypothetical protein PRUPE_ppa007935mg [Prunus persica]
Length=351

 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 80/259 (31%), Positives = 123/259 (47%), Gaps = 35/259 (14%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGFLVME--LMSKSLDMHIKENSGQRKRMSFSIP  221
            E+A +  L HPN++ +       ++   F ++   L   SL  ++     Q++  S  + 
Sbjct  106  EVALLFRLHHPNIISFVAAC---KKPPVFCIITEYLCGGSLRKYLH----QQEPHSVPLS  158

Query  222  VAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQY  401
            + V + L IARGM+YLHS++I H +L   N+LL      GE     KV+ FG+S ++SQ 
Sbjct  159  LVVKLALDIARGMQYLHSQSILHRDLKSENLLL------GED-MSVKVADFGISCLESQ-  210

Query  402  TFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKA  581
                C  A G      W APE++ E+             ++K DVYSFG++ +++LT   
Sbjct  211  ----CGSAKGFTGTYRWMAPEMIKEKHH-----------TKKVDVYSFGIVLWELLTALT  255

Query  582  PFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILR  761
            PF +   P Q    V    A  RP  P   P   + LI +CW T P+ RP F  +  IL 
Sbjct  256  PF-DNMTPEQAAFAVSQKNA--RPPLPSTCPTAFSRLISRCWSTHPDKRPHFDEIVHILE  312

Query  762  YIKKVLVINPEHGHPDCPP  818
               + L  +P+      PP
Sbjct  313  SYAESLEQDPDFFSSYKPP  331



>gb|AES71532.2| Serine/Threonine-kinase HT1-like protein [Medicago truncatula]
Length=356

 Score =   105 bits (262),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 125/261 (48%), Gaps = 35/261 (13%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGFLVME--LMSKSLDMHIKENSGQRKRMSFSIP  221
            E+A ++ L HPN+L +       ++   F ++   L   SL  ++     Q++  S    
Sbjct  106  EVALLLRLRHPNILTFIAAC---KKPPVFCIITEYLAGGSLRKYLH----QQEPHSVPHE  158

Query  222  VAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQY  401
            + + + L IARGM+YLHS+ I H +L   N+LL       +     KV+ FG+S ++SQ 
Sbjct  159  LVLKLALDIARGMKYLHSQGILHRDLKSENLLL-------DEDMCVKVADFGISCLESQ-  210

Query  402  TFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKA  581
                C  A G      W APE++ E+             ++K DVYSFG++ +++LT   
Sbjct  211  ----CGSAKGFTGTYRWMAPEMIREKHH-----------TKKVDVYSFGIVLWELLTALI  255

Query  582  PFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILR  761
            PF+    P Q    V    A  RP  P   P   +NLI +CW ++PN RP F  +  IL 
Sbjct  256  PFD-NMTPEQAAFAVSYKNA--RPPLPSECPWAFSNLINRCWSSNPNKRPHFVEIVSILE  312

Query  762  YIKKVLVINPEHGHPDCPPPL  824
               + L ++P+      P P+
Sbjct  313  CFTESLELDPDFFTTYKPRPI  333



>gb|KGN49067.1| hypothetical protein Csa_6G511830 [Cucumis sativus]
Length=363

 Score =   105 bits (262),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/241 (30%), Positives = 122/241 (51%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  122  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  175

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  176  TETILRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  228

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  + G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  229  Q-----CRESKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  272

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS +   
Sbjct  273  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWAANPSKRPDFSDIVAA  329

Query  756  L  758
            L
Sbjct  330  L  330



>gb|KDQ19166.1| hypothetical protein BOTBODRAFT_485672 [Botryobasidium botryosum 
FD-172 SS1]
Length=284

 Score =   104 bits (260),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 116/242 (48%), Gaps = 31/242 (13%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSKSLDMHIKEN-SGQRKRMSFS  215
            LR E      L HPN+L+++ G Y  E  +  +   + +  L  ++K +    RK M   
Sbjct  55   LRRETEVWHHLEHPNILEFY-GVYHHESLDYLVSPWIPNGDLLTYLKSHPQIDRKAM---  110

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                   +L+IA  +EYLH + + HG++   NIL+     P        +  FGLS +  
Sbjct  111  -------VLEIAGALEYLHKKEVVHGDVKSKNILVSSSGRP-------LLCDFGLSKILD  156

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            +   R  P    G   + W APE L +Q   R  +K+G       DV++FG +  ++ TG
Sbjct  157  RARSRT-PTEIQGAGSLRWSAPEFLIDQPDGRSKTKAG-------DVFAFGFVTIEVYTG  208

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
            + PF E         ++  L+ G+RP  P  +   +  L RKCW T+P++RP   ++C++
Sbjct  209  RIPFYE----YNDSSVLAFLLCGKRPERPLDMDGVVWKLTRKCWPTNPSSRPTMRTICQM  264

Query  756  LR  761
            LR
Sbjct  265  LR  266



>ref|XP_003550476.2| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
 gb|KHN03512.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=381

 Score =   105 bits (261),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 72/244 (30%), Positives = 122/244 (50%), Gaps = 34/244 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  130  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  183

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  184  TETILRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  236

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            +     C    G +    W APE++ E+            ++ K DVYSFG++ +++ T 
Sbjct  237  R-----CRETKGNMGTYRWMAPEMIKEK-----------SYTRKVDVYSFGIVLWELTTA  280

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSS-VCR  752
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS  VC 
Sbjct  281  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSANPSKRPDFSDIVCT  337

Query  753  ILRY  764
            + +Y
Sbjct  338  LEKY  341



>ref|XP_003601281.1| Fibroblast growth factor receptor [Medicago truncatula]
Length=387

 Score =   105 bits (261),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 125/261 (48%), Gaps = 35/261 (13%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGFLVME--LMSKSLDMHIKENSGQRKRMSFSIP  221
            E+A ++ L HPN+L +       ++   F ++   L   SL  ++     Q++  S    
Sbjct  137  EVALLLRLRHPNILTFIAAC---KKPPVFCIITEYLAGGSLRKYLH----QQEPHSVPHE  189

Query  222  VAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQY  401
            + + + L IARGM+YLHS+ I H +L   N+LL       +     KV+ FG+S ++SQ 
Sbjct  190  LVLKLALDIARGMKYLHSQGILHRDLKSENLLL-------DEDMCVKVADFGISCLESQ-  241

Query  402  TFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKA  581
                C  A G      W APE++ E+             ++K DVYSFG++ +++LT   
Sbjct  242  ----CGSAKGFTGTYRWMAPEMIREKHH-----------TKKVDVYSFGIVLWELLTALI  286

Query  582  PFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILR  761
            PF+    P Q    V    A  RP  P   P   +NLI +CW ++PN RP F  +  IL 
Sbjct  287  PFD-NMTPEQAAFAVSYKNA--RPPLPSECPWAFSNLINRCWSSNPNKRPHFVEIVSILE  343

Query  762  YIKKVLVINPEHGHPDCPPPL  824
               + L ++P+      P P+
Sbjct  344  CFTESLELDPDFFTTYKPRPI  364



>ref|XP_010546527.1| PREDICTED: serine/threonine-protein kinase HT1 [Tarenaya hassleriana]
Length=390

 Score =   105 bits (261),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 124/246 (50%), Gaps = 36/246 (15%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  132  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  185

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  186  TETILRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  238

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  239  Q-----CREAKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  282

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L  LI++CW  +P+ RP F   C I
Sbjct  283  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAQLIKRCWSANPSKRPDF---CEI  336

Query  756  LRYIKK  773
            +  ++K
Sbjct  337  VAALEK  342



>ref|XP_008239758.1| PREDICTED: serine/threonine-protein kinase HT1-like [Prunus mume]
Length=351

 Score =   104 bits (260),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 123/258 (48%), Gaps = 33/258 (13%)
 Frame = +3

Query  48   EIATVMSLSHPNVLQYHCGFYDEERKEGF-LVMELMSKSLDMHIKENSGQRKRMSFSIPV  224
            E+A +  L HPN++ +       ++   F ++ E +S      +++   Q++  S  + +
Sbjct  106  EVALLFRLHHPNIISFVAAC---KKPPVFCIITEYLSGG---SLRKYLHQQEPHSVPLSL  159

Query  225  AVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKSQYT  404
             V + L IARGM+YLHS++I H +L   N+LL      GE     KV+ FG+S ++SQ  
Sbjct  160  VVKLALDIARGMQYLHSQSILHRDLKSENLLL------GED-MSVKVADFGISCLESQ--  210

Query  405  FRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTGKAP  584
               C  A G      W APE++ E+             ++K DVYSFG++ +++LT   P
Sbjct  211  ---CGSAKGFTGTYRWMAPEMIKEKHH-----------TKKVDVYSFGIVLWELLTALTP  256

Query  585  FEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRILRY  764
            F +   P Q    V    A  RP  P   P   + LI +CW T P+ RP F  +  IL  
Sbjct  257  F-DNMTPEQAAFAVSQKNA--RPPLPSTCPMAFSRLISRCWSTRPDKRPHFDEIVHILES  313

Query  765  IKKVLVINPEHGHPDCPP  818
                L  +P+      PP
Sbjct  314  YADSLDQDPDFFSSYKPP  331



>ref|XP_001752525.1| predicted protein [Physcomitrella patens]
 gb|EDQ82764.1| predicted protein [Physcomitrella patens]
Length=895

 Score =   108 bits (269),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 100/350 (29%), Positives = 151/350 (43%), Gaps = 50/350 (14%)
 Frame = +3

Query  48    EIATVMSLSHPNVLQYHCGFYDEERKEG-------------FLVMELMSKSLDMHIKENS  188
             E+  + SLSHPN+++Y        ++ G             +L MELM  SL   I++N 
Sbjct  254   EVGILASLSHPNLIKYFFAMKGNAKESGECWQLKTKETRKLYLGMELMQTSLSEMIEKNG  313

Query  189   GQRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILL----RPMSSPGETYFH  356
                     S    +D+M QIARGM YLH  +I H  L P NILL    + +S+    +  
Sbjct  314   ------ELSYVFLIDIMYQIARGMCYLHDMHIAHRGLKPDNILLNIKEKKISNRIVQHAT  367

Query  357   SKVSGFGLSMMK--SQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKA  530
              KV  FG+S ++  S     N     G  +   + APEVL  + Q    + +   F  +A
Sbjct  368   VKVIDFGMSKIEVGSNPKATNNKHVYGSAN---YMAPEVLKNKSQ----TMTICPF--EA  418

Query  531   DVYSFGMLCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWH  710
             DVY F M+C ++   K PF +        K++  +  GERP  P    + LT LI++CW 
Sbjct  419   DVYLFVMVCCKMFFKKDPFYDANTM---KKILERIENGERPNLPSNCDE-LTRLIKECWS  474

Query  711   TSPNARPGFSSVCRILRYIKKVLVINPEHGHPDCPPPLVDYCDIEAGYIKKFPGDNVPPG  890
              +P  RP F ++C  L  +K+  +         C           A   K  P   + P 
Sbjct  475   LNPLQRPKFVNICERLIVLKRKFIAREVQKKAPC---------FGASKEKSHPNIELQPQ  525

Query  891   VSEIPFQMFAYKLV---EKEKTLGNDGFAVRARDDHLVSMDDLCLVPNNG  1031
             +  +P   F  K +    +E+  G      + R+    +M  LCLV   G
Sbjct  526   LDRLPLISFRSKYMVDEVEEEVFGRTQHLAQIRELCASNMKALCLVGMGG  575



>ref|XP_007026235.1| Serine/threonine-protein kinase HT1 [Theobroma cacao]
 gb|EOY28857.1| Serine/threonine-protein kinase HT1 [Theobroma cacao]
Length=373

 Score =   105 bits (261),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 123/244 (50%), Gaps = 34/244 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  122  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  175

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  176  TETILRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  228

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C    G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  229  Q-----CLETKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  272

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS +   
Sbjct  273  LLPF-QGMTPVQAAFAVAE--KNERPPLPESCQPALAHLIKRCWAANPSKRPDFSDIVSA  329

Query  756  L-RY  764
            L RY
Sbjct  330  LERY  333



>ref|XP_004231068.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X2 [Solanum 
lycopersicum]
Length=563

 Score =   107 bits (266),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 100/194 (52%), Gaps = 26/194 (13%)
 Frame = +3

Query  192  QRKRMSFSIPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSG  371
             ++R SF +P  + V + +++GM YLH  NI H +L  +N+L+       E     KV+ 
Sbjct  369  HKQRGSFKLPTVLKVAIDVSKGMNYLHQNNIIHRDLKAANLLM----DENEVV---KVAD  421

Query  372  FGLSMMKSQYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGM  551
            FG++ +K+Q         +       W APEV+  + +P         +  KADV+SFG+
Sbjct  422  FGVARVKAQTGVMTAETGT-----YRWMAPEVI--EHKP---------YDHKADVFSFGV  465

Query  552  LCFQILTGKAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARP  731
            + +++LTGK P+E    PLQ    +  +  G RP  P   P  L +L+  CW   P +RP
Sbjct  466  VLWELLTGKIPYEYL-TPLQA--AIGVVQKGLRPTIPKHTPPKLADLLETCWQQDPTSRP  522

Query  732  GFSSVCRILRYIKK  773
             FS++  IL+ I K
Sbjct  523  DFSAIVDILQQIAK  536



>ref|XP_007154003.1| hypothetical protein PHAVU_003G082800g [Phaseolus vulgaris]
 gb|ESW25997.1| hypothetical protein PHAVU_003G082800g [Phaseolus vulgaris]
Length=381

 Score =   105 bits (261),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 73/244 (30%), Positives = 124/244 (51%), Gaps = 34/244 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  130  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGTLRMYL----NKKEPYSLS  183

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
                + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  184  TETILRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  236

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            +     C    G +    W APE++  +E+P         ++ K DVYSFG++ +++ T 
Sbjct  237  R-----CRETKGNMGTYRWMAPEMI--KEKP---------YTRKVDVYSFGIVLWELTTA  280

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSS-VCR  752
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS  VC 
Sbjct  281  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPALAHLIKRCWSANPSKRPDFSDIVCT  337

Query  753  ILRY  764
            + +Y
Sbjct  338  LEKY  341



>emb|CDY08153.1| BnaA06g15730D [Brassica napus]
Length=389

 Score =   105 bits (261),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 72/241 (30%), Positives = 124/241 (51%), Gaps = 33/241 (14%)
 Frame = +3

Query  39   LRPEIATVMSLSHPNVLQYHCGFYDEERKEGFLVMELMSK-SLDMHIKENSGQRKRMSFS  215
             + E+A +  L HPN++Q+      ++     ++ E MS+ +L M++     +++  S S
Sbjct  130  FKSEVALLSRLFHPNIVQFIAAC--KKPPVYCIITEYMSQGNLRMYL----NKKEPYSLS  183

Query  216  IPVAVDVMLQIARGMEYLHSRNIFHGELNPSNILLRPMSSPGETYFHSKVSGFGLSMMKS  395
            I   + + L I+RGMEYLHS+ + H +L  +N+LL             KV+ FG S +++
Sbjct  184  IETVLRLALDISRGMEYLHSQGVIHRDLKSNNLLL-------NDEMRVKVADFGTSCLET  236

Query  396  QYTFRNCPRASGGVDPVIWYAPEVLAEQEQPRGSSKSGAKFSEKADVYSFGMLCFQILTG  575
            Q     C  A G +    W A E++  +++P         ++ K DVYSFG++ +++ T 
Sbjct  237  Q-----CREAKGNMGTYRWMALEMI--KDKP---------YTRKVDVYSFGIVLWELTTA  280

Query  576  KAPFEEGERPLQGDKMVHSLMAGERPLFPYPLPKYLTNLIRKCWHTSPNARPGFSSVCRI  755
              PF +G  P+Q    V      ERP  P      L +LI++CW  +P+ RP FS++  +
Sbjct  281  LLPF-QGMTPVQAAFAVAE--KNERPPLPASCQPELDHLIKRCWSENPSKRPDFSNIVAV  337

Query  756  L  758
            L
Sbjct  338  L  338



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6633056408746