BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19294_g1_i1 len=4982 path=[113:0-4981]

Length=4982
                                                                      Score     E

ref|XP_009595739.1|  PREDICTED: uncharacterized protein LOC104091...   1709   0.0      
ref|XP_009595735.1|  PREDICTED: uncharacterized protein LOC104091...   1709   0.0      
ref|XP_009595738.1|  PREDICTED: uncharacterized protein LOC104091...   1704   0.0      
ref|XP_009595742.1|  PREDICTED: uncharacterized protein LOC104091...   1703   0.0      
ref|XP_009595737.1|  PREDICTED: uncharacterized protein LOC104091...   1703   0.0      
ref|XP_009595734.1|  PREDICTED: uncharacterized protein LOC104091...   1703   0.0      
ref|XP_009595736.1|  PREDICTED: uncharacterized protein LOC104091...   1699   0.0      
ref|XP_009595740.1|  PREDICTED: uncharacterized protein LOC104091...   1669   0.0      
ref|XP_006344824.1|  PREDICTED: uncharacterized protein LOC102599460   1657   0.0      
ref|XP_010317142.1|  PREDICTED: uncharacterized protein LOC101258...   1647   0.0      
ref|XP_010317145.1|  PREDICTED: uncharacterized protein LOC101258...   1646   0.0      
ref|XP_010317143.1|  PREDICTED: uncharacterized protein LOC101258...   1643   0.0      
emb|CDO99760.1|  unnamed protein product                               1490   0.0      
ref|XP_010644438.1|  PREDICTED: uncharacterized protein LOC100264...   1400   0.0      
ref|XP_010644440.1|  PREDICTED: uncharacterized protein LOC100264...   1400   0.0      
ref|XP_010644441.1|  PREDICTED: uncharacterized protein LOC100264...   1399   0.0      
ref|XP_010644439.1|  PREDICTED: uncharacterized protein LOC100264...   1399   0.0      
ref|XP_011077283.1|  PREDICTED: uncharacterized protein LOC105161334   1357   0.0      
ref|XP_009595741.1|  PREDICTED: uncharacterized protein LOC104091...   1310   0.0      
ref|XP_008226923.1|  PREDICTED: uncharacterized protein LOC103326471   1290   0.0      
ref|XP_011010316.1|  PREDICTED: uncharacterized protein LOC105115...   1283   0.0      
ref|XP_011010317.1|  PREDICTED: uncharacterized protein LOC105115...   1282   0.0      
ref|XP_009595744.1|  PREDICTED: uncharacterized protein LOC104091...   1271   0.0      
ref|XP_009595743.1|  PREDICTED: uncharacterized protein LOC104091...   1271   0.0      
ref|XP_006370696.1|  hypothetical protein POPTR_0001s44980g            1247   0.0      
gb|EYU39621.1|  hypothetical protein MIMGU_mgv1a0000302mg              1245   0.0      
ref|XP_009352441.1|  PREDICTED: uncharacterized protein LOC103943806   1237   0.0      
ref|XP_010092143.1|  hypothetical protein L484_017832                  1233   0.0      
ref|XP_007022465.1|  Uncharacterized protein isoform 1                 1227   0.0      
ref|XP_010317144.1|  PREDICTED: uncharacterized protein LOC101258...   1217   0.0      
ref|XP_008365212.1|  PREDICTED: uncharacterized protein LOC103428...   1209   0.0      
ref|XP_008365204.1|  PREDICTED: uncharacterized protein LOC103428...   1208   0.0      
ref|XP_006475161.1|  PREDICTED: uncharacterized protein LOC102613...   1205   0.0      
ref|XP_002533083.1|  conserved hypothetical protein                    1170   0.0      Ricinus communis
gb|EYU23596.1|  hypothetical protein MIMGU_mgv1a025361mg               1140   0.0      
ref|XP_006475162.1|  PREDICTED: uncharacterized protein LOC102613...   1137   0.0      
ref|XP_010062998.1|  PREDICTED: uncharacterized protein LOC104450...   1135   0.0      
ref|XP_010062996.1|  PREDICTED: uncharacterized protein LOC104450...   1135   0.0      
ref|XP_004295819.1|  PREDICTED: uncharacterized protein LOC101298301   1121   0.0      
gb|KDO62639.1|  hypothetical protein CISIN_1g0000571mg                 1093   0.0      
gb|KDO62640.1|  hypothetical protein CISIN_1g0000571mg                 1092   0.0      
ref|XP_010675691.1|  PREDICTED: uncharacterized protein LOC104891...   1086   0.0      
ref|XP_008458087.1|  PREDICTED: uncharacterized protein LOC103497...   1084   0.0      
ref|XP_008458089.1|  PREDICTED: uncharacterized protein LOC103497...   1083   0.0      
gb|KDO62642.1|  hypothetical protein CISIN_1g0000571mg                 1075   0.0      
gb|KCW70172.1|  hypothetical protein EUGRSUZ_F03461                    1074   0.0      
ref|XP_004149328.1|  PREDICTED: uncharacterized protein LOC101215477   1071   0.0      
ref|XP_009763146.1|  PREDICTED: uncharacterized protein LOC104215...   1065   0.0      
ref|XP_009763145.1|  PREDICTED: uncharacterized protein LOC104215...   1064   0.0      
ref|XP_009763144.1|  PREDICTED: uncharacterized protein LOC104215...   1064   0.0      
ref|XP_004500064.1|  PREDICTED: uncharacterized protein LOC101510812   1062   0.0      
emb|CAN83957.1|  hypothetical protein VITISV_039906                    1056   0.0      Vitis vinifera
ref|XP_004163080.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   1051   0.0      
ref|XP_010267868.1|  PREDICTED: uncharacterized protein LOC104604974   1037   0.0      
ref|XP_010675692.1|  PREDICTED: uncharacterized protein LOC104891...   1028   0.0      
gb|KHN13336.1|  Nucleolar pre-ribosomal-associated protein 1           1022   0.0      
ref|XP_010644442.1|  PREDICTED: uncharacterized protein LOC100264...   1009   0.0      
ref|XP_010545221.1|  PREDICTED: uncharacterized protein LOC104817...   1009   0.0      
ref|XP_010545220.1|  PREDICTED: uncharacterized protein LOC104817...   1008   0.0      
ref|XP_008458088.1|  PREDICTED: uncharacterized protein LOC103497...   1000   0.0      
gb|KEH33828.1|  ribosome 60S biogenesis amino-terminal protein          993   0.0      
gb|KHM99566.1|  Nucleolar pre-ribosomal-associated protein 1            988   0.0      
ref|XP_006586082.1|  PREDICTED: uncharacterized protein LOC100796806    986   0.0      
ref|XP_007146471.1|  hypothetical protein PHAVU_006G043300g             982   0.0      
ref|XP_008809188.1|  PREDICTED: uncharacterized protein LOC103720976    979   0.0      
ref|XP_010917532.1|  PREDICTED: uncharacterized protein LOC105042...    972   0.0      
ref|XP_010917531.1|  PREDICTED: uncharacterized protein LOC105042...    972   0.0      
ref|XP_002869583.1|  hypothetical protein ARALYDRAFT_354097             953   0.0      
ref|XP_006413117.1|  hypothetical protein EUTSA_v10024185mg             947   0.0      
gb|KDP45875.1|  hypothetical protein JCGZ_15319                         926   0.0      
ref|XP_006282527.1|  hypothetical protein CARUB_v10003963mg             941   0.0      
gb|KFK29207.1|  hypothetical protein AALP_AA7G103100                    937   0.0      
ref|XP_009393325.1|  PREDICTED: uncharacterized protein LOC103979...    914   0.0      
ref|NP_194431.3|  uncharacterized protein                               914   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAB36547.1|  putative protein                                       913   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009393324.1|  PREDICTED: uncharacterized protein LOC103979...    914   0.0      
ref|NP_001154270.2|  uncharacterized protein                            897   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891275.1|  hypothetical protein ARALYDRAFT_314107             897   0.0      
emb|CDX89286.1|  BnaA01g16070D                                          877   0.0      
emb|CDY29264.1|  BnaC01g19160D                                          875   0.0      
ref|NP_565039.4|  uncharacterized protein                               869   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142988.1|  PREDICTED: uncharacterized protein LOC103866...    855   0.0      
ref|XP_002893970.1|  hypothetical protein ARALYDRAFT_336756             852   0.0      
ref|XP_009142994.1|  PREDICTED: uncharacterized protein LOC103866...    849   0.0      
ref|XP_010675693.1|  PREDICTED: uncharacterized protein LOC104891...    832   0.0      
ref|XP_010235576.1|  PREDICTED: uncharacterized protein LOC100836046    832   0.0      
ref|XP_004958824.1|  PREDICTED: uncharacterized protein LOC101763...    831   0.0      
ref|XP_006293524.1|  hypothetical protein CARUB_v10024544mg             814   0.0      
ref|XP_006418233.1|  hypothetical protein EUTSA_v10009735mg             814   0.0      
ref|XP_007022466.1|  Uncharacterized protein isoform 2                  791   0.0      
emb|CAE03517.2|  OSJNBa0053K19.25                                       786   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAH66826.1|  OSIGBa0148A10.3                                        782   0.0      Oryza sativa [red rice]
gb|KGN44668.1|  hypothetical protein Csa_7G368200                       749   0.0      
ref|XP_002448559.1|  hypothetical protein SORBIDRAFT_06g029102          743   0.0      Sorghum bicolor [broomcorn]
gb|AAG51799.1|AC067754_15  hypothetical protein; 75067-63678            744   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CBI26624.3|  unnamed protein product                                713   0.0      
ref|XP_009767852.1|  PREDICTED: uncharacterized protein LOC104218...    649   0.0      
ref|XP_009767848.1|  PREDICTED: uncharacterized protein LOC104218...    644   0.0      
ref|XP_009767851.1|  PREDICTED: uncharacterized protein LOC104218...    642   0.0      
ref|XP_009767847.1|  PREDICTED: uncharacterized protein LOC104218...    641   0.0      
ref|XP_009767849.1|  PREDICTED: uncharacterized protein LOC104218...    637   0.0      
ref|XP_006858190.1|  hypothetical protein AMTR_s00062p00165700          686   0.0      
ref|XP_009767853.1|  PREDICTED: uncharacterized protein LOC104218...    608   0.0      
ref|XP_010436368.1|  PREDICTED: uncharacterized protein LOC104720098    613   0.0      
ref|XP_010438668.1|  PREDICTED: uncharacterized protein LOC104722226    568   2e-179   
ref|XP_010438666.1|  PREDICTED: uncharacterized protein LOC104722...    565   2e-178   
gb|EMT15404.1|  hypothetical protein F775_01717                         574   6e-168   
ref|XP_004980119.1|  PREDICTED: uncharacterized protein LOC101758221    566   2e-165   
ref|XP_009767854.1|  PREDICTED: uncharacterized protein LOC104218...    520   4e-165   
ref|XP_008345051.1|  PREDICTED: uncharacterized protein LOC103407956    500   5e-156   
ref|XP_006452312.1|  hypothetical protein CICLE_v100072361mg            511   3e-148   
ref|XP_010438667.1|  PREDICTED: uncharacterized protein LOC104722...    429   3e-130   
ref|XP_006452310.1|  hypothetical protein CICLE_v10007711mg             426   9e-128   
ref|XP_008668866.1|  PREDICTED: uncharacterized protein LOC103645921    394   2e-117   
ref|XP_006653786.1|  PREDICTED: uncharacterized protein LOC102722013    363   2e-106   
tpg|DAA35931.1|  TPA: hypothetical protein ZEAMMB73_902980              349   9e-102   
gb|EEC78054.1|  hypothetical protein OsI_17497                          350   2e-94    Oryza sativa Indica Group [Indian rice]
gb|KGN44665.1|  hypothetical protein Csa_7G368170                       321   1e-93    
ref|XP_010092142.1|  hypothetical protein L484_017831                   312   6e-92    
gb|EMS50591.1|  hypothetical protein TRIUR3_05504                       333   4e-89    
ref|XP_001756292.1|  predicted protein                                  296   2e-77    
ref|XP_006653787.1|  PREDICTED: uncharacterized protein LOC102722296    288   4e-75    
gb|EMT14380.1|  hypothetical protein F775_01479                         269   3e-69    
ref|XP_002976606.1|  hypothetical protein SELMODRAFT_443287             264   1e-67    
ref|XP_002973298.1|  hypothetical protein SELMODRAFT_442019             260   2e-66    
ref|XP_006575207.1|  PREDICTED: nucleolar pre-ribosomal-associate...    231   2e-65    
ref|NP_001053939.1|  Os04g0625300                                       196   5e-51    Oryza sativa Japonica Group [Japonica rice]
gb|EMT15403.1|  hypothetical protein F775_27504                         201   6e-51    
ref|XP_010278715.1|  PREDICTED: uncharacterized protein LOC104612823    191   4e-50    
ref|XP_002862159.1|  hypothetical protein ARALYDRAFT_359794             195   3e-48    
ref|XP_002448560.1|  hypothetical protein SORBIDRAFT_06g029102          145   2e-35    Sorghum bicolor [broomcorn]
ref|XP_006452303.1|  hypothetical protein CICLE_v10007833mg             144   5e-32    
tpg|DAA35930.1|  TPA: hypothetical protein ZEAMMB73_692446              144   6e-31    
ref|XP_006858194.1|  hypothetical protein AMTR_s00062p00168210          134   1e-30    
emb|CDH60529.1|  hypothetical protein RO3G_06036                        141   3e-30    
tpg|DAA43440.1|  TPA: hypothetical protein ZEAMMB73_622457              129   5e-30    
emb|CDS07405.1|  hypothetical protein LRAMOSA01354                      140   9e-30    
emb|CEF96522.1|  Nucleolar pre-ribosomal-associated protein 1, N-...    138   4e-29    
ref|XP_008604996.1|  hypothetical protein SDRG_01257                    137   6e-29    
ref|XP_003074141.1|  unnamed protein product                            137   6e-29    
gb|KDR11374.1|  Nucleolar pre-ribosomal-associated protein 1            137   7e-29    
gb|ERZ99138.1|  hypothetical protein GLOINDRAFT_9831                    135   8e-29    
gb|KDO34983.1|  hypothetical protein SPRG_01045                         136   1e-28    
gb|EXX68709.1|  Urb1p                                                   135   4e-28    
gb|ETO62692.1|  hypothetical protein F444_19426                         132   2e-27    
gb|ETP31921.1|  hypothetical protein F442_19245                         132   2e-27    
ref|XP_008879480.1|  hypothetical protein H310_13669                    132   2e-27    
ref|XP_008897378.1|  hypothetical protein PPTG_05546                    132   3e-27    
gb|ETI33903.1|  hypothetical protein F443_19474                         130   6e-27    
gb|ETK74261.1|  hypothetical protein L915_18892                         130   6e-27    
ref|XP_009517123.1|  hypothetical protein PHYSODRAFT_309991             130   7e-27    
gb|ETL80934.1|  hypothetical protein L917_18613                         130   7e-27    
gb|ETM34126.1|  hypothetical protein L914_18711                         130   8e-27    
ref|XP_003723889.1|  PREDICTED: nucleolar pre-ribosomal-associate...    127   7e-26    
ref|XP_005345403.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    127   1e-25    
ref|XP_006035756.1|  PREDICTED: nucleolar pre-ribosomal-associate...    126   2e-25    
ref|XP_005849166.1|  hypothetical protein CHLNCDRAFT_57419              125   4e-25    
ref|XP_003731583.1|  PREDICTED: nucleolar pre-ribosomal-associate...    122   5e-25    
ref|XP_003704945.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    124   6e-25    
ref|XP_001415404.1|  predicted protein                                  124   8e-25    Ostreococcus lucimarinus CCE9901
ref|XP_009841762.1|  hypothetical protein H257_15368                    124   8e-25    
ref|XP_006983601.1|  PREDICTED: nucleolar pre-ribosomal-associate...    123   1e-24    
ref|XP_006475169.1|  PREDICTED: uncharacterized protein LOC102615...    116   1e-24    
ref|XP_002907672.1|  conserved hypothetical protein                     122   3e-24    
gb|EZA54632.1|  Nucleolar pre-ribosomal-associated protein              122   3e-24    
ref|XP_005375723.1|  PREDICTED: nucleolar pre-ribosomal-associate...    122   3e-24    
gb|KFH73852.1|  hypothetical protein MVEG_01066                         122   4e-24    
ref|XP_006268321.1|  PREDICTED: nucleolar pre-ribosomal-associate...    121   4e-24    
ref|XP_005993684.1|  PREDICTED: nucleolar pre-ribosomal-associate...    121   4e-24    
ref|XP_003467321.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    121   6e-24    
ref|XP_010606933.1|  PREDICTED: nucleolar pre-ribosomal-associate...    120   8e-24    
ref|XP_010606934.1|  PREDICTED: nucleolar pre-ribosomal-associate...    120   8e-24    
ref|XP_010606935.1|  PREDICTED: nucleolar pre-ribosomal-associate...    120   9e-24    
ref|XP_010872252.1|  PREDICTED: nucleolar pre-ribosomal-associate...    120   1e-23    
ref|XP_005323593.1|  PREDICTED: nucleolar pre-ribosomal-associate...    120   1e-23    
gb|KFO54919.1|  Nucleolar pre-ribosomal-associated protein 1            120   1e-23    
ref|XP_008642871.1|  PREDICTED: nucleolar pre-ribosomal-associate...    119   2e-23    
ref|XP_010389699.1|  PREDICTED: nucleolar pre-ribosomal-associate...    119   2e-23    
ref|XP_006126117.1|  PREDICTED: nucleolar pre-ribosomal-associate...    119   2e-23    
ref|XP_006126118.1|  PREDICTED: nucleolar pre-ribosomal-associate...    119   2e-23    
ref|XP_004842340.1|  PREDICTED: nucleolar pre-ribosomal-associate...    119   2e-23    
ref|XP_010389697.1|  PREDICTED: nucleolar pre-ribosomal-associate...    119   2e-23    
ref|XP_006126119.1|  PREDICTED: nucleolar pre-ribosomal-associate...    119   2e-23    
ref|NP_001131087.1|  URB1 ribosome biogenesis 1 homolog                 119   3e-23    Xenopus tropicalis [western clawed frog]
gb|AFW84162.1|  hypothetical protein ZEAMMB73_733237                    114   3e-23    
gb|KFQ32136.1|  Nucleolar pre-ribosomal-associated protein 1            119   3e-23    
ref|XP_010139241.1|  PREDICTED: nucleolar pre-ribosomal-associate...    118   3e-23    
ref|XP_008941141.1|  PREDICTED: nucleolar pre-ribosomal-associate...    119   3e-23    
ref|XP_004645415.1|  PREDICTED: nucleolar pre-ribosomal-associate...    118   4e-23    
tpg|DAA43439.1|  TPA: hypothetical protein ZEAMMB73_622457              114   5e-23    
gb|ELW62043.1|  Nucleolar pre-ribosomal-associated protein 1            117   9e-23    
ref|XP_006153927.1|  PREDICTED: nucleolar pre-ribosomal-associate...    117   9e-23    
gb|KFP42806.1|  Nucleolar pre-ribosomal-associated protein 1            117   9e-23    
ref|XP_008925593.1|  PREDICTED: nucleolar pre-ribosomal-associate...    117   9e-23    
gb|KFO80793.1|  Nucleolar pre-ribosomal-associated protein 1            117   9e-23    
ref|XP_009870096.1|  PREDICTED: nucleolar pre-ribosomal-associate...    117   9e-23    
ref|XP_005073951.1|  PREDICTED: nucleolar pre-ribosomal-associate...    117   1e-22    
ref|XP_009565429.1|  PREDICTED: nucleolar pre-ribosomal-associate...    117   1e-22    
gb|EPB91763.1|  hypothetical protein HMPREF1544_01477                   117   1e-22    
ref|XP_009481221.1|  PREDICTED: nucleolar pre-ribosomal-associate...    117   1e-22    
gb|AAH73005.1|  LOC443605 protein                                       116   1e-22    Xenopus laevis [clawed frog]
ref|XP_005524223.1|  PREDICTED: nucleolar pre-ribosomal-associate...    117   1e-22    
ref|XP_010120490.1|  PREDICTED: nucleolar pre-ribosomal-associate...    117   1e-22    
gb|KFP90100.1|  Nucleolar pre-ribosomal-associated protein 1            116   1e-22    
ref|XP_005234439.1|  PREDICTED: nucleolar pre-ribosomal-associate...    117   1e-22    
ref|XP_009083738.1|  PREDICTED: nucleolar pre-ribosomal-associate...    116   1e-22    
ref|XP_005438671.1|  PREDICTED: nucleolar pre-ribosomal-associate...    116   2e-22    
ref|XP_009665948.1|  PREDICTED: nucleolar pre-ribosomal-associate...    116   2e-22    
ref|XP_006475167.1|  PREDICTED: uncharacterized protein LOC102615...    110   2e-22    
ref|XP_008288399.1|  PREDICTED: nucleolar pre-ribosomal-associate...    116   2e-22    
gb|KFV77599.1|  Nucleolar pre-ribosomal-associated protein 1            116   2e-22    
ref|XP_010172157.1|  PREDICTED: nucleolar pre-ribosomal-associate...    115   2e-22    
ref|XP_006475170.1|  PREDICTED: uncharacterized protein LOC102615...    109   2e-22    
ref|XP_009326288.1|  PREDICTED: nucleolar pre-ribosomal-associate...    115   3e-22    
gb|KFW69864.1|  Nucleolar pre-ribosomal-associated protein 1            115   3e-22    
ref|XP_006815971.1|  PREDICTED: uncharacterized protein LOC102805121    115   3e-22    
gb|KFV56845.1|  Nucleolar pre-ribosomal-associated protein 1            115   3e-22    
ref|XP_010002992.1|  PREDICTED: nucleolar pre-ribosomal-associate...    115   3e-22    
ref|XP_009969608.1|  PREDICTED: nucleolar pre-ribosomal-associate...    115   3e-22    
gb|KFU94949.1|  Nucleolar pre-ribosomal-associated protein 1            115   4e-22    
emb|CEG70256.1|  hypothetical protein RMATCC62417_06187                 115   4e-22    
emb|CEG70257.1|  hypothetical protein RMATCC62417_06187                 115   4e-22    
emb|CEG70255.1|  hypothetical protein RMATCC62417_06187                 115   4e-22    
ref|XP_009281220.1|  PREDICTED: nucleolar pre-ribosomal-associate...    115   4e-22    
emb|CAN66707.1|  hypothetical protein VITISV_025360                     114   4e-22    Vitis vinifera
ref|XP_010282741.1|  PREDICTED: nucleolar pre-ribosomal-associate...    115   4e-22    
gb|KFM09979.1|  Nucleolar pre-ribosomal-associated protein 1            115   4e-22    
ref|XP_005674802.1|  PREDICTED: nucleolar pre-ribosomal-associate...    115   4e-22    
gb|KFO92706.1|  Nucleolar pre-ribosomal-associated protein 1            115   4e-22    
gb|KGL87857.1|  Nucleolar pre-ribosomal-associated protein 1            115   5e-22    
ref|XP_010203274.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   5e-22    
gb|KFW07628.1|  Nucleolar pre-ribosomal-associated protein 1            114   5e-22    
ref|XP_004654497.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   5e-22    
gb|KFP28004.1|  Nucleolar pre-ribosomal-associated protein 1            114   5e-22    
ref|XP_009579184.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   5e-22    
ref|XP_009893225.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   6e-22    
ref|XP_005097584.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   6e-22    
ref|XP_007568680.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   6e-22    
ref|XP_008066646.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   6e-22    
gb|KFV13184.1|  Nucleolar pre-ribosomal-associated protein 1            114   7e-22    
ref|XP_005283998.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   7e-22    
ref|XP_009289746.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   7e-22    
ref|XP_010079306.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   7e-22    
gb|KFR09721.1|  Nucleolar pre-ribosomal-associated protein 1            114   8e-22    
ref|XP_008424553.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   8e-22    
ref|XP_005013907.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   8e-22    
gb|KFV50204.1|  Nucleolar pre-ribosomal-associated protein 1            114   9e-22    
ref|XP_009931656.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   1e-21    
ref|XP_009805877.1|  PREDICTED: nucleolar pre-ribosomal-associate...    113   1e-21    
ref|XP_005431000.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   1e-21    
ref|XP_007424576.1|  PREDICTED: nucleolar pre-ribosomal-associate...    114   1e-21    
ref|XP_007424577.1|  PREDICTED: nucleolar pre-ribosomal-associate...    113   1e-21    
gb|KFP17724.1|  Nucleolar pre-ribosomal-associated protein 1            113   1e-21    
ref|XP_002507617.1|  predicted protein                                  112   1e-21    Micromonas commoda
ref|XP_009639190.1|  PREDICTED: nucleolar pre-ribosomal-associate...    113   1e-21    
ref|XP_007519795.1|  PREDICTED: nucleolar pre-ribosomal-associate...    113   1e-21    
dbj|BAD90144.1|  mKIAA0539 protein                                      113   1e-21    Mus musculus [mouse]
gb|EKC23523.1|  Nucleolar pre-ribosomal-associated protein 1            113   2e-21    
ref|XP_006523040.1|  PREDICTED: nucleolar pre-ribosomal-associate...    113   2e-21    
gb|KFP86629.1|  Nucleolar pre-ribosomal-associated protein 1            113   2e-21    
ref|XP_010583629.1|  PREDICTED: nucleolar pre-ribosomal-associate...    113   2e-21    
ref|XP_009079096.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    112   2e-21    
sp|Q571H0.2|NPA1P_MOUSE  RecName: Full=Nucleolar pre-ribosomal-as...    112   2e-21    Mus musculus [mouse]
gb|EDL03850.1|  mCG115615, isoform CRA_a                                112   2e-21    
ref|NP_083773.1|  nucleolar pre-ribosomal-associated protein 1          112   2e-21    Mus musculus [mouse]
emb|CEG79694.1|  hypothetical protein RMATCC62417_14129                 112   2e-21    
gb|KFQ15269.1|  Nucleolar pre-ribosomal-associated protein 1            112   2e-21    
ref|XP_010181519.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   2e-21    
ref|XP_003968685.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   2e-21    
ref|XP_005061819.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   2e-21    
ref|XP_005151844.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   3e-21    
ref|XP_010336627.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   3e-21    
ref|XP_009955891.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   3e-21    
ref|XP_007100660.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   3e-21    
gb|KFR06914.1|  Nucleolar pre-ribosomal-associated protein 1            112   3e-21    
ref|XP_003640527.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   4e-21    
ref|XP_009905702.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   4e-21    
ref|XP_005511570.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   4e-21    
ref|XP_009471824.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   4e-21    
ref|XP_004075583.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   4e-21    
ref|XP_005926537.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   4e-21    
ref|XP_005926536.1|  PREDICTED: nucleolar pre-ribosomal-associate...    112   4e-21    
gb|ERE76713.1|  nucleolar pre-ribosomal-associated protein 1            111   5e-21    
ref|XP_005736055.1|  PREDICTED: nucleolar pre-ribosomal-associate...    111   5e-21    
ref|XP_010783400.1|  PREDICTED: nucleolar pre-ribosomal-associate...    107   6e-21    
ref|XP_007619340.1|  PREDICTED: nucleolar pre-ribosomal-associate...    111   7e-21    
ref|XP_006810466.1|  PREDICTED: nucleolar pre-ribosomal-associate...    110   8e-21    
ref|XP_004891907.1|  PREDICTED: nucleolar pre-ribosomal-associate...    110   8e-21    
gb|EFN81907.1|  Nucleolar pre-ribosomal-associated protein 1            110   8e-21    
ref|XP_005796930.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    110   8e-21    
emb|CAH18579.1|  human mRNA for KIAA0539 protein                        109   9e-21    
ref|XP_002830680.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    110   9e-21    
ref|NP_055640.2|  nucleolar pre-ribosomal-associated protein 1          110   9e-21    
ref|XP_011060059.1|  PREDICTED: nucleolar pre-ribosomal-associate...    110   1e-20    
dbj|BAA25465.2|  KIAA0539 protein                                       110   1e-20    
gb|EDM10694.1|  rCG58772, isoform CRA_a                                 110   1e-20    
ref|XP_008984813.1|  PREDICTED: nucleolar pre-ribosomal-associate...    110   1e-20    
gb|AAF72943.1|  C21orf108                                               110   1e-20    
ref|XP_531425.3|  PREDICTED: nucleolar pre-ribosomal-associated p...    110   2e-20    
ref|XP_007939478.1|  PREDICTED: nucleolar pre-ribosomal-associate...    110   2e-20    
ref|XP_003824049.1|  PREDICTED: nucleolar pre-ribosomal-associate...    109   2e-20    
gb|KFM73003.1|  Nucleolar pre-ribosomal-associated protein 1            106   2e-20    
ref|XP_004062759.1|  PREDICTED: nucleolar pre-ribosomal-associate...    109   2e-20    
ref|XP_009200629.1|  PREDICTED: nucleolar pre-ribosomal-associate...    109   2e-20    
ref|XP_009200628.1|  PREDICTED: nucleolar pre-ribosomal-associate...    109   2e-20    
ref|XP_010155068.1|  PREDICTED: nucleolar pre-ribosomal-associate...    107   2e-20    
ref|XP_010212117.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    109   2e-20    
ref|NP_001178590.1|  nucleolar pre-ribosomal-associated protein 1       109   2e-20    
ref|XP_003895584.1|  PREDICTED: nucleolar pre-ribosomal-associate...    109   3e-20    
gb|ELK04493.1|  Nucleolar pre-ribosomal-associated protein 1            109   3e-20    
ref|XP_007969865.1|  PREDICTED: nucleolar pre-ribosomal-associate...    109   3e-20    
ref|XP_006921477.1|  PREDICTED: nucleolar pre-ribosomal-associate...    109   3e-20    
ref|XP_008494927.1|  PREDICTED: nucleolar pre-ribosomal-associate...    108   3e-20    
gb|KFP03074.1|  Nucleolar pre-ribosomal-associated protein 1            108   3e-20    
ref|XP_007070795.1|  PREDICTED: nucleolar pre-ribosomal-associate...    108   3e-20    
ref|XP_008834202.1|  PREDICTED: nucleolar pre-ribosomal-associate...    108   3e-20    
ref|XP_010357111.1|  PREDICTED: nucleolar pre-ribosomal-associate...    108   3e-20    
ref|XP_010588730.1|  PREDICTED: nucleolar pre-ribosomal-associate...    108   4e-20    
ref|XP_006110123.1|  PREDICTED: LOW QUALITY PROTEIN: URB1 ribosom...    108   4e-20    
gb|EMC90413.1|  Nucleolar pre-ribosomal-associated protein 1            108   4e-20    
ref|XP_007100661.1|  PREDICTED: nucleolar pre-ribosomal-associate...    108   6e-20    
gb|EMP25445.1|  Nucleolar pre-ribosomal-associated protein 1            108   6e-20    
ref|XP_005548883.1|  PREDICTED: nucleolar pre-ribosomal-associate...    108   6e-20    
ref|XP_004560638.1|  PREDICTED: nucleolar pre-ribosomal-associate...    108   6e-20    
ref|XP_007183757.1|  PREDICTED: nucleolar pre-ribosomal-associate...    107   7e-20    
ref|XP_009913283.1|  PREDICTED: nucleolar pre-ribosomal-associate...    106   7e-20    
gb|EHH51901.1|  URB1 ribosome biogenesis 1-like protein                 107   8e-20    
ref|XP_009509297.1|  PREDICTED: nucleolar pre-ribosomal-associate...    105   9e-20    
ref|XP_003763486.1|  PREDICTED: nucleolar pre-ribosomal-associate...    107   9e-20    
ref|XP_010014259.1|  PREDICTED: nucleolar pre-ribosomal-associate...    105   9e-20    
ref|XP_004313843.1|  PREDICTED: nucleolar pre-ribosomal-associate...    107   1e-19    
gb|KFV73213.1|  Nucleolar pre-ribosomal-associated protein 1            107   1e-19    
ref|XP_009696050.1|  PREDICTED: nucleolar pre-ribosomal-associate...    105   1e-19    
ref|XP_004364094.1|  predicted protein                                  107   1e-19    
ref|XP_003797152.1|  PREDICTED: nucleolar pre-ribosomal-associate...    107   1e-19    
ref|XP_004711382.1|  PREDICTED: nucleolar pre-ribosomal-associate...    107   1e-19    
ref|XP_006862589.1|  PREDICTED: nucleolar pre-ribosomal-associate...    106   1e-19    
ref|XP_003263815.1|  PREDICTED: nucleolar pre-ribosomal-associate...    106   2e-19    
ref|XP_005638889.1|  PREDICTED: nucleolar pre-ribosomal-associate...    106   2e-19    
ref|XP_004675404.1|  PREDICTED: nucleolar pre-ribosomal-associate...    106   2e-19    
ref|XP_005638888.1|  PREDICTED: nucleolar pre-ribosomal-associate...    106   2e-19    
ref|XP_544859.2|  PREDICTED: nucleolar pre-ribosomal-associated p...    106   2e-19    
ref|XP_009018294.1|  hypothetical protein HELRODRAFT_191944             105   2e-19    
ref|XP_003450230.1|  PREDICTED: nucleolar pre-ribosomal-associate...    106   2e-19    
ref|XP_007640509.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    106   2e-19    
gb|EZA45049.1|  Ribosome 60S biogenesis N-terminal domain-contain...    105   3e-19    
ref|XP_008105812.1|  PREDICTED: nucleolar pre-ribosomal-associate...    105   3e-19    
ref|XP_008209600.1|  PREDICTED: nucleolar pre-ribosomal-associate...    105   4e-19    
ref|XP_008550096.1|  PREDICTED: uncharacterized protein LOC103573023    105   4e-19    
ref|XP_008105811.1|  PREDICTED: nucleolar pre-ribosomal-associate...    105   5e-19    
ref|XP_010955140.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    104   9e-19    
ref|XP_010989931.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    104   9e-19    
ref|XP_006187583.1|  PREDICTED: nucleolar pre-ribosomal-associate...    104   9e-19    
ref|XP_002716742.1|  PREDICTED: nucleolar pre-ribosomal-associate...    103   1e-18    
gb|EQB78512.1|  nucleolar pre-ribosomal-associated protein 1            103   1e-18    
ref|XP_007901740.1|  PREDICTED: nucleolar pre-ribosomal-associate...    103   1e-18    
ref|XP_007447489.1|  PREDICTED: nucleolar pre-ribosomal-associate...    103   1e-18    
ref|XP_004588677.1|  PREDICTED: nucleolar pre-ribosomal-associate...    103   1e-18    
ref|XP_007493354.1|  PREDICTED: nucleolar pre-ribosomal-associate...    103   1e-18    
gb|ELU10398.1|  hypothetical protein CAPTEDRAFT_219734                  103   2e-18    
ref|XP_003399988.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    103   2e-18    
gb|EIE81331.1|  hypothetical protein RO3G_06036                         103   2e-18    
ref|XP_006216094.1|  PREDICTED: nucleolar pre-ribosomal-associate...    103   2e-18    
ref|XP_004387045.1|  PREDICTED: nucleolar pre-ribosomal-associate...    102   2e-18    
ref|XP_004468710.1|  PREDICTED: nucleolar pre-ribosomal-associate...    102   3e-18    
ref|XP_004757559.1|  PREDICTED: nucleolar pre-ribosomal-associate...    102   4e-18    
ref|XP_004786163.1|  PREDICTED: nucleolar pre-ribosomal-associate...    102   4e-18    
emb|CAG09031.1|  unnamed protein product                                102   4e-18    
ref|XP_007090541.1|  PREDICTED: nucleolar pre-ribosomal-associate...    101   5e-18    
gb|EHH17017.1|  URB1 ribosome biogenesis 1-like protein                 101   5e-18    
ref|XP_003493722.1|  PREDICTED: nucleolar pre-ribosomal-associate...    101   6e-18    
ref|XP_006935983.1|  PREDICTED: nucleolar pre-ribosomal-associate...    101   7e-18    
ref|XP_008575455.1|  PREDICTED: nucleolar pre-ribosomal-associate...    101   8e-18    
ref|XP_010721557.1|  PREDICTED: nucleolar pre-ribosomal-associate...    100   8e-18    
ref|XP_003695243.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    100   8e-18    
ref|XP_008307557.1|  PREDICTED: nucleolar pre-ribosomal-associate...    100   1e-17    
ref|XP_002110588.1|  predicted protein                                  100   1e-17    
ref|XP_005961161.1|  PREDICTED: nucleolar pre-ribosomal-associate...    100   1e-17    
gb|KFD71585.1|  hypothetical protein M514_05296                         100   1e-17    
gb|KFD53790.1|  hypothetical protein M513_05296                         100   1e-17    
gb|KHJ42181.1|  hypothetical protein D918_07713                         100   1e-17    
ref|XP_009858818.1|  PREDICTED: nucleolar pre-ribosomal-associate...    100   2e-17    
ref|XP_005606183.1|  PREDICTED: nucleolar pre-ribosomal-associate...  99.8    2e-17    
gb|EHB07610.1|  Nucleolar pre-ribosomal-associated protein 1          99.4    3e-17    
ref|XP_004003790.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  99.4    3e-17    
ref|XP_006567050.1|  PREDICTED: uncharacterized protein LOC726580     99.0    3e-17    
ref|XP_004620404.1|  PREDICTED: nucleolar pre-ribosomal-associate...  99.4    3e-17    
ref|XP_001498726.2|  PREDICTED: nucleolar pre-ribosomal-associate...  99.0    3e-17    
ref|XP_004264694.1|  PREDICTED: nucleolar pre-ribosomal-associate...  99.0    3e-17    
ref|XP_006612032.1|  PREDICTED: uncharacterized protein LOC102671654  98.6    4e-17    
gb|EPZ31419.1|  Nucleolar pre-ribosomal-associated protein 1 doma...  98.6    4e-17    
ref|XP_006044877.1|  PREDICTED: nucleolar pre-ribosomal-associate...  98.6    5e-17    
ref|XP_010860606.1|  PREDICTED: nucleolar pre-ribosomal-associate...  98.6    5e-17    
ref|XP_010860605.1|  PREDICTED: nucleolar pre-ribosomal-associate...  98.2    6e-17    
ref|XP_004406366.1|  PREDICTED: nucleolar pre-ribosomal-associate...  97.8    7e-17    
ref|XP_009050748.1|  hypothetical protein LOTGIDRAFT_174169           97.8    9e-17    
ref|XP_004429749.1|  PREDICTED: nucleolar pre-ribosomal-associate...  97.4    1e-16    
ref|XP_006680083.1|  hypothetical protein BATDEDRAFT_89917            97.4    1e-16    
emb|CDW54706.1|  nucleolar pre ribosomal associated protein           97.1    1e-16    
ref|NP_001192909.1|  nucleolar pre-ribosomal-associated protein 1     97.1    1e-16    
gb|EFB23564.1|  hypothetical protein PANDA_019558                     97.1    2e-16    
ref|XP_002929391.1|  PREDICTED: nucleolar pre-ribosomal-associate...  96.7    2e-16    
gb|AFW73378.1|  hypothetical protein ZEAMMB73_864304                  88.6    2e-16    
gb|EFN70096.1|  Nucleolar pre-ribosomal-associated protein 1          96.7    2e-16    
ref|XP_001847938.1|  conserved hypothetical protein                   96.7    2e-16    
gb|EGU11112.1|  hypothetical protein RTG_02912                        96.3    2e-16    
ref|XP_007240944.1|  PREDICTED: nucleolar pre-ribosomal-associate...  96.3    2e-16    
ref|XP_008700170.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  95.1    5e-16    
ref|XP_004995422.1|  hypothetical protein PTSG_03695                  94.4    8e-16    
ref|XP_010299836.1|  PREDICTED: nucleolar pre-ribosomal-associate...  92.8    1e-15    
gb|KDE02566.1|  hypothetical protein MVLG_06882                       92.8    2e-15    
ref|XP_005893401.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  92.8    3e-15    
ref|XP_001582919.1|  hypothetical protein                             92.4    3e-15    
ref|XP_004520303.1|  PREDICTED: uncharacterized protein LOC101462025  92.4    3e-15    
ref|XP_005185290.1|  PREDICTED: uncharacterized protein LOC101887909  92.0    4e-15    
gb|KFB50221.1|  hypothetical protein ZHAS_00018291                    92.0    4e-15    
ref|XP_005648198.1|  hypothetical protein COCSUDRAFT_41829            92.0    5e-15    
ref|XP_007005205.1|  hypothetical protein TREMEDRAFT_73980            91.3    8e-15    
ref|XP_004923992.1|  PREDICTED: uncharacterized protein LOC101747067  90.5    1e-14    
ref|XP_011060061.1|  PREDICTED: nucleolar pre-ribosomal-associate...  89.7    2e-14    
ref|XP_007371486.1|  hypothetical protein DICSQDRAFT_184195           89.7    2e-14    
ref|XP_003380525.1|  putative nucleolar pre-ribosomal-associated ...  89.0    4e-14    
gb|EMS19809.1|  transcription coactivator, histone acetyltransferase  88.6    5e-14    
ref|XP_009066386.1|  hypothetical protein LOTGIDRAFT_176277           84.3    5e-14    
ref|XP_001993909.1|  GH18486                                          88.2    6e-14    
ref|XP_001358721.2|  GA11665                                          88.2    7e-14    
ref|XP_007862685.1|  hypothetical protein GLOTRDRAFT_136566           87.4    1e-13    
ref|XP_001982278.1|  GG12515                                          87.0    1e-13    
ref|XP_002637250.1|  Hypothetical protein CBG18929                    85.5    1e-13    
emb|CBK23617.2|  unnamed protein product                              86.7    2e-13    
emb|CAP36258.2|  Protein CBG18929                                     85.1    2e-13    
ref|XP_002098288.1|  GE24038                                          86.3    3e-13    
ref|NP_651044.1|  CG12499                                             85.9    3e-13    
ref|XP_002058397.1|  GJ14390                                          85.9    3e-13    
gb|EJT99629.1|  hypothetical protein DACRYDRAFT_95959                 85.9    4e-13    
ref|XP_004367926.1|  hypothetical protein ACA1_288930                 85.9    4e-13    
ref|XP_002032199.1|  GM23650                                          84.3    5e-13    
ref|XP_002001439.1|  GI10793                                          85.5    5e-13    
ref|XP_007656790.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  85.1    5e-13    
ref|XP_001743766.1|  hypothetical protein                             85.1    6e-13    
emb|CDO76370.1|  hypothetical protein BN946_scf185011.g34             84.7    9e-13    
ref|XP_006457598.1|  hypothetical protein AGABI2DRAFT_123450          84.0    1e-12    
ref|XP_007333213.1|  hypothetical protein AGABI1DRAFT_45430           82.8    3e-12    
ref|XP_001660291.1|  hypothetical protein AaeL_AAEL009662             82.4    4e-12    
ref|XP_007874786.1|  hypothetical protein PNEG_02755                  82.0    5e-12    
ref|XP_007388479.1|  hypothetical protein PUNSTDRAFT_146557           81.6    6e-12    
gb|ENN76448.1|  hypothetical protein YQE_06902                        81.6    7e-12    
ref|XP_006753188.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...  81.3    8e-12    
gb|EHJ74435.1|  hypothetical protein KGM_17430                        80.5    1e-11    
ref|XP_657841.1|  hypothetical protein AN0237.2                       80.5    1e-11    
gb|ELK38277.1|  Nucleolar pre-ribosomal-associated protein 1          80.5    1e-11    
gb|EYC01702.1|  hypothetical protein Y032_0105g3694                   79.0    1e-11    
gb|ELU36765.1|  hypothetical protein AG1IA_09205                      77.0    1e-11    
gb|KDO62635.1|  hypothetical protein CISIN_1g0000572mg                73.2    2e-11    
emb|CAN80492.1|  hypothetical protein VITISV_042680                   76.3    2e-11    
ref|XP_002069763.1|  GK11397                                          79.7    2e-11    
gb|AFW73379.1|  hypothetical protein ZEAMMB73_864304                  79.3    2e-11    
gb|EGO04208.1|  hypothetical protein SERLA73DRAFT_100441              79.3    3e-11    
ref|XP_007312032.1|  hypothetical protein SERLADRAFT_444262           79.3    3e-11    
ref|XP_003112333.1|  hypothetical protein CRE_31126                   78.2    3e-11    
ref|XP_008035903.1|  hypothetical protein TRAVEDRAFT_117828           79.3    3e-11    
ref|XP_005834036.1|  hypothetical protein GUITHDRAFT_106970           74.7    5e-11    
ref|XP_007878141.1|  hypothetical protein PFL1_02433                  78.2    8e-11    
ref|XP_005496603.1|  PREDICTED: nucleolar pre-ribosomal-associate...  77.8    1e-10    
ref|XP_010734665.1|  PREDICTED: nucleolar pre-ribosomal-associate...  77.4    1e-10    
ref|NP_587943.2|  ribosome biogenesis protein Urb1 (predicted)        77.0    1e-10    
dbj|GAA99026.1|  hypothetical protein E5Q_05715                       77.0    1e-10    
emb|CDQ04437.1|  Protein Bm5598                                       75.9    2e-10    
ref|XP_009269831.1|  hypothetical protein J056_001928                 77.0    2e-10    
ref|XP_007767665.1|  hypothetical protein CONPUDRAFT_143472           76.6    2e-10    
ref|XP_001401000.1|  ribosome biogenesis protein Urb1                 76.3    2e-10    
gb|EHA27827.1|  hypothetical protein ASPNIDRAFT_184611                75.9    3e-10    
ref|NP_504629.1|  Protein T05H4.10                                    74.3    4e-10    
ref|XP_007022440.1|  Uncharacterized protein TCM_032898               72.0    4e-10    
gb|EGT47154.1|  hypothetical protein CAEBREN_20330                    73.9    5e-10    
gb|KDQ28726.1|  hypothetical protein PLEOSDRAFT_1063525               75.5    5e-10    
ref|XP_001868235.1|  conserved hypothetical protein                   75.1    6e-10    
ref|XP_003748502.1|  PREDICTED: uncharacterized protein LOC100903630  75.1    7e-10    
gb|KEP52900.1|  ribosome 60S biogenesis amino-terminal protein        74.7    8e-10    
ref|XP_008144034.1|  PREDICTED: nucleolar pre-ribosomal-associate...  74.7    8e-10    
dbj|BAE66310.1|  unnamed protein product                              73.2    2e-09    
gb|ERL89734.1|  hypothetical protein D910_07095                       69.7    2e-09    
ref|XP_002384647.1|  ribosome biogenesis protein Urb1, putative       73.2    2e-09    
ref|XP_001827443.2|  ribosome biogenesis protein Urb1                 73.2    2e-09    
gb|KDQ65157.1|  hypothetical protein JAAARDRAFT_75487                 73.2    2e-09    
ref|XP_007391566.1|  hypothetical protein PHACADRAFT_169452           73.2    3e-09    
gb|EPS95224.1|  hypothetical protein FOMPIDRAFT_50425                 72.8    4e-09    
ref|XP_001216262.1|  conserved hypothetical protein                   72.4    4e-09    
gb|KDN46833.1|  hypothetical protein RSAG8_03910                      71.6    4e-09    
dbj|GAA90809.1|  ribosome biogenesis protein Urb1                     72.0    4e-09    
ref|XP_003026614.1|  hypothetical protein SCHCODRAFT_114329           72.4    4e-09    
gb|AFW77142.1|  hypothetical protein ZEAMMB73_506191                  72.0    5e-09    
gb|KIH57534.1|  hypothetical protein ANCDUO_12273                     70.5    6e-09    
gb|EMD38681.1|  hypothetical protein CERSUDRAFT_94218                 72.0    6e-09    
ref|XP_002835576.1|  hypothetical protein                             71.2    6e-09    
ref|XP_009544297.1|  hypothetical protein HETIRDRAFT_433391           70.9    1e-08    
emb|CCX08357.1|  Similar to Uncharacterized protein C14G10.02; ac...  70.9    1e-08    
ref|XP_001839472.1|  hypothetical protein CC1G_06685                  70.9    1e-08    
ref|XP_005709879.1|  unnamed protein product                          70.5    2e-08    
ref|XP_002475008.1|  predicted protein                                70.5    2e-08    



>ref|XP_009595739.1| PREDICTED: uncharacterized protein LOC104091985 isoform X6 [Nicotiana 
tomentosiformis]
Length=2568

 Score =  1709 bits (4427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 911/1636 (56%), Positives = 1182/1636 (72%), Gaps = 20/1636 (1%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM +FF EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  944   EIIQNFPLIMSVSNKLLGVPLSLLMQLFFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  1003

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S A S+FL  A   +LFP  L I   DLS Q GL NL +A LSE T
Sbjct  1004  RTMDCSVISSMDNKSNAFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLFMAKLSEET  1063

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++    T
Sbjct  1064  SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCGLDT  1123

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+D+F+ES K  V  KM
Sbjct  1124  FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIKDSVDQFVESAKLEV-SKM  1182

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC  Q SS E  HA + V  +FKNVV KL + FK + ++C++S
Sbjct  1183  DHHVHNLLKATSELWLSFCHSQGSSSEVYHANKHVISSFKNVVNKLVMAFKQKMNECMKS  1242

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  1243  KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  1299

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M QPH + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVAD+CLL
Sbjct  1300  SAFSHLAANMQQPHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADICLL  1358

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1359  KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITKRKAEILFLVADISPLH  1418

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ++LMLLPTV LYL+S+  K G Q+    
Sbjct  1419  LSVFGKLFSDMMNKYVAVKSCAVQQICGYSDEDMLMLLPTVILYLNSIPSKFGGQLCMLH  1478

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+ QL
Sbjct  1479  ENIVSFYWGILKQGFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVAQL  1536

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + RM +F+SVC  + +  D L+FD +Q G  S+E+SLN VNRTV KI L
Sbjct  1537  FFELRGDLVNVKKRMSIFNSVCSSEYS--DLLEFDLTQDGAYSVEESLNVVNRTVTKIRL  1594

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV SW+ IV++  +   + 
Sbjct  1595  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQSWQLIVKRCSLNVVDF  1654

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+EV +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DP TL
Sbjct  1655  SQIEVGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPTTL  1714

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS +S G S  GL FTPLPS+MRS+
Sbjct  1715  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIHSSPISAGHSHFGLIFTPLPSIMRSY  1774

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1775  V-PCIDQDALDLKDNFKLSEERARQLELVKLLKLLFQIRAQQCDIDNVKDIGINLRELVF  1833

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EIKS +D    S+A+ D+LW +A++K RKE ELVQT+S
Sbjct  1834  LLLSSYGASMSAIDLEIYSLLDEIKSANDLDEESMAKLDFLWSSALLKVRKENELVQTLS  1893

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +D R+I FREN+PIDPK CA+TVLYFPY R  G G+  K + D  D  +  
Sbjct  1894  RNLSEAEAVDDYRRIHFRENIPIDPKFCATTVLYFPYDRTVGAGIHRKPETDNPDFRYAV  1953

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1954  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  2013

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LEKCQK+KDVMRL+LL+SYLQN IEE WQKI S+TA+F+AEASFVLLDPSHD
Sbjct  2014  VLGRFKSTLEKCQKRKDVMRLRLLMSYLQNGIEEPWQKISSITAVFVAEASFVLLDPSHD  2073

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+ +LM+SPS N+K IPLF N  WS S +F  ERLWILR+LYSGLN +DD  IYIR
Sbjct  2074  HYSAISAYLMRSPSANMKGIPLFHNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIR  2133

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N+IFETLLSFYVSP++ +ESKELI+Q VKKS  + +MAR+L+E CGLISW S V++S   
Sbjct  2134  NAIFETLLSFYVSPISSHESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVISS---  2190

Query  3771  IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQML  3950
             + +   +   F +  V+LE +NE+I  RHT+EW+QKYALEQL ELSC+L ++LVE  +  
Sbjct  2191  LSWSPCRRDSFVELTVILEALNEVILSRHTIEWMQKYALEQLVELSCNLYKMLVERVETF  2250

Query  3951  KEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTG  4130
             K  +   KLILQI+T   K+SQKRKVYQPHF +S+E L  LCE +D CC+G  SP+A+  
Sbjct  2251  KGKTQLVKLILQIVTSALKISQKRKVYQPHFNISIESLLQLCEVVDECCDGRQSPVAQIA  2310

Query  4131  LEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETEN  4310
             LEA+LMSTPPV ILQMD +KVSKF+ WA  IALQ + + +   E     + + +E+ET++
Sbjct  2311  LEAVLMSTPPVNILQMDKEKVSKFVRWATLIALQPKIENIHGPENFACIVRLQAEKETDD  2370

Query  4311  SLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFAC  4490
             SLISKL+RWL ASVI+GK+S + S  D  HS DRSKL NL  ++EWNE+   E  + FAC
Sbjct  2371  SLISKLVRWLAASVIVGKLSLRFSNSDLCHSFDRSKLNNLLSMMEWNEKRCEETNRAFAC  2430

Query  4491  QEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIR  4661
             +  LA SIF+LQQL  T++ +LPS VSAL LLLL + +S+ +++L G+A   A LCSKI 
Sbjct  2431  EGTLALSIFFLQQLQCTNYIVLPSVVSALSLLLLSSLSSAETDILAGDAVQLATLCSKIN  2490

Query  4662  CPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLK  4841
             CPAEAN AWRWSFYQPWKDHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +
Sbjct  2491  CPAEANPAWRWSFYQPWKDHSSELTDAEKLEENQACEMLLVVISKLLGRNSLYSQFFSFQ  2550

Query  4842  DVEKLGVFEWERSILN  4889
             D+EKL VF+WERSILN
Sbjct  2551  DLEKLCVFDWERSILN  2566



>ref|XP_009595735.1| PREDICTED: uncharacterized protein LOC104091985 isoform X2 [Nicotiana 
tomentosiformis]
Length=2582

 Score =  1709 bits (4425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 911/1643 (55%), Positives = 1183/1643 (72%), Gaps = 20/1643 (1%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM +FF EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  944   EIIQNFPLIMSVSNKLLGVPLSLLMQLFFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  1003

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S A S+FL  A   +LFP  L I   DLS Q GL NL +A LSE T
Sbjct  1004  RTMDCSVISSMDNKSNAFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLFMAKLSEET  1063

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++    T
Sbjct  1064  SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCGLDT  1123

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+D+F+ES K  V  KM
Sbjct  1124  FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIKDSVDQFVESAKLEV-SKM  1182

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC  Q SS E  HA + V  +FKNVV KL + FK + ++C++S
Sbjct  1183  DHHVHNLLKATSELWLSFCHSQGSSSEVYHANKHVISSFKNVVNKLVMAFKQKMNECMKS  1242

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  1243  KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  1299

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M QPH + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVAD+CLL
Sbjct  1300  SAFSHLAANMQQPHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADICLL  1358

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1359  KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITKRKAEILFLVADISPLH  1418

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ++LMLLPTV LYL+S+  K G Q+    
Sbjct  1419  LSVFGKLFSDMMNKYVAVKSCAVQQICGYSDEDMLMLLPTVILYLNSIPSKFGGQLCMLH  1478

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+ QL
Sbjct  1479  ENIVSFYWGILKQGFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVAQL  1536

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + RM +F+SVC  + +  D L+FD +Q G  S+E+SLN VNRTV KI L
Sbjct  1537  FFELRGDLVNVKKRMSIFNSVCSSEYS--DLLEFDLTQDGAYSVEESLNVVNRTVTKIRL  1594

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV SW+ IV++  +   + 
Sbjct  1595  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQSWQLIVKRCSLNVVDF  1654

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+EV +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DP TL
Sbjct  1655  SQIEVGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPTTL  1714

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS +S G S  GL FTPLPS+MRS+
Sbjct  1715  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIHSSPISAGHSHFGLIFTPLPSIMRSY  1774

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1775  V-PCIDQDALDLKDNFKLSEERARQLELVKLLKLLFQIRAQQCDIDNVKDIGINLRELVF  1833

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EIKS +D    S+A+ D+LW +A++K RKE ELVQT+S
Sbjct  1834  LLLSSYGASMSAIDLEIYSLLDEIKSANDLDEESMAKLDFLWSSALLKVRKENELVQTLS  1893

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +D R+I FREN+PIDPK CA+TVLYFPY R  G G+  K + D  D  +  
Sbjct  1894  RNLSEAEAVDDYRRIHFRENIPIDPKFCATTVLYFPYDRTVGAGIHRKPETDNPDFRYAV  1953

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1954  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  2013

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LEKCQK+KDVMRL+LL+SYLQN IEE WQKI S+TA+F+AEASFVLLDPSHD
Sbjct  2014  VLGRFKSTLEKCQKRKDVMRLRLLMSYLQNGIEEPWQKISSITAVFVAEASFVLLDPSHD  2073

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+ +LM+SPS N+K IPLF N  WS S +F  ERLWILR+LYSGLN +DD  IYIR
Sbjct  2074  HYSAISAYLMRSPSANMKGIPLFHNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIR  2133

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N+IFETLLSFYVSP++ +ESKELI+Q VKKS  + +MAR+L+E CGLISW S V++S   
Sbjct  2134  NAIFETLLSFYVSPISSHESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVISS---  2190

Query  3771  IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQML  3950
             + +   +   F +  V+LE +NE+I  RHT+EW+QKYALEQL ELSC+L ++LVE  +  
Sbjct  2191  LSWSPCRRDSFVELTVILEALNEVILSRHTIEWMQKYALEQLVELSCNLYKMLVERVETF  2250

Query  3951  KEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTG  4130
             K  +   KLILQI+T   K+SQKRKVYQPHF +S+E L  LCE +D CC+G  SP+A+  
Sbjct  2251  KGKTQLVKLILQIVTSALKISQKRKVYQPHFNISIESLLQLCEVVDECCDGRQSPVAQIA  2310

Query  4131  LEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETEN  4310
             LEA+LMSTPPV ILQMD +KVSKF+ WA  IALQ + + +   E     + + +E+ET++
Sbjct  2311  LEAVLMSTPPVNILQMDKEKVSKFVRWATLIALQPKIENIHGPENFACIVRLQAEKETDD  2370

Query  4311  SLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFAC  4490
             SLISKL+RWL ASVI+GK+S + S  D  HS DRSKL NL  ++EWNE+   E  + FAC
Sbjct  2371  SLISKLVRWLAASVIVGKLSLRFSNSDLCHSFDRSKLNNLLSMMEWNEKRCEETNRAFAC  2430

Query  4491  QEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIR  4661
             +  LA SIF+LQQL  T++ +LPS VSAL LLLL + +S+ +++L G+A   A LCSKI 
Sbjct  2431  EGTLALSIFFLQQLQCTNYIVLPSVVSALSLLLLSSLSSAETDILAGDAVQLATLCSKIN  2490

Query  4662  CPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLK  4841
             CPAEAN AWRWSFYQPWKDHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +
Sbjct  2491  CPAEANPAWRWSFYQPWKDHSSELTDAEKLEENQACEMLLVVISKLLGRNSLYSQFFSFQ  2550

Query  4842  DVEKLGVFEWERSILNLNHV*LH  4910
             D+EKL VF+WER+   L  V LH
Sbjct  2551  DLEKLCVFDWERTTTALPEVHLH  2573



>ref|XP_009595738.1| PREDICTED: uncharacterized protein LOC104091985 isoform X5 [Nicotiana 
tomentosiformis]
Length=2579

 Score =  1704 bits (4414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 907/1634 (56%), Positives = 1180/1634 (72%), Gaps = 20/1634 (1%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM +FF EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  944   EIIQNFPLIMSVSNKLLGVPLSLLMQLFFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  1003

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S A S+FL  A   +LFP  L I   DLS Q GL NL +A LSE T
Sbjct  1004  RTMDCSVISSMDNKSNAFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLFMAKLSEET  1063

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++    T
Sbjct  1064  SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCGLDT  1123

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+D+F+ES K  V  KM
Sbjct  1124  FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIKDSVDQFVESAKLEV-SKM  1182

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC  Q SS E  HA + V  +FKNVV KL + FK + ++C++S
Sbjct  1183  DHHVHNLLKATSELWLSFCHSQGSSSEVYHANKHVISSFKNVVNKLVMAFKQKMNECMKS  1242

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  1243  KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  1299

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M QPH + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVAD+CLL
Sbjct  1300  SAFSHLAANMQQPHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADICLL  1358

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1359  KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITKRKAEILFLVADISPLH  1418

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ++LMLLPTV LYL+S+  K G Q+    
Sbjct  1419  LSVFGKLFSDMMNKYVAVKSCAVQQICGYSDEDMLMLLPTVILYLNSIPSKFGGQLCMLH  1478

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+ QL
Sbjct  1479  ENIVSFYWGILKQGFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVAQL  1536

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + RM +F+SVC  + +  D L+FD +Q G  S+E+SLN VNRTV KI L
Sbjct  1537  FFELRGDLVNVKKRMSIFNSVCSSEYS--DLLEFDLTQDGAYSVEESLNVVNRTVTKIRL  1594

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV SW+ IV++  +   + 
Sbjct  1595  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQSWQLIVKRCSLNVVDF  1654

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+EV +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DP TL
Sbjct  1655  SQIEVGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPTTL  1714

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS +S G S  GL FTPLPS+MRS+
Sbjct  1715  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIHSSPISAGHSHFGLIFTPLPSIMRSY  1774

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1775  V-PCIDQDALDLKDNFKLSEERARQLELVKLLKLLFQIRAQQCDIDNVKDIGINLRELVF  1833

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EIKS +D    S+A+ D+LW +A++K RKE ELVQT+S
Sbjct  1834  LLLSSYGASMSAIDLEIYSLLDEIKSANDLDEESMAKLDFLWSSALLKVRKENELVQTLS  1893

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +D R+I FREN+PIDPK CA+TVLYFPY R  G G+  K + D  D  +  
Sbjct  1894  RNLSEAEAVDDYRRIHFRENIPIDPKFCATTVLYFPYDRTVGAGIHRKPETDNPDFRYAV  1953

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1954  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  2013

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LEKCQK+KDVMRL+LL+SYLQN IEE WQKI S+TA+F+AEASFVLLDPSHD
Sbjct  2014  VLGRFKSTLEKCQKRKDVMRLRLLMSYLQNGIEEPWQKISSITAVFVAEASFVLLDPSHD  2073

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+ +LM+SPS N+K IPLF N  WS S +F  ERLWILR+LYSGLN +DD  IYIR
Sbjct  2074  HYSAISAYLMRSPSANMKGIPLFHNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIR  2133

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N+IFETLLSFYVSP++ +ESKELI+Q VKKS  + +MAR+L+E CGLISW S V++S   
Sbjct  2134  NAIFETLLSFYVSPISSHESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVISS---  2190

Query  3771  IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQML  3950
             + +   +   F +  V+LE +NE+I  RHT+EW+QKYALEQL ELSC+L ++LVE  +  
Sbjct  2191  LSWSPCRRDSFVELTVILEALNEVILSRHTIEWMQKYALEQLVELSCNLYKMLVERVETF  2250

Query  3951  KEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTG  4130
             K  +   KLILQI+T   K+SQKRKVYQPHF +S+E L  LCE +D CC+G  SP+A+  
Sbjct  2251  KGKTQLVKLILQIVTSALKISQKRKVYQPHFNISIESLLQLCEVVDECCDGRQSPVAQIA  2310

Query  4131  LEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETEN  4310
             LEA+LMSTPPV ILQMD +KVSKF+ WA  IALQ + + +   E     + + +E+ET++
Sbjct  2311  LEAVLMSTPPVNILQMDKEKVSKFVRWATLIALQPKIENIHGPENFACIVRLQAEKETDD  2370

Query  4311  SLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFAC  4490
             SLISKL+RWL ASVI+GK+S + S  D  HS DRSKL NL  ++EWNE+   E  + FAC
Sbjct  2371  SLISKLVRWLAASVIVGKLSLRFSNSDLCHSFDRSKLNNLLSMMEWNEKRCEETNRAFAC  2430

Query  4491  QEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIR  4661
             +  LA SIF+LQQL  T++ +LPS VSAL LLLL + +S+ +++L G+A   A LCSKI 
Sbjct  2431  EGTLALSIFFLQQLQCTNYIVLPSVVSALSLLLLSSLSSAETDILAGDAVQLATLCSKIN  2490

Query  4662  CPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLK  4841
             CPAEAN AWRWSFYQPWKDHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +
Sbjct  2491  CPAEANPAWRWSFYQPWKDHSSELTDAEKLEENQACEMLLVVISKLLGRNSLYSQFFSFQ  2550

Query  4842  DVEKLGVFEWERSI  4883
             D+EKL VF+WER++
Sbjct  2551  DLEKLCVFDWERTL  2564



>ref|XP_009595742.1| PREDICTED: uncharacterized protein LOC104091985 isoform X9 [Nicotiana 
tomentosiformis]
Length=2215

 Score =  1703 bits (4411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 907/1632 (56%), Positives = 1178/1632 (72%), Gaps = 20/1632 (1%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM +FF EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  575   EIIQNFPLIMSVSNKLLGVPLSLLMQLFFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  634

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S A S+FL  A   +LFP  L I   DLS Q GL NL +A LSE T
Sbjct  635   RTMDCSVISSMDNKSNAFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLFMAKLSEET  694

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++    T
Sbjct  695   SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCGLDT  754

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+D+F+ES K  V  KM
Sbjct  755   FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIKDSVDQFVESAKLEV-SKM  813

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC  Q SS E  HA + V  +FKNVV KL + FK + ++C++S
Sbjct  814   DHHVHNLLKATSELWLSFCHSQGSSSEVYHANKHVISSFKNVVNKLVMAFKQKMNECMKS  873

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  874   KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  930

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M QPH + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVAD+CLL
Sbjct  931   SAFSHLAANMQQPHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADICLL  989

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  990   KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITKRKAEILFLVADISPLH  1049

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ++LMLLPTV LYL+S+  K G Q+    
Sbjct  1050  LSVFGKLFSDMMNKYVAVKSCAVQQICGYSDEDMLMLLPTVILYLNSIPSKFGGQLCMLH  1109

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+ QL
Sbjct  1110  ENIVSFYWGILKQGFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVAQL  1167

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + RM +F+SVC  + +  D L+FD +Q G  S+E+SLN VNRTV KI L
Sbjct  1168  FFELRGDLVNVKKRMSIFNSVCSSEYS--DLLEFDLTQDGAYSVEESLNVVNRTVTKIRL  1225

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV SW+ IV++  +   + 
Sbjct  1226  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQSWQLIVKRCSLNVVDF  1285

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+EV +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DP TL
Sbjct  1286  SQIEVGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPTTL  1345

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS +S G S  GL FTPLPS+MRS+
Sbjct  1346  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIHSSPISAGHSHFGLIFTPLPSIMRSY  1405

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1406  V-PCIDQDALDLKDNFKLSEERARQLELVKLLKLLFQIRAQQCDIDNVKDIGINLRELVF  1464

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EIKS +D    S+A+ D+LW +A++K RKE ELVQT+S
Sbjct  1465  LLLSSYGASMSAIDLEIYSLLDEIKSANDLDEESMAKLDFLWSSALLKVRKENELVQTLS  1524

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +D R+I FREN+PIDPK CA+TVLYFPY R  G G+  K + D  D  +  
Sbjct  1525  RNLSEAEAVDDYRRIHFRENIPIDPKFCATTVLYFPYDRTVGAGIHRKPETDNPDFRYAV  1584

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1585  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  1644

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LEKCQK+KDVMRL+LL+SYLQN IEE WQKI S+TA+F+AEASFVLLDPSHD
Sbjct  1645  VLGRFKSTLEKCQKRKDVMRLRLLMSYLQNGIEEPWQKISSITAVFVAEASFVLLDPSHD  1704

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+ +LM+SPS N+K IPLF N  WS S +F  ERLWILR+LYSGLN +DD  IYIR
Sbjct  1705  HYSAISAYLMRSPSANMKGIPLFHNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIR  1764

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N+IFETLLSFYVSP++ +ESKELI+Q VKKS  + +MAR+L+E CGLISW S V++S   
Sbjct  1765  NAIFETLLSFYVSPISSHESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVISS---  1821

Query  3771  IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQML  3950
             + +   +   F +  V+LE +NE+I  RHT+EW+QKYALEQL ELSC+L ++LVE  +  
Sbjct  1822  LSWSPCRRDSFVELTVILEALNEVILSRHTIEWMQKYALEQLVELSCNLYKMLVERVETF  1881

Query  3951  KEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTG  4130
             K  +   KLILQI+T   K+SQKRKVYQPHF +S+E L  LCE +D CC+G  SP+A+  
Sbjct  1882  KGKTQLVKLILQIVTSALKISQKRKVYQPHFNISIESLLQLCEVVDECCDGRQSPVAQIA  1941

Query  4131  LEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETEN  4310
             LEA+LMSTPPV ILQMD +KVSKF+ WA  IALQ + + +   E     + + +E+ET++
Sbjct  1942  LEAVLMSTPPVNILQMDKEKVSKFVRWATLIALQPKIENIHGPENFACIVRLQAEKETDD  2001

Query  4311  SLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFAC  4490
             SLISKL+RWL ASVI+GK+S + S  D  HS DRSKL NL  ++EWNE+   E  + FAC
Sbjct  2002  SLISKLVRWLAASVIVGKLSLRFSNSDLCHSFDRSKLNNLLSMMEWNEKRCEETNRAFAC  2061

Query  4491  QEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIR  4661
             +  LA SIF+LQQL  T++ +LPS VSAL LLLL + +S+ +++L G+A   A LCSKI 
Sbjct  2062  EGTLALSIFFLQQLQCTNYIVLPSVVSALSLLLLSSLSSAETDILAGDAVQLATLCSKIN  2121

Query  4662  CPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLK  4841
             CPAEAN AWRWSFYQPWKDHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +
Sbjct  2122  CPAEANPAWRWSFYQPWKDHSSELTDAEKLEENQACEMLLVVISKLLGRNSLYSQFFSFQ  2181

Query  4842  DVEKLGVFEWER  4877
             D+EKL VF+WER
Sbjct  2182  DLEKLCVFDWER  2193



>ref|XP_009595737.1| PREDICTED: uncharacterized protein LOC104091985 isoform X4 [Nicotiana 
tomentosiformis]
Length=2581

 Score =  1703 bits (4411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 907/1632 (56%), Positives = 1178/1632 (72%), Gaps = 20/1632 (1%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM +FF EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  941   EIIQNFPLIMSVSNKLLGVPLSLLMQLFFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  1000

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S A S+FL  A   +LFP  L I   DLS Q GL NL +A LSE T
Sbjct  1001  RTMDCSVISSMDNKSNAFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLFMAKLSEET  1060

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++    T
Sbjct  1061  SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCGLDT  1120

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+D+F+ES K  V  KM
Sbjct  1121  FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIKDSVDQFVESAKLEV-SKM  1179

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC  Q SS E  HA + V  +FKNVV KL + FK + ++C++S
Sbjct  1180  DHHVHNLLKATSELWLSFCHSQGSSSEVYHANKHVISSFKNVVNKLVMAFKQKMNECMKS  1239

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  1240  KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  1296

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M QPH + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVAD+CLL
Sbjct  1297  SAFSHLAANMQQPHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADICLL  1355

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1356  KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITKRKAEILFLVADISPLH  1415

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ++LMLLPTV LYL+S+  K G Q+    
Sbjct  1416  LSVFGKLFSDMMNKYVAVKSCAVQQICGYSDEDMLMLLPTVILYLNSIPSKFGGQLCMLH  1475

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+ QL
Sbjct  1476  ENIVSFYWGILKQGFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVAQL  1533

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + RM +F+SVC  + +  D L+FD +Q G  S+E+SLN VNRTV KI L
Sbjct  1534  FFELRGDLVNVKKRMSIFNSVCSSEYS--DLLEFDLTQDGAYSVEESLNVVNRTVTKIRL  1591

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV SW+ IV++  +   + 
Sbjct  1592  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQSWQLIVKRCSLNVVDF  1651

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+EV +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DP TL
Sbjct  1652  SQIEVGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPTTL  1711

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS +S G S  GL FTPLPS+MRS+
Sbjct  1712  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIHSSPISAGHSHFGLIFTPLPSIMRSY  1771

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1772  V-PCIDQDALDLKDNFKLSEERARQLELVKLLKLLFQIRAQQCDIDNVKDIGINLRELVF  1830

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EIKS +D    S+A+ D+LW +A++K RKE ELVQT+S
Sbjct  1831  LLLSSYGASMSAIDLEIYSLLDEIKSANDLDEESMAKLDFLWSSALLKVRKENELVQTLS  1890

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +D R+I FREN+PIDPK CA+TVLYFPY R  G G+  K + D  D  +  
Sbjct  1891  RNLSEAEAVDDYRRIHFRENIPIDPKFCATTVLYFPYDRTVGAGIHRKPETDNPDFRYAV  1950

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1951  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  2010

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LEKCQK+KDVMRL+LL+SYLQN IEE WQKI S+TA+F+AEASFVLLDPSHD
Sbjct  2011  VLGRFKSTLEKCQKRKDVMRLRLLMSYLQNGIEEPWQKISSITAVFVAEASFVLLDPSHD  2070

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+ +LM+SPS N+K IPLF N  WS S +F  ERLWILR+LYSGLN +DD  IYIR
Sbjct  2071  HYSAISAYLMRSPSANMKGIPLFHNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIR  2130

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N+IFETLLSFYVSP++ +ESKELI+Q VKKS  + +MAR+L+E CGLISW S V++S   
Sbjct  2131  NAIFETLLSFYVSPISSHESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVISS---  2187

Query  3771  IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQML  3950
             + +   +   F +  V+LE +NE+I  RHT+EW+QKYALEQL ELSC+L ++LVE  +  
Sbjct  2188  LSWSPCRRDSFVELTVILEALNEVILSRHTIEWMQKYALEQLVELSCNLYKMLVERVETF  2247

Query  3951  KEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTG  4130
             K  +   KLILQI+T   K+SQKRKVYQPHF +S+E L  LCE +D CC+G  SP+A+  
Sbjct  2248  KGKTQLVKLILQIVTSALKISQKRKVYQPHFNISIESLLQLCEVVDECCDGRQSPVAQIA  2307

Query  4131  LEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETEN  4310
             LEA+LMSTPPV ILQMD +KVSKF+ WA  IALQ + + +   E     + + +E+ET++
Sbjct  2308  LEAVLMSTPPVNILQMDKEKVSKFVRWATLIALQPKIENIHGPENFACIVRLQAEKETDD  2367

Query  4311  SLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFAC  4490
             SLISKL+RWL ASVI+GK+S + S  D  HS DRSKL NL  ++EWNE+   E  + FAC
Sbjct  2368  SLISKLVRWLAASVIVGKLSLRFSNSDLCHSFDRSKLNNLLSMMEWNEKRCEETNRAFAC  2427

Query  4491  QEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIR  4661
             +  LA SIF+LQQL  T++ +LPS VSAL LLLL + +S+ +++L G+A   A LCSKI 
Sbjct  2428  EGTLALSIFFLQQLQCTNYIVLPSVVSALSLLLLSSLSSAETDILAGDAVQLATLCSKIN  2487

Query  4662  CPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLK  4841
             CPAEAN AWRWSFYQPWKDHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +
Sbjct  2488  CPAEANPAWRWSFYQPWKDHSSELTDAEKLEENQACEMLLVVISKLLGRNSLYSQFFSFQ  2547

Query  4842  DVEKLGVFEWER  4877
             D+EKL VF+WER
Sbjct  2548  DLEKLCVFDWER  2559



>ref|XP_009595734.1| PREDICTED: uncharacterized protein LOC104091985 isoform X1 [Nicotiana 
tomentosiformis]
Length=2584

 Score =  1703 bits (4411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 907/1632 (56%), Positives = 1178/1632 (72%), Gaps = 20/1632 (1%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM +FF EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  944   EIIQNFPLIMSVSNKLLGVPLSLLMQLFFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  1003

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S A S+FL  A   +LFP  L I   DLS Q GL NL +A LSE T
Sbjct  1004  RTMDCSVISSMDNKSNAFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLFMAKLSEET  1063

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++    T
Sbjct  1064  SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCGLDT  1123

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+D+F+ES K  V  KM
Sbjct  1124  FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIKDSVDQFVESAKLEV-SKM  1182

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC  Q SS E  HA + V  +FKNVV KL + FK + ++C++S
Sbjct  1183  DHHVHNLLKATSELWLSFCHSQGSSSEVYHANKHVISSFKNVVNKLVMAFKQKMNECMKS  1242

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  1243  KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  1299

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M QPH + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVAD+CLL
Sbjct  1300  SAFSHLAANMQQPHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADICLL  1358

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1359  KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITKRKAEILFLVADISPLH  1418

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ++LMLLPTV LYL+S+  K G Q+    
Sbjct  1419  LSVFGKLFSDMMNKYVAVKSCAVQQICGYSDEDMLMLLPTVILYLNSIPSKFGGQLCMLH  1478

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+ QL
Sbjct  1479  ENIVSFYWGILKQGFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVAQL  1536

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + RM +F+SVC  + +  D L+FD +Q G  S+E+SLN VNRTV KI L
Sbjct  1537  FFELRGDLVNVKKRMSIFNSVCSSEYS--DLLEFDLTQDGAYSVEESLNVVNRTVTKIRL  1594

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV SW+ IV++  +   + 
Sbjct  1595  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQSWQLIVKRCSLNVVDF  1654

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+EV +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DP TL
Sbjct  1655  SQIEVGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPTTL  1714

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS +S G S  GL FTPLPS+MRS+
Sbjct  1715  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIHSSPISAGHSHFGLIFTPLPSIMRSY  1774

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1775  V-PCIDQDALDLKDNFKLSEERARQLELVKLLKLLFQIRAQQCDIDNVKDIGINLRELVF  1833

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EIKS +D    S+A+ D+LW +A++K RKE ELVQT+S
Sbjct  1834  LLLSSYGASMSAIDLEIYSLLDEIKSANDLDEESMAKLDFLWSSALLKVRKENELVQTLS  1893

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +D R+I FREN+PIDPK CA+TVLYFPY R  G G+  K + D  D  +  
Sbjct  1894  RNLSEAEAVDDYRRIHFRENIPIDPKFCATTVLYFPYDRTVGAGIHRKPETDNPDFRYAV  1953

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1954  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  2013

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LEKCQK+KDVMRL+LL+SYLQN IEE WQKI S+TA+F+AEASFVLLDPSHD
Sbjct  2014  VLGRFKSTLEKCQKRKDVMRLRLLMSYLQNGIEEPWQKISSITAVFVAEASFVLLDPSHD  2073

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+ +LM+SPS N+K IPLF N  WS S +F  ERLWILR+LYSGLN +DD  IYIR
Sbjct  2074  HYSAISAYLMRSPSANMKGIPLFHNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIR  2133

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N+IFETLLSFYVSP++ +ESKELI+Q VKKS  + +MAR+L+E CGLISW S V++S   
Sbjct  2134  NAIFETLLSFYVSPISSHESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVISS---  2190

Query  3771  IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQML  3950
             + +   +   F +  V+LE +NE+I  RHT+EW+QKYALEQL ELSC+L ++LVE  +  
Sbjct  2191  LSWSPCRRDSFVELTVILEALNEVILSRHTIEWMQKYALEQLVELSCNLYKMLVERVETF  2250

Query  3951  KEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTG  4130
             K  +   KLILQI+T   K+SQKRKVYQPHF +S+E L  LCE +D CC+G  SP+A+  
Sbjct  2251  KGKTQLVKLILQIVTSALKISQKRKVYQPHFNISIESLLQLCEVVDECCDGRQSPVAQIA  2310

Query  4131  LEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETEN  4310
             LEA+LMSTPPV ILQMD +KVSKF+ WA  IALQ + + +   E     + + +E+ET++
Sbjct  2311  LEAVLMSTPPVNILQMDKEKVSKFVRWATLIALQPKIENIHGPENFACIVRLQAEKETDD  2370

Query  4311  SLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFAC  4490
             SLISKL+RWL ASVI+GK+S + S  D  HS DRSKL NL  ++EWNE+   E  + FAC
Sbjct  2371  SLISKLVRWLAASVIVGKLSLRFSNSDLCHSFDRSKLNNLLSMMEWNEKRCEETNRAFAC  2430

Query  4491  QEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIR  4661
             +  LA SIF+LQQL  T++ +LPS VSAL LLLL + +S+ +++L G+A   A LCSKI 
Sbjct  2431  EGTLALSIFFLQQLQCTNYIVLPSVVSALSLLLLSSLSSAETDILAGDAVQLATLCSKIN  2490

Query  4662  CPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLK  4841
             CPAEAN AWRWSFYQPWKDHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +
Sbjct  2491  CPAEANPAWRWSFYQPWKDHSSELTDAEKLEENQACEMLLVVISKLLGRNSLYSQFFSFQ  2550

Query  4842  DVEKLGVFEWER  4877
             D+EKL VF+WER
Sbjct  2551  DLEKLCVFDWER  2562



>ref|XP_009595736.1| PREDICTED: uncharacterized protein LOC104091985 isoform X3 [Nicotiana 
tomentosiformis]
Length=2582

 Score =  1699 bits (4400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 907/1632 (56%), Positives = 1176/1632 (72%), Gaps = 22/1632 (1%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM +FF EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  944   EIIQNFPLIMSVSNKLLGVPLSLLMQLFFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  1003

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S A S+FL  A   +LFP  L I   DLS Q GL NL +A LSE T
Sbjct  1004  RTMDCSVISSMDNKSNAFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLFMAKLSEET  1063

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++    T
Sbjct  1064  SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCGLDT  1123

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+D+F+ES K  V  KM
Sbjct  1124  FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIKDSVDQFVESAKLEV-SKM  1182

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC  Q SS E  HA + V  +FKNVV KL + FK + ++C++S
Sbjct  1183  DHHVHNLLKATSELWLSFCHSQGSSSEVYHANKHVISSFKNVVNKLVMAFKQKMNECMKS  1242

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  1243  KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  1299

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M QPH + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVAD+CLL
Sbjct  1300  SAFSHLAANMQQPHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADICLL  1358

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1359  KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITKRKAEILFLVADISPLH  1418

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ++LMLLPTV LYL+S+  K G Q+    
Sbjct  1419  LSVFGKLFSDMMNKYVAVKSCAVQQICGYSDEDMLMLLPTVILYLNSIPSKFGGQLCMLH  1478

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+ QL
Sbjct  1479  ENIVSFYWGILKQGFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVAQL  1536

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + RM +F+SVC  + +  D L+FD +Q G  S+E+SLN VNRTV KI L
Sbjct  1537  FFELRGDLVNVKKRMSIFNSVCSSEYS--DLLEFDLTQDGAYSVEESLNVVNRTVTKIRL  1594

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV SW+ IV++  +   + 
Sbjct  1595  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQSWQLIVKRCSLNVVDF  1654

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+EV +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DP TL
Sbjct  1655  SQIEVGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPTTL  1714

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS +S G S  GL FTPLPS+MRS+
Sbjct  1715  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIHSSPISAGHSHFGLIFTPLPSIMRSY  1774

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1775  V-PCIDQDALDLKDNFKLSEERARQLELVKLLKLLFQIRAQQCDIDNVKDIGINLRELVF  1833

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EIKS +D    S+A+ D+LW +A++K RKE ELVQT+S
Sbjct  1834  LLLSSYGASMSAIDLEIYSLLDEIKSANDLDEESMAKLDFLWSSALLKVRKENELVQTLS  1893

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +D R+I FREN+PIDPK CA+TVLYFPY R  G G+  K + D  D  +  
Sbjct  1894  RNLSEAEAVDDYRRIHFRENIPIDPKFCATTVLYFPYDRTVGAGIHRKPETDNPDFRYAV  1953

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1954  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  2013

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LEKCQK+KDVMRL+LL+SYLQN IEE WQKI S+TA+F+AEASFVLLDPSHD
Sbjct  2014  VLGRFKSTLEKCQKRKDVMRLRLLMSYLQNGIEEPWQKISSITAVFVAEASFVLLDPSHD  2073

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+ +LM+SPS N+K IPLF N  WS S +F  ERLWILR+LYSGLN +DD  IYIR
Sbjct  2074  HYSAISAYLMRSPSANMKGIPLFHNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIR  2133

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N+IFETLLSFYVSP++ +ESKELI+Q VKKS  + +MAR+L+E CGLISW S V++S   
Sbjct  2134  NAIFETLLSFYVSPISSHESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVISS---  2190

Query  3771  IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQML  3950
             + +   +   F +  V+LE +NE+I  RHT+EW+QKYALEQL ELSC+L ++LVE  +  
Sbjct  2191  LSWSPCRRDSFVELTVILEALNEVILSRHTIEWMQKYALEQLVELSCNLYKMLVERVETF  2250

Query  3951  KEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTG  4130
             K  +   KLILQI+T   K+SQKRKVYQPHF +S+E L  LCE +D CC+G  SP+A+  
Sbjct  2251  KGKTQLVKLILQIVTSALKISQKRKVYQPHFNISIESLLQLCEVVDECCDGRQSPVAQIA  2310

Query  4131  LEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETEN  4310
             LEA+LMSTPPV ILQMD +KVSKF+ WA  IALQ + + +   E     + + +E+ET++
Sbjct  2311  LEAVLMSTPPVNILQMDKEKVSKFVRWATLIALQPKIENIHGPENFACIVRLQAEKETDD  2370

Query  4311  SLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFAC  4490
             SLISKL+RWL ASVI+GK+S + S  D  HS DRSKL NL  ++EWNE+   E  + FAC
Sbjct  2371  SLISKLVRWLAASVIVGKLSLRFSNSDLCHSFDRSKLNNLLSMMEWNEKRCEETNRAFAC  2430

Query  4491  QEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIR  4661
             +  LA SIF+LQQL  T++ +LPS VSAL LLLL   + S +++L G+A   A LCSKI 
Sbjct  2431  EGTLALSIFFLQQLQCTNYIVLPSVVSALSLLLLS--SLSSADILAGDAVQLATLCSKIN  2488

Query  4662  CPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLK  4841
             CPAEAN AWRWSFYQPWKDHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +
Sbjct  2489  CPAEANPAWRWSFYQPWKDHSSELTDAEKLEENQACEMLLVVISKLLGRNSLYSQFFSFQ  2548

Query  4842  DVEKLGVFEWER  4877
             D+EKL VF+WER
Sbjct  2549  DLEKLCVFDWER  2560



>ref|XP_009595740.1| PREDICTED: uncharacterized protein LOC104091985 isoform X7 [Nicotiana 
tomentosiformis]
Length=2568

 Score =  1669 bits (4323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 898/1632 (55%), Positives = 1165/1632 (71%), Gaps = 36/1632 (2%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM +FF EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  944   EIIQNFPLIMSVSNKLLGVPLSLLMQLFFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  1003

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S A S+FL  A   +LFP  L I   DLS Q GL NL +A LSE T
Sbjct  1004  RTMDCSVISSMDNKSNAFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLFMAKLSEET  1063

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++    T
Sbjct  1064  SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCGLDT  1123

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+D+F+ES K  V  KM
Sbjct  1124  FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIKDSVDQFVESAKLEV-SKM  1182

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC  Q SS E  HA + V  +FKNVV KL + FK + ++C++S
Sbjct  1183  DHHVHNLLKATSELWLSFCHSQGSSSEVYHANKHVISSFKNVVNKLVMAFKQKMNECMKS  1242

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  1243  KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  1299

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M QPH + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVAD+CLL
Sbjct  1300  SAFSHLAANMQQPHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADICLL  1358

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1359  KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITKRKAEILFLVADISPLH  1418

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ++LMLLPTV LYL+S+  K G Q+    
Sbjct  1419  LSVFGKLFSDMMNKYVAVKSCAVQQICGYSDEDMLMLLPTVILYLNSIPSKFGGQLCMLH  1478

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+ QL
Sbjct  1479  ENIVSFYWGILKQGFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVAQL  1536

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + RM +F+SVC  + +  D L+FD +Q G  S+E+SLN VNRTV KI L
Sbjct  1537  FFELRGDLVNVKKRMSIFNSVCSSEYS--DLLEFDLTQDGAYSVEESLNVVNRTVTKIRL  1594

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV SW+ IV++  +   + 
Sbjct  1595  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQSWQLIVKRCSLNVVDF  1654

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+EV +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DP TL
Sbjct  1655  SQIEVGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPTTL  1714

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS +S G S  GL FTPLPS+MRS+
Sbjct  1715  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIHSSPISAGHSHFGLIFTPLPSIMRSY  1774

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1775  V-PCIDQDALDLKDNFKLSEERARQLELVKLLKLLFQIRAQQCDIDNVKDIGINLRELVF  1833

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EIKS +D    S+A+ D+LW +A++K RKE ELVQT+S
Sbjct  1834  LLLSSYGASMSAIDLEIYSLLDEIKSANDLDEESMAKLDFLWSSALLKVRKENELVQTLS  1893

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +D R+I FREN+PIDPK CA+TVLYFPY R  G G+  K + D  D  +  
Sbjct  1894  RNLSEAEAVDDYRRIHFRENIPIDPKFCATTVLYFPYDRTVGAGIHRKPETDNPDFRYAV  1953

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1954  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  2013

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LEKCQK+KDVMRL+LL+SYLQN IEE WQKI S+TA+F+AEASFVLLDPSHD
Sbjct  2014  VLGRFKSTLEKCQKRKDVMRLRLLMSYLQNGIEEPWQKISSITAVFVAEASFVLLDPSHD  2073

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+ +LM+SPS N+K IPLF N  WS S +F  ERLWILR+LYSGLN +DD  IYIR
Sbjct  2074  HYSAISAYLMRSPSANMKGIPLFHNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIR  2133

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N+IFETLLSFYVSP++ +ESKELI+Q VKKS  + +MAR+L+E CGLISW S V++S   
Sbjct  2134  NAIFETLLSFYVSPISSHESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVISS---  2190

Query  3771  IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQML  3950
             + +   +   F +  V+LE                KYALEQL ELSC+L ++LVE  +  
Sbjct  2191  LSWSPCRRDSFVELTVILE----------------KYALEQLVELSCNLYKMLVERVETF  2234

Query  3951  KEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTG  4130
             K  +   KLILQI+T   K+SQKRKVYQPHF +S+E L  LCE +D CC+G  SP+A+  
Sbjct  2235  KGKTQLVKLILQIVTSALKISQKRKVYQPHFNISIESLLQLCEVVDECCDGRQSPVAQIA  2294

Query  4131  LEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETEN  4310
             LEA+LMSTPPV ILQMD +KVSKF+ WA  IALQ + + +   E     + + +E+ET++
Sbjct  2295  LEAVLMSTPPVNILQMDKEKVSKFVRWATLIALQPKIENIHGPENFACIVRLQAEKETDD  2354

Query  4311  SLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFAC  4490
             SLISKL+RWL ASVI+GK+S + S  D  HS DRSKL NL  ++EWNE+   E  + FAC
Sbjct  2355  SLISKLVRWLAASVIVGKLSLRFSNSDLCHSFDRSKLNNLLSMMEWNEKRCEETNRAFAC  2414

Query  4491  QEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIR  4661
             +  LA SIF+LQQL  T++ +LPS VSAL LLLL + +S+ +++L G+A   A LCSKI 
Sbjct  2415  EGTLALSIFFLQQLQCTNYIVLPSVVSALSLLLLSSLSSAETDILAGDAVQLATLCSKIN  2474

Query  4662  CPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLK  4841
             CPAEAN AWRWSFYQPWKDHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +
Sbjct  2475  CPAEANPAWRWSFYQPWKDHSSELTDAEKLEENQACEMLLVVISKLLGRNSLYSQFFSFQ  2534

Query  4842  DVEKLGVFEWER  4877
             D+EKL VF+WER
Sbjct  2535  DLEKLCVFDWER  2546



>ref|XP_006344824.1| PREDICTED: uncharacterized protein LOC102599460 [Solanum tuberosum]
Length=2550

 Score =  1657 bits (4291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 896/1635 (55%), Positives = 1183/1635 (72%), Gaps = 28/1635 (2%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP IVSVS K+LGVP SLLM +FF EPSLL D SK WPE+FFTG+E A++ L  G
Sbjct  934   EIIQNFPSIVSVSNKLLGVPLSLLMQLFFSEPSLLNDASKRWPEIFFTGMERALARLSGG  993

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT        M++ S A S+FL+ A   +LFP  L I   DLS Q GL +LLLA LSE+T
Sbjct  994   RT--------MDYESDAFSVFLEHAPFYVLFPAVLYIDGLDLSDQSGLQSLLLAKLSEKT  1045

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQ  +SYR E  E LE LS  CF ++  ML++ L  K ++    T
Sbjct  1046  SDHLLSCFRYLLFWLNQTQLSYRHEQFEGLEKLSAACFLLLSGMLKKLLAEKSNSCGVDT  1105

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              S   T  ++EL+ TI  HP V A LE P P N+DF      DS+D+F+ES K ++  K 
Sbjct  1106  CSPFSTYFIEELVVTILDHPAVVAVLEYPSPVNSDFACGTIKDSVDQFVESVKLKIC-KT  1164

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV+NL++ T E  L FC GQ+SS E  HA + V  +FKNVV+KL LTF+ + ++C++S
Sbjct  1165  DHHVLNLVKATSEFWLSFCFGQSSSSEVYHANKHVVSSFKNVVKKLVLTFRLKMNECMKS  1224

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K+L PL+P +YA+H+L  FI PFE+LEL HW+ S IDLED S   +   S L VGLHIAG
Sbjct  1225  KNLIPLVPVLYALHSLIHFISPFEVLELAHWILSLIDLEDRSVWLT---SALCVGLHIAG  1281

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S FD L+A MWQP  + P+  LFWG+ +EQ D++L EK+LLQVY+IAT   LDVAD CLL
Sbjct  1282  SAFDHLAAYMWQPQEKIPIC-LFWGIQQEQNDVILYEKVLLQVYDIATRFELDVADACLL  1340

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVK HK MQ+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1341  KAVKVVKVHKSMQKQSHLFLKDTCRAVANTHVNILSHCMLKITKRKAEILFLVADISPLH  1400

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S  ++K V ++   +    + SD + LMLLPTV LYL+S+  K G Q+    
Sbjct  1401  LSVFGKLFSDRMNKYVVVKPCTVPPICDFSDEDALMLLPTVILYLNSIPAKFGGQLCMLH  1460

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E I SFYW IL   FS WK YV+R++F +E F+NL  S+E+F ++ S +LL+ +VL+VQL
Sbjct  1461  EHIASFYWEILKQGFSIWKSYVSREIFKVEYFENL--SMEDFPNLVSGSLLANTVLVVQL  1518

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LVK + R+ +F+SVC   S C D L+FD +Q G+ S+E+SLN VNRTVAKI L
Sbjct  1519  FFELRGDLVKVKKRLSIFNSVC--SSDCSDLLEFDLTQDGSYSVEESLNVVNRTVAKIRL  1576

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             C  LLFPE  KF S LK++     +E    LD++RIR L +LV SW+ IV++  +   + 
Sbjct  1577  CSALLFPEKGKFPSLLKKNAEVIASEECPILDLTRIRFLNLLVQSWQLIVKRCSLNVVDF  1636

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              QMEV +CS+FR+LEV IL+N+ E+++EMHGCL+ L+SLPF+ +L K++  HRF DP+TL
Sbjct  1637  RQMEVGSCSIFRYLEVYILKNVTEITREMHGCLLNLESLPFVEQLGKSSLLHRFYDPLTL  1696

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
               LR IISS+SEGKFSC+ IIQL++AHSQF   I SS++S G S  G+ FTPLPS+MRS+
Sbjct  1697  GMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIHSSHISAGHSHFGMIFTPLPSIMRSY  1756

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V    + ++   KD+ ++S++  +QLEL+KLLR+LFQ++ARQ DI   ++IGINL++L+F
Sbjct  1757  V-QFADLDAYDLKDSCKLSEERARQLELVKLLRLLFQIRARQCDINNVEDIGINLKELLF  1815

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EI S +D    S+A+ DYLWG+A++K RKE EL QT+S
Sbjct  1816  LLLSSYGASMSVIDLEIYSLMDEINSTNDLGEGSMAKLDYLWGSALLKVRKENELEQTIS  1875

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +D R+I FREN+PIDPK+CA+TVLYFPY R  G G++ + +KD  D  +E 
Sbjct  1876  SNLSEAEAVDDYRRICFRENIPIDPKVCATTVLYFPYDRTVGSGILKEPKKDYPDFGYEV  1935

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
               A+     +YDPIFIL  S HCLSMG+IEP+EFA+LGLLA+++ SISSPDDD RKLGY 
Sbjct  1936  QYADAEKLRVYDPIFILHFSVHCLSMGFIEPLEFASLGLLAIAVVSISSPDDDMRKLGYE  1995

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LE+CQK+KDVMRL+LL+SYLQN IEE WQKI SVTAIF+AEAS+VLLDPSHD
Sbjct  1996  VLGRFKSVLERCQKRKDVMRLRLLMSYLQNGIEEPWQKISSVTAIFVAEASYVLLDPSHD  2055

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+K+L++SP+ N+K IPLFQ   WS S +F TERLW+LR+L SGLN DDD  IYIR
Sbjct  2056  HYSAISKYLIRSPNANMKGIPLFQTFFWSISTNFITERLWMLRLLCSGLNVDDDAQIYIR  2115

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N+IFETL SFYVSP++D+ESKELI+Q V+KS ++ +MAR+L+E CGLISW S VV+S   
Sbjct  2116  NAIFETLFSFYVSPISDHESKELIVQIVRKSVRIPKMARYLVEQCGLISWSSCVVSS---  2172

Query  3771  IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQML  3950
             + +   +     +F V+LE +NE++  RHTVEW+QKYALEQL ELSC+L ++L+EG + L
Sbjct  2173  LSWSQCRRNSLVEFTVILEALNEVVLSRHTVEWMQKYALEQLVELSCNLYKMLIEGVERL  2232

Query  3951  KEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTG  4130
             K ++   KLILQIL    ++SQKRKVYQPHFTLSVE L  LCE +D CC+G  S +A+ G
Sbjct  2233  KVNTQLVKLILQILRSALRISQKRKVYQPHFTLSVESLLQLCEVLDECCDGRQSLVAQIG  2292

Query  4131  LEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETEN  4310
             LEA+LMSTPPV ILQMD +KVSKF+ WA   ALQS  + V   E     + + S+EE+++
Sbjct  2293  LEAVLMSTPPVTILQMDKEKVSKFVRWATLTALQSNIEEVHGPENFDCIMRLQSDEESDD  2352

Query  4311  SLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFAC  4490
             SLISKL+RWL ASVI+GK S K S LD  HS DRSKL NL  L+EW+++      + FAC
Sbjct  2353  SLISKLVRWLAASVIVGKHSLKFSNLDLCHSFDRSKLNNLLSLMEWDDQRCSSTNRTFAC  2412

Query  4491  QEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIR  4661
             +E LA+S+F+LQQL  T++ +LPS VSALCLLL  + + + +++L  +A   A L SKI 
Sbjct  2413  EETLASSVFFLQQLQRTNYTVLPSVVSALCLLLSSSLSCTETDILGDDAIQLATLFSKIN  2472

Query  4662  CPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLK  4841
             CPAEA   WRWSFYQPWKD SS L+D+ K+E+  AC+MLL+V SK+L RNSLYS  +S +
Sbjct  2473  CPAEAYPTWRWSFYQPWKDQSSELSDAAKLEKNQACEMLLVVISKLLGRNSLYSNFLSFQ  2532

Query  4842  DVEKLGVFEWERSIL  4886
             DV+KLGVF+WER IL
Sbjct  2533  DVDKLGVFDWERHIL  2547



>ref|XP_010317142.1| PREDICTED: uncharacterized protein LOC101258227 isoform X1 [Solanum 
lycopersicum]
Length=2554

 Score =  1647 bits (4266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 889/1635 (54%), Positives = 1179/1635 (72%), Gaps = 28/1635 (2%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP IVS+S K+LGVP SLLM +FF EPSLL D SK WPE+FFTG+E A++ L  G
Sbjct  938   EIIQNFPSIVSLSNKLLGVPLSLLMQLFFSEPSLLSDASKRWPEIFFTGMERALARLSGG  997

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT        M++ S A S+FL+ A   +LFP  L I   D S Q GL +LLLA LS++T
Sbjct  998   RT--------MDYESDAFSVFLERAPFYVLFPAVLYIDGLDFSDQSGLQSLLLAKLSKKT  1049

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQ  +SYR E  E LE LS  CF ++  ML++ L  K ++    T
Sbjct  1050  SDHLLSCFRYLLFWLNQTQLSYRHEQFEGLEKLSAACFLLLSGMLKKLLVEKSNSRGVDT  1109

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              S   T  ++EL+ TI  HP V + LE P P N+DF      DS+D+F+ES K ++  K 
Sbjct  1110  CSPFSTYFIEELVVTILDHPAVVSVLEYPSPVNSDFACGTIQDSVDQFVESVKLKIC-KT  1168

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV+NL++ TFE  L FC GQ+SS E  HA + V  +FKNVV+KL LTF+ + ++C++S
Sbjct  1169  DHHVLNLVKATFEFWLSFCFGQSSSSEVYHANKHVVTSFKNVVKKLVLTFRLKMNECMKS  1228

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K+L PL+P +YA+H+L  FI PFE+LEL HW+ S IDLED S   +   S L VGLHIAG
Sbjct  1229  KNLIPLVPVLYALHSLIHFISPFEVLELAHWILSLIDLEDRSVWLT---SALCVGLHIAG  1285

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S FD L+A MWQP  + P+  LFWG+ +EQ D++L EK+LLQVY+IAT   LDVAD CLL
Sbjct  1286  SAFDHLAAYMWQPQEKIPIC-LFWGIQQEQNDVILYEKVLLQVYDIATRFELDVADACLL  1344

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVK HK MQ+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1345  KAVKVVKVHKSMQKESHLFLKDSCRTVANTHVNVLSHCMLKITKRKAEILFLVADISPLH  1404

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQVKYF-  1613
             LS+FG L S  ++K V ++   +    + SD + LMLLPTV LYL+S+  K G Q+    
Sbjct  1405  LSVFGKLFSDRMNKYVVVKPRTVPPICDFSDEDALMLLPTVILYLNSIPAKFGGQLCILH  1464

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E I SFYW IL   FS W  YV+R++F +E F+NL  S+E+F ++ S +LL+ +V++VQL
Sbjct  1465  EHIASFYWEILKQGFSIWTSYVSREIFKVEYFENL--SMEDFPNLVSGSLLANTVIVVQL  1522

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                + G LVK + R+ +F+SVC   S C D L+FD +Q G+ S+E+SLN VNRTVAKI L
Sbjct  1523  FFEIRGDLVKVKKRLSIFNSVC--SSDCSDLLEFDLTQDGSYSVEESLNVVNRTVAKIRL  1580

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLFPE  KF S LK++     +E    LD++RIR L +LV SW+ IV++  +     
Sbjct  1581  CRALLFPEKGKFPSLLKKNAEVVASEDCPILDLARIRFLNLLVQSWQLIVKRCSLNVVGF  1640

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              QMEV +CS+FR+LEV IL+N+ E+++EM GCL+ L+SLPF+ +L  ++  HRF DP+TL
Sbjct  1641  RQMEVGSCSIFRYLEVYILKNVTEITREMQGCLLNLESLPFVEQLGNSSLLHRFYDPLTL  1700

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
               LR IISS+SEGKFSC+ IIQ ++AHSQF   I SS++S G S  G+ FTPLPS+MRS+
Sbjct  1701  GMLRAIISSVSEGKFSCISIIQRLLAHSQFAATIHSSHISAGHSHFGMIFTPLPSIMRSY  1760

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V    + ++   KD+ ++S++  +QLEL+KLLR+LFQ+ ARQ DI   ++IGINLR+L+F
Sbjct  1761  V-QFADLDAYDLKDSCKLSEECARQLELVKLLRLLFQISARQCDINNVKDIGINLRELLF  1819

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EI S ++   +S+A+ DYLWG+A++K RKE E  QT+S
Sbjct  1820  LLLSSYGASMSVIDLEIYSLMDEISSANNLGEVSMAKLDYLWGSALLKVRKENEQEQTIS  1879

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
             CNLS+AE  +D R+I+FREN+PIDPK+CA+TVLYFPY R  GP ++ + +KD  D  +E 
Sbjct  1880  CNLSEAEAVDDYRRIRFRENIPIDPKVCATTVLYFPYERTVGPRILKEPKKDYPDFGYEV  1939

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
               A+    H+YDPIFIL  S HCLSMG++EP+EFA+LGLLA+++ SISSPDDD RKLGY 
Sbjct  1940  HYADAEKLHVYDPIFILHFSVHCLSMGFVEPLEFASLGLLAIAVVSISSPDDDMRKLGYE  1999

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LE+CQK+KDV+RL+LL+SYLQN IEE WQKI SVTAIF+AEAS+VLLDPSHD
Sbjct  2000  VLGRFKSVLERCQKRKDVVRLRLLMSYLQNGIEEPWQKISSVTAIFVAEASYVLLDPSHD  2059

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+K+L++SPS N+K IPLFQ   WS S ++ TERLW+LR+L SGLN DDD  IYIR
Sbjct  2060  HYSAISKYLIRSPSANMKGIPLFQTFFWSISTNYITERLWMLRLLCSGLNLDDDAQIYIR  2119

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N+IFETL SFYVSP++D+ESKELI+Q V+KS ++ +MAR+L+E CGLISW S  V+S   
Sbjct  2120  NAIFETLFSFYVSPISDHESKELIVQIVRKSVRIPKMARYLVEQCGLISWSSCAVSS---  2176

Query  3771  IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQML  3950
             + +   +   F +  V+LE +NE++  RHTVEW+QKYALEQL ELSC+L ++L+EG + L
Sbjct  2177  LSWSQCRRNSFVELTVILEALNEVVLSRHTVEWMQKYALEQLVELSCNLYKMLIEGVERL  2236

Query  3951  KEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTG  4130
             K +S   KLILQIL    ++SQKRKVYQPHFTLSVE L  LCE +D CC G  S +A+ G
Sbjct  2237  KVNSQLVKLILQILRSALRISQKRKVYQPHFTLSVESLLQLCEVVDECCGGRQSLVAQIG  2296

Query  4131  LEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETEN  4310
             LEA+LMSTPPVAILQMD +KVSKF+ WA   ALQS  + V   E     + + + EE+++
Sbjct  2297  LEAVLMSTPPVAILQMDKEKVSKFVRWATLTALQSNIEKVHAPESIDCIMRLQANEESDD  2356

Query  4311  SLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFAC  4490
             SLISKL+RWLTASVI+GK S K S +D SHS DRSKL NL  L+E N++      + FAC
Sbjct  2357  SLISKLVRWLTASVIVGKHSLKFSNMDISHSFDRSKLNNLLSLMEGNDQRCSSTSRTFAC  2416

Query  4491  QEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIR  4661
             ++ LA+SIF+LQQL   ++ +LPS VSALCLLL  + +S  +++L  +A   A L SKI 
Sbjct  2417  EDTLASSIFFLQQLQRKNYTVLPSVVSALCLLLSSSLSSRETDILGDDAIQLAILFSKIN  2476

Query  4662  CPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLK  4841
             CPAEA   WRWSFYQPWKD SS L+D+ K+EE  AC+MLL+V SK+L RNSLYS  +S +
Sbjct  2477  CPAEAYPIWRWSFYQPWKDQSSELSDAAKLEENQACEMLLVVISKLLGRNSLYSNFLSFQ  2536

Query  4842  DVEKLGVFEWERSIL  4886
             DV+KLGVF+WER IL
Sbjct  2537  DVDKLGVFDWERHIL  2551



>ref|XP_010317145.1| PREDICTED: uncharacterized protein LOC101258227 isoform X4 [Solanum 
lycopersicum]
Length=2089

 Score =  1646 bits (4263),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 889/1636 (54%), Positives = 1179/1636 (72%), Gaps = 28/1636 (2%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP IVS+S K+LGVP SLLM +FF EPSLL D SK WPE+FFTG+E A++ L  G
Sbjct  473   EIIQNFPSIVSLSNKLLGVPLSLLMQLFFSEPSLLSDASKRWPEIFFTGMERALARLSGG  532

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT        M++ S A S+FL+ A   +LFP  L I   D S Q GL +LLLA LS++T
Sbjct  533   RT--------MDYESDAFSVFLERAPFYVLFPAVLYIDGLDFSDQSGLQSLLLAKLSKKT  584

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQ  +SYR E  E LE LS  CF ++  ML++ L  K ++    T
Sbjct  585   SDHLLSCFRYLLFWLNQTQLSYRHEQFEGLEKLSAACFLLLSGMLKKLLVEKSNSRGVDT  644

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              S   T  ++EL+ TI  HP V + LE P P N+DF      DS+D+F+ES K ++  K 
Sbjct  645   CSPFSTYFIEELVVTILDHPAVVSVLEYPSPVNSDFACGTIQDSVDQFVESVKLKIC-KT  703

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV+NL++ TFE  L FC GQ+SS E  HA + V  +FKNVV+KL LTF+ + ++C++S
Sbjct  704   DHHVLNLVKATFEFWLSFCFGQSSSSEVYHANKHVVTSFKNVVKKLVLTFRLKMNECMKS  763

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K+L PL+P +YA+H+L  FI PFE+LEL HW+ S IDLED S   +   S L VGLHIAG
Sbjct  764   KNLIPLVPVLYALHSLIHFISPFEVLELAHWILSLIDLEDRSVWLT---SALCVGLHIAG  820

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S FD L+A MWQP  + P+  LFWG+ +EQ D++L EK+LLQVY+IAT   LDVAD CLL
Sbjct  821   SAFDHLAAYMWQPQEKIPIC-LFWGIQQEQNDVILYEKVLLQVYDIATRFELDVADACLL  879

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVK HK MQ+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  880   KAVKVVKVHKSMQKESHLFLKDSCRTVANTHVNVLSHCMLKITKRKAEILFLVADISPLH  939

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQVKYF-  1613
             LS+FG L S  ++K V ++   +    + SD + LMLLPTV LYL+S+  K G Q+    
Sbjct  940   LSVFGKLFSDRMNKYVVVKPRTVPPICDFSDEDALMLLPTVILYLNSIPAKFGGQLCILH  999

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E I SFYW IL   FS W  YV+R++F +E F+NL  S+E+F ++ S +LL+ +V++VQL
Sbjct  1000  EHIASFYWEILKQGFSIWTSYVSREIFKVEYFENL--SMEDFPNLVSGSLLANTVIVVQL  1057

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                + G LVK + R+ +F+SVC   S C D L+FD +Q G+ S+E+SLN VNRTVAKI L
Sbjct  1058  FFEIRGDLVKVKKRLSIFNSVC--SSDCSDLLEFDLTQDGSYSVEESLNVVNRTVAKIRL  1115

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLFPE  KF S LK++     +E    LD++RIR L +LV SW+ IV++  +     
Sbjct  1116  CRALLFPEKGKFPSLLKKNAEVVASEDCPILDLARIRFLNLLVQSWQLIVKRCSLNVVGF  1175

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              QMEV +CS+FR+LEV IL+N+ E+++EM GCL+ L+SLPF+ +L  ++  HRF DP+TL
Sbjct  1176  RQMEVGSCSIFRYLEVYILKNVTEITREMQGCLLNLESLPFVEQLGNSSLLHRFYDPLTL  1235

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
               LR IISS+SEGKFSC+ IIQ ++AHSQF   I SS++S G S  G+ FTPLPS+MRS+
Sbjct  1236  GMLRAIISSVSEGKFSCISIIQRLLAHSQFAATIHSSHISAGHSHFGMIFTPLPSIMRSY  1295

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V    + ++   KD+ ++S++  +QLEL+KLLR+LFQ+ ARQ DI   ++IGINLR+L+F
Sbjct  1296  V-QFADLDAYDLKDSCKLSEECARQLELVKLLRLLFQISARQCDINNVKDIGINLRELLF  1354

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EI S ++   +S+A+ DYLWG+A++K RKE E  QT+S
Sbjct  1355  LLLSSYGASMSVIDLEIYSLMDEISSANNLGEVSMAKLDYLWGSALLKVRKENEQEQTIS  1414

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
             CNLS+AE  +D R+I+FREN+PIDPK+CA+TVLYFPY R  GP ++ + +KD  D  +E 
Sbjct  1415  CNLSEAEAVDDYRRIRFRENIPIDPKVCATTVLYFPYERTVGPRILKEPKKDYPDFGYEV  1474

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
               A+    H+YDPIFIL  S HCLSMG++EP+EFA+LGLLA+++ SISSPDDD RKLGY 
Sbjct  1475  HYADAEKLHVYDPIFILHFSVHCLSMGFVEPLEFASLGLLAIAVVSISSPDDDMRKLGYE  1534

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LE+CQK+KDV+RL+LL+SYLQN IEE WQKI SVTAIF+AEAS+VLLDPSHD
Sbjct  1535  VLGRFKSVLERCQKRKDVVRLRLLMSYLQNGIEEPWQKISSVTAIFVAEASYVLLDPSHD  1594

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+K+L++SPS N+K IPLFQ   WS S ++ TERLW+LR+L SGLN DDD  IYIR
Sbjct  1595  HYSAISKYLIRSPSANMKGIPLFQTFFWSISTNYITERLWMLRLLCSGLNLDDDAQIYIR  1654

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N+IFETL SFYVSP++D+ESKELI+Q V+KS ++ +MAR+L+E CGLISW S  V+S   
Sbjct  1655  NAIFETLFSFYVSPISDHESKELIVQIVRKSVRIPKMARYLVEQCGLISWSSCAVSS---  1711

Query  3771  IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQML  3950
             + +   +   F +  V+LE +NE++  RHTVEW+QKYALEQL ELSC+L ++L+EG + L
Sbjct  1712  LSWSQCRRNSFVELTVILEALNEVVLSRHTVEWMQKYALEQLVELSCNLYKMLIEGVERL  1771

Query  3951  KEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTG  4130
             K +S   KLILQIL    ++SQKRKVYQPHFTLSVE L  LCE +D CC G  S +A+ G
Sbjct  1772  KVNSQLVKLILQILRSALRISQKRKVYQPHFTLSVESLLQLCEVVDECCGGRQSLVAQIG  1831

Query  4131  LEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETEN  4310
             LEA+LMSTPPVAILQMD +KVSKF+ WA   ALQS  + V   E     + + + EE+++
Sbjct  1832  LEAVLMSTPPVAILQMDKEKVSKFVRWATLTALQSNIEKVHAPESIDCIMRLQANEESDD  1891

Query  4311  SLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFAC  4490
             SLISKL+RWLTASVI+GK S K S +D SHS DRSKL NL  L+E N++      + FAC
Sbjct  1892  SLISKLVRWLTASVIVGKHSLKFSNMDISHSFDRSKLNNLLSLMEGNDQRCSSTSRTFAC  1951

Query  4491  QEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIR  4661
             ++ LA+SIF+LQQL   ++ +LPS VSALCLLL  + +S  +++L  +A   A L SKI 
Sbjct  1952  EDTLASSIFFLQQLQRKNYTVLPSVVSALCLLLSSSLSSRETDILGDDAIQLAILFSKIN  2011

Query  4662  CPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLK  4841
             CPAEA   WRWSFYQPWKD SS L+D+ K+EE  AC+MLL+V SK+L RNSLYS  +S +
Sbjct  2012  CPAEAYPIWRWSFYQPWKDQSSELSDAAKLEENQACEMLLVVISKLLGRNSLYSNFLSFQ  2071

Query  4842  DVEKLGVFEWERSILN  4889
             DV+KLGVF+WER IL 
Sbjct  2072  DVDKLGVFDWERHILK  2087



>ref|XP_010317143.1| PREDICTED: uncharacterized protein LOC101258227 isoform X2 [Solanum 
lycopersicum]
Length=2552

 Score =  1643 bits (4255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 889/1635 (54%), Positives = 1177/1635 (72%), Gaps = 30/1635 (2%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP IVS+S K+LGVP SLLM +FF EPSLL D SK WPE+FFTG+E A++ L  G
Sbjct  938   EIIQNFPSIVSLSNKLLGVPLSLLMQLFFSEPSLLSDASKRWPEIFFTGMERALARLSGG  997

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT        M++ S A S+FL+ A   +LFP  L I   D S Q GL +LLLA LS++T
Sbjct  998   RT--------MDYESDAFSVFLERAPFYVLFPAVLYIDGLDFSDQSGLQSLLLAKLSKKT  1049

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQ  +SYR E  E LE LS  CF ++  ML++ L  K ++    T
Sbjct  1050  SDHLLSCFRYLLFWLNQTQLSYRHEQFEGLEKLSAACFLLLSGMLKKLLVEKSNSRGVDT  1109

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              S   T  ++EL+ TI  HP V + LE P P N+DF      DS+D+F+ES K ++  K 
Sbjct  1110  CSPFSTYFIEELVVTILDHPAVVSVLEYPSPVNSDFACGTIQDSVDQFVESVKLKIC-KT  1168

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV+NL++ TFE  L FC GQ+SS E  HA + V  +FKNVV+KL LTF+ + ++C++S
Sbjct  1169  DHHVLNLVKATFEFWLSFCFGQSSSSEVYHANKHVVTSFKNVVKKLVLTFRLKMNECMKS  1228

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K+L PL+P +YA+H+L  FI PFE+LEL HW+ S IDLED S   +   S L VGLHIAG
Sbjct  1229  KNLIPLVPVLYALHSLIHFISPFEVLELAHWILSLIDLEDRSVWLT---SALCVGLHIAG  1285

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S FD L+A MWQP  + P+  LFWG+ +EQ D++L EK+LLQVY+IAT   LDVAD CLL
Sbjct  1286  SAFDHLAAYMWQPQEKIPIC-LFWGIQQEQNDVILYEKVLLQVYDIATRFELDVADACLL  1344

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVK HK MQ+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1345  KAVKVVKVHKSMQKESHLFLKDSCRTVANTHVNVLSHCMLKITKRKAEILFLVADISPLH  1404

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQVKYF-  1613
             LS+FG L S  ++K V ++   +    + SD + LMLLPTV LYL+S+  K G Q+    
Sbjct  1405  LSVFGKLFSDRMNKYVVVKPRTVPPICDFSDEDALMLLPTVILYLNSIPAKFGGQLCILH  1464

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E I SFYW IL   FS W  YV+R++F +E F+NL  S+E+F ++ S +LL+ +V++VQL
Sbjct  1465  EHIASFYWEILKQGFSIWTSYVSREIFKVEYFENL--SMEDFPNLVSGSLLANTVIVVQL  1522

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                + G LVK + R+ +F+SVC   S C D L+FD +Q G+ S+E+SLN VNRTVAKI L
Sbjct  1523  FFEIRGDLVKVKKRLSIFNSVC--SSDCSDLLEFDLTQDGSYSVEESLNVVNRTVAKIRL  1580

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLFPE  KF S LK++     +E    LD++RIR L +LV SW+ IV++  +     
Sbjct  1581  CRALLFPEKGKFPSLLKKNAEVVASEDCPILDLARIRFLNLLVQSWQLIVKRCSLNVVGF  1640

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              QMEV +CS+FR+LEV IL+N+ E+++EM GCL+ L+SLPF+ +L  ++  HRF DP+TL
Sbjct  1641  RQMEVGSCSIFRYLEVYILKNVTEITREMQGCLLNLESLPFVEQLGNSSLLHRFYDPLTL  1700

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
               LR IISS+SEGKFSC+ IIQ ++AHSQF   I SS++S G S  G+ FTPLPS+MRS+
Sbjct  1701  GMLRAIISSVSEGKFSCISIIQRLLAHSQFAATIHSSHISAGHSHFGMIFTPLPSIMRSY  1760

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V    + ++   KD+ ++S++  +QLEL+KLLR+LFQ+ ARQ DI   ++IGINLR+L+F
Sbjct  1761  V-QFADLDAYDLKDSCKLSEECARQLELVKLLRLLFQISARQCDINNVKDIGINLRELLF  1819

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EI S ++   +S+A+ DYLWG+A++K RKE E  QT+S
Sbjct  1820  LLLSSYGASMSVIDLEIYSLMDEISSANNLGEVSMAKLDYLWGSALLKVRKENEQEQTIS  1879

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
             CNLS+AE  +D R+I+FREN+PIDPK+CA+TVLYFPY R  GP ++ + +KD  D  +E 
Sbjct  1880  CNLSEAEAVDDYRRIRFRENIPIDPKVCATTVLYFPYERTVGPRILKEPKKDYPDFGYEV  1939

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
               A+    H+YDPIFIL  S HCLSMG++EP+EFA+LGLLA+++ SISSPDDD RKLGY 
Sbjct  1940  HYADAEKLHVYDPIFILHFSVHCLSMGFVEPLEFASLGLLAIAVVSISSPDDDMRKLGYE  1999

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LE+CQK+KDV+RL+LL+SYLQN IEE WQKI SVTAIF+AEAS+VLLDPSHD
Sbjct  2000  VLGRFKSVLERCQKRKDVVRLRLLMSYLQNGIEEPWQKISSVTAIFVAEASYVLLDPSHD  2059

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+K+L++SPS N+K IPLFQ   WS S ++ TERLW+LR+L SGLN DDD  IYIR
Sbjct  2060  HYSAISKYLIRSPSANMKGIPLFQTFFWSISTNYITERLWMLRLLCSGLNLDDDAQIYIR  2119

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N+IFETL SFYVSP++D+ESKELI+Q V+KS ++ +MAR+L+E CGLISW S  V+S   
Sbjct  2120  NAIFETLFSFYVSPISDHESKELIVQIVRKSVRIPKMARYLVEQCGLISWSSCAVSS---  2176

Query  3771  IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQML  3950
             + +   +   F +  V+LE +NE++  RHTVEW+QKYALEQL ELSC+L ++L+EG + L
Sbjct  2177  LSWSQCRRNSFVELTVILEALNEVVLSRHTVEWMQKYALEQLVELSCNLYKMLIEGVERL  2236

Query  3951  KEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTG  4130
             K +S   KLILQIL    ++SQKRKVYQPHFTLSVE L  LCE +D CC G  S +A+ G
Sbjct  2237  KVNSQLVKLILQILRSALRISQKRKVYQPHFTLSVESLLQLCEVVDECCGGRQSLVAQIG  2296

Query  4131  LEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETEN  4310
             LEA+LMSTPPVAILQMD +KVSKF+ WA   ALQS  + V   E     + + + EE+++
Sbjct  2297  LEAVLMSTPPVAILQMDKEKVSKFVRWATLTALQSNIEKVHAPESIDCIMRLQANEESDD  2356

Query  4311  SLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFAC  4490
             SLISKL+RWLTASVI+GK S K S +D SHS DRSKL NL  L+E N++      + FAC
Sbjct  2357  SLISKLVRWLTASVIVGKHSLKFSNMDISHSFDRSKLNNLLSLMEGNDQRCSSTSRTFAC  2416

Query  4491  QEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIR  4661
             ++ LA+SIF+LQQL   ++ +LPS VSALCLLL    + S  ++L  +A   A L SKI 
Sbjct  2417  EDTLASSIFFLQQLQRKNYTVLPSVVSALCLLLSS--SLSSRDILGDDAIQLAILFSKIN  2474

Query  4662  CPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLK  4841
             CPAEA   WRWSFYQPWKD SS L+D+ K+EE  AC+MLL+V SK+L RNSLYS  +S +
Sbjct  2475  CPAEAYPIWRWSFYQPWKDQSSELSDAAKLEENQACEMLLVVISKLLGRNSLYSNFLSFQ  2534

Query  4842  DVEKLGVFEWERSIL  4886
             DV+KLGVF+WER IL
Sbjct  2535  DVDKLGVFDWERHIL  2549



>emb|CDO99760.1| unnamed protein product [Coffea canephora]
Length=2571

 Score =  1490 bits (3857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 809/1642 (49%), Positives = 1106/1642 (67%), Gaps = 29/1642 (2%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEGR  185
             +LQNFP  +S S K+LGVPFS+L+  FFLEPS   +V K WP++ F G+E  ISG+ +G 
Sbjct  941   ILQNFPSTISTSTKLLGVPFSILLLRFFLEPSHFAEVFKLWPKICFAGVEKVISGVHDGE  1000

Query  186   TEEFGD--IDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSER  359
              +   +   DS + AS A S  +K A   +LFP         L     + NLLL   +E 
Sbjct  1001  GQTIANELDDSPDSASIAFSFLVKNAPFHVLFPAIFFTDGLHLLDHSKMQNLLLDKFTES  1060

Query  360   TPDHIVSSFLYVLFWFNQAHISYRVepleeleml-selCFNIVDRMLRQFLNTKGDASSK  536
             TPD  VSS  ++LF   QA ++YR++P +ELE L    CF     + + F+   G   S 
Sbjct  1061  TPDFSVSSLCHLLFCLLQARLAYRIKPSDELEKLCESSCFLAKHIVKQSFVEKFGPDCSP  1120

Query  537   CTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIH  716
                  L +  ++E+ E I  HP++ A LE PL  ++D  D       + FL+  + R + 
Sbjct  1121  RVLPPLSSGHIREVAEIILGHPLLTALLEWPLHTDSDVGDMIFMKPPETFLQYAE-RGVR  1179

Query  717   KMDLHVINLLR-TTFELLY--FCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRTDKC  887
             K+D H++ LLR TT ELL   F   ++ S       ++ KAFK +VQKLFLTFK R    
Sbjct  1180  KIDHHILQLLRRTTSELLVHVFSKCRSPSVVDHSTERIAKAFKALVQKLFLTFKGRFTDS  1239

Query  888   IESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLH  1067
              ++ DL PL+P +YA+H+L  FI PFELL LVHW+FSRIDL D +   S +   L VGL 
Sbjct  1240  RKTDDLMPLIPTLYALHSLSEFICPFELLNLVHWLFSRIDLNDTAVSISCQRCGLSVGLQ  1299

Query  1068  IAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADM  1247
             IA   FDSLS  M +PH++R L + F G     FDI L E+I   ++EIATH  L+VAD+
Sbjct  1300  IASWAFDSLSLYMLEPHAKRTLFNFFMGTGNRSFDITLFERIFNSIFEIATHTQLEVADI  1359

Query  1248  CLLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMS  1427
             CL KA K++K HK M++++   VMA SR + +IPV+ +SYC+ +  K K + LFL +EMS
Sbjct  1360  CLFKAVKIIKMHKCMEKTSLPFVMATSRLLPSIPVSFISYCLDKTTKTKCDFLFLLSEMS  1419

Query  1428  PLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPS-DPELLMLLPTVFLYLDSVLIKAGSQV  1604
              LHL +FGHL+SG I     L+ N     + P    E LMLLPTV LYL S  +K G Q 
Sbjct  1420  SLHLCVFGHLVSGKISNNQALKVNKEENCNRPQYSEEFLMLLPTVLLYLRSNFLKFGGQF  1479

Query  1605  -KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVL  1781
              K+ E   SF+W+ILLH FS+WK +V+ ++F+I+  +   L +E+F ++FS +LL ++VL
Sbjct  1480  GKHVENTSSFFWKILLHGFSNWKSFVSEEIFEIKLVECSSLCMEDFSNLFSSSLLGKAVL  1539

Query  1782  MVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVA  1961
             +++   A++G+LVK +  +  FDSVCP  S   D LD D  ++G CSLE SLNFVN+ +A
Sbjct  1540  LMRHYLAVSGHLVKMKRLLSTFDSVCPHASAQNDLLDCDAREIGVCSLELSLNFVNKIIA  1599

Query  1962  KINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMT  2141
             KI LCR LLFPEHN   S +K+ K +    + S + + RIR L MLV SW+++VE F   
Sbjct  1600  KICLCRMLLFPEHNNLQSVVKDGKKKG---IESEVSILRIRFLSMLVHSWQRLVENF---  1653

Query  2142  ADNSC-QMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFD  2318
               ++C Q E    S+FRFLE+ I +NIVEL +EMH CLV+L SLPF+ +LAK +  HRFD
Sbjct  1654  --HTCRQGENIRASLFRFLEIFIAKNIVELVREMHDCLVELHSLPFLDQLAKYSLLHRFD  1711

Query  2319  DPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPS  2498
             DP T++ LR ++ SLS+GKF C+ I+QL++AHSQF   I  ++ ST  +Q G++F P PS
Sbjct  1712  DPTTIRMLRTVLISLSKGKFLCISILQLLLAHSQFAPTILFAHSSTVCTQFGMSFAPAPS  1771

Query  2499  LMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINL  2678
             +MR F +     N++  K +      H+K+LELIKLLRVL  +  +Q  ++     G+NL
Sbjct  1772  IMRLFTVLHTEENTVDGKKDAHEIGPHMKKLELIKLLRVLIHILGQQHYLDSETSHGLNL  1831

Query  2679  RDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDS-NISIAEWDYLWGNAVVKARKEREL  2855
             ++LV +LLSSY AT+ +ID E+++L+NEI++I  S +  IAE D+LWG+A +K R+ERE 
Sbjct  1832  KELVLVLLSSYGATMDEIDLEMYSLMNEIEAIDKSVSEGIAEMDFLWGSASLKVRQEREQ  1891

Query  2856  VQTVSC--NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDT  3029
              Q+VS   N  D EV  + R+IQFRENLPID K+CA TVL FP+ R    G ++K+Q D 
Sbjct  1892  KQSVSSLSNSYDNEVVGERRRIQFRENLPIDTKLCAKTVLCFPHDR-FADGSLSKLQTDD  1950

Query  3030  FDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDD  3209
              D  +   S +V    +YDP+FILR S H L+M YIEP+EFA+LGLLA++  S+SSPD D
Sbjct  1951  SDEGYNANSKKV---QLYDPVFILRFSIHSLAMEYIEPLEFASLGLLAITFISLSSPDAD  2007

Query  3210  TRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFV  3389
             TRKLGY  + +FK+A+EKC+K+KDVMR +LL+SYLQN IEE+ Q+IPS+TA+FIAEASFV
Sbjct  2008  TRKLGYEAVVRFKSAVEKCRKRKDVMRFRLLVSYLQNGIEEECQRIPSITAVFIAEASFV  2067

Query  3390  LLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDD  3569
             LLD SHDHY+ I+K LMQS   N+K +PLFQ   WS SV+F++ERLW+LR+L + L  DD
Sbjct  2068  LLDSSHDHYSAISKCLMQSSGANMKGVPLFQEFFWSSSVTFKSERLWMLRLLNTSLTMDD  2127

Query  3570  DVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSS  3749
             D  I +RNSI+E LL+FY SPL+D+ESKELI++ VKKS K++++A HL+  CG+ISWLSS
Sbjct  2128  DAQILVRNSIYEILLNFYASPLSDDESKELIVEMVKKSVKINKLAWHLVVRCGIISWLSS  2187

Query  3750  VVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQIL  3929
              V SF GI     + F FA+ A+VLEV N++I  R+T EWLQKYALEQLSEL+ HL +IL
Sbjct  2188  HVASFYGILLRDQRSFSFAKLAMVLEVANDVIMSRNTSEWLQKYALEQLSELAAHLYRIL  2247

Query  3930  VEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCY  4109
             V  ++ ++E +    LIL++L  T K+SQKRKVYQPHFT+S EGL+HL EA+DVCC+G +
Sbjct  2248  VGCSRHIQEKTRIIDLILELLMSTLKISQKRKVYQPHFTISFEGLYHLYEAVDVCCSGTF  2307

Query  4110  SPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVS  4289
             S  A+TGL+A+LMSTPPV+IL MD  K+ KF++WA+S A+QS    V + E   +   + 
Sbjct  2308  SSTAETGLKAVLMSTPPVSILHMDKNKLLKFVSWAISTAVQSNLMEVPESE-AMYSNALR  2366

Query  4290  SEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRE  4469
               E++E  L+SKLLRWLTASVILG++S+KLS L+S+ S D  KL NLHC++++  +   E
Sbjct  2367  FSEQSEEDLVSKLLRWLTASVILGRLSWKLSDLNSTSSSDILKLDNLHCIMDYCVKECGE  2426

Query  4470  NGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNAA---  4640
             N + F  +EILA SIFYLQQL G  +  LPS V+AL LLL   P+SS S+ L G+ +   
Sbjct  2427  NQENFGSEEILAVSIFYLQQLAGIKWNFLPSVVAALSLLLYSGPSSSDSDSLHGDGSPWV  2486

Query  4641  ALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLY  4820
             +LC KI CPAEAN +WRWS+YQPW+D S      +K+EEIHACQ LL++  K L  NSL+
Sbjct  2487  SLCQKIHCPAEANPSWRWSYYQPWRDLSLKRAAVQKLEEIHACQKLLVLILKKLGNNSLF  2546

Query  4821  SKLISLKDVEKLGVFEWERSIL  4886
             S+ +SL+DVE   VF+WERSI+
Sbjct  2547  SQFLSLQDVENFDVFKWERSII  2568



>ref|XP_010644438.1| PREDICTED: uncharacterized protein LOC100264016 isoform X1 [Vitis 
vinifera]
Length=2639

 Score =  1400 bits (3625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/1670 (48%), Positives = 1103/1670 (66%), Gaps = 52/1670 (3%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGL---  173
             D+L+NFP +++VS+ + GVPF+LL SI F + SLL   SK WP++FF+GL+    GL   
Sbjct  968   DILKNFPSVITVSQDLQGVPFALLSSISFHDRSLLARASKLWPDIFFSGLQRV--GLMIH  1025

Query  174   QEGRTEEFGDIDSM----------------EFASAALSLFLKEASLCMLFPITLSIYKSD  305
              +G+ ++   I S                 E AS A SLFL++A   +LFP  ++I    
Sbjct  1026  SKGKGDDNCRIPSHSLSAEEIFPKTDFGLSESASVAFSLFLQQAPFHVLFPAIMNIDGPY  1085

Query  306   LSTQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIV  485
             L     +  LLLA LSE+T D+++ S  +VLFW +Q    YR+ PL ELE L E+CF +V
Sbjct  1086  LLEPSKVQQLLLAKLSEQTTDYLILSLRHVLFWIHQIRSYYRIRPLGELEHLFEVCFILV  1145

Query  486   DRMLRQFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTF  662
             +RML + L  + D  S C+ ++ +P   VQE+ E IF HP V  SL CPL C+ + T   
Sbjct  1146  ERMLDELLVLRPD--SDCSTTIGVPFSTVQEVAEIIFCHPAVMVSLSCPLSCHEELTKGT  1203

Query  663   SGDSMDKFLESNKWRVIHKMDLHVINLLRTTFE-LLYFCDGQT--SSFEACHARQVTKAF  833
              GDS++ FL S+K  V HKMD HV+NLL +T + L+  CDGQ   S  +    +Q+ K F
Sbjct  1204  IGDSLETFLRSSKHSV-HKMDHHVLNLLISTSDYLVALCDGQNPISKVDDSAKKQLVKVF  1262

Query  834   KNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLE  1013
             K ++Q+L L  + R D CI +K+  P L A YA H L  FI PF+L EL +WMFSR+DL 
Sbjct  1263  KALLQRLLLELRSRFDVCIRTKNFVPFLQAFYASHILSHFISPFKLFELAYWMFSRVDLN  1322

Query  1014  DNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKI  1193
             D +  +    S L V   IA   FD LS+    P +++   DLFW M E+ FDI++ EKI
Sbjct  1323  DLTTGEFDNMSALSVVFCIASGAFDMLSSYFQHPITKKVQFDLFWEMEEKSFDIIVFEKI  1382

Query  1194  LLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAI--SRFIVNIPVNLLSY  1367
              ++  E AT   L+ AD+CLLKA KV+   K  Q  +  L +++  SR IV+ PV ++S+
Sbjct  1383  YMKALEFATCFKLEFADVCLLKAVKVMYRQKFEQHQSFLLPLSLVSSRVIVSTPVKMISH  1442

Query  1368  CMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLML  1547
             C+ + +  +A+LLFL  E+SPLH S+FGHL SG+++K +  + N +     PSD   +ML
Sbjct  1443  CINRPSMIRAKLLFLLIEVSPLHSSVFGHLFSGLLNKGLPHKDNVVE---TPSDEGFMML  1499

Query  1548  LPTVFLYLDSVLIKAGSQVKY-FEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPL  1724
             LP    YL S  +K G Q    F+ I S Y RILL  F DWK +V+R +F IE  + LP 
Sbjct  1500  LPAALSYLKSTSLKFGKQYYTCFKGIPSLYSRILLDGFLDWKGFVSRSIFQIEDGEFLPS  1559

Query  1725  SIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPS  1904
             S E+  ++ + +LL +S+ M+    A +G+ +K + R +LFD + P  S     LD D S
Sbjct  1560  STEDLSNLVNSSLLGKSIHMLWFYFAFSGHSMKKKKRFKLFDVIFPC-SGQDGMLDCDVS  1618

Query  1905  QVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKM---ETCAELH-STLDV  2072
             ++ + SL QSLNFVNR VAKI+LCR LLFP   +  S  KE      +T  E+  +  D 
Sbjct  1619  EIDSYSLNQSLNFVNRVVAKISLCRMLLFPGDCQVKSLSKESDGPVEDTPLEMGLNREDS  1678

Query  2073  SRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGC  2249
             SRIRL+ +LV++W+KIVE+F   +DNS ++   +C  +F+FLEV ILRN++EL++EMH  
Sbjct  1679  SRIRLINILVNTWQKIVERFSCVSDNSGKVTDTDCLPLFKFLEVFILRNVLELAREMHNS  1738

Query  2250  LVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFET  2429
             L++L SLPF+ KL + +  HRF+D  TL+ LR +++SLSEGKFS V ++QL++AHSQF  
Sbjct  1739  LIQLHSLPFLEKLTRLSLLHRFEDATTLKMLRSVLTSLSEGKFSHVLLLQLLLAHSQFAP  1798

Query  2430  AICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLL  2609
              I S + S G SQ+G+   P+ S++RS      +  +I   +N + S   +KQLE+IKLL
Sbjct  1799  TIQSVSKSPGCSQVGVFSKPMSSILRSLTFTCTDQGTIDGNNNFERSDLCVKQLEVIKLL  1858

Query  2610  RVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISD-SN  2786
             R+L   K      +  + I IN R+L+ LLLSSY A L ++D EI++L++EI+S     +
Sbjct  1859  RLLLCFKGHWDGSDLEKNIDINARELISLLLSSYGAMLNEVDLEIYSLMHEIESNDRLKS  1918

Query  2787  ISIAEWDYLWGNAVVKARKER-ELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
              SIA+ DYLWG++ ++ RKER + ++  + N+ DAE  E+ ++ QFRENLPIDPK+C +T
Sbjct  1919  GSIADMDYLWGSSALRIRKERVQELEISANNILDAEAVEERQRSQFRENLPIDPKLCVNT  1978

Query  2964  VLYFPYGR--PNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYI  3137
             VLYFPY R   +GP  +NKV  D    M +     V N   YDP+FIL  S H LSM YI
Sbjct  1979  VLYFPYNRTASDGPISLNKVHPDNVKDMIQGYPPHVENVPRYDPVFILHFSIHSLSMRYI  2038

Query  3138  EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQ  3317
             EPVEF+ LGLLAV+  S+SSPDD  RKLGY  L +FKNALE CQK+KDVM+L+LLL+Y+Q
Sbjct  2039  EPVEFSALGLLAVAFVSLSSPDDMIRKLGYETLGRFKNALEMCQKRKDVMQLRLLLTYMQ  2098

Query  3318  NCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWS  3497
             N IEE WQ+IPSVTAIF AEASF+LLDPSH+HY+TI+K LM+S  VN+K IPLF N +WS
Sbjct  2099  NGIEEPWQRIPSVTAIFAAEASFILLDPSHEHYSTISKLLMRSTGVNMKCIPLFNNFIWS  2158

Query  3498  DSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVK  3677
              S++F++ERLWILR+ Y+GLN +DD  IYIRNSI ET+LSFY SP +DNESKELI+Q VK
Sbjct  2159  SSINFKSERLWILRLSYAGLNLEDDAQIYIRNSILETILSFYASPFSDNESKELILQIVK  2218

Query  3678  KSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRH  3857
             KS KL +MAR+L+E+CGLISWLSS ++ F        + F   Q  +V EV+N +I  R+
Sbjct  2219  KSVKLHKMARYLVEHCGLISWLSSALSFFSERLSGDQRSFWLKQLTIVTEVINNVISSRN  2278

Query  3858  TVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQP  4037
              + WLQK ALEQLSE++ HL ++L+   Q++K++ T    ILQIL  T K SQKRK+YQP
Sbjct  2279  IIGWLQKDALEQLSEVALHLYKLLIGAVQLMKDNVTLVNSILQILISTLKFSQKRKIYQP  2338

Query  4038  HFTLSVEGLFHLCEA-IDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWA  4214
              FT+S+EGLF + +A +DV      SP ++ GL+ ILMS+PP+ I QM  +++ +F+ W 
Sbjct  2339  RFTISIEGLFKIYQAVVDVSSVPRSSPASEFGLKVILMSSPPLNIFQMKQEELQEFVGWT  2398

Query  4215  MSIALQSETKGVLQVEKCCFPLNVSSEEE-TENSLISKLLRWLTASVILGKISYKLSKLD  4391
             +S ALQ E  G LQ+ +      V SEEE +++SL+SKLLRWLTASVILG +S+K + LD
Sbjct  2399  ISTALQPECTGTLQLAESYLHFRVFSEEEPSQDSLLSKLLRWLTASVILGMLSWKSTDLD  2458

Query  4392  SSHSCDRSKLINLHCLLEWNEESDRENGKE-FACQEILAASIFYLQQLLGTSFKLLPSAV  4568
               +  +RS    L  LLE  ++   ENG+  F C+EILAASIFYLQQLLG + ++LPS V
Sbjct  2459  -INILERSNSKTLLSLLEHVKKGSGENGRNAFHCEEILAASIFYLQQLLGLNSRVLPSVV  2517

Query  4569  SALCLLLLKNPA-SSGSEVLIG---NAAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLT  4736
             SALCLLLL + + S+GSE ++G   + A+LCS+I CP EAN AWRWSFYQPWKD +S  T
Sbjct  2518  SALCLLLLSDASNSAGSEFMLGHESHVASLCSRIHCPVEANPAWRWSFYQPWKDLTSEPT  2577

Query  4737  DSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             D +K++E+HACQ LL+V S  L + SL +  +S +DVE  GV++WERSI+
Sbjct  2578  DLQKMDELHACQSLLVVISNFLGKKSLDAPFLSHQDVENSGVYKWERSII  2627



>ref|XP_010644440.1| PREDICTED: uncharacterized protein LOC100264016 isoform X3 [Vitis 
vinifera]
Length=2632

 Score =  1400 bits (3624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/1670 (48%), Positives = 1103/1670 (66%), Gaps = 52/1670 (3%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGL---  173
             D+L+NFP +++VS+ + GVPF+LL SI F + SLL   SK WP++FF+GL+    GL   
Sbjct  961   DILKNFPSVITVSQDLQGVPFALLSSISFHDRSLLARASKLWPDIFFSGLQRV--GLMIH  1018

Query  174   QEGRTEEFGDIDSM----------------EFASAALSLFLKEASLCMLFPITLSIYKSD  305
              +G+ ++   I S                 E AS A SLFL++A   +LFP  ++I    
Sbjct  1019  SKGKGDDNCRIPSHSLSAEEIFPKTDFGLSESASVAFSLFLQQAPFHVLFPAIMNIDGPY  1078

Query  306   LSTQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIV  485
             L     +  LLLA LSE+T D+++ S  +VLFW +Q    YR+ PL ELE L E+CF +V
Sbjct  1079  LLEPSKVQQLLLAKLSEQTTDYLILSLRHVLFWIHQIRSYYRIRPLGELEHLFEVCFILV  1138

Query  486   DRMLRQFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTF  662
             +RML + L  + D  S C+ ++ +P   VQE+ E IF HP V  SL CPL C+ + T   
Sbjct  1139  ERMLDELLVLRPD--SDCSTTIGVPFSTVQEVAEIIFCHPAVMVSLSCPLSCHEELTKGT  1196

Query  663   SGDSMDKFLESNKWRVIHKMDLHVINLLRTTFE-LLYFCDGQT--SSFEACHARQVTKAF  833
              GDS++ FL S+K  V HKMD HV+NLL +T + L+  CDGQ   S  +    +Q+ K F
Sbjct  1197  IGDSLETFLRSSKHSV-HKMDHHVLNLLISTSDYLVALCDGQNPISKVDDSAKKQLVKVF  1255

Query  834   KNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLE  1013
             K ++Q+L L  + R D CI +K+  P L A YA H L  FI PF+L EL +WMFSR+DL 
Sbjct  1256  KALLQRLLLELRSRFDVCIRTKNFVPFLQAFYASHILSHFISPFKLFELAYWMFSRVDLN  1315

Query  1014  DNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKI  1193
             D +  +    S L V   IA   FD LS+    P +++   DLFW M E+ FDI++ EKI
Sbjct  1316  DLTTGEFDNMSALSVVFCIASGAFDMLSSYFQHPITKKVQFDLFWEMEEKSFDIIVFEKI  1375

Query  1194  LLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAI--SRFIVNIPVNLLSY  1367
              ++  E AT   L+ AD+CLLKA KV+   K  Q  +  L +++  SR IV+ PV ++S+
Sbjct  1376  YMKALEFATCFKLEFADVCLLKAVKVMYRQKFEQHQSFLLPLSLVSSRVIVSTPVKMISH  1435

Query  1368  CMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLML  1547
             C+ + +  +A+LLFL  E+SPLH S+FGHL SG+++K +  + N +     PSD   +ML
Sbjct  1436  CINRPSMIRAKLLFLLIEVSPLHSSVFGHLFSGLLNKGLPHKDNVVE---TPSDEGFMML  1492

Query  1548  LPTVFLYLDSVLIKAGSQVKY-FEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPL  1724
             LP    YL S  +K G Q    F+ I S Y RILL  F DWK +V+R +F IE  + LP 
Sbjct  1493  LPAALSYLKSTSLKFGKQYYTCFKGIPSLYSRILLDGFLDWKGFVSRSIFQIEDGEFLPS  1552

Query  1725  SIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPS  1904
             S E+  ++ + +LL +S+ M+    A +G+ +K + R +LFD + P  S     LD D S
Sbjct  1553  STEDLSNLVNSSLLGKSIHMLWFYFAFSGHSMKKKKRFKLFDVIFPC-SGQDGMLDCDVS  1611

Query  1905  QVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKM---ETCAELH-STLDV  2072
             ++ + SL QSLNFVNR VAKI+LCR LLFP   +  S  KE      +T  E+  +  D 
Sbjct  1612  EIDSYSLNQSLNFVNRVVAKISLCRMLLFPGDCQVKSLSKESDGPVEDTPLEMGLNREDS  1671

Query  2073  SRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGC  2249
             SRIRL+ +LV++W+KIVE+F   +DNS ++   +C  +F+FLEV ILRN++EL++EMH  
Sbjct  1672  SRIRLINILVNTWQKIVERFSCVSDNSGKVTDTDCLPLFKFLEVFILRNVLELAREMHNS  1731

Query  2250  LVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFET  2429
             L++L SLPF+ KL + +  HRF+D  TL+ LR +++SLSEGKFS V ++QL++AHSQF  
Sbjct  1732  LIQLHSLPFLEKLTRLSLLHRFEDATTLKMLRSVLTSLSEGKFSHVLLLQLLLAHSQFAP  1791

Query  2430  AICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLL  2609
              I S + S G SQ+G+   P+ S++RS      +  +I   +N + S   +KQLE+IKLL
Sbjct  1792  TIQSVSKSPGCSQVGVFSKPMSSILRSLTFTCTDQGTIDGNNNFERSDLCVKQLEVIKLL  1851

Query  2610  RVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISD-SN  2786
             R+L   K      +  + I IN R+L+ LLLSSY A L ++D EI++L++EI+S     +
Sbjct  1852  RLLLCFKGHWDGSDLEKNIDINARELISLLLSSYGAMLNEVDLEIYSLMHEIESNDRLKS  1911

Query  2787  ISIAEWDYLWGNAVVKARKER-ELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
              SIA+ DYLWG++ ++ RKER + ++  + N+ DAE  E+ ++ QFRENLPIDPK+C +T
Sbjct  1912  GSIADMDYLWGSSALRIRKERVQELEISANNILDAEAVEERQRSQFRENLPIDPKLCVNT  1971

Query  2964  VLYFPYGR--PNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYI  3137
             VLYFPY R   +GP  +NKV  D    M +     V N   YDP+FIL  S H LSM YI
Sbjct  1972  VLYFPYNRTASDGPISLNKVHPDNVKDMIQGYPPHVENVPRYDPVFILHFSIHSLSMRYI  2031

Query  3138  EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQ  3317
             EPVEF+ LGLLAV+  S+SSPDD  RKLGY  L +FKNALE CQK+KDVM+L+LLL+Y+Q
Sbjct  2032  EPVEFSALGLLAVAFVSLSSPDDMIRKLGYETLGRFKNALEMCQKRKDVMQLRLLLTYMQ  2091

Query  3318  NCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWS  3497
             N IEE WQ+IPSVTAIF AEASF+LLDPSH+HY+TI+K LM+S  VN+K IPLF N +WS
Sbjct  2092  NGIEEPWQRIPSVTAIFAAEASFILLDPSHEHYSTISKLLMRSTGVNMKCIPLFNNFIWS  2151

Query  3498  DSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVK  3677
              S++F++ERLWILR+ Y+GLN +DD  IYIRNSI ET+LSFY SP +DNESKELI+Q VK
Sbjct  2152  SSINFKSERLWILRLSYAGLNLEDDAQIYIRNSILETILSFYASPFSDNESKELILQIVK  2211

Query  3678  KSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRH  3857
             KS KL +MAR+L+E+CGLISWLSS ++ F        + F   Q  +V EV+N +I  R+
Sbjct  2212  KSVKLHKMARYLVEHCGLISWLSSALSFFSERLSGDQRSFWLKQLTIVTEVINNVISSRN  2271

Query  3858  TVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQP  4037
              + WLQK ALEQLSE++ HL ++L+   Q++K++ T    ILQIL  T K SQKRK+YQP
Sbjct  2272  IIGWLQKDALEQLSEVALHLYKLLIGAVQLMKDNVTLVNSILQILISTLKFSQKRKIYQP  2331

Query  4038  HFTLSVEGLFHLCEA-IDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWA  4214
              FT+S+EGLF + +A +DV      SP ++ GL+ ILMS+PP+ I QM  +++ +F+ W 
Sbjct  2332  RFTISIEGLFKIYQAVVDVSSVPRSSPASEFGLKVILMSSPPLNIFQMKQEELQEFVGWT  2391

Query  4215  MSIALQSETKGVLQVEKCCFPLNVSSEEE-TENSLISKLLRWLTASVILGKISYKLSKLD  4391
             +S ALQ E  G LQ+ +      V SEEE +++SL+SKLLRWLTASVILG +S+K + LD
Sbjct  2392  ISTALQPECTGTLQLAESYLHFRVFSEEEPSQDSLLSKLLRWLTASVILGMLSWKSTDLD  2451

Query  4392  SSHSCDRSKLINLHCLLEWNEESDRENGKE-FACQEILAASIFYLQQLLGTSFKLLPSAV  4568
               +  +RS    L  LLE  ++   ENG+  F C+EILAASIFYLQQLLG + ++LPS V
Sbjct  2452  -INILERSNSKTLLSLLEHVKKGSGENGRNAFHCEEILAASIFYLQQLLGLNSRVLPSVV  2510

Query  4569  SALCLLLLKNPA-SSGSEVLIG---NAAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLT  4736
             SALCLLLL + + S+GSE ++G   + A+LCS+I CP EAN AWRWSFYQPWKD +S  T
Sbjct  2511  SALCLLLLSDASNSAGSEFMLGHESHVASLCSRIHCPVEANPAWRWSFYQPWKDLTSEPT  2570

Query  4737  DSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             D +K++E+HACQ LL+V S  L + SL +  +S +DVE  GV++WERSI+
Sbjct  2571  DLQKMDELHACQSLLVVISNFLGKKSLDAPFLSHQDVENSGVYKWERSII  2620



>ref|XP_010644441.1| PREDICTED: uncharacterized protein LOC100264016 isoform X4 [Vitis 
vinifera]
Length=2239

 Score =  1399 bits (3622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/1670 (48%), Positives = 1103/1670 (66%), Gaps = 52/1670 (3%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGL---  173
             D+L+NFP +++VS+ + GVPF+LL SI F + SLL   SK WP++FF+GL+    GL   
Sbjct  568   DILKNFPSVITVSQDLQGVPFALLSSISFHDRSLLARASKLWPDIFFSGLQRV--GLMIH  625

Query  174   QEGRTEEFGDIDSM----------------EFASAALSLFLKEASLCMLFPITLSIYKSD  305
              +G+ ++   I S                 E AS A SLFL++A   +LFP  ++I    
Sbjct  626   SKGKGDDNCRIPSHSLSAEEIFPKTDFGLSESASVAFSLFLQQAPFHVLFPAIMNIDGPY  685

Query  306   LSTQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIV  485
             L     +  LLLA LSE+T D+++ S  +VLFW +Q    YR+ PL ELE L E+CF +V
Sbjct  686   LLEPSKVQQLLLAKLSEQTTDYLILSLRHVLFWIHQIRSYYRIRPLGELEHLFEVCFILV  745

Query  486   DRMLRQFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTF  662
             +RML + L  + D  S C+ ++ +P   VQE+ E IF HP V  SL CPL C+ + T   
Sbjct  746   ERMLDELLVLRPD--SDCSTTIGVPFSTVQEVAEIIFCHPAVMVSLSCPLSCHEELTKGT  803

Query  663   SGDSMDKFLESNKWRVIHKMDLHVINLLRTTFE-LLYFCDGQT--SSFEACHARQVTKAF  833
              GDS++ FL S+K  V HKMD HV+NLL +T + L+  CDGQ   S  +    +Q+ K F
Sbjct  804   IGDSLETFLRSSKHSV-HKMDHHVLNLLISTSDYLVALCDGQNPISKVDDSAKKQLVKVF  862

Query  834   KNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLE  1013
             K ++Q+L L  + R D CI +K+  P L A YA H L  FI PF+L EL +WMFSR+DL 
Sbjct  863   KALLQRLLLELRSRFDVCIRTKNFVPFLQAFYASHILSHFISPFKLFELAYWMFSRVDLN  922

Query  1014  DNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKI  1193
             D +  +    S L V   IA   FD LS+    P +++   DLFW M E+ FDI++ EKI
Sbjct  923   DLTTGEFDNMSALSVVFCIASGAFDMLSSYFQHPITKKVQFDLFWEMEEKSFDIIVFEKI  982

Query  1194  LLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAI--SRFIVNIPVNLLSY  1367
              ++  E AT   L+ AD+CLLKA KV+   K  Q  +  L +++  SR IV+ PV ++S+
Sbjct  983   YMKALEFATCFKLEFADVCLLKAVKVMYRQKFEQHQSFLLPLSLVSSRVIVSTPVKMISH  1042

Query  1368  CMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLML  1547
             C+ + +  +A+LLFL  E+SPLH S+FGHL SG+++K +  + N +     PSD   +ML
Sbjct  1043  CINRPSMIRAKLLFLLIEVSPLHSSVFGHLFSGLLNKGLPHKDNVVE---TPSDEGFMML  1099

Query  1548  LPTVFLYLDSVLIKAGSQVKY-FEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPL  1724
             LP    YL S  +K G Q    F+ I S Y RILL  F DWK +V+R +F IE  + LP 
Sbjct  1100  LPAALSYLKSTSLKFGKQYYTCFKGIPSLYSRILLDGFLDWKGFVSRSIFQIEDGEFLPS  1159

Query  1725  SIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPS  1904
             S E+  ++ + +LL +S+ M+    A +G+ +K + R +LFD + P  S     LD D S
Sbjct  1160  STEDLSNLVNSSLLGKSIHMLWFYFAFSGHSMKKKKRFKLFDVIFPC-SGQDGMLDCDVS  1218

Query  1905  QVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKM---ETCAELH-STLDV  2072
             ++ + SL QSLNFVNR VAKI+LCR LLFP   +  S  KE      +T  E+  +  D 
Sbjct  1219  EIDSYSLNQSLNFVNRVVAKISLCRMLLFPGDCQVKSLSKESDGPVEDTPLEMGLNREDS  1278

Query  2073  SRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGC  2249
             SRIRL+ +LV++W+KIVE+F   +DNS ++   +C  +F+FLEV ILRN++EL++EMH  
Sbjct  1279  SRIRLINILVNTWQKIVERFSCVSDNSGKVTDTDCLPLFKFLEVFILRNVLELAREMHNS  1338

Query  2250  LVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFET  2429
             L++L SLPF+ KL + +  HRF+D  TL+ LR +++SLSEGKFS V ++QL++AHSQF  
Sbjct  1339  LIQLHSLPFLEKLTRLSLLHRFEDATTLKMLRSVLTSLSEGKFSHVLLLQLLLAHSQFAP  1398

Query  2430  AICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLL  2609
              I S + S G SQ+G+   P+ S++RS      +  +I   +N + S   +KQLE+IKLL
Sbjct  1399  TIQSVSKSPGCSQVGVFSKPMSSILRSLTFTCTDQGTIDGNNNFERSDLCVKQLEVIKLL  1458

Query  2610  RVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISD-SN  2786
             R+L   K      +  + I IN R+L+ LLLSSY A L ++D EI++L++EI+S     +
Sbjct  1459  RLLLCFKGHWDGSDLEKNIDINARELISLLLSSYGAMLNEVDLEIYSLMHEIESNDRLKS  1518

Query  2787  ISIAEWDYLWGNAVVKARKER-ELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
              SIA+ DYLWG++ ++ RKER + ++  + N+ DAE  E+ ++ QFRENLPIDPK+C +T
Sbjct  1519  GSIADMDYLWGSSALRIRKERVQELEISANNILDAEAVEERQRSQFRENLPIDPKLCVNT  1578

Query  2964  VLYFPYGR--PNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYI  3137
             VLYFPY R   +GP  +NKV  D    M +     V N   YDP+FIL  S H LSM YI
Sbjct  1579  VLYFPYNRTASDGPISLNKVHPDNVKDMIQGYPPHVENVPRYDPVFILHFSIHSLSMRYI  1638

Query  3138  EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQ  3317
             EPVEF+ LGLLAV+  S+SSPDD  RKLGY  L +FKNALE CQK+KDVM+L+LLL+Y+Q
Sbjct  1639  EPVEFSALGLLAVAFVSLSSPDDMIRKLGYETLGRFKNALEMCQKRKDVMQLRLLLTYMQ  1698

Query  3318  NCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWS  3497
             N IEE WQ+IPSVTAIF AEASF+LLDPSH+HY+TI+K LM+S  VN+K IPLF N +WS
Sbjct  1699  NGIEEPWQRIPSVTAIFAAEASFILLDPSHEHYSTISKLLMRSTGVNMKCIPLFNNFIWS  1758

Query  3498  DSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVK  3677
              S++F++ERLWILR+ Y+GLN +DD  IYIRNSI ET+LSFY SP +DNESKELI+Q VK
Sbjct  1759  SSINFKSERLWILRLSYAGLNLEDDAQIYIRNSILETILSFYASPFSDNESKELILQIVK  1818

Query  3678  KSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRH  3857
             KS KL +MAR+L+E+CGLISWLSS ++ F        + F   Q  +V EV+N +I  R+
Sbjct  1819  KSVKLHKMARYLVEHCGLISWLSSALSFFSERLSGDQRSFWLKQLTIVTEVINNVISSRN  1878

Query  3858  TVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQP  4037
              + WLQK ALEQLSE++ HL ++L+   Q++K++ T    ILQIL  T K SQKRK+YQP
Sbjct  1879  IIGWLQKDALEQLSEVALHLYKLLIGAVQLMKDNVTLVNSILQILISTLKFSQKRKIYQP  1938

Query  4038  HFTLSVEGLFHLCEA-IDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWA  4214
              FT+S+EGLF + +A +DV      SP ++ GL+ ILMS+PP+ I QM  +++ +F+ W 
Sbjct  1939  RFTISIEGLFKIYQAVVDVSSVPRSSPASEFGLKVILMSSPPLNIFQMKQEELQEFVGWT  1998

Query  4215  MSIALQSETKGVLQVEKCCFPLNVSSEEE-TENSLISKLLRWLTASVILGKISYKLSKLD  4391
             +S ALQ E  G LQ+ +      V SEEE +++SL+SKLLRWLTASVILG +S+K + LD
Sbjct  1999  ISTALQPECTGTLQLAESYLHFRVFSEEEPSQDSLLSKLLRWLTASVILGMLSWKSTDLD  2058

Query  4392  SSHSCDRSKLINLHCLLEWNEESDRENGKE-FACQEILAASIFYLQQLLGTSFKLLPSAV  4568
               +  +RS    L  LLE  ++   ENG+  F C+EILAASIFYLQQLLG + ++LPS V
Sbjct  2059  -INILERSNSKTLLSLLEHVKKGSGENGRNAFHCEEILAASIFYLQQLLGLNSRVLPSVV  2117

Query  4569  SALCLLLLKNPA-SSGSEVLIG---NAAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLT  4736
             SALCLLLL + + S+GSE ++G   + A+LCS+I CP EAN AWRWSFYQPWKD +S  T
Sbjct  2118  SALCLLLLSDASNSAGSEFMLGHESHVASLCSRIHCPVEANPAWRWSFYQPWKDLTSEPT  2177

Query  4737  DSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             D +K++E+HACQ LL+V S  L + SL +  +S +DVE  GV++WERSI+
Sbjct  2178  DLQKMDELHACQSLLVVISNFLGKKSLDAPFLSHQDVENSGVYKWERSII  2227



>ref|XP_010644439.1| PREDICTED: uncharacterized protein LOC100264016 isoform X2 [Vitis 
vinifera]
Length=2637

 Score =  1399 bits (3620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 799/1669 (48%), Positives = 1102/1669 (66%), Gaps = 52/1669 (3%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGL---  173
             D+L+NFP +++VS+ + GVPF+LL SI F + SLL   SK WP++FF+GL+    GL   
Sbjct  968   DILKNFPSVITVSQDLQGVPFALLSSISFHDRSLLARASKLWPDIFFSGLQRV--GLMIH  1025

Query  174   QEGRTEEFGDIDSM----------------EFASAALSLFLKEASLCMLFPITLSIYKSD  305
              +G+ ++   I S                 E AS A SLFL++A   +LFP  ++I    
Sbjct  1026  SKGKGDDNCRIPSHSLSAEEIFPKTDFGLSESASVAFSLFLQQAPFHVLFPAIMNIDGPY  1085

Query  306   LSTQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIV  485
             L     +  LLLA LSE+T D+++ S  +VLFW +Q    YR+ PL ELE L E+CF +V
Sbjct  1086  LLEPSKVQQLLLAKLSEQTTDYLILSLRHVLFWIHQIRSYYRIRPLGELEHLFEVCFILV  1145

Query  486   DRMLRQFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTF  662
             +RML + L  + D  S C+ ++ +P   VQE+ E IF HP V  SL CPL C+ + T   
Sbjct  1146  ERMLDELLVLRPD--SDCSTTIGVPFSTVQEVAEIIFCHPAVMVSLSCPLSCHEELTKGT  1203

Query  663   SGDSMDKFLESNKWRVIHKMDLHVINLLRTTFE-LLYFCDGQT--SSFEACHARQVTKAF  833
              GDS++ FL S+K  V HKMD HV+NLL +T + L+  CDGQ   S  +    +Q+ K F
Sbjct  1204  IGDSLETFLRSSKHSV-HKMDHHVLNLLISTSDYLVALCDGQNPISKVDDSAKKQLVKVF  1262

Query  834   KNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLE  1013
             K ++Q+L L  + R D CI +K+  P L A YA H L  FI PF+L EL +WMFSR+DL 
Sbjct  1263  KALLQRLLLELRSRFDVCIRTKNFVPFLQAFYASHILSHFISPFKLFELAYWMFSRVDLN  1322

Query  1014  DNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKI  1193
             D +  +    S L V   IA   FD LS+    P +++   DLFW M E+ FDI++ EKI
Sbjct  1323  DLTTGEFDNMSALSVVFCIASGAFDMLSSYFQHPITKKVQFDLFWEMEEKSFDIIVFEKI  1382

Query  1194  LLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAI--SRFIVNIPVNLLSY  1367
              ++  E AT   L+ AD+CLLKA KV+   K  Q  +  L +++  SR IV+ PV ++S+
Sbjct  1383  YMKALEFATCFKLEFADVCLLKAVKVMYRQKFEQHQSFLLPLSLVSSRVIVSTPVKMISH  1442

Query  1368  CMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLML  1547
             C+ + +  +A+LLFL  E+SPLH S+FGHL SG+++K +  + N +     PSD   +ML
Sbjct  1443  CINRPSMIRAKLLFLLIEVSPLHSSVFGHLFSGLLNKGLPHKDNVVE---TPSDEGFMML  1499

Query  1548  LPTVFLYLDSVLIKAGSQVKY-FEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPL  1724
             LP    YL S  +K G Q    F+ I S Y RILL  F DWK +V+R +F IE  + LP 
Sbjct  1500  LPAALSYLKSTSLKFGKQYYTCFKGIPSLYSRILLDGFLDWKGFVSRSIFQIEDGEFLPS  1559

Query  1725  SIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPS  1904
             S E+  ++ + +LL +S+ M+    A +G+ +K + R +LFD + P  S     LD D S
Sbjct  1560  STEDLSNLVNSSLLGKSIHMLWFYFAFSGHSMKKKKRFKLFDVIFPC-SGQDGMLDCDVS  1618

Query  1905  QVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKM---ETCAELH-STLDV  2072
             ++ + SL QSLNFVNR VAKI+LCR LLFP   +  S  KE      +T  E+  +  D 
Sbjct  1619  EIDSYSLNQSLNFVNRVVAKISLCRMLLFPGDCQVKSLSKESDGPVEDTPLEMGLNREDS  1678

Query  2073  SRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGC  2249
             SRIRL+ +LV++W+KIVE+F   +DNS ++   +C  +F+FLEV ILRN++EL++EMH  
Sbjct  1679  SRIRLINILVNTWQKIVERFSCVSDNSGKVTDTDCLPLFKFLEVFILRNVLELAREMHNS  1738

Query  2250  LVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFET  2429
             L++L SLPF+ KL + +  HRF+D  TL+ LR +++SLSEGKFS V ++QL++AHSQF  
Sbjct  1739  LIQLHSLPFLEKLTRLSLLHRFEDATTLKMLRSVLTSLSEGKFSHVLLLQLLLAHSQFAP  1798

Query  2430  AICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLL  2609
              I S + S G SQ+G+   P+ S++RS      +  +I   +N + S   +KQLE+IKLL
Sbjct  1799  TIQSVSKSPGCSQVGVFSKPMSSILRSLTFTCTDQGTIDGNNNFERSDLCVKQLEVIKLL  1858

Query  2610  RVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISD-SN  2786
             R+L   K      +  + I IN R+L+ LLLSSY A L ++D EI++L++EI+S     +
Sbjct  1859  RLLLCFKGHWDGSDLEKNIDINARELISLLLSSYGAMLNEVDLEIYSLMHEIESNDRLKS  1918

Query  2787  ISIAEWDYLWGNAVVKARKER-ELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
              SIA+ DYLWG++ ++ RKER + ++  + N+ DAE  E+ ++ QFRENLPIDPK+C +T
Sbjct  1919  GSIADMDYLWGSSALRIRKERVQELEISANNILDAEAVEERQRSQFRENLPIDPKLCVNT  1978

Query  2964  VLYFPYGR--PNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYI  3137
             VLYFPY R   +GP  +NKV  D    M +     V N   YDP+FIL  S H LSM YI
Sbjct  1979  VLYFPYNRTASDGPISLNKVHPDNVKDMIQGYPPHVENVPRYDPVFILHFSIHSLSMRYI  2038

Query  3138  EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQ  3317
             EPVEF+ LGLLAV+  S+SSPDD  RKLGY  L +FKNALE CQK+KDVM+L+LLL+Y+Q
Sbjct  2039  EPVEFSALGLLAVAFVSLSSPDDMIRKLGYETLGRFKNALEMCQKRKDVMQLRLLLTYMQ  2098

Query  3318  NCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWS  3497
             N IEE WQ+IPSVTAIF AEASF+LLDPSH+HY+TI+K LM+S  VN+K IPLF N +WS
Sbjct  2099  NGIEEPWQRIPSVTAIFAAEASFILLDPSHEHYSTISKLLMRSTGVNMKCIPLFNNFIWS  2158

Query  3498  DSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVK  3677
              S++F++ERLWILR+ Y+GLN +DD  IYIRNSI ET+LSFY SP +DNESKELI+Q VK
Sbjct  2159  SSINFKSERLWILRLSYAGLNLEDDAQIYIRNSILETILSFYASPFSDNESKELILQIVK  2218

Query  3678  KSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRH  3857
             KS KL +MAR+L+E+CGLISWLSS ++ F        + F   Q  +V EV+N +I  R+
Sbjct  2219  KSVKLHKMARYLVEHCGLISWLSSALSFFSERLSGDQRSFWLKQLTIVTEVINNVISSRN  2278

Query  3858  TVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQP  4037
              + WLQK ALEQLSE++ HL ++L+   Q++K++ T    ILQIL  T K SQKRK+YQP
Sbjct  2279  IIGWLQKDALEQLSEVALHLYKLLIGAVQLMKDNVTLVNSILQILISTLKFSQKRKIYQP  2338

Query  4038  HFTLSVEGLFHLCEA-IDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWA  4214
              FT+S+EGLF + +A +DV      SP ++ GL+ ILMS+PP+ I QM  +++ +F+ W 
Sbjct  2339  RFTISIEGLFKIYQAVVDVSSVPRSSPASEFGLKVILMSSPPLNIFQMKQEELQEFVGWT  2398

Query  4215  MSIALQSETKGVLQVEKCCFPLNVSSEEE-TENSLISKLLRWLTASVILGKISYKLSKLD  4391
             +S ALQ E  G LQ+ +      V SEEE +++SL+SKLLRWLTASVILG +S+K + LD
Sbjct  2399  ISTALQPECTGTLQLAESYLHFRVFSEEEPSQDSLLSKLLRWLTASVILGMLSWKSTDLD  2458

Query  4392  SSHSCDRSKLINLHCLLEWNEESDRENGKE-FACQEILAASIFYLQQLLGTSFKLLPSAV  4568
               +  +RS    L  LLE  ++   ENG+  F C+EILAASIFYLQQLLG + ++LPS V
Sbjct  2459  -INILERSNSKTLLSLLEHVKKGSGENGRNAFHCEEILAASIFYLQQLLGLNSRVLPSVV  2517

Query  4569  SALCLLLLKNPASSGSEVLIG---NAAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTD  4739
             SALCLLLL + AS+ +E ++G   + A+LCS+I CP EAN AWRWSFYQPWKD +S  TD
Sbjct  2518  SALCLLLLSD-ASNSAEFMLGHESHVASLCSRIHCPVEANPAWRWSFYQPWKDLTSEPTD  2576

Query  4740  SEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
              +K++E+HACQ LL+V S  L + SL +  +S +DVE  GV++WERSI+
Sbjct  2577  LQKMDELHACQSLLVVISNFLGKKSLDAPFLSHQDVENSGVYKWERSII  2625



>ref|XP_011077283.1| PREDICTED: uncharacterized protein LOC105161334, partial [Sesamum 
indicum]
Length=2488

 Score =  1357 bits (3512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 764/1571 (49%), Positives = 1032/1571 (66%), Gaps = 34/1571 (2%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +LLQNFP+++S+S  +L VPFS+L SIFFLE S L DV K WP+MFF  L+S I   +  
Sbjct  932   ELLQNFPLVLSISSNLLEVPFSVLSSIFFLESSYLADVLKLWPDMFFAALDSVIHHTE--  989

Query  183   RTEE---FGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLS  353
             + EE     D+DSME AS A + +L+ A  C+LF          L  Q  L  LLL  ++
Sbjct  990   KKEECLCRVDLDSMEAASVAFACYLRNAPFCVLFSSIAQSSSLHLFEQSALVKLLLDKVT  1049

Query  354   ERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASS  533
             E   DH+VSS   VLFW N A   YRV  ++ELE+LSE CF + + +L+Q L    D   
Sbjct  1050  EMPSDHLVSSLCNVLFWINYASSYYRVRSMDELEILSETCFMLAEHLLKQLLVENTDTVG  1109

Query  534   KCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVI  713
                    P  C  + +E IF HP V ASL CPL  N +F+D+   ++ +KFLE  K   +
Sbjct  1110  AAHVKAPPLSCAVQAVEIIFSHPAVTASLNCPLSSNMEFSDSVFAETSEKFLELAK-EGL  1168

Query  714   HKMDLHVINLLRTTFELLY-FCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRTDKCI  890
             H+MD  V+ L+RT  ELL+   D Q S       ++++ A K + QKLF  FK+  D CI
Sbjct  1169  HRMDHRVLTLIRTVSELLFPMYDNQGSEEMTNGRKRISGACKVLQQKLFEVFKNNFDACI  1228

Query  891   ESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHI  1070
             +S+D  PL+P  YA++TL  FI PFELL LV+W FSRID  +++   S +   +   L++
Sbjct  1229  QSRDFKPLVPTFYALYTLIHFISPFELLGLVNWCFSRIDFNNSTLYLSSKRYAVFASLNL  1288

Query  1071  AGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMC  1250
             A   FD L A M +P  E        G  E  FD+ L E+I  QV +I+  + L++AD C
Sbjct  1289  ASCFFDFLLAYMGKPDPENKQYYFLDGTDEMHFDVSLFERIFFQVLDISRCVQLELADAC  1348

Query  1251  LLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSP  1430
             LLKA KV+   KV+Q  +   +M +SR +   PV+  +YC+ +IN+ KAEL+ L   MSP
Sbjct  1349  LLKAVKVINMRKVIQCPHLPSIMVLSRVMSGTPVSTFAYCLHKINRAKAELVHLIAGMSP  1408

Query  1431  LHLSIFGHLLSGMIDKQVHLQTNAIRETSNP-----SDPELLMLLPTVFLYLDSVLIKAG  1595
             LHLS+FG++ S ++DK   L  NAI  T  P     S+ EL+MLLPTVFLYL+SV+ K+G
Sbjct  1409  LHLSVFGYMFSEILDKS--LLPNAIG-TQEPCKYSFSNEELVMLLPTVFLYLNSVISKSG  1465

Query  1596  SQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSR  1772
              Q+ K FE IVS Y R+LL  FS WK +V+  +F+I     L  SIEEF+D+FS +LL +
Sbjct  1466  GQLCKPFETIVSVYGRVLLGGFSKWKIFVSGIIFEIGLDKPLTASIEEFLDLFSDSLLGK  1525

Query  1773  SVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNR  1952
             ++LMV+   AL   ++K E R+ LF+SVCP  S+  D  D+   + G   L+Q L FVNR
Sbjct  1526  AILMVRDHLALREDIMKSERRLSLFNSVCP--SSADDIFDYCCGETGLLLLKQPLEFVNR  1583

Query  1953  TVAKINLCRTLLFPEHNKFSSGLK-EDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEK  2129
              VAKI+ C+ +LF + ++    L+ E+K     ++   ++ SRI  L+ML++SW  IV  
Sbjct  1584  VVAKISFCKMILFSDDDQCHPQLEGEEKKVIAPQVIFDIEKSRIWFLRMLINSWMSIVRT  1643

Query  2130  FPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWH  2309
              P     S  ++ +N S+FRFLEV ++ NI+EL+KEMH  L+KLD LP+I +L ++   +
Sbjct  1644  IPDNISYSGNIDGQNISLFRFLEVFVMNNILELTKEMHDQLIKLDYLPYIEQLVRSFLLY  1703

Query  2310  RFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAI---CSSNLSTGISQLGLT  2480
             RF DP+TL+ LR +++ LSEG FS   +IQL++AHSQF  +I   C S +ST   Q GL 
Sbjct  1704  RFGDPVTLKMLRTVLTYLSEGAFSSASVIQLLLAHSQFAQSIHFPCQSLVST---QFGLV  1760

Query  2481  FTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQ  2660
             F P+ S++RS VIP    +S+  K+N   S+QHL  LEL+KL+RV+  + A+Q  +   +
Sbjct  1761  FAPMQSILRSLVIPHTQLDSLDGKNNKLTSQQHLYALELVKLVRVILHLYAQQRKVNLGE  1820

Query  2661  EIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDS-NISIAEWDYLWGNAVVKA  2837
             +IGIN R+LV+LLLSSY AT  ++D EI+NL+ EI++   S   ++++ DYLWG A +K 
Sbjct  1821  DIGINSRELVYLLLSSYGATCTEVDLEIYNLILEIEANDKSCAGTVSQLDYLWGVASLKV  1880

Query  2838  RKE-RELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNK  3014
             RK+  +     S +  + E  ED RK +FRENLPIDPK+CA TVLYFPY R    G +NK
Sbjct  1881  RKDCAQNKDMQSVDAENMEFVEDRRKTKFRENLPIDPKLCAQTVLYFPYNRFVNGGTLNK  1940

Query  3015  VQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASIS  3194
             +Q+DT  ++  +  +      IYDP+FILR S HCLS+ YIEP+EFA+LGLLAV+  SIS
Sbjct  1941  LQEDTATTVMHEARSTSDKLQIYDPVFILRFSIHCLSVSYIEPIEFASLGLLAVTFVSIS  2000

Query  3195  SPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIA  3374
             S DDD RKLGY  L KFK+ALEKCQKKKDV  L+LL+SYLQN IEE WQ+IPS+ A+F+A
Sbjct  2001  SADDDMRKLGYETLAKFKSALEKCQKKKDVAGLRLLVSYLQNGIEEPWQRIPSIIAMFVA  2060

Query  3375  EASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSG  3554
             EAS VLLDPSHD+Y+TI+KHLM  PSVN+K IPLFQNL WS SVSFR +RLW+LR+LY+G
Sbjct  2061  EASLVLLDPSHDNYSTISKHLMNFPSVNMKVIPLFQNLFWSSSVSFRADRLWMLRLLYTG  2120

Query  3555  LNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLI  3734
             LNT+DD  IY++NSIFE L+SFY SPL+DN+SKELIIQ VKK+A+L +    L+  CGLI
Sbjct  2121  LNTEDDAQIYVKNSIFEILMSFYTSPLSDNDSKELIIQIVKKAAQLHKAVWFLVRQCGLI  2180

Query  3735  SWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCH  3914
              WLSS+V+S  G +    K F   Q A+VLEVVN +   R+ VEWLQK+A+EQLSELS H
Sbjct  2181  LWLSSIVSSLYGSECQERKEFTLTQLAIVLEVVNCMTSPRYIVEWLQKHAMEQLSELSSH  2240

Query  3915  LCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVC  4094
             L ++LV G  ++KE  T    ILQILTL  K+SQKR++YQPHFTLS EGLF L EA++VC
Sbjct  2241  LYKLLV-GVDLIKEQRTLCDTILQILTLMLKISQKRRIYQPHFTLSEEGLFQLYEAVEVC  2299

Query  4095  CNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCF  4274
                  +  A  GL+A+LMSTPP  I +MD  K+ KF+ W ++ A+QS+   V + E   +
Sbjct  2300  SKTSCNSTAFLGLQAVLMSTPPATIFRMDQGKLLKFLRWTVTTAIQSKPTKVSEAEDSDY  2359

Query  4275  PLNVSSEEET-ENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWN  4451
              L   SE++T E+ L+SKLL WLTA+VIL K+S KLSKL+++   +R  L +L  LLE+ 
Sbjct  2360  HLMAVSEKKTPEDPLVSKLLCWLTAAVILRKVSCKLSKLNNNSFLERQNLDSLQSLLEYC  2419

Query  4452  EESDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIG  4631
             E    E+     C+++LAASIFYL Q+LG S  LLPSAVSALCLLL  N + S SE  +G
Sbjct  2420  EPGFGEDAG-CGCEDVLAASIFYLLQMLGFSHALLPSAVSALCLLLFSN-SPSESEFSVG  2477

Query  4632  NAAA---LCSK  4655
                +   LCSK
Sbjct  2478  RGISLPLLCSK  2488



>ref|XP_009595741.1| PREDICTED: uncharacterized protein LOC104091985 isoform X8 [Nicotiana 
tomentosiformis]
Length=2234

 Score =  1310 bits (3389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 701/1279 (55%), Positives = 914/1279 (71%), Gaps = 17/1279 (1%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM +FF EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  944   EIIQNFPLIMSVSNKLLGVPLSLLMQLFFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  1003

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S A S+FL  A   +LFP  L I   DLS Q GL NL +A LSE T
Sbjct  1004  RTMDCSVISSMDNKSNAFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLFMAKLSEET  1063

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++    T
Sbjct  1064  SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCGLDT  1123

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+D+F+ES K  V  KM
Sbjct  1124  FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIKDSVDQFVESAKLEV-SKM  1182

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC  Q SS E  HA + V  +FKNVV KL + FK + ++C++S
Sbjct  1183  DHHVHNLLKATSELWLSFCHSQGSSSEVYHANKHVISSFKNVVNKLVMAFKQKMNECMKS  1242

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  1243  KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  1299

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M QPH + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVAD+CLL
Sbjct  1300  SAFSHLAANMQQPHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADICLL  1358

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1359  KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITKRKAEILFLVADISPLH  1418

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ++LMLLPTV LYL+S+  K G Q+    
Sbjct  1419  LSVFGKLFSDMMNKYVAVKSCAVQQICGYSDEDMLMLLPTVILYLNSIPSKFGGQLCMLH  1478

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+ QL
Sbjct  1479  ENIVSFYWGILKQGFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVAQL  1536

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + RM +F+SVC  + +  D L+FD +Q G  S+E+SLN VNRTV KI L
Sbjct  1537  FFELRGDLVNVKKRMSIFNSVCSSEYS--DLLEFDLTQDGAYSVEESLNVVNRTVTKIRL  1594

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV SW+ IV++  +   + 
Sbjct  1595  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQSWQLIVKRCSLNVVDF  1654

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+EV +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DP TL
Sbjct  1655  SQIEVGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPTTL  1714

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS +S G S  GL FTPLPS+MRS+
Sbjct  1715  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIHSSPISAGHSHFGLIFTPLPSIMRSY  1774

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1775  V-PCIDQDALDLKDNFKLSEERARQLELVKLLKLLFQIRAQQCDIDNVKDIGINLRELVF  1833

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EIKS +D    S+A+ D+LW +A++K RKE ELVQT+S
Sbjct  1834  LLLSSYGASMSAIDLEIYSLLDEIKSANDLDEESMAKLDFLWSSALLKVRKENELVQTLS  1893

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +D R+I FREN+PIDPK CA+TVLYFPY R  G G+  K + D  D  +  
Sbjct  1894  RNLSEAEAVDDYRRIHFRENIPIDPKFCATTVLYFPYDRTVGAGIHRKPETDNPDFRYAV  1953

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1954  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  2013

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LEKCQK+KDVMRL+LL+SYLQN IEE WQKI S+TA+F+AEASFVLLDPSHD
Sbjct  2014  VLGRFKSTLEKCQKRKDVMRLRLLMSYLQNGIEEPWQKISSITAVFVAEASFVLLDPSHD  2073

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+ +LM+SPS N+K IPLF N  WS S +F  ERLWILR+LYSGLN +DD  IYIR
Sbjct  2074  HYSAISAYLMRSPSANMKGIPLFHNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIR  2133

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N+IFETLLSFYVSP++ +ESKELI+Q VKKS  + +MAR+L+E CGLISW S V++S   
Sbjct  2134  NAIFETLLSFYVSPISSHESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVISS---  2190

Query  3771  IKYDHWKGFPFAQFAVVLE  3827
             + +   +   F +  V+LE
Sbjct  2191  LSWSPCRRDSFVELTVILE  2209



>ref|XP_008226923.1| PREDICTED: uncharacterized protein LOC103326471 [Prunus mume]
Length=2502

 Score =  1290 bits (3339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 759/1663 (46%), Positives = 1067/1663 (64%), Gaps = 52/1663 (3%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS------  167
             +L+ FP ++ +S+ +LGVP SLL S FFLE +LL  VSK WPE+FF  L+ A+S      
Sbjct  824   ILKYFPSVMIISQFVLGVPVSLLSSRFFLEQTLLGSVSKLWPEIFFPALDMALSNSCCRG  883

Query  168   --------GLQEGRTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQG  323
                         G      D+D+ E ASAA S FLK+A   +LFP  +SI+    S    
Sbjct  884   RNNFSLDPASYAGEMIYNQDVDADEAASAAFSFFLKKAPFHVLFPAIMSIHGPS-SEPSK  942

Query  324   LHNLLLANLSE-RTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLR  500
             + +LLLA LSE  T  H +S    VLFW  Q   S+R+E L   + LSE+C  +VD +L 
Sbjct  943   IQDLLLAKLSECATDGHPISYLRLVLFWLYQIRSSHRIEQLVNFQQLSEICLVLVDSLLS  1002

Query  501   QFLNTKGD-ASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSM  677
             Q L    D  SSK + +LL ++ +QE+ ETIF HP +  S  CPL C+ D   +   ++ 
Sbjct  1003  QLLVLNTDSGSSKNSWALLSSQDIQEVAETIFSHPAMITSFSCPLGCSEDLPKSNLAENT  1062

Query  678   DKFLESNKWRVIHKMDLHVINLLRTTFELLY-FCDGQ--TSSFEACHARQVTKAFKNVVQ  848
             D  +  ++ R IH +D H +++L TT +  +  C+    T   E    +Q  KAF  ++Q
Sbjct  1063  DALIGLSRRR-IHILDRHGLDILATTCDYFFSLCNDHQFTPEVENGAGKQFVKAFNILLQ  1121

Query  849   KLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQ  1028
             KL    +D+ D+CI +KDL P LP  YA+H L RFI PFELLELV WMFSR+D++DN   
Sbjct  1122  KLLQVVRDKFDQCISAKDLMPFLPTYYALHALIRFISPFELLELVRWMFSRVDMDDN---  1178

Query  1029  QSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVY  1208
                + S +  G  IAG  F +LS+ + QP+++R   DLFW M E   +  + E+I  +V 
Sbjct  1179  ---QKSAISFGSCIAGGAFRNLSSYLQQPNTKRKSYDLFWKMEETSINSDIFEEIYSKVC  1235

Query  1209  EIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSYCMFQIN  1385
             + + H   +V D+CLL+A   V  HK MQQ N   L + +SR I   PV +LS+C+++ +
Sbjct  1236  KFSLHFKAEVVDVCLLEAINAVCRHKYMQQCNLHPLHIVLSRVIATTPVEMLSHCIYRTS  1295

Query  1386  KRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP--SDPELLMLLPTV  1559
             K+KA  L L T+MS +HLS FGHL  G+++K    + N I ET  P  SD   LMLLP  
Sbjct  1296  KKKARFLSLLTDMSSMHLSTFGHLFLGILNKDFLHEGNVIEETCVPAFSDEHYLMLLPAA  1355

Query  1560  FLYLDSVLIKAGSQ-VKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEE  1736
               YL+SV +K G    K+F  I  FY +ILL+ F  W  +V+RD+F  E  + LP S  E
Sbjct  1356  LSYLNSVSMKFGRLCYKHFRNIPVFYSKILLNGFQHWNTFVSRDVFQEEFGEFLPSSAPE  1415

Query  1737  FMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGT  1916
              + +   +LL +++ M++   +L     K + R++LF+S+ P  S   + +D D   +G+
Sbjct  1416  LLCLIDDSLLGKAICMLRYHFSLNEDSTKLKKRLKLFNSIFPPSSEHNELIDCDVGGLGS  1475

Query  1917  CSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKM  2096
              SL +SLN VN+  AKI+ C+ LLFP+ N+     ++ K  +     +  D SR++ L +
Sbjct  1476  QSLNESLNLVNKIFAKISFCKILLFPKCNQSDEAGRDLKDISLDNGSNKEDSSRMQFLNI  1535

Query  2097  LVSSWRKIVEKFPMTADNSCQMEV-ENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLP  2273
             LV  W+ IV++    +D+S +  + ++ S++R LEVLIL +I+EL++E+   L +L S+P
Sbjct  1536  LVGIWQWIVKRVSSVSDSSRKETITDSSSLWRCLEVLILTSILELTREISDGLTQLQSIP  1595

Query  2274  FIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLS  2453
             F+ +L K+   +RF+DP TL+ +RD+++ LSEGKFS V  +QL++AHSQF   I S   S
Sbjct  1596  FLEQLMKSALLYRFEDPTTLKTVRDLLTFLSEGKFSRVPYLQLLLAHSQFAPTIRSVYKS  1655

Query  2454  TGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKA  2633
             +  S +G    P+  ++RS V P  N N I  K NL+ +  ++KQLE+IKLLR+LF +K 
Sbjct  1656  SDCSIVGAFSRPMSGILRSLVFPSTNKNVIDGKCNLETTDLYVKQLEVIKLLRILFPIKV  1715

Query  2634  RQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDY  2810
              Q D + A+++GINLR+L  LLLSSY +TL +ID EI+NL+  I+SI D   ++ A  D+
Sbjct  1716  HQYDFDFAKDLGINLRELHLLLLSSYGSTLSEIDVEIYNLMRTIESIDDIEPVNFAGMDH  1775

Query  2811  LWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR  2987
             LWGNAV+K  KER L Q +S + ++D E  ++ R+ QFRENL IDPK+CASTVLYFPY R
Sbjct  1776  LWGNAVLKIEKERTLAQNLSYDSMTDTEAVKERRRSQFRENLVIDPKICASTVLYFPYDR  1835

Query  2988  PNGPGVV--NKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANL  3161
                  ++  NK QKD FD MH   S +V N   Y+P+FILR S H L+ GYIEP+EFA L
Sbjct  1836  VTSEELLSLNKFQKDNFDDMHVLHSPDVENVERYNPVFILRFSIHSLAEGYIEPLEFAGL  1895

Query  3162  GLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQ  3341
             GLL ++  S+SSPDD  R+LGY  L +FKNALEKC K+K + ++QLLL+Y+QN IEE WQ
Sbjct  1896  GLLGIAFMSMSSPDDRIRRLGYDSLGRFKNALEKCPKRKGIRQIQLLLTYVQNAIEEPWQ  1955

Query  3342  KIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTE  3521
             +IPSV AIF AE S +LLDPSHDHYA ++K LM+S  +N+K+I  F N  WS S++F+ E
Sbjct  1956  RIPSVNAIFAAETSLILLDPSHDHYAALSKLLMRSSRMNVKNILFFSNFFWSSSINFKAE  2015

Query  3522  RLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRM  3701
             RLWILR++Y+GLN +DD  IY++NSI ETL+SFYVSP++D+ESKELI+Q VKK+ KL +M
Sbjct  2016  RLWILRLVYAGLNFEDDAKIYMKNSILETLMSFYVSPISDDESKELILQVVKKAVKLHKM  2075

Query  3702  ARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKY  3881
             AR+L+E CGL SWLSSV++      +   K     Q  VV EVVN++I  R+  EWLQKY
Sbjct  2076  ARYLVEQCGLFSWLSSVLSILSESHFRDEKSLFLLQLGVVSEVVNDVISSRNMTEWLQKY  2135

Query  3882  ALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEG  4061
             ALEQL EL+ HL + LV    ++K+       IL I+  T K+SQKR++YQPHF LS+EG
Sbjct  2136  ALEQLMELTSHLYKFLVSYMALIKQKVAVVNPILGIIISTLKISQKRRIYQPHFILSIEG  2195

Query  4062  LFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSET  4241
              +++ +A+ +C N      A+ GL AILMS PPVAI  +  +K+S FI WA+S A++ E+
Sbjct  2196  SYNIYKAVKICDNTRSCATAELGLHAILMSAPPVAIFCLSREKLSSFIMWAISAAVEVES  2255

Query  4242  KGVLQVEKC--CFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRS  4415
               +LQ ++   CF + +  EE  ENSLISKLLRWLTASVILGK+ +K + LD     +  
Sbjct  2256  AKMLQHKESHQCFAI-IPEEELQENSLISKLLRWLTASVILGKLDWKSNYLDP----EFP  2310

Query  4416  KLIN---LHCLLEWNEESDRENGKE-FACQEILAASIFYLQQLLGTSFKLLPSAVSALCL  4583
             K++N   L  L++  E + REN K  + C+EILA++I YLQQL GT++KLLPS  +AL L
Sbjct  2311  KMLNIKTLQSLMDHVESACRENSKNSYGCEEILASAILYLQQLAGTNYKLLPSVTTALSL  2370

Query  4584  LLLKNPASSGSEVLIGNAA---ALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIE  4754
             LL  + AS  +  L  N +   +L SKI  PAEAN AWRWSFYQPWKD +  LT S+K+E
Sbjct  2371  LL--SDASIFAGFLRNNGSVVKSLWSKIGFPAEANPAWRWSFYQPWKDLTLELTGSQKME  2428

Query  4755  EIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSI  4883
             E+HACQ LL++ S +L +     ++ S ++V++LGVFEWERSI
Sbjct  2429  ELHACQSLLVIISNVLGKGPSELQVSSTQEVDRLGVFEWERSI  2471



>ref|XP_011010316.1| PREDICTED: uncharacterized protein LOC105115191 isoform X1 [Populus 
euphratica]
Length=2611

 Score =  1283 bits (3320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 758/1662 (46%), Positives = 1082/1662 (65%), Gaps = 51/1662 (3%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQE-  179
             +LL+NFP ++ ++ + L VP S L SI FLE S L  V K WPE+FF+GLE  IS +   
Sbjct  961   ELLKNFPSVL-ITFQRLRVPESFLSSIIFLEHSFLAGVLKLWPEVFFSGLEMVISMINSR  1019

Query  180   --------GRTEEFGDIDSMEFASA-ALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHN  332
                       T +  D D  E A+A + SLFL++    +LFP  +SI    L     + +
Sbjct  1020  GTIGDASAKETAQHVDFDVSESAAAVSFSLFLRQVPFHLLFPAIMSINAPSLVESLNIKD  1079

Query  333   LLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLN  512
             LLLA LSE + D ++S    +LFWF+Q   SYR++PL ELE L+E+C+ +V  +L Q L 
Sbjct  1080  LLLARLSESSTDSVISHLRLILFWFHQIRSSYRIKPLTELERLAEICYVLVKHILAQPLA  1139

Query  513   TKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLE  692
             +K ++       L     + E+ ETIF HP V ASL  PL C+ DFT    G+S+++ L 
Sbjct  1140  SKLNSPMNAGVPL-AADNIGEVAETIFCHPAVVASLVHPLRCHGDFTKGKFGESLEEIL-  1197

Query  693   SNKWRVIHKMDLHVINLLRTTFELLYFCDG----QTSSFEACHARQVTKAFKNVVQKLFL  860
                 + +HK+D HV+++L  TF+  +   G     T  F+ C +  + KAF  ++Q+L+L
Sbjct  1198  CFSGQTVHKIDHHVLDMLTATFDDFFLLSGGQHLSTLEFDDCGSELIVKAFNTLLQRLYL  1257

Query  861   TFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLR  1040
               +D+ D+CI ++D  PLLP  YA+H L RFI PFELL+LVHWMF R+D+   + Q+   
Sbjct  1258  EVRDKFDQCISTEDPLPLLPLFYALHALNRFISPFELLKLVHWMFGRVDVSGLNVQKHFG  1317

Query  1041  DSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIAT  1220
              S L VGL IA   FD LSA + QP +      + W   E+ FD+ L+E+I +QV + AT
Sbjct  1318  LSALSVGLCIAADAFDILSAYLQQPITRNVPFYMLWKSEEKFFDVNLIEEIYVQVCKFAT  1377

Query  1221  HLHLDVADMCLLKAFKVVKTHKVMQQS--NPTLVMAISRFIVNIPVNLLSYCMFQINKRK  1394
               + D A +CLLKA   V + K MQ    +P L + + R I + P+ +LS C+++ N  K
Sbjct  1378  DFNQDFAHVCLLKAVNAVHSQKYMQHDILHP-LSLVLPRIIRSTPLEILSQCIYRTNMTK  1436

Query  1395  AELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRET--SNPSDPELLMLLPTVFLY  1568
             A+LL L  EMSPLHLS+FGHL  G++D+  +L+   + +T  S  S+ + +MLLP    Y
Sbjct  1437  AKLLSLLVEMSPLHLSVFGHLFFGILDEDFNLKIKKVEKTCDSALSNTDFVMLLPAALSY  1496

Query  1569  LDSVLIK-AGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMD  1745
             L+S+L+K    Q K+F  I SFY ++LL  F  WK +V+  +F     D LP SIEE ++
Sbjct  1497  LNSILMKFEKQQYKHFTNIPSFYSKLLLKGFLHWKSFVSGYVFQESYNDFLPSSIEELLN  1556

Query  1746  IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSL  1925
             +   +LL +++ M++   +++  + K + R++LF+S+     T V+ LD +  ++  CS 
Sbjct  1557  LVDSSLLGKAICMLRQYFSISVDM-KLKERLKLFNSIVSCSDTHVELLDCEVGEMEFCSH  1615

Query  1926  EQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELH-----STLDVSRIRLL  2090
              QSLN VNR VAKI+ CR LLFP+ N+  S L ++ +E   E+      +    SR+RLL
Sbjct  1616  NQSLNLVNRVVAKISFCRMLLFPKDNQIVS-LPKEAVENLQEVSLEKVSNKEGQSRMRLL  1674

Query  2091  KMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGCLVKLDS  2267
             K+LV +W+ +V+KFP  ++ S + ++ NC  ++R+LE+ I R I E + EM   L+ L+S
Sbjct  1675  KILVDTWQFMVKKFPSVSNGSTKEKISNCLQLYRYLELFIFRTIFEFAMEMREDLILLES  1734

Query  2268  LPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSN  2447
             +PF+ +L +++  +RF+DP T++ LR I+  LSEGKFSC   +QL+V+HSQF + I S  
Sbjct  1735  VPFLEQLMRSSLLYRFEDPTTMKILRGILVLLSEGKFSCALYLQLLVSHSQFSSTIQSIT  1794

Query  2448  LSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQV  2627
              S G  Q G    P+ S++RS VI L   +S    D+LQ ++ H+KQLE++KLLR L Q+
Sbjct  1795  ESFGC-QTGAFVKPMSSILRSPVI-LRTKSS----DDLQTTELHMKQLEIVKLLRTLLQL  1848

Query  2628  KARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISI-AEW  2804
             K  Q   +P  +IGINL++L  LLLSSY ATL + D EI+NL+ EI+SI +S + + A+ 
Sbjct  1849  KPCQTSFDPGNDIGINLKELHLLLLSSYGATLSETDLEIYNLMLEIESIDNSVVDVVADM  1908

Query  2805  DYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYG  2984
             DYLWG AV+K  KER L Q     +++ E  ++ R+ QFRENLP+DPKMC  TVL+FPY 
Sbjct  1909  DYLWGTAVLKISKERVLDQETYDVVTNTEAVKEHRRSQFRENLPVDPKMCVKTVLHFPYD  1968

Query  2985  RP--NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFAN  3158
             R   +G   ++++Q D    ++E     V N  +YDP+FILR S H LSMGYIE VEFA 
Sbjct  1969  RTVTDGSLSLDRLQLDNLKDIYERHVPGVENIQLYDPVFILRFSIHALSMGYIEAVEFAG  2028

Query  3159  LGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDW  3338
             LGLLAV+  S+SSPD   RKLGY +  K+KN LE CQK KDVMRL+LLL+YLQN I E W
Sbjct  2029  LGLLAVAFVSMSSPDVGMRKLGYELTGKYKNVLENCQKTKDVMRLRLLLTYLQNGISEPW  2088

Query  3339  QKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRT  3518
             Q+IPSV A+F AE+S +LLDPSHDHY T++KHLM S  VN+KSIPLF     S++V+FR 
Sbjct  2089  QRIPSVLALFAAESSLILLDPSHDHYTTLSKHLMHSSKVNMKSIPLFHVFFLSNAVNFRM  2148

Query  3519  ERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSR  3698
             ERLW+LR+   GLN DDD  I+IR+S  ETLLSFY SPL++NESKE+I++ VKK+AKL R
Sbjct  2149  ERLWMLRLACGGLNLDDDTQIFIRSSTIETLLSFYSSPLSENESKEIILEIVKKAAKLPR  2208

Query  3699  MARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQK  3878
             M R+L+E+CGL  WLSSV++ + G+ +++ + F      VV+EVVN+++  R+ VEWLQ 
Sbjct  2209  MVRYLVEHCGLFPWLSSVLSVYKGMLHENERIFFSQLLVVVIEVVNDVVSSRNIVEWLQN  2268

Query  3879  YALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVE  4058
             YALEQL EL+ +L ++LV GA+++KE+ T    +L I+  T K+SQKRK+YQPHFTL+ E
Sbjct  2269  YALEQLMELATYLYKLLVAGAKLIKENVTLVNSVLHIMLTTLKISQKRKIYQPHFTLTFE  2328

Query  4059  GLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSE  4238
             GLF + +A+DV      S  ++ GL+ ILM  P V I  M+ +K+S F+ WA+S A++S+
Sbjct  2329  GLFQIYQALDVFNTSRPSTSSELGLKTILMGFPRVDIFHMNREKLSSFLLWAVSTAMKSD  2388

Query  4239  TKGVLQVEKCCFPLNVSSEEE-TENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRS  4415
             +  ++ V+     L ++ EE  +E SLISKLLRWL ASVILGK+S KL    ++   ++S
Sbjct  2389  SIQIINVKDSRANLTINLEETPSEESLISKLLRWLVASVILGKLSRKLDV--NAELSEKS  2446

Query  4416  KLINLHCLLEWNEESDRENGK-EFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLL  4592
                 L  LLE  E+   E+ +  F C+E+LA SIFYLQQLLG +F +LPS VS+L LLLL
Sbjct  2447  SFKTLQSLLENVEKGCGESNRLGFDCEEVLALSIFYLQQLLGMNFTVLPSVVSSLSLLLL  2506

Query  4593  -KNPASSGSEVLIG---NAAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEI  4760
              KN  S  S+  +G   +  +L SKIRCPAEAN AWRWSFYQPWKD S  L++S+++ E 
Sbjct  2507  CKN--SKFSDFALGYRTSTLSLWSKIRCPAEANPAWRWSFYQPWKDLSCELSESQRMYEQ  2564

Query  4761  HACQMLLLVASKMLARNSL-YSKLISLKDVEKLGVFEWERSI  4883
             HACQ LL++ + +L + SL  ++++SL+DVE  G+F+WER+I
Sbjct  2565  HACQSLLVIITNVLGKKSLDDTRVLSLEDVENSGLFKWERTI  2606



>ref|XP_011010317.1| PREDICTED: uncharacterized protein LOC105115191 isoform X2 [Populus 
euphratica]
Length=2217

 Score =  1282 bits (3318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 758/1662 (46%), Positives = 1082/1662 (65%), Gaps = 51/1662 (3%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQE-  179
             +LL+NFP ++ ++ + L VP S L SI FLE S L  V K WPE+FF+GLE  IS +   
Sbjct  567   ELLKNFPSVL-ITFQRLRVPESFLSSIIFLEHSFLAGVLKLWPEVFFSGLEMVISMINSR  625

Query  180   --------GRTEEFGDIDSMEFASA-ALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHN  332
                       T +  D D  E A+A + SLFL++    +LFP  +SI    L     + +
Sbjct  626   GTIGDASAKETAQHVDFDVSESAAAVSFSLFLRQVPFHLLFPAIMSINAPSLVESLNIKD  685

Query  333   LLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLN  512
             LLLA LSE + D ++S    +LFWF+Q   SYR++PL ELE L+E+C+ +V  +L Q L 
Sbjct  686   LLLARLSESSTDSVISHLRLILFWFHQIRSSYRIKPLTELERLAEICYVLVKHILAQPLA  745

Query  513   TKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLE  692
             +K ++       L     + E+ ETIF HP V ASL  PL C+ DFT    G+S+++ L 
Sbjct  746   SKLNSPMNAGVPL-AADNIGEVAETIFCHPAVVASLVHPLRCHGDFTKGKFGESLEEIL-  803

Query  693   SNKWRVIHKMDLHVINLLRTTFELLYFCDG----QTSSFEACHARQVTKAFKNVVQKLFL  860
                 + +HK+D HV+++L  TF+  +   G     T  F+ C +  + KAF  ++Q+L+L
Sbjct  804   CFSGQTVHKIDHHVLDMLTATFDDFFLLSGGQHLSTLEFDDCGSELIVKAFNTLLQRLYL  863

Query  861   TFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLR  1040
               +D+ D+CI ++D  PLLP  YA+H L RFI PFELL+LVHWMF R+D+   + Q+   
Sbjct  864   EVRDKFDQCISTEDPLPLLPLFYALHALNRFISPFELLKLVHWMFGRVDVSGLNVQKHFG  923

Query  1041  DSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIAT  1220
              S L VGL IA   FD LSA + QP +      + W   E+ FD+ L+E+I +QV + AT
Sbjct  924   LSALSVGLCIAADAFDILSAYLQQPITRNVPFYMLWKSEEKFFDVNLIEEIYVQVCKFAT  983

Query  1221  HLHLDVADMCLLKAFKVVKTHKVMQQS--NPTLVMAISRFIVNIPVNLLSYCMFQINKRK  1394
               + D A +CLLKA   V + K MQ    +P L + + R I + P+ +LS C+++ N  K
Sbjct  984   DFNQDFAHVCLLKAVNAVHSQKYMQHDILHP-LSLVLPRIIRSTPLEILSQCIYRTNMTK  1042

Query  1395  AELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRET--SNPSDPELLMLLPTVFLY  1568
             A+LL L  EMSPLHLS+FGHL  G++D+  +L+   + +T  S  S+ + +MLLP    Y
Sbjct  1043  AKLLSLLVEMSPLHLSVFGHLFFGILDEDFNLKIKKVEKTCDSALSNTDFVMLLPAALSY  1102

Query  1569  LDSVLIK-AGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMD  1745
             L+S+L+K    Q K+F  I SFY ++LL  F  WK +V+  +F     D LP SIEE ++
Sbjct  1103  LNSILMKFEKQQYKHFTNIPSFYSKLLLKGFLHWKSFVSGYVFQESYNDFLPSSIEELLN  1162

Query  1746  IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSL  1925
             +   +LL +++ M++   +++  + K + R++LF+S+     T V+ LD +  ++  CS 
Sbjct  1163  LVDSSLLGKAICMLRQYFSISVDM-KLKERLKLFNSIVSCSDTHVELLDCEVGEMEFCSH  1221

Query  1926  EQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELH-----STLDVSRIRLL  2090
              QSLN VNR VAKI+ CR LLFP+ N+  S L ++ +E   E+      +    SR+RLL
Sbjct  1222  NQSLNLVNRVVAKISFCRMLLFPKDNQIVS-LPKEAVENLQEVSLEKVSNKEGQSRMRLL  1280

Query  2091  KMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGCLVKLDS  2267
             K+LV +W+ +V+KFP  ++ S + ++ NC  ++R+LE+ I R I E + EM   L+ L+S
Sbjct  1281  KILVDTWQFMVKKFPSVSNGSTKEKISNCLQLYRYLELFIFRTIFEFAMEMREDLILLES  1340

Query  2268  LPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSN  2447
             +PF+ +L +++  +RF+DP T++ LR I+  LSEGKFSC   +QL+V+HSQF + I S  
Sbjct  1341  VPFLEQLMRSSLLYRFEDPTTMKILRGILVLLSEGKFSCALYLQLLVSHSQFSSTIQSIT  1400

Query  2448  LSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQV  2627
              S G  Q G    P+ S++RS VI L   +S    D+LQ ++ H+KQLE++KLLR L Q+
Sbjct  1401  ESFG-CQTGAFVKPMSSILRSPVI-LRTKSS----DDLQTTELHMKQLEIVKLLRTLLQL  1454

Query  2628  KARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISI-AEW  2804
             K  Q   +P  +IGINL++L  LLLSSY ATL + D EI+NL+ EI+SI +S + + A+ 
Sbjct  1455  KPCQTSFDPGNDIGINLKELHLLLLSSYGATLSETDLEIYNLMLEIESIDNSVVDVVADM  1514

Query  2805  DYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYG  2984
             DYLWG AV+K  KER L Q     +++ E  ++ R+ QFRENLP+DPKMC  TVL+FPY 
Sbjct  1515  DYLWGTAVLKISKERVLDQETYDVVTNTEAVKEHRRSQFRENLPVDPKMCVKTVLHFPYD  1574

Query  2985  RP--NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFAN  3158
             R   +G   ++++Q D    ++E     V N  +YDP+FILR S H LSMGYIE VEFA 
Sbjct  1575  RTVTDGSLSLDRLQLDNLKDIYERHVPGVENIQLYDPVFILRFSIHALSMGYIEAVEFAG  1634

Query  3159  LGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDW  3338
             LGLLAV+  S+SSPD   RKLGY +  K+KN LE CQK KDVMRL+LLL+YLQN I E W
Sbjct  1635  LGLLAVAFVSMSSPDVGMRKLGYELTGKYKNVLENCQKTKDVMRLRLLLTYLQNGISEPW  1694

Query  3339  QKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRT  3518
             Q+IPSV A+F AE+S +LLDPSHDHY T++KHLM S  VN+KSIPLF     S++V+FR 
Sbjct  1695  QRIPSVLALFAAESSLILLDPSHDHYTTLSKHLMHSSKVNMKSIPLFHVFFLSNAVNFRM  1754

Query  3519  ERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSR  3698
             ERLW+LR+   GLN DDD  I+IR+S  ETLLSFY SPL++NESKE+I++ VKK+AKL R
Sbjct  1755  ERLWMLRLACGGLNLDDDTQIFIRSSTIETLLSFYSSPLSENESKEIILEIVKKAAKLPR  1814

Query  3699  MARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQK  3878
             M R+L+E+CGL  WLSSV++ + G+ +++ + F      VV+EVVN+++  R+ VEWLQ 
Sbjct  1815  MVRYLVEHCGLFPWLSSVLSVYKGMLHENERIFFSQLLVVVIEVVNDVVSSRNIVEWLQN  1874

Query  3879  YALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVE  4058
             YALEQL EL+ +L ++LV GA+++KE+ T    +L I+  T K+SQKRK+YQPHFTL+ E
Sbjct  1875  YALEQLMELATYLYKLLVAGAKLIKENVTLVNSVLHIMLTTLKISQKRKIYQPHFTLTFE  1934

Query  4059  GLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSE  4238
             GLF + +A+DV      S  ++ GL+ ILM  P V I  M+ +K+S F+ WA+S A++S+
Sbjct  1935  GLFQIYQALDVFNTSRPSTSSELGLKTILMGFPRVDIFHMNREKLSSFLLWAVSTAMKSD  1994

Query  4239  TKGVLQVEKCCFPLNVSSEEE-TENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRS  4415
             +  ++ V+     L ++ EE  +E SLISKLLRWL ASVILGK+S KL    ++   ++S
Sbjct  1995  SIQIINVKDSRANLTINLEETPSEESLISKLLRWLVASVILGKLSRKLDV--NAELSEKS  2052

Query  4416  KLINLHCLLEWNEESDRENGK-EFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLL  4592
                 L  LLE  E+   E+ +  F C+E+LA SIFYLQQLLG +F +LPS VS+L LLLL
Sbjct  2053  SFKTLQSLLENVEKGCGESNRLGFDCEEVLALSIFYLQQLLGMNFTVLPSVVSSLSLLLL  2112

Query  4593  -KNPASSGSEVLIG---NAAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEI  4760
              KN  S  S+  +G   +  +L SKIRCPAEAN AWRWSFYQPWKD S  L++S+++ E 
Sbjct  2113  CKN--SKFSDFALGYRTSTLSLWSKIRCPAEANPAWRWSFYQPWKDLSCELSESQRMYEQ  2170

Query  4761  HACQMLLLVASKMLARNSL-YSKLISLKDVEKLGVFEWERSI  4883
             HACQ LL++ + +L + SL  ++++SL+DVE  G+F+WER+I
Sbjct  2171  HACQSLLVIITNVLGKKSLDDTRVLSLEDVENSGLFKWERTI  2212



>ref|XP_009595744.1| PREDICTED: uncharacterized protein LOC104091985 isoform X11 [Nicotiana 
tomentosiformis]
Length=2162

 Score =  1271 bits (3289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 679/1226 (55%), Positives = 881/1226 (72%), Gaps = 14/1226 (1%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM +FF EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  944   EIIQNFPLIMSVSNKLLGVPLSLLMQLFFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  1003

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S A S+FL  A   +LFP  L I   DLS Q GL NL +A LSE T
Sbjct  1004  RTMDCSVISSMDNKSNAFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLFMAKLSEET  1063

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++    T
Sbjct  1064  SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCGLDT  1123

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+D+F+ES K  V  KM
Sbjct  1124  FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIKDSVDQFVESAKLEV-SKM  1182

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC  Q SS E  HA + V  +FKNVV KL + FK + ++C++S
Sbjct  1183  DHHVHNLLKATSELWLSFCHSQGSSSEVYHANKHVISSFKNVVNKLVMAFKQKMNECMKS  1242

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  1243  KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  1299

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M QPH + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVAD+CLL
Sbjct  1300  SAFSHLAANMQQPHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADICLL  1358

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1359  KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITKRKAEILFLVADISPLH  1418

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ++LMLLPTV LYL+S+  K G Q+    
Sbjct  1419  LSVFGKLFSDMMNKYVAVKSCAVQQICGYSDEDMLMLLPTVILYLNSIPSKFGGQLCMLH  1478

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+ QL
Sbjct  1479  ENIVSFYWGILKQGFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVAQL  1536

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + RM +F+SVC  + +  D L+FD +Q G  S+E+SLN VNRTV KI L
Sbjct  1537  FFELRGDLVNVKKRMSIFNSVCSSEYS--DLLEFDLTQDGAYSVEESLNVVNRTVTKIRL  1594

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV SW+ IV++  +   + 
Sbjct  1595  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQSWQLIVKRCSLNVVDF  1654

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+EV +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DP TL
Sbjct  1655  SQIEVGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPTTL  1714

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS +S G S  GL FTPLPS+MRS+
Sbjct  1715  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIHSSPISAGHSHFGLIFTPLPSIMRSY  1774

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1775  V-PCIDQDALDLKDNFKLSEERARQLELVKLLKLLFQIRAQQCDIDNVKDIGINLRELVF  1833

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EIKS +D    S+A+ D+LW +A++K RKE ELVQT+S
Sbjct  1834  LLLSSYGASMSAIDLEIYSLLDEIKSANDLDEESMAKLDFLWSSALLKVRKENELVQTLS  1893

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +D R+I FREN+PIDPK CA+TVLYFPY R  G G+  K + D  D  +  
Sbjct  1894  RNLSEAEAVDDYRRIHFRENIPIDPKFCATTVLYFPYDRTVGAGIHRKPETDNPDFRYAV  1953

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1954  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  2013

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LEKCQK+KDVMRL+LL+SYLQN IEE WQKI S+TA+F+AEASFVLLDPSHD
Sbjct  2014  VLGRFKSTLEKCQKRKDVMRLRLLMSYLQNGIEEPWQKISSITAVFVAEASFVLLDPSHD  2073

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+ +LM+SPS N+K IPLF N  WS S +F  ERLWILR+LYSGLN +DD  IYIR
Sbjct  2074  HYSAISAYLMRSPSANMKGIPLFHNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIR  2133

Query  3591  NSIFETLLSFYVSPLADNESKELIIQ  3668
             N+IFETLLSFYVSP++ +ESKELI+Q
Sbjct  2134  NAIFETLLSFYVSPISSHESKELIVQ  2159



>ref|XP_009595743.1| PREDICTED: uncharacterized protein LOC104091985 isoform X10 [Nicotiana 
tomentosiformis]
Length=2162

 Score =  1271 bits (3289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 679/1228 (55%), Positives = 882/1228 (72%), Gaps = 14/1228 (1%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM +FF EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  944   EIIQNFPLIMSVSNKLLGVPLSLLMQLFFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  1003

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S A S+FL  A   +LFP  L I   DLS Q GL NL +A LSE T
Sbjct  1004  RTMDCSVISSMDNKSNAFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLFMAKLSEET  1063

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++    T
Sbjct  1064  SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCGLDT  1123

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+D+F+ES K  V  KM
Sbjct  1124  FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIKDSVDQFVESAKLEV-SKM  1182

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC  Q SS E  HA + V  +FKNVV KL + FK + ++C++S
Sbjct  1183  DHHVHNLLKATSELWLSFCHSQGSSSEVYHANKHVISSFKNVVNKLVMAFKQKMNECMKS  1242

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  1243  KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  1299

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M QPH + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVAD+CLL
Sbjct  1300  SAFSHLAANMQQPHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADICLL  1358

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1359  KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITKRKAEILFLVADISPLH  1418

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ++LMLLPTV LYL+S+  K G Q+    
Sbjct  1419  LSVFGKLFSDMMNKYVAVKSCAVQQICGYSDEDMLMLLPTVILYLNSIPSKFGGQLCMLH  1478

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+ QL
Sbjct  1479  ENIVSFYWGILKQGFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVAQL  1536

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + RM +F+SVC  + +  D L+FD +Q G  S+E+SLN VNRTV KI L
Sbjct  1537  FFELRGDLVNVKKRMSIFNSVCSSEYS--DLLEFDLTQDGAYSVEESLNVVNRTVTKIRL  1594

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV SW+ IV++  +   + 
Sbjct  1595  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQSWQLIVKRCSLNVVDF  1654

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+EV +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DP TL
Sbjct  1655  SQIEVGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPTTL  1714

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS +S G S  GL FTPLPS+MRS+
Sbjct  1715  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIHSSPISAGHSHFGLIFTPLPSIMRSY  1774

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1775  V-PCIDQDALDLKDNFKLSEERARQLELVKLLKLLFQIRAQQCDIDNVKDIGINLRELVF  1833

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EIKS +D    S+A+ D+LW +A++K RKE ELVQT+S
Sbjct  1834  LLLSSYGASMSAIDLEIYSLLDEIKSANDLDEESMAKLDFLWSSALLKVRKENELVQTLS  1893

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +D R+I FREN+PIDPK CA+TVLYFPY R  G G+  K + D  D  +  
Sbjct  1894  RNLSEAEAVDDYRRIHFRENIPIDPKFCATTVLYFPYDRTVGAGIHRKPETDNPDFRYAV  1953

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1954  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  2013

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LEKCQK+KDVMRL+LL+SYLQN IEE WQKI S+TA+F+AEASFVLLDPSHD
Sbjct  2014  VLGRFKSTLEKCQKRKDVMRLRLLMSYLQNGIEEPWQKISSITAVFVAEASFVLLDPSHD  2073

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+ +LM+SPS N+K IPLF N  WS S +F  ERLWILR+LYSGLN +DD  IYIR
Sbjct  2074  HYSAISAYLMRSPSANMKGIPLFHNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIR  2133

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTV  3674
             N+IFETLLSFYVSP++ +ESKELI+Q +
Sbjct  2134  NAIFETLLSFYVSPISSHESKELIVQLI  2161



>ref|XP_006370696.1| hypothetical protein POPTR_0001s44980g [Populus trichocarpa]
 gb|ERP67265.1| hypothetical protein POPTR_0001s44980g [Populus trichocarpa]
Length=2573

 Score =  1247 bits (3227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 738/1661 (44%), Positives = 1062/1661 (64%), Gaps = 74/1661 (4%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQE-  179
             +LL+NFP ++ ++ + L VP S L SI FLE S L  V K WPEMFF+GLE  IS +   
Sbjct  948   ELLKNFPSVL-ITFQRLRVPESFLSSIIFLEHSFLAGVLKLWPEMFFSGLEMVISMINSQ  1006

Query  180   --------GRTEEFGDIDSMEFASA-ALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHN  332
                       T +  D D  E A+A + SLFL++    +LFP  +SI    L     + +
Sbjct  1007  GTIGDASAKETAQHVDFDVSESAAAVSFSLFLRQVPFHLLFPAIMSINAPSLVESLNIKD  1066

Query  333   LLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLN  512
             LLLA LSE + D ++S    +LFWF+Q   SYR++PL ELE L+E+C+ +V  +L Q L 
Sbjct  1067  LLLARLSESSTDSVISHLRLILFWFHQIWSSYRIKPLTELERLAEICYVLVKHILAQPLA  1126

Query  513   TKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLE  692
             +K ++       L     + E+ ETIF HP V ASL  PL C+ DFT+   G+S+++ L 
Sbjct  1127  SKLNSPMNAGVPL-SADNIGEVAETIFCHPAVVASLVHPLHCHGDFTEGKLGESLEEIL-  1184

Query  693   SNKWRVIHKMDLHVINLLRTTFELLYFCDG----QTSSFEACHARQVTKAFKNVVQKLFL  860
                 + +HK+D HV+++L  TF+ L+   G     T  F+ C ++ + KAF  ++Q+L+L
Sbjct  1185  CFSGQTVHKIDHHVLDMLTATFDDLFLLSGGQHRSTLEFDDCASKLIVKAFNTLLQRLYL  1244

Query  861   TFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLR  1040
               +D+ D+C  ++D  PLLP  YA+H L RFI PFELL+LVHWMF R+D    + Q+   
Sbjct  1245  EVRDKFDQCTSTEDPLPLLPLFYALHALNRFISPFELLKLVHWMFGRVDASGLNVQKHFG  1304

Query  1041  DSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIAT  1220
              S L VGL IA   FD LSA + QP +      + W   E+ FD+ L+E+I +QV + AT
Sbjct  1305  LSALSVGLCIAADAFDILSAYLQQPMTRNVPFYMLWKSEEKFFDVNLIEEIYVQVCKFAT  1364

Query  1221  HLHLDVADMCLLKAFKVVKTHKVMQQS--NPTLVMAISRFIVNIPVNLLSYCMFQINKRK  1394
               + D A +CLLKA   V + K MQ    +P L + + R I + P+ +LS C+++ N  K
Sbjct  1365  DFNQDFAHVCLLKAVNAVYSQKYMQHGILHP-LSLVLPRIIRSTPLEILSQCIYRTNMTK  1423

Query  1395  AELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP--SDPELLMLLPTVFLY  1568
              +LL L  EMSPLHLS+FGHL  G++D+  +L+   + +T +   S+ + +MLLP    Y
Sbjct  1424  TKLLSLLVEMSPLHLSVFGHLFFGILDEDFNLKIKTVEKTRDSALSNTDFVMLLPAALSY  1483

Query  1569  LDSVLIK-AGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMD  1745
             L+S+L+K    Q K F  I SFY ++LL  F  WK +V+  +F     D LP SIEE ++
Sbjct  1484  LNSILMKFEKQQYKQFTNIPSFYSKLLLKGFLHWKSFVSGYVFQESYNDFLPSSIEELLN  1543

Query  1746  IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSL  1925
             +   +LL +++ M++   +++   +K + R++LF+S+     T V+ LD +  ++  CS 
Sbjct  1544  LVDSSLLGKAICMLRQYFSIS-VDMKLKERLKLFNSILSCSDTHVELLDCEVGEMEFCSH  1602

Query  1926  EQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELH-----STLDVSRIRLL  2090
              QSLN VNR VAKI+ CR LLFP+ N+  S L ++ +E   E+      +    SR+RLL
Sbjct  1603  NQSLNLVNRVVAKISFCRMLLFPKDNQIVS-LPKEAVENLQEVSLEKVSNKEGQSRMRLL  1661

Query  2091  KMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGCLVKLDS  2267
             K+LV +W+ +V+KFP  ++ S + ++ NC  ++R+LE+ I R I EL+ EM   L+ L+S
Sbjct  1662  KILVDTWQFMVKKFPSVSNGSTKEKISNCLQLYRYLELFIFRTIFELAMEMREDLILLES  1721

Query  2268  LPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSN  2447
             +PF+ +L +++  +RF+DP T++ LR I+  LSEGKFSC   +QL+V+HSQF + I S  
Sbjct  1722  VPFLEQLTRSSLLYRFEDPTTMKILRGILVLLSEGKFSCALYLQLLVSHSQFSSTIQSIT  1781

Query  2448  LSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQV  2627
              S G  Q G    P+ S++RS VI L   +S    D+LQ ++ H+KQLE++KLLR L Q+
Sbjct  1782  ESFGC-QTGAFVKPMSSILRSPVI-LRTKSS----DDLQTTELHMKQLEIVKLLRTLLQL  1835

Query  2628  KARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISI-AEW  2804
             K RQ   +   +IGINL++L  LLLSSY ATL + DFEI+NL+ EI+SI +S + + A+ 
Sbjct  1836  KPRQSSFDSGNDIGINLKELHLLLLSSYGATLSETDFEIYNLMLEIESIDNSVVDVVADM  1895

Query  2805  DYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYG  2984
             DYLWG AV+K  KER L Q     +++ E  ++ R+ QFRENLP+DPKMC +T L+FPY 
Sbjct  1896  DYLWGTAVLKISKERVLDQETYDVVTNTEAVKEHRRSQFRENLPVDPKMCVTTALHFPYD  1955

Query  2985  RP--NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFAN  3158
             R   +G   ++++Q D    ++E     V N  +YDP+FILR S H LSMGYIE VEFA 
Sbjct  1956  RTVTDGSFSLDRLQLDNLKDIYERHVPGVENIQLYDPVFILRFSIHALSMGYIEAVEFAG  2015

Query  3159  LGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDW  3338
             LGLLAV+  S+SSPD   RKLGY ++ K+KN LE CQK KDVMRL+LLL+YLQN I E W
Sbjct  2016  LGLLAVAFVSMSSPDVGMRKLGYELIGKYKNVLENCQKTKDVMRLRLLLTYLQNGISEPW  2075

Query  3339  QKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRT  3518
             Q+IPSV A+F AE+S +LLDPSHDHY T++KHLM S  VN+K                  
Sbjct  2076  QRIPSVLALFAAESSLILLDPSHDHYTTLSKHLMHSSKVNMK------------------  2117

Query  3519  ERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSR  3698
              RLW+LR+   GLN DDD  I+IRNS  ETLLSFY SPL+DNESKE+I++ VKK+AKL R
Sbjct  2118  -RLWMLRLACGGLNLDDDTQIFIRNSTIETLLSFYSSPLSDNESKEIILEIVKKAAKLPR  2176

Query  3699  MARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQK  3878
             M R+L+E+CGL  WLSSV++ + G+ +++ + F      VV+EVVN+++  R+ VEWLQ 
Sbjct  2177  MVRYLVEHCGLFPWLSSVLSVYKGMLHENERIFFSQLLVVVIEVVNDVVSSRNIVEWLQN  2236

Query  3879  YALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVE  4058
             YALEQL EL+ +L ++LV G++++KE+ T    +L I+  T K+SQKRK+YQPHFTL+ E
Sbjct  2237  YALEQLMELATYLYKLLVAGSKLIKENVTLVNSVLHIMLTTLKISQKRKIYQPHFTLTFE  2296

Query  4059  GLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSE  4238
             GLF + +A+DV      S  ++ GL+ ILM  P       + +K+S F+ WA+S A++S+
Sbjct  2297  GLFQIYQALDVFNTSRPSASSELGLKTILMGFP------RNQEKLSSFLLWAVSTAMKSD  2350

Query  4239  TKGVLQVEKCCFPLNVSSEEE-TENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRS  4415
             +  ++ V+     L ++SEE  +E SL+SKLLRWL ASVILGK+S KL    ++   ++S
Sbjct  2351  SSQIINVKDTRANLTINSEETPSEESLVSKLLRWLVASVILGKLSRKLDV--NAELSEKS  2408

Query  4416  KLINLHCLLEWNEESDRENGK-EFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLL  4592
                 L  LLE  E+   E+ +  F C+E+LA SIFYLQQLLG +F +L  +V +   LLL
Sbjct  2409  SFKTLQNLLENVEKGCGESNRLGFDCEEVLALSIFYLQQLLGMNFTVL-PSVVSSLSLLL  2467

Query  4593  KNPASSGSEVLIG---NAAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIH  4763
                 S  S+  +G   +  +L SKIRCPAEAN AWRWSFYQPWKD S  L++S+++ E H
Sbjct  2468  LRKKSKFSDFALGYRTSTLSLWSKIRCPAEANPAWRWSFYQPWKDPSCELSESQRMYEQH  2527

Query  4764  ACQMLLLVASKMLARNSL-YSKLISLKDVEKLGVFEWERSI  4883
             ACQ LL++ + +L + S   ++++SL+DVE  G+F+WER+I
Sbjct  2528  ACQSLLVIITNVLGKKSSDDTRVLSLEDVENSGLFKWERTI  2568



>gb|EYU39621.1| hypothetical protein MIMGU_mgv1a0000302mg, partial [Erythranthe 
guttata]
Length=1540

 Score =  1245 bits (3222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 724/1639 (44%), Positives = 1016/1639 (62%), Gaps = 135/1639 (8%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             ++LQNFP+++S+S ++L  PFS+L S+FFL+ S L DVSK WPEM F  L S     ++ 
Sbjct  28    EILQNFPLVLSISSELLEAPFSVLSSMFFLQSSFLTDVSKLWPEMLFDALGSVTCCKEKE  87

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
                  GD+DS + ASAA + +L+ A  C+LF   +      L  Q  L  LLL  ++   
Sbjct  88    DNSCKGDLDSKKAASAAFARYLRSAPFCVLFSAIVQSSSCHLFEQSALKKLLLDKVTAVP  147

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH+VSS  YV+FW N A  SYR+    +L+M SE CF + + +++Q L+          
Sbjct  148   SDHLVSSLCYVMFWMNHASSSYRIGSSNDLKMSSETCFILAEYLVKQLLDK--------N  199

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              S +P  C  E++E I  HP V +SL  PL  + +F+D+  G+S+ + L+S K + +++M
Sbjct  200   LSHIPVNCAAEVVEFILNHPSVTSSLRFPLSGDIEFSDSIFGESLGELLQSAK-QAVNRM  258

Query  723   DLHVINLLRTTFELLYFCDGQTSSFEACHAR-QVTKAFKNVVQKLFLTFKDRTDKCIESK  899
             D HV++L++T  E ++       S +  + R Q+++AF+ + QKLFL FK + D CI+S 
Sbjct  259   DHHVLDLIKTVAEFIFPMRNDQLSEQVINGRKQISRAFEAMEQKLFLIFKTKFDACIKSM  318

Query  900   DLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAGS  1079
             D  P +P  YA+HTL RFI PF+LLELV+W+FSRID ++ +  QS + + L VGLH+A  
Sbjct  319   DFKPFVPTFYALHTLIRFISPFKLLELVNWLFSRIDSKNATVHQSSKRNDLFVGLHLASC  378

Query  1080  VFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLLK  1259
              FD LSA M QP+ E  L   + G  E QFD++L E+I  QV+EI     LD+AD CLLK
Sbjct  379   TFDILSAYMGQPNPESTLYS-YLGGTETQFDVLLFERIFFQVFEICCRFKLDIADKCLLK  437

Query  1260  AFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLHL  1439
             A KVVK HK +Q      +M +SR + + P++++S+C+ ++++ KA+LL+L T  SPLH+
Sbjct  438   AVKVVKMHKSVQDPYLPSIMVLSRIVASTPIDIISHCLHKVDRTKADLLYLITGTSPLHM  497

Query  1440  SIFGHLLSGMIDKQVHLQTNAIR--ETS--NPSDPELLMLLPTVFLYLDSVLIK-AGSQV  1604
             S FG   S +++    L  NA +  ETS  + SD EL MLLPT  LYL+SV IK  G   
Sbjct  498   SAFGFTFSEILNT---LLPNAHKNQETSKYSLSDEELTMLLPTALLYLNSVTIKFEGQPS  554

Query  1605  KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLM  1784
             K F+ I+S Y R+L   FS WK +V+  +F+I     L  S EEF ++FS +LL +++L+
Sbjct  555   KPFQVILSVYGRLLFGGFSKWKIFVSSSIFEIRLDKLLTASREEFSNLFSDSLLGKAILI  614

Query  1785  VQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAK  1964
              +   A    + K + R+ LF+ VCP  S   D  D    + G  SL+Q L FVN+ VA 
Sbjct  615   ARDHLASNEDISKLDWRLSLFNQVCP--SNADDIFDCCCGETGLHSLKQPLEFVNKVVAY  672

Query  1965  INLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTA  2144
             IN CR LLF + N   S                L+ SRI+ L+ML+S+W  IV+KFP   
Sbjct  673   INFCRILLFFDCNGSES--------------PPLEKSRIQFLRMLISTWMLIVKKFPENN  718

Query  2145  DNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDP  2324
               S  ++ EN S+FRFLE  ++ N+ EL+ E+  CL+KLDSLPF  +L K+   +RF+D 
Sbjct  719   AYSGNIDGENLSLFRFLEFFVMHNVSELTTEIQNCLIKLDSLPFTEQLVKSFLLYRFEDS  778

Query  2325  MTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLM  2504
             +TL+ LR +++SLS GKFSC+ +IQL++AHS+F  +I S+N S   +Q GL FTP+ S+M
Sbjct  779   VTLKMLRTVLTSLSRGKFSCISVIQLLLAHSKFAQSIHSANQSLDSTQFGLVFTPMRSIM  838

Query  2505  RSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVD-IEPAQEIGINLR  2681
              S VIP  N +S+  K+    S+  L  LELIKL+RVLFQ+  +Q +      E GIN R
Sbjct  839   TSLVIPCTNLDSLYFKNKKSTSEPDLNLLELIKLVRVLFQIYVQQREEANVGDEEGINCR  898

Query  2682  DLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISI-AEWDYLWGNAVVKARKERELV  2858
             +LV+LLLSSY AT  ++D EI+NL+ EI+S   S+  I A+ DY+WG + +K RK+    
Sbjct  899   ELVYLLLSSYGATCSEVDKEIYNLMLEIESNDKSSAGIVAQTDYIWGPSSLKMRKD----  954

Query  2859  QTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDS  3038
                S +L + E  E+ +K++FREN+P+DP MCA TVL+FPY      G  + V       
Sbjct  955   ---SVDLKNTESFEELQKVKFRENIPVDPNMCAQTVLHFPYNEFVNGGTSSTV-------  1004

Query  3039  MHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRK  3218
             M E CS       IYDPIFILR S HCLS  YIEP+EFA+LGLLA++  S+SS D+ TRK
Sbjct  1005  MTEACST-TDKLQIYDPIFILRFSIHCLSRNYIEPIEFASLGLLAITFVSMSSNDEVTRK  1063

Query  3219  LGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLD  3398
             LGY  L KF +ALEKCQKKKDV RL LL++ LQN IE  W++IPS+ AIF AEAS VLLD
Sbjct  1064  LGYEALSKFNSALEKCQKKKDVKRLGLLMTSLQNGIEGQWRRIPSIIAIFCAEASLVLLD  1123

Query  3399  PSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVH  3578
              S+ ++++I ++  +S  VN+K IPLF  L WS S  F+ +RLW+LR+LY GLNT+DD  
Sbjct  1124  ESYANHSSIYEYFNKSRCVNMKDIPLFSTLFWSSSDKFKMDRLWMLRLLYVGLNTEDDAQ  1183

Query  3579  IYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVT  3758
             IY+ N IF+TL+SFY SPL+DN+SKELIIQ V+K+ +  R  R L+E+ GLI WLSS+V 
Sbjct  1184  IYLGNHIFKTLMSFYCSPLSDNDSKELIIQIVEKACQFHRAVRVLVEHGGLILWLSSIVV  1243

Query  3759  SFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEG  3938
             S+                         I   R+ +EWL K+A+EQLSELS +L ++LV  
Sbjct  1244  SY-------------------------ITSPRNNIEWLPKHAMEQLSELSSNLFKLLVSS  1278

Query  3939  AQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPI  4118
               ++KE ST    IL+ LTL  KVSQKRK+ QPHFTLS + LF L               
Sbjct  1279  FDLIKEESTLCYSILETLTLLLKVSQKRKISQPHFTLSEDSLFQL---------------  1323

Query  4119  AKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEE  4298
              KTG E                  +SKF+ WA++ A+QS+ +                  
Sbjct  1324  YKTGQE-----------------NLSKFLRWAVATAIQSKPE------------------  1348

Query  4299  ETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGK  4478
               + S++SKLLRWL ASVI GKIS KL + D ++SC  SK  +LH L  W    +++  +
Sbjct  1349  --DESIVSKLLRWLIASVIRGKISRKLIE-DDNNSC--SKRESLHSLQSWLSSKNKKVFE  1403

Query  4479  EFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIG-NAAALCSK  4655
             E  C ++LAA+IFYL Q++G +  LLPSAVSALCLLL+  P SS  E L G +  +LC+K
Sbjct  1404  ENGCDDVLAATIFYLLQIIGFNHSLLPSAVSALCLLLV--PNSSELESLTGISLPSLCTK  1461

Query  4656  IRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLIS  4835
             I CP EAN AWRW + + W + S  ++ +EK++EIHAC+ L++VAS +L + S +S +  
Sbjct  1462  IHCPTEANPAWRWLYDEKWGEVSKEISAAEKLDEIHACEKLVMVASNILTKKSGFSHIFE  1521

Query  4836  LKDVEKLGVFEWERSILNL  4892
             LKDVE L V++WERS++ +
Sbjct  1522  LKDVENLHVYDWERSLIQI  1540



>ref|XP_009352441.1| PREDICTED: uncharacterized protein LOC103943806 [Pyrus x bretschneideri]
Length=2603

 Score =  1237 bits (3201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 717/1667 (43%), Positives = 1040/1667 (62%), Gaps = 53/1667 (3%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQ-EG  182
             +L+ FP  ++  K +L VP SLL SIFFLE +LL  VSK WP++F  GLE A+S +   G
Sbjct  947   ILEKFPSFMTAWKYLLAVPVSLLSSIFFLEQTLLASVSKLWPDIFIPGLEKALSSIYCRG  1006

Query  183   RTEEF----------------GDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLST  314
             R ++                  D+D+ E ASAA S +L++A   +LFP  +SI     S 
Sbjct  1007  RQDDACGCLDPVSYARGMICNQDLDTNEAASAAFSFYLEKAPFHVLFPAIMSIDGHSSSD  1066

Query  315   QQGLHNLLLANLSERTPD-HIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDR  491
                + +LL+A LSE + D H++S    VLFW  Q   S RV  L   + L E+C  +V++
Sbjct  1067  LSKIQDLLVAKLSECSIDCHLISHLRLVLFWLYQIRSSQRVGHLVNFQQLLEICLVLVEK  1126

Query  492   MLRQFL--NTKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFS  665
             +L Q L  NT  D+S   +  LL ++ VQE+ E I  HP +   L CPL C+ D   +  
Sbjct  1127  LLSQLLVLNTDSDSSENYS-VLLSSQDVQEVAEIIICHPAMLTLLSCPLGCSEDLPKSSL  1185

Query  666   GDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLY-FC-DGQ-TSSFEACHARQVTKAFK  836
              D+++  +  ++ + IH++D H  ++L  T + L+  C DGQ T+  E    +Q  KAF 
Sbjct  1186  ADNVNALISLSR-QSIHRLDCHAFDILVKTCDYLFTLCNDGQFTAEVEIGAGKQFVKAFN  1244

Query  837   NVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED  1016
              + + LF   + + D+CI +KD TP +P  YA+H L RFI PFELLELVHWMFSR D++D
Sbjct  1245  ILQRNLFHEVRGKFDQCIGTKDFTPFVPTFYALHVLIRFISPFELLELVHWMFSRTDMDD  1304

Query  1017  NSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKIL  1196
                   +  S +  G  IAG  F +LS+ + QP+++R   D+FW M E + +  ++E+I 
Sbjct  1305  ------IEKSAISFGSCIAGGAFRNLSSFLQQPNTKRKSYDIFWKMEENKVNSDIIEEIY  1358

Query  1197  LQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSYCM  1373
             L++ + + H   +  D+CLL+A   V   K MQQ N   L + +SR I   PV ++S+C+
Sbjct  1359  LKICKFSLHFKTEFVDLCLLEAINAVCRQKYMQQCNLHPLHIILSRVIATTPVEIISHCI  1418

Query  1374  FQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHL--QTNAIRE--TSNPSDPELL  1541
              + +K KA LL L T+MS LHLS FGHL  G ++K      + N + E   S  SD + +
Sbjct  1419  CRTSKMKARLLSLLTDMSSLHLSTFGHLFLGFVNKDRDFLHEDNVMEEPCVSALSDEDCI  1478

Query  1542  MLLPTVFLYLDSVLIKAGS-QVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNL  1718
             MLLP    YL+SV +K G    ++F  I +FY RI+L+ F  WK +V+RD+F  E  + L
Sbjct  1479  MLLPAALSYLNSVSLKFGRLSYEHFRCIPTFYSRIILNGFLQWKSFVSRDVFQEEFGEFL  1538

Query  1719  PLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFD  1898
             P S +E + +   +LL +++ M++   +L    +K + R +LF+SV P   +  + +  D
Sbjct  1539  PSSTQELLSLIDDSLLGKTICMLRYHFSLNENAMKMKNRFKLFNSVFPPSVSQDELVGCD  1598

Query  1899  PSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPE---HNKFSSGLKEDKMETCAELHSTLD  2069
                + + SL +SLN VN+  AKI+  + LLFP+    N+  S +K++ ++  ++    LD
Sbjct  1599  IGGLASQSLNESLNLVNKFFAKISFGKVLLFPKGSRSNEAGSDMKDNPLDIASK---KLD  1655

Query  2070  VSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGC  2249
              SR++ + +LV  W+ IV++ P  AD+S +      S++R  E LIL NI+EL+ EM   
Sbjct  1656  SSRMQFMNILVGIWQWIVKRVPSVADSSQKETSTGTSLWRCFEALILMNILELTGEMSDG  1715

Query  2250  LVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFET  2429
             L+KL S+PF+ +L K    +RF+DP TL+ +RD++S LSEGKFS V  +QL++AHSQFE 
Sbjct  1716  LIKLQSIPFLEQLMKPALLYRFEDPTTLKSIRDLLSVLSEGKFSRVPYLQLLLAHSQFEP  1775

Query  2430  AICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLL  2609
              + S   S+     G    P+P ++RS V+P  N + I  K NL+ +  + +QLE++KLL
Sbjct  1776  TVRSDYRSSDGFSFGAFSRPMPGILRSLVVPSANQSVIDHKCNLETADLYARQLEVVKLL  1835

Query  2610  RVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN-  2786
             R+LF +K  Q   +  ++I INL++L  LLLSSY ATL +ID EI+NL+  I+ +  S  
Sbjct  1836  RMLFPIKEHQHSFDFGKDICINLKELHLLLLSSYGATLSEIDVEIYNLIRTIECLDGSKP  1895

Query  2787  ISIAEWDYLWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
              ++A  D+LWG+AV+K  KER L + +S + L++ E  ++ R+ QFRENL +DPK+CAST
Sbjct  1896  ANVAGMDHLWGSAVLKIEKERTLERNMSDDVLTNTEAVKERRRSQFRENLVVDPKICAST  1955

Query  2964  VLYFPYGRPNGPGVV--NKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYI  3137
             VLYFPY R     ++  NK Q D FD      S +      Y+PIFILR S H L+ GY 
Sbjct  1956  VLYFPYDRVASEELLCLNKFQTDNFDDGRLLHSPDAEYIQRYNPIFILRFSIHSLAEGYF  2015

Query  3138  EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQ  3317
             EP+EFA LGLLA++  S+SSPDD  R+LGY  L +FKN LE+CQK+K V  +QLLL+Y+Q
Sbjct  2016  EPLEFAGLGLLAIAFMSMSSPDDRIRRLGYDTLGRFKNTLERCQKRKGVKHIQLLLTYVQ  2075

Query  3318  NCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWS  3497
             N IEE WQ+IPSV +IF AE S +LLDPSH+HYA +T  LM+S  +N+K+I  F N  WS
Sbjct  2076  NAIEEPWQRIPSVNSIFAAETSLILLDPSHEHYAALTTLLMRSSRLNVKNILFFSNFFWS  2135

Query  3498  DSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVK  3677
              S++F+ ERLWILR++Y+GLN D+D  IY+ NS+ E L+SFYVSP++++ESKELI+Q VK
Sbjct  2136  SSINFKAERLWILRLVYAGLNFDEDAQIYMNNSVLEALMSFYVSPISEDESKELILQVVK  2195

Query  3678  KSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRH  3857
             K+ KL +MARHL+E CGL SWLSSV++      +   K     Q  VV EVVN++I  R 
Sbjct  2196  KAVKLHKMARHLVEKCGLFSWLSSVLSVLGEWHFRDGKSLVLLQLGVVSEVVNDVISLRK  2255

Query  3858  TVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQP  4037
               EWLQ+YALEQL EL+ HL + LV    ++K++      IL  + LT K+SQKR++YQP
Sbjct  2256  INEWLQQYALEQLMELASHLFKFLVSDMTLIKDNVAAVNPILGTIILTLKMSQKRRIYQP  2315

Query  4038  HFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAM  4217
             HF LSVEG +++ +A+ +C N       +  L+AILMS PP  I  +  +K+S FI WA+
Sbjct  2316  HFVLSVEGSYNIYKAVKICDNARSCGTVELALKAILMSAPPADIFCLSREKISSFIVWAV  2375

Query  4218  SIALQSETKGVLQVEKC--CFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLD  4391
             S AL++++  +LQ ++   C  +++  EE  ENSLISKLLRWLTASVILGK+ +K + LD
Sbjct  2376  SAALEADSAKMLQPKESHLCL-ISIPEEELYENSLISKLLRWLTASVILGKLDWKSNDLD  2434

Query  4392  SSHSCDRSKLINLHCLLEW-NEESDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAV  4568
                S     L  LH L+E  +  S R++   + C+EILA++I +LQQL GT++++LPS  
Sbjct  2435  PEVS-KSLNLKTLHTLMELVDSASGRKSKSRYGCEEILASAILFLQQLAGTNYQMLPSVA  2493

Query  4569  SALCLLLLKNPASSGSEVLIGNAA-ALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSE  4745
             +AL LLL      +G     G+   +L SKI CPAEAN +WRW+FYQPWKD +   T S+
Sbjct  2494  AALSLLLYDGSVFTGFLCKNGSVVKSLWSKIGCPAEANLSWRWAFYQPWKDLTQGQTGSQ  2553

Query  4746  KIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             K+EE+HAC  LL + S +L +      + S  DV++ G FEWERSI+
Sbjct  2554  KMEELHACHSLLDIVSNVLGKRPSELLVSSTYDVDRFGAFEWERSIM  2600



>ref|XP_010092143.1| hypothetical protein L484_017832 [Morus notabilis]
 gb|EXB50294.1| hypothetical protein L484_017832 [Morus notabilis]
Length=2615

 Score =  1233 bits (3189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 727/1675 (43%), Positives = 1043/1675 (62%), Gaps = 55/1675 (3%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISG--LQ  176
             ++L +FP ++S+SK +  VP  L+ S+FFLE +LL  VS  WPE+FF GLE  +S    +
Sbjct  946   EILNSFPTVMSISKILPSVPAYLMPSLFFLEQTLLTSVSNFWPEVFFAGLEMTVSSTYYK  1005

Query  177   EGRTEEFG---------------DIDSMEFASAAL--SLFLKEASLCMLFPITLSIYKSD  305
             + + +  G               + D+ E ASAA   S FLK+A   +LFP  +S     
Sbjct  1006  DRKDDACGATDYALAMEEMVGTKEFDTNEAASAAFTFSFFLKQAPFHVLFPSIMSTDGPY  1065

Query  306   LSTQQGLHNLLLANLSERTPDHIVSSFLYVL-FWFNQAHISYRVepleelemlselCFNI  482
              S    + +LLLA LSE   D    S+L +L FW +Q   SYRV P  +L+ LSE+CF +
Sbjct  1066  SSEPTKIKDLLLAKLSEWKFDGRFVSYLRLLLFWIHQIQSSYRVSPAAKLQELSEICFVL  1125

Query  483   VDRMLRQFLNTKGDAS-SKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDT  659
             +  +L Q L+ K D+   + +R LL T+ +QE+  TIF HP V  S+  PL C+      
Sbjct  1126  LKDLLVQLLDIKIDSDCPRTSRVLLSTQEIQEVAVTIFCHPAVETSISRPLGCDVSLAKA  1185

Query  660   FSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLY-FCDGQTSSFEACH--ARQVTKA  830
                +S+     S++ + +HK+D H++++L  T E L+  CD      +  +    ++ K 
Sbjct  1186  NLLNSIGSLTNSSR-QSVHKLDHHILDMLVRTSEYLFSLCDDHHFEVKVKNVVGNKLVKV  1244

Query  831   FKNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDL  1010
                ++Q +    K+  D+CI + DL  LL   YA+H +  F  P ELLELV WMF R+++
Sbjct  1245  VNMLIQMILKEVKEGFDRCISTGDLIQLLQPYYALHAMIHFASPVELLELVQWMFKRVNV  1304

Query  1011  EDNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEK  1190
             +  + + S + S +  G  IA   F +LSA + QP S+R   D+ W  +EE  ++ ++E+
Sbjct  1305  DKLTDENSNKTSPISFGFCIAVGAFRNLSAYLMQPLSKRRKYDMLWD-VEENKNVNIVEE  1363

Query  1191  ILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQ-SNPTLVMAISRFIVNIPVNLLSY  1367
             I +QV  +A H   + ADMCLL+A    +  K  +  S   L + +SR I+N  V +L +
Sbjct  1364  IYIQVTWLAMHFETEYADMCLLEAVNAAQMQKFRRHHSFHRLSLVMSRVIMNTSVKILPH  1423

Query  1368  CMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSN--PSDPELL  1541
             C ++    KA+LLFL T+MS LHLSIFG L   +++K +  + N   E+     SD E +
Sbjct  1424  CTYRTTMTKAKLLFLLTDMSSLHLSIFGDLFLSLVNKDLVHRGNKAEESRGFALSDEEYM  1483

Query  1542  MLLPTVFLYLDSVLIKAGSQ-VKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNL  1718
             MLLPT   YL+S ++K G Q  K+F  I SFY  ILL  F DWK +V+ D+F  E  + L
Sbjct  1484  MLLPTALSYLNSSIMKFGLQNYKHFRSIPSFYSTILLKGFRDWKSFVSSDVFWEEYGNFL  1543

Query  1719  PLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFD  1898
             P S +E + + + +LL +++ M+Q   AL G  +K + R++LF+S+ P  ++  + +D D
Sbjct  1544  PTSTQELLILVNDSLLGKAIRMLQFHFALDGGSMKMKKRLKLFNSIFPVSTSHEELVDSD  1603

Query  1899  PSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDK--METCAELHSTL-D  2069
                  +CSL Q+LN +NR +AKI+LCR LLFP  N+  S  KED    ET  E+ ST  D
Sbjct  1604  FIAADSCSLNQALNLINRVLAKISLCRVLLFPNCNQIQSIPKEDGGLKETPWEMGSTKED  1663

Query  2070  VSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGC  2249
              S +  +K+LV  W+ IV+KFP+ +  S +   +  S+FR+LE  IL++I+EL+ EMHG 
Sbjct  1664  CSGMDFVKILVGLWQSIVKKFPLVS-GSYKKRTDIVSLFRYLEAFILQSILELTTEMHGS  1722

Query  2250  LVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFET  2429
             L++L+S+PF+ +L K+   +RF+DP TL+ L+ I++ LSEGKFS    +QL++AHSQFE+
Sbjct  1723  LIQLESIPFLEQLMKSALRYRFEDPTTLKMLQGILTVLSEGKFSRDFYLQLLLAHSQFES  1782

Query  2430  AICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLL  2609
              I S + ST  S +G    PLP ++R  V P  + N+      L+    +LKQL +IKLL
Sbjct  1783  TIHSVSNSTNCSHIGAFLRPLPGVLRHLVFPTADKNTSDGNHELETMDLYLKQLGVIKLL  1842

Query  2610  RVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNI  2789
             RVLF  K+ Q   +  + +GI  R L  LLLSSY A L ++D EI+NL++ I+S      
Sbjct  1843  RVLFSFKSHQSASDFGKSLGIKFRKLHLLLLSSYGAKLNEMDMEIYNLMSTIESFDGLEA  1902

Query  2790  -SIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTV  2966
              +IA  D+LWG A  K  KE+ L Q +   ++DAE  ++ R+ QFRENLP+DPK+CASTV
Sbjct  1903  ENIAGLDHLWGTAASKVEKEQALEQDI---MNDAEAVKERRRSQFRENLPVDPKICASTV  1959

Query  2967  LYFPYGR--PNGPGVVNKVQKDTFDSM----HEDCSAEVANRHIYDPIFILRLSFHCLSM  3128
             LYFPY R   + P  ++K + D F  M     +   ++V N   YDP+FILR S + L++
Sbjct  1960  LYFPYDRTASHEPVSLDKFRADNFACMIVNYTQTRPSDVENLERYDPVFILRFSLYSLTV  2019

Query  3129  GYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLS  3308
             GYIEP+EFA LGLLA++  S+SSPD+  RKL Y  L KFK+ LE+C+K+K+V R++LLLS
Sbjct  2020  GYIEPMEFAGLGLLAIAFVSMSSPDEGIRKLAYSTLGKFKDTLEQCKKRKEVTRIRLLLS  2079

Query  3309  YLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNL  3488
              LQN IEE WQ+IPSV +IF AEASF+LLDPSHD Y+T+++ LM S  +NLK++P+F + 
Sbjct  2080  SLQNGIEEPWQRIPSVVSIFAAEASFILLDPSHDQYSTLSRLLMNSSKLNLKNVPVFSDF  2139

Query  3489  LWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQ  3668
              WS SV++R +RLWILR++Y+GLN+ DD  IYIRNSI ET +SFY SPL+D ESK+LI+Q
Sbjct  2140  FWSTSVNYRADRLWILRLVYAGLNSSDDAQIYIRNSIPETFMSFYFSPLSDTESKDLILQ  2199

Query  3669  TVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIF  3848
              VK+S K  ++ RHL+E+CGL+ WLSSV+T+      D    F   Q  VVLEVVN +I 
Sbjct  2200  VVKRSVKFYKLTRHLVESCGLLLWLSSVLTANTRNSRDETNIF-IMQLTVVLEVVNGVIS  2258

Query  3849  FRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKV  4028
              R+  EWLQK ALEQL EL  HL + LV+G   +KEH+T   L+L+ L  T K+SQKRK+
Sbjct  2259  SRNITEWLQKEALEQLMELVSHLYRFLVDGMVSVKEHATLVNLLLETLISTLKISQKRKI  2318

Query  4029  YQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFIN  4208
             YQPHF LS+EGL+ +CE +    +      A+ GL+AILMSTPP AI  M  +K+S+F+ 
Sbjct  2319  YQPHFNLSIEGLYQICEVLSTDDDVITCANAEFGLKAILMSTPPAAIFSMSQEKLSRFLM  2378

Query  4209  WAMSIALQSETKGVLQVEKCCFPLN-VSSEEETENSLISKLLRWLTASVILGKISYKLSK  4385
             WA+S ALQ+E     Q +     L+ +  EE+ E+SL+SKLLRWLTASVILGK+    + 
Sbjct  2379  WAVSSALQAECAKSPQSKLSQQSLSFILEEEQHEDSLLSKLLRWLTASVILGKLVTNSND  2438

Query  4386  LDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSA  4565
             LD         L++    +E   E   +NG     +E LA++I +LQ+L+GT+ K+LPS 
Sbjct  2439  LDPKTGSSVKDLLSSLDHVETACEESNQNG--VGREEFLASTILFLQRLVGTNHKVLPSV  2496

Query  4566  VSALCLLLLKNPASSGSEVLIGNA-----AALCSKIRCPAEANSAWRWSFYQPWKDHSSN  4730
             VSAL +LLL   A + ++VL G+       +L S+I  PAEAN +WRWSFYQPWKD S  
Sbjct  2497  VSALSILLLH--AFNLADVLRGHGLRSLLESLWSRICPPAEANPSWRWSFYQPWKDLSLE  2554

Query  4731  LTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSILNLN  4895
             LTDS+K++E+HACQ LL V S +L   +  S     +DV K+  FE E+ IL L+
Sbjct  2555  LTDSQKLDELHACQTLLFVMSNVLGSMNSESLRSLTEDVRKIDSFEREKGILGLD  2609



>ref|XP_007022465.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY13990.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=2614

 Score =  1227 bits (3174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 726/1660 (44%), Positives = 1036/1660 (62%), Gaps = 40/1660 (2%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGL-QE  179
             D+L NFP+++++S K LGV   LL SI F E + L+ +S  WPE+F  GLE A+  + Q+
Sbjct  960   DILINFPLVMTISLK-LGVAVPLLSSIIFSEQNFLVGLSNLWPEVFVPGLEMALLEIHQK  1018

Query  180   GRTEEFG-----DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLA  344
             G+ ++ G     D D+++ A+AA SLFLK+    +LFP T+SI    LS    + +LLL+
Sbjct  1019  GKDDDEGMTSNIDFDTIQSAAAAFSLFLKQVPFHVLFPATISIDAPYLSESSKIQDLLLS  1078

Query  345   NLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGD  524
               S+ T D  +S    VLFWF +  +  R + L ELE +S++C  I+  M  Q L  K D
Sbjct  1079  KRSDWTSDCPISFLRLVLFWFYRVRLFCRNKQLNELEQVSDICLIIIKHMFSQLLALKPD  1138

Query  525   -ASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNK  701
                S  T   L  + ++E+ E I  HP + +SL CPL CN + T    G+ ++ FL  + 
Sbjct  1139  FECSMNTEVPLLAETIREVGEIILCHPEMISSLTCPLSCNKEVTTGLLGNGLETFLSLSG  1198

Query  702   WRVIHKMDLHVINLLRTTFEL-LYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRT  878
              RV  K+D HV++LL  T +  L       S  E    R + +AF ++VQ+LFL  KDR 
Sbjct  1199  QRV-RKLDHHVLDLLTATLDFYLSVSKSHYSVIEDEAKRTIRRAFSSLVQRLFLDVKDRF  1257

Query  879   DKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRV  1058
             D C  S DL PLL +  AIH L  FI PFELLEL HWMFSRID+   + + S   S L V
Sbjct  1258  DVCSGSGDLQPLLSSFCAIHALILFISPFELLELGHWMFSRIDVNKLTAENSHVMSALSV  1317

Query  1059  GLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDV  1238
             G  +AG  F+ LS  + QP  ER   D  W + E+ FD+ +LE I ++V + A + +LD 
Sbjct  1318  GFSLAGGGFEVLSTYLQQPLIERAPYDFLWQVEEKTFDVNILEDIYVKVCKFACNFNLDF  1377

Query  1239  ADMCLLKAFKVVKTHKVMQQS--NPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFL  1412
             ADMCLL+A   V   K  Q+   +P+  + +SR +++ PV ++S+C+++ +  KA+LL L
Sbjct  1378  ADMCLLRAVNAVYRQKSSQRGELHPSSAV-MSRVLMSTPVEMVSHCIYRTSIAKAKLLHL  1436

Query  1413  ATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP--SDPELLMLLPTVFLYLDSVLI  1586
               EMSPLHLSIFG L   +++K        ++E S    SD   +MLLP     ++S  +
Sbjct  1437  LIEMSPLHLSIFGQLFLNILNKDFFSNAILMKEISGYALSDDNFMMLLPAALSLVNSAFV  1496

Query  1587  KAGSQ-VKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNL  1763
             K      ++F+ I SFY R+LL+ F  WK +V+ D+F  E  + LP S +E  ++   +L
Sbjct  1497  KFEKHFYRHFKSIPSFYSRMLLNGFVHWKSFVSGDIFQEEYSEFLPSSAQELFNLVDESL  1556

Query  1764  LSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNF  1943
             L +++ +++    L+G  +K + R+ELF+S+     T  + LD   S++   S+ +SLN 
Sbjct  1557  LGKAIHLLRYHFFLSGDSLKLKKRLELFNSIFAYSVTHEELLDCGVSEMDFSSVNKSLNH  1616

Query  1944  VNRTVAKINLCRTLLFPEHNKF-------SSGLKEDKMETCAELHSTLDVSRIRLLKMLV  2102
             +N+ VAKI+ C+ LLFPE +K          GL+E  +   +   +  D SR+  +  LV
Sbjct  1617  INKVVAKISFCKMLLFPEDDKVLFLPKEEDGGLREISLTMGS---NKADSSRMHFMDALV  1673

Query  2103  SSWRKIVEKFPMTADNSCQMEVENCS---VFRFLEVLILRNIVELSKEMHGCLVKLDSLP  2273
              +W+ +V+K P+  + S  +  ++     ++R LEV ILRNI++L+++MH  L+ L S+P
Sbjct  1674  GAWQWMVKKLPLIPEYSISIIAKSGDCLCLYRCLEVFILRNILQLTRKMHSYLILLQSIP  1733

Query  2274  FIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLS  2453
             F+ +L ++T  +RF+D  TL  LR I+  LSEGKFS V  +Q+++ HSQF   I S + S
Sbjct  1734  FVEQLMRSTLLYRFEDSKTLGILRSILILLSEGKFSRVLCLQMLLGHSQFAPMIHSISKS  1793

Query  2454  TGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKA  2633
             +  S+ G  F P+ S++R  V+P    N    KD+ + ++  +KQLE++KLLR L    A
Sbjct  1794  S-TSETGTFFRPMSSILRLLVVPDITSNVKDGKDDQEAAEMCVKQLEILKLLRTLLLSGA  1852

Query  2634  RQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNIS-IAEWDY  2810
                D +   +  INL++L  LLLSSY ATL +ID E+++L+NEI++I  S+   IAE DY
Sbjct  1853  AHSDFDSRNDSSINLKELHLLLLSSYGATLSEIDLEMYSLINEIETIDSSDSKYIAEIDY  1912

Query  2811  LWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR  2987
             LWG+A +K RKE  L    S N ++D E A++  KI++R+NLP+DPK+CA+TVL+FPY R
Sbjct  1913  LWGSAAMKVRKEHGLEHGASRNIMTDIEAAQERLKIKYRDNLPVDPKVCAATVLHFPYDR  1972

Query  2988  --PNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANL  3161
                + P  +NK+Q D    M +  S    N   YDP+FI+R S H LS GYIEPVEFA L
Sbjct  1973  TASDRPLSLNKLQSDNIKDMIKLHSPGAGNIQRYDPVFIMRFSIHSLSAGYIEPVEFAGL  2032

Query  3162  GLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQ  3341
             GLLAV+  S+SS D   RKL Y VL +FK +LE+CQ+KKDV RL LLL Y+QN IEE WQ
Sbjct  2033  GLLAVAFVSMSSLDVGMRKLAYEVLSRFKISLERCQRKKDVTRLHLLLMYMQNGIEEPWQ  2092

Query  3342  KIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTE  3521
             +IPSV A+F AE S VLLDP H+HY+T  K LM S  VN+K IPLF +   S +V+FR +
Sbjct  2093  RIPSVIALFAAETSLVLLDPLHEHYSTFNKLLMNSSRVNMKQIPLFHDFFQSSAVNFRAQ  2152

Query  3522  RLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRM  3701
             RLWILR+  +GLN +DD  +YIR+SI ETL+SFYVSPL+DNESK+LI+Q +KKS +L +M
Sbjct  2153  RLWILRLANAGLNLEDDAWLYIRSSILETLMSFYVSPLSDNESKKLILQILKKSVQLHKM  2212

Query  3702  ARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKY  3881
              R+L+E C L SWLSS+++++  +           +  +V+EVV E+I  +   EWLQ  
Sbjct  2213  VRYLVEQCSLFSWLSSILSNYSRVLLGDENRIFLTELVMVIEVVTEVISSKDITEWLQSC  2272

Query  3882  ALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEG  4061
             ALEQL EL+ HL ++LV G +++ EH+ F    LQI+  T K+SQKR++YQPHFTLS+EG
Sbjct  2273  ALEQLMELASHLYKLLVGGMKLINEHAAFVNPTLQIIISTLKMSQKRQMYQPHFTLSLEG  2332

Query  4062  LFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSET  4241
             LF +  A++    G YS  A+ GLEAIL STPP+ +  MD +K+S F+ WA S AL+SE+
Sbjct  2333  LFQIYRAVNEHDIGRYSGNAECGLEAILTSTPPIDMFCMDREKLSSFLIWATSTALKSES  2392

Query  4242  KGVLQVEKCCFPLNVSSEEET-ENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSK  4418
             + + Q ++    L V  EE   E SL  KLLRWLTAS+I GK+S+K +   +  S DRS 
Sbjct  2393  RKMFQCKESGLYLPVILEEAPHEESLTLKLLRWLTASIIHGKLSWKFNDWIAKFS-DRSN  2451

Query  4419  LINLHCLLEWNEESDRENGK-EFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLK  4595
                L  LLE+  + D+E  K  F C+E+LAA +FYLQQ LG +   LPS +SALCLLL  
Sbjct  2452  SKTLQSLLEYVPKGDKEGNKSSFDCEEMLAAQVFYLQQSLGINCSALPSVISALCLLLCD  2511

Query  4596  NPASSGSEVLIG---NAAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHA  4766
             +   +G + ++    +   LCS I CP E+  AWRWSF QPWKDHSS LTD E+I+E+HA
Sbjct  2512  DSKVAGLDFMLDFRTSMVTLCSMICCPPESYPAWRWSFDQPWKDHSSELTDLERIDELHA  2571

Query  4767  CQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             CQ LL++ S +L R S     +SL+ VE  GV +WERSI+
Sbjct  2572  CQKLLVMISNVLWRKSSDFLALSLQAVENCGVLKWERSII  2611



>ref|XP_010317144.1| PREDICTED: uncharacterized protein LOC101258227 isoform X3 [Solanum 
lycopersicum]
Length=2151

 Score =  1217 bits (3149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 661/1226 (54%), Positives = 884/1226 (72%), Gaps = 22/1226 (2%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP IVS+S K+LGVP SLLM +FF EPSLL D SK WPE+FFTG+E A++ L  G
Sbjct  938   EIIQNFPSIVSLSNKLLGVPLSLLMQLFFSEPSLLSDASKRWPEIFFTGMERALARLSGG  997

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT        M++ S A S+FL+ A   +LFP  L I   D S Q GL +LLLA LS++T
Sbjct  998   RT--------MDYESDAFSVFLERAPFYVLFPAVLYIDGLDFSDQSGLQSLLLAKLSKKT  1049

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQ  +SYR E  E LE LS  CF ++  ML++ L  K ++    T
Sbjct  1050  SDHLLSCFRYLLFWLNQTQLSYRHEQFEGLEKLSAACFLLLSGMLKKLLVEKSNSRGVDT  1109

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              S   T  ++EL+ TI  HP V + LE P P N+DF      DS+D+F+ES K ++  K 
Sbjct  1110  CSPFSTYFIEELVVTILDHPAVVSVLEYPSPVNSDFACGTIQDSVDQFVESVKLKIC-KT  1168

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV+NL++ TFE  L FC GQ+SS E  HA + V  +FKNVV+KL LTF+ + ++C++S
Sbjct  1169  DHHVLNLVKATFEFWLSFCFGQSSSSEVYHANKHVVTSFKNVVKKLVLTFRLKMNECMKS  1228

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K+L PL+P +YA+H+L  FI PFE+LEL HW+ S IDLED S   +   S L VGLHIAG
Sbjct  1229  KNLIPLVPVLYALHSLIHFISPFEVLELAHWILSLIDLEDRSVWLT---SALCVGLHIAG  1285

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S FD L+A MWQP  + P+  LFWG+ +EQ D++L EK+LLQVY+IAT   LDVAD CLL
Sbjct  1286  SAFDHLAAYMWQPQEKIPIC-LFWGIQQEQNDVILYEKVLLQVYDIATRFELDVADACLL  1344

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVK HK MQ+ +   +    R + N  VN+LS+CM +I KRKAE+LFL  ++SPLH
Sbjct  1345  KAVKVVKVHKSMQKESHLFLKDSCRTVANTHVNVLSHCMLKITKRKAEILFLVADISPLH  1404

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQVKYF-  1613
             LS+FG L S  ++K V ++   +    + SD + LMLLPTV LYL+S+  K G Q+    
Sbjct  1405  LSVFGKLFSDRMNKYVVVKPRTVPPICDFSDEDALMLLPTVILYLNSIPAKFGGQLCILH  1464

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E I SFYW IL   FS W  YV+R++F +E F+NL  S+E+F ++ S +LL+ +V++VQL
Sbjct  1465  EHIASFYWEILKQGFSIWTSYVSREIFKVEYFENL--SMEDFPNLVSGSLLANTVIVVQL  1522

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                + G LVK + R+ +F+SVC   S C D L+FD +Q G+ S+E+SLN VNRTVAKI L
Sbjct  1523  FFEIRGDLVKVKKRLSIFNSVC--SSDCSDLLEFDLTQDGSYSVEESLNVVNRTVAKIRL  1580

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLFPE  KF S LK++     +E    LD++RIR L +LV SW+ IV++  +     
Sbjct  1581  CRALLFPEKGKFPSLLKKNAEVVASEDCPILDLARIRFLNLLVQSWQLIVKRCSLNVVGF  1640

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              QMEV +CS+FR+LEV IL+N+ E+++EM GCL+ L+SLPF+ +L  ++  HRF DP+TL
Sbjct  1641  RQMEVGSCSIFRYLEVYILKNVTEITREMQGCLLNLESLPFVEQLGNSSLLHRFYDPLTL  1700

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
               LR IISS+SEGKFSC+ IIQ ++AHSQF   I SS++S G S  G+ FTPLPS+MRS+
Sbjct  1701  GMLRAIISSVSEGKFSCISIIQRLLAHSQFAATIHSSHISAGHSHFGMIFTPLPSIMRSY  1760

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V    + ++   KD+ ++S++  +QLEL+KLLR+LFQ+ ARQ DI   ++IGINLR+L+F
Sbjct  1761  V-QFADLDAYDLKDSCKLSEECARQLELVKLLRLLFQISARQCDINNVKDIGINLRELLF  1819

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  ID EI++L++EI S ++   +S+A+ DYLWG+A++K RKE E  QT+S
Sbjct  1820  LLLSSYGASMSVIDLEIYSLMDEISSANNLGEVSMAKLDYLWGSALLKVRKENEQEQTIS  1879

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
             CNLS+AE  +D R+I+FREN+PIDPK+CA+TVLYFPY R  GP ++ + +KD  D  +E 
Sbjct  1880  CNLSEAEAVDDYRRIRFRENIPIDPKVCATTVLYFPYERTVGPRILKEPKKDYPDFGYEV  1939

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
               A+    H+YDPIFIL  S HCLSMG++EP+EFA+LGLLA+++ SISSPDDD RKLGY 
Sbjct  1940  HYADAEKLHVYDPIFILHFSVHCLSMGFVEPLEFASLGLLAIAVVSISSPDDDMRKLGYE  1999

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK+ LE+CQK+KDV+RL+LL+SYLQN IEE WQKI SVTAIF+AEAS+VLLDPSHD
Sbjct  2000  VLGRFKSVLERCQKRKDVVRLRLLMSYLQNGIEEPWQKISSVTAIFVAEASYVLLDPSHD  2059

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             HY+ I+K+L++SPS N+K IPLFQ   WS S ++ TERLW+LR+L SGLN DDD  IYIR
Sbjct  2060  HYSAISKYLIRSPSANMKGIPLFQTFFWSISTNYITERLWMLRLLCSGLNLDDDAQIYIR  2119

Query  3591  NSIFETLLSFYVSPLADNESKELIIQ  3668
             N+IFETL SFYVSP++D+ESKELI+Q
Sbjct  2120  NAIFETLFSFYVSPISDHESKELIVQ  2145



>ref|XP_008365212.1| PREDICTED: uncharacterized protein LOC103428852 isoform X2 [Malus 
domestica]
Length=2225

 Score =  1209 bits (3127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/1669 (42%), Positives = 1032/1669 (62%), Gaps = 57/1669 (3%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQ-EG  182
             +LQNFP  ++  K +LG+P SLL SIFF E +LL  VSK WP++F  GLE A+S +   G
Sbjct  569   ILQNFPSFMTAWKYLLGIPVSLLSSIFFQEQTLLASVSKLWPDIFIPGLEKALSSICCRG  628

Query  183   RTEEF----------------GDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLST  314
             R ++                  D D+ E ASAA S +L++A   +LF   +SI       
Sbjct  629   RKDDARGSLDPVSYARGMIFNQDHDTNEAASAAFSFYLEKAPFHVLFSAIMSIDGHSSXD  688

Query  315   QQGLHNLLLANLSERTPD-HIVSSFLYVLFWFNQAHISYRVepleelemlselCF--NIV  485
                + +LL+A LSE + D H++S    VLFW  Q   S+RV  L   + LSE+C      
Sbjct  689   LSKIQDLLVAKLSECSIDCHLISHLRLVLFWLYQIQSSHRVGHLVNFQQLSEICLVLLEN  748

Query  486   DRMLRQFLNTKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFS  665
                    LNT  D+S   +  LL ++ VQE+ E I  HP +   L CPL C+ D   +  
Sbjct  749   LLSQLLMLNTDSDSSENYS-VLLSSQDVQEVAEIIICHPAMLTLLSCPLGCSDDLPKSSL  807

Query  666   GDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLY-FCDGQ--TSSFEACHARQVTKAFK  836
              D+++  +  ++ + IH++D H +++L  T + L+  C+ +  T+  E    +Q  KAF 
Sbjct  808   ADNVNALISLSR-QSIHRLDCHALDILAKTCDYLFTLCNDRQFTAEGEIGAGKQFVKAFN  866

Query  837   NVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED  1016
              + + LF   + + D+CI +KD TP LP  YA+H L RFI PFELLELVHWMFSR+D++D
Sbjct  867   VLQRNLFHEVRVKFDQCIGTKDFTPFLPTFYALHVLIRFISPFELLELVHWMFSRVDMDD  926

Query  1017  NSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKIL  1196
                   +  S +  G  IAG  F +LS+ +  P+++R   D+FW M E +F+  ++E+I 
Sbjct  927   ------IEKSAISFGSCIAGGAFRNLSSFLQHPNTKRKSYDIFWKMEENKFNSDIIEEIY  980

Query  1197  LQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSYCM  1373
             L++ + + H   +V D+CLL+A   V   K  QQ N   L + +SR I   PV ++S+C+
Sbjct  981   LKICKFSLHFKTEVVDICLLEAINAVCRQKFKQQCNLHPLHIILSRVIATTPVEIVSHCI  1040

Query  1374  FQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQ--TNAIRE--TSNPSDPELL  1541
             ++ +K KA LL L T+MS LHLS FGHL S  ++K    Q   N + E   S  SD + +
Sbjct  1041  YRTSKMKARLLSLLTDMSSLHLSTFGHLFSCFVNKYRDFQREGNVMEELCVSXLSDEDCI  1100

Query  1542  MLLPTVFLYLDSVLIKAGS-QVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNL  1718
             MLLP    YL+SV +K G    ++F  I +FY RI+L+ F  WK +V+RD+F  E  + L
Sbjct  1101  MLLPAALXYLNSVSLKFGRLSFEHFRYIPTFYSRIILNGFLQWKSFVSRDVFQEEFGEFL  1160

Query  1719  PLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFD  1898
             P S +E + +   +LL +++ M++   +L    +K + R +LF+S+ P   +  + +  D
Sbjct  1161  PSSAQELLSLIDDSLLGKTICMLRYHFSLNEDAMKMKNRFQLFNSIFPPSVSQDELVGCD  1220

Query  1899  PSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPE---HNKFSSGLKEDKMETCAELHSTLD  2069
                + + SL +SLN VN+  AKI+  + LLFP+    N+  S +K++ ++  ++    LD
Sbjct  1221  IGGLASQSLNESLNLVNKFFAKISFGKVLLFPKGSRSNEAGSDVKDNPLDIASK---KLD  1277

Query  2070  VSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGC  2249
              SR++ + +LV  W+ IV++ P   D+S +    + S++   E LIL NI+EL+ EM   
Sbjct  1278  SSRMQFMNILVGIWQWIVKRVPSVEDSSQKETSTDTSLWXCFEALILMNILELTGEMSDG  1337

Query  2250  LVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFET  2429
             L++L S+PF+ +L K+   +RF+DP TL+ +RD++S LSEGKFS V  +QL++AHSQF  
Sbjct  1338  LIQLQSIPFLEQLTKSALLYRFEDPTTLKSIRDLLSVLSEGKFSHVPYLQLLLAHSQFAP  1397

Query  2430  AICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLL  2609
              + S   S+     G    P+P ++RS V+P  N + I  K NL+ +  + +QLE++KLL
Sbjct  1398  TVRSEYRSSEGFIFGAFSRPMPGILRSLVVPSANQSIIDHKCNLETADLYARQLEVVKLL  1457

Query  2610  RVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN-  2786
             R+LF +K  Q   +  ++I INL++L  LLLSSY ATL +ID EI+NL+  I+ +  S  
Sbjct  1458  RMLFPIKEHQHGFDFGKDICINLKELHLLLLSSYGATLSEIDVEIYNLIRTIECLDGSKP  1517

Query  2787  ISIAEWDYLWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
              ++A  D+LWG+AV+K  KER L + +  + L+D E  ++ R+ QFRENL +DPK+CAST
Sbjct  1518  ANVAGMDHLWGSAVLKIEKERTLERNMXDDVLTDTEAVKERRRSQFRENLVVDPKICAST  1577

Query  2964  VLYFPYGRPNGPGVV--NKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYI  3137
             VLYFPY R     ++  NK Q D F +     S +      Y+PIFILR S H LS GYI
Sbjct  1578  VLYFPYDRVASEELLCLNKFQTDNFGNGLLLHSPDGEYMQRYNPIFILRFSIHSLSEGYI  1637

Query  3138  EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQ  3317
             EP+EFA LGLLA++  S+SSPDD  R+LGY  L +FKN LE+CQK+K V ++QLLL+Y+Q
Sbjct  1638  EPLEFAGLGLLAIAFMSMSSPDDRIRRLGYDTLGRFKNTLERCQKRKGVKQIQLLLTYVQ  1697

Query  3318  NCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWS  3497
             N IEE WQ+IPSV +IF AE S +LLDPSH+HY  +T  LM+S  +N+K+I  F N  WS
Sbjct  1698  NAIEEPWQRIPSVNSIFAAETSLILLDPSHEHYTALTTLLMRSSRLNVKNILFFSNFFWS  1757

Query  3498  DSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVK  3677
              S++F+ ERLWILR++Y+GLN D+D  IY+ NS+ E L+SFYVSP++D+ESKELI+Q VK
Sbjct  1758  SSINFKAERLWILRLVYAGLNFDEDAQIYMNNSVLEALMSFYVSPISDDESKELILQVVK  1817

Query  3678  KSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRH  3857
             K+ KL +MARHL+E CGL SWLSSV++      +   K     Q  VV EVVN++I    
Sbjct  1818  KAVKLHKMARHLVEKCGLFSWLSSVLSVLGERHFRDGKSLFLLQLGVVSEVVNDVISLXK  1877

Query  3858  TVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQP  4037
               EWLQ+YALEQL EL+ HL + L+    ++K++      IL  + LT K+SQKR++YQP
Sbjct  1878  INEWLQQYALEQLMELASHLFKFLISDMTLIKDNVAAVNPILXAIILTLKISQKRRIYQP  1937

Query  4038  HFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAM  4217
             HF LSVEG +++ +A+ +C N       +  L+AILMS PPV I  +  +++S FI WA+
Sbjct  1938  HFVLSVEGSYNIYKAVKICDNARSCGTVELALKAILMSAPPVDIFCLSREQISSFIXWAV  1997

Query  4218  SIALQSETKGVLQVEKCCFPLNVSSEEE-TENSLISKLLRWLTASVILGKISYKLSKLDS  4394
             S AL+++   + Q ++    L    EEE  ENSLISKLLRWLTASVILGK+ +K + LD 
Sbjct  1998  SAALEADFAKMXQPKESHLCLTSIPEEELYENSLISKLLRWLTASVILGKLDWKSNDLDP  2057

Query  4395  SHSCDRSKLINLHCLLEWNEE-SDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVS  4571
               S  R  L  L  L+E  E  S+R++   + C+EILA++I +LQQL GT+ ++LPS  +
Sbjct  2058  EVS-KRLNLKTLQTLMELVESASERKSKSRYGCEEILASAILFLQQLAGTNHQMLPSVAA  2116

Query  4572  ALCLLLLKNPASSG----SEVLIGNAAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTD  4739
             AL LLL      +G    +E ++    +L SKI CPAEAN +WRW+FYQPWKD +   T 
Sbjct  2117  ALSLLLYDGSVFTGFFCKNESVV---KSLWSKIGCPAEANLSWRWAFYQPWKDLTQEQTG  2173

Query  4740  SEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             S+K+EE+HAC  LL + S +L +      + S  DV++ G FEWERSI+
Sbjct  2174  SQKMEELHACHSLLDIVSNVLGKRPSELLVSSTYDVDRFGAFEWERSIM  2222



>ref|XP_008365204.1| PREDICTED: uncharacterized protein LOC103428852 isoform X1 [Malus 
domestica]
Length=2603

 Score =  1208 bits (3126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 708/1669 (42%), Positives = 1032/1669 (62%), Gaps = 57/1669 (3%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQ-EG  182
             +LQNFP  ++  K +LG+P SLL SIFF E +LL  VSK WP++F  GLE A+S +   G
Sbjct  947   ILQNFPSFMTAWKYLLGIPVSLLSSIFFQEQTLLASVSKLWPDIFIPGLEKALSSICCRG  1006

Query  183   RTEEF----------------GDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLST  314
             R ++                  D D+ E ASAA S +L++A   +LF   +SI       
Sbjct  1007  RKDDARGSLDPVSYARGMIFNQDHDTNEAASAAFSFYLEKAPFHVLFSAIMSIDGHSSXD  1066

Query  315   QQGLHNLLLANLSERTPD-HIVSSFLYVLFWFNQAHISYRVepleelemlselCF--NIV  485
                + +LL+A LSE + D H++S    VLFW  Q   S+RV  L   + LSE+C      
Sbjct  1067  LSKIQDLLVAKLSECSIDCHLISHLRLVLFWLYQIQSSHRVGHLVNFQQLSEICLVLLEN  1126

Query  486   DRMLRQFLNTKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFS  665
                    LNT  D+S   +  LL ++ VQE+ E I  HP +   L CPL C+ D   +  
Sbjct  1127  LLSQLLMLNTDSDSSENYS-VLLSSQDVQEVAEIIICHPAMLTLLSCPLGCSDDLPKSSL  1185

Query  666   GDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLY-FCDGQ--TSSFEACHARQVTKAFK  836
              D+++  +  ++ + IH++D H +++L  T + L+  C+ +  T+  E    +Q  KAF 
Sbjct  1186  ADNVNALISLSR-QSIHRLDCHALDILAKTCDYLFTLCNDRQFTAEGEIGAGKQFVKAFN  1244

Query  837   NVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED  1016
              + + LF   + + D+CI +KD TP LP  YA+H L RFI PFELLELVHWMFSR+D++D
Sbjct  1245  VLQRNLFHEVRVKFDQCIGTKDFTPFLPTFYALHVLIRFISPFELLELVHWMFSRVDMDD  1304

Query  1017  NSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKIL  1196
                   +  S +  G  IAG  F +LS+ +  P+++R   D+FW M E +F+  ++E+I 
Sbjct  1305  ------IEKSAISFGSCIAGGAFRNLSSFLQHPNTKRKSYDIFWKMEENKFNSDIIEEIY  1358

Query  1197  LQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSYCM  1373
             L++ + + H   +V D+CLL+A   V   K  QQ N   L + +SR I   PV ++S+C+
Sbjct  1359  LKICKFSLHFKTEVVDICLLEAINAVCRQKFKQQCNLHPLHIILSRVIATTPVEIVSHCI  1418

Query  1374  FQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQ--TNAIRE--TSNPSDPELL  1541
             ++ +K KA LL L T+MS LHLS FGHL S  ++K    Q   N + E   S  SD + +
Sbjct  1419  YRTSKMKARLLSLLTDMSSLHLSTFGHLFSCFVNKYRDFQREGNVMEELCVSXLSDEDCI  1478

Query  1542  MLLPTVFLYLDSVLIKAGS-QVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNL  1718
             MLLP    YL+SV +K G    ++F  I +FY RI+L+ F  WK +V+RD+F  E  + L
Sbjct  1479  MLLPAALXYLNSVSLKFGRLSFEHFRYIPTFYSRIILNGFLQWKSFVSRDVFQEEFGEFL  1538

Query  1719  PLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFD  1898
             P S +E + +   +LL +++ M++   +L    +K + R +LF+S+ P   +  + +  D
Sbjct  1539  PSSAQELLSLIDDSLLGKTICMLRYHFSLNEDAMKMKNRFQLFNSIFPPSVSQDELVGCD  1598

Query  1899  PSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEH---NKFSSGLKEDKMETCAELHSTLD  2069
                + + SL +SLN VN+  AKI+  + LLFP+    N+  S +K++ ++  ++    LD
Sbjct  1599  IGGLASQSLNESLNLVNKFFAKISFGKVLLFPKGSRSNEAGSDVKDNPLDIASK---KLD  1655

Query  2070  VSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGC  2249
              SR++ + +LV  W+ IV++ P   D+S +    + S++   E LIL NI+EL+ EM   
Sbjct  1656  SSRMQFMNILVGIWQWIVKRVPSVEDSSQKETSTDTSLWXCFEALILMNILELTGEMSDG  1715

Query  2250  LVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFET  2429
             L++L S+PF+ +L K+   +RF+DP TL+ +RD++S LSEGKFS V  +QL++AHSQF  
Sbjct  1716  LIQLQSIPFLEQLTKSALLYRFEDPTTLKSIRDLLSVLSEGKFSHVPYLQLLLAHSQFAP  1775

Query  2430  AICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLL  2609
              + S   S+     G    P+P ++RS V+P  N + I  K NL+ +  + +QLE++KLL
Sbjct  1776  TVRSEYRSSEGFIFGAFSRPMPGILRSLVVPSANQSIIDHKCNLETADLYARQLEVVKLL  1835

Query  2610  RVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN-  2786
             R+LF +K  Q   +  ++I INL++L  LLLSSY ATL +ID EI+NL+  I+ +  S  
Sbjct  1836  RMLFPIKEHQHGFDFGKDICINLKELHLLLLSSYGATLSEIDVEIYNLIRTIECLDGSKP  1895

Query  2787  ISIAEWDYLWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
              ++A  D+LWG+AV+K  KER L + +  + L+D E  ++ R+ QFRENL +DPK+CAST
Sbjct  1896  ANVAGMDHLWGSAVLKIEKERTLERNMXDDVLTDTEAVKERRRSQFRENLVVDPKICAST  1955

Query  2964  VLYFPYGRPNGPGVV--NKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYI  3137
             VLYFPY R     ++  NK Q D F +     S +      Y+PIFILR S H LS GYI
Sbjct  1956  VLYFPYDRVASEELLCLNKFQTDNFGNGLLLHSPDGEYMQRYNPIFILRFSIHSLSEGYI  2015

Query  3138  EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQ  3317
             EP+EFA LGLLA++  S+SSPDD  R+LGY  L +FKN LE+CQK+K V ++QLLL+Y+Q
Sbjct  2016  EPLEFAGLGLLAIAFMSMSSPDDRIRRLGYDTLGRFKNTLERCQKRKGVKQIQLLLTYVQ  2075

Query  3318  NCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWS  3497
             N IEE WQ+IPSV +IF AE S +LLDPSH+HY  +T  LM+S  +N+K+I  F N  WS
Sbjct  2076  NAIEEPWQRIPSVNSIFAAETSLILLDPSHEHYTALTTLLMRSSRLNVKNILFFSNFFWS  2135

Query  3498  DSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVK  3677
              S++F+ ERLWILR++Y+GLN D+D  IY+ NS+ E L+SFYVSP++D+ESKELI+Q VK
Sbjct  2136  SSINFKAERLWILRLVYAGLNFDEDAQIYMNNSVLEALMSFYVSPISDDESKELILQVVK  2195

Query  3678  KSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRH  3857
             K+ KL +MARHL+E CGL SWLSSV++      +   K     Q  VV EVVN++I    
Sbjct  2196  KAVKLHKMARHLVEKCGLFSWLSSVLSVLGERHFRDGKSLFLLQLGVVSEVVNDVISLXK  2255

Query  3858  TVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQP  4037
               EWLQ+YALEQL EL+ HL + L+    ++K++      IL  + LT K+SQKR++YQP
Sbjct  2256  INEWLQQYALEQLMELASHLFKFLISDMTLIKDNVAAVNPILXAIILTLKISQKRRIYQP  2315

Query  4038  HFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAM  4217
             HF LSVEG +++ +A+ +C N       +  L+AILMS PPV I  +  +++S FI WA+
Sbjct  2316  HFVLSVEGSYNIYKAVKICDNARSCGTVELALKAILMSAPPVDIFCLSREQISSFIXWAV  2375

Query  4218  SIALQSETKGVLQVEKCCFPLNVSSEEE-TENSLISKLLRWLTASVILGKISYKLSKLDS  4394
             S AL+++   + Q ++    L    EEE  ENSLISKLLRWLTASVILGK+ +K + LD 
Sbjct  2376  SAALEADFAKMXQPKESHLCLTSIPEEELYENSLISKLLRWLTASVILGKLDWKSNDLDP  2435

Query  4395  SHSCDRSKLINLHCLLEWNEE-SDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVS  4571
               S  R  L  L  L+E  E  S+R++   + C+EILA++I +LQQL GT+ ++LPS  +
Sbjct  2436  EVS-KRLNLKTLQTLMELVESASERKSKSRYGCEEILASAILFLQQLAGTNHQMLPSVAA  2494

Query  4572  ALCLLLLKNPASSG----SEVLIGNAAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTD  4739
             AL LLL      +G    +E ++    +L SKI CPAEAN +WRW+FYQPWKD +   T 
Sbjct  2495  ALSLLLYDGSVFTGFFCKNESVV---KSLWSKIGCPAEANLSWRWAFYQPWKDLTQEQTG  2551

Query  4740  SEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             S+K+EE+HAC  LL + S +L +      + S  DV++ G FEWERSI+
Sbjct  2552  SQKMEELHACHSLLDIVSNVLGKRPSELLVSSTYDVDRFGAFEWERSIM  2600



>ref|XP_006475161.1| PREDICTED: uncharacterized protein LOC102613555 isoform X1 [Citrus 
sinensis]
Length=2618

 Score =  1205 bits (3118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 732/1668 (44%), Positives = 1058/1668 (63%), Gaps = 48/1668 (3%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +LL++FP+++++S  +LGVP SLL S+ FLE S L + SK WPEMFF+GLE A+S ++  
Sbjct  958   ELLKSFPLVMTISHNLLGVPASLLPSMIFLEQSFLANASKLWPEMFFSGLEIAVSTIRH-  1016

Query  183   RTEEFG------------------DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDL  308
                EF                   D D+ E A+ ALS FLK+A   ++FP  +++    L
Sbjct  1017  EVREFDVCRIPTHSSFDEEVLCNIDFDANESAAGALSFFLKQAPFHVIFPAIMTVGAPYL  1076

Query  309   STQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVD  488
             S    + +LLL  LS+   D ++S    VLF F Q   SYR EP  EL  LSE+C  ++ 
Sbjct  1077  SEPSKVQDLLLDKLSDWRSDCLISYLRLVLFCFFQIQSSYRDEPTAELLQLSEICIVLMK  1136

Query  489   RMLRQFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFS  665
              +  Q L  K +     T  L L  + V E+ ET+  HP V ASL  PL C+ +      
Sbjct  1137  NVFTQLLVLKPNPGHPKTVGLHLSAENVWEVAETVLCHPAVFASLSSPLSCDLESPLGNL  1196

Query  666   GDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYF-CDGQTSSFEACHA--RQVTKAFK  836
             G +++ FL   + + +HK+D HV+++L  T + L+  C    +  E  +   + + KAF 
Sbjct  1197  GHNLETFLSLTQ-QSVHKIDRHVLDMLTATLDHLFSSCTDHYTILEVDNGVCKSLVKAFN  1255

Query  837   NVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED  1016
              +V++LFL  +D+ D CI ++D+ PLLPA YA+H L RFI P +LLELVHWMF ++D+ +
Sbjct  1256  TLVRRLFLELRDKFDLCIATEDVLPLLPAFYALHALIRFISPLKLLELVHWMFRKVDVNE  1315

Query  1017  NSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKIL  1196
              S  +S     L VG  IAG  F++LS  + QP  +    +L W   E  F +  +E+I 
Sbjct  1316  MSICKSCNVYALSVGFCIAGGTFEALSNYLQQPVEKIASYNLLWETEENSFGVNHIEEIY  1375

Query  1197  LQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMF  1376
             ++V ++A +  L +AD CLLK    + +   MQ  +P L + +SR IV  P+ ++S+C++
Sbjct  1376  IEVCKLAINFDLGLADTCLLKIVNCIYSQNYMQSVHP-LNLIMSRVIVKTPIEMISHCVY  1434

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP-SDPELLMLLP  1553
             +    KA++LFL T+MSP+HLS+FG+LL G ++K   L  + +       SD E +MLLP
Sbjct  1435  RTTMTKAKVLFLFTKMSPMHLSVFGNLLVGSLNKDSLLTGSQMWTCGYAFSDEEFMMLLP  1494

Query  1554  TVFLYLDSVLIKAGSQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSI  1730
                 YL+   +K   Q  K+   I+SFY R+LL  F +WK +V+  +F  E     P S 
Sbjct  1495  AALSYLNMNFLKFEKQYHKHLMDILSFYSRMLLSGFRNWKSFVSGYIFQEEYDGFFPSST  1554

Query  1731  EEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQV  1910
             EE +++ + +LL ++VL++    AL G  +K +  ++LF+S+ P      + LDFD ++V
Sbjct  1555  EELLNLVNGSLLGKTVLLLHYHFALNGDSLKTKKLIKLFNSIFPCSGAQNELLDFDINEV  1614

Query  1911  GTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFS-------SGLKEDKMETCAELHSTLD  2069
              + S +QSLN +NR VAK++LCR LLFPE ++          GLK   +++ ++  ++  
Sbjct  1615  KSNSFKQSLNHINRVVAKVSLCRMLLFPEDDQVQFLPKAAEGGLKGISLKSGSDDQNS--  1672

Query  2070  VSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHG  2246
              SR+R + +LV SW+ +V K P  + +  + +  N  S++++LEV ILR+I EL  +M  
Sbjct  1673  -SRMRFMNILVGSWQWMVMKLPSISKDFERNKSANVLSLYKYLEVFILRSIFELVSKMSK  1731

Query  2247  CLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFE  2426
              L++L S+PF+ +L ++  ++RF+D  TL+ LR I++ L EGKFSC   +QL++AHSQF 
Sbjct  1732  GLIELQSIPFLEQLIRSALFYRFEDSTTLKMLRSILTLLLEGKFSCGLYLQLLLAHSQFA  1791

Query  2427  TAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKL  2606
             T+I S + ++     G+   P+ S++R  VI  FN N+  + D  + ++ +  QLE++KL
Sbjct  1792  TSIQSVSAASNAGG-GVLLRPMSSILRFLVIHHFNQNADEKNDK-KTTELYQSQLEVVKL  1849

Query  2607  LRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN  2786
             L+ L Q KA     +  ++  INLR+L  LLL+SY ATL DID EI+++++EI+ I +S+
Sbjct  1850  LKTLLQFKAHPCGADFGRDSDINLRELCLLLLASYGATLSDIDMEIYDVMHEIERIENSD  1909

Query  2787  ISIAEWDYLWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
               IA+ DYLWG A  K RKE  L Q  SCN ++DAE A++ ++ QFRENL IDPK+CA T
Sbjct  1910  NEIAQLDYLWGRAAAKVRKEWILEQDTSCNIMTDAEAAKEQKRSQFRENLAIDPKICAMT  1969

Query  2964  VLYFPYGRP-NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIE  3140
             VLYFPY R  +GP   NK++ D   + HE  S ++ +   YDP+FILR + H LS+G+IE
Sbjct  1970  VLYFPYDRTTDGPSSSNKLKADNLWNTHEIHSPDLQDLQRYDPVFILRFAIHSLSVGFIE  2029

Query  3141  PVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQN  3320
             PVEFA LGLLAV+  SISSPD   RKLGY  L +FKN LEKC KKKDVMRL+LLL+Y+QN
Sbjct  2030  PVEFAGLGLLAVAFVSISSPDVGMRKLGYETLGRFKNELEKCSKKKDVMRLRLLLTYVQN  2089

Query  3321  CIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSD  3500
              IEE WQ+IPSV AIF AEAS +LLDPSHDHY +++K LM+S  VNLKSIPLF +   S 
Sbjct  2090  GIEEPWQRIPSVIAIFAAEASLLLLDPSHDHYTSVSKLLMRSSRVNLKSIPLFHDFFSSS  2149

Query  3501  SVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKK  3680
             SV+FR ERLW+LR+LY+GLN DDD  +YIRNS+ E L+SFY SPL+D+ESKELI+  +KK
Sbjct  2150  SVNFRKERLWMLRLLYAGLNLDDDAQVYIRNSVLEILMSFYASPLSDSESKELILLILKK  2209

Query  3681  SAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHT  3860
             S KL +MA +L+E+CGL SWLSS+++SF G+     K F  AQ  VV+EVVN++I  R+ 
Sbjct  2210  SIKLHKMACYLVEHCGLFSWLSSLLSSFSGMLLGGEKMFLMAQLIVVVEVVNDVISSRNI  2269

Query  3861  VEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPH  4040
              EWLQ++ALEQL + S HL ++LV G ++++E+      IL IL  T K+SQKRK+YQPH
Sbjct  2270  NEWLQRHALEQLVDFSSHLYKLLVGGMKLMRENVPLVNSILLILISTVKISQKRKMYQPH  2329

Query  4041  FTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMS  4220
             FTLS+E  F +C+A+D+         A+  L+ ILMS+P + I +++  K+S F+ WA+S
Sbjct  2330  FTLSLESFFQICQAVDMYNTARSGANAELALKVILMSSPSIDIFRVNQVKLSSFLTWAIS  2389

Query  4221  IALQSETKGVLQVEKCCFPL-NVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSS  4397
              AL+S++  + ++ +    L N+  +   E SL SKLLRWL ASVILGK+  KL    S 
Sbjct  2390  AALKSDSGQMYELRESHLHLRNMLEDAPFEESLTSKLLRWLVASVILGKLFGKLDIPGSK  2449

Query  4398  HSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSAL  4577
              S    + +N     ++  +    N   F C+EILAA+IFYLQQLLG     LPS +SAL
Sbjct  2450  LSKSSYETLN-SLFQDFGNKCVENNKSRFDCKEILAAAIFYLQQLLGLCCGGLPSVISAL  2508

Query  4578  CLLLLKNPAS-SGSEVLIGNA---AALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSE  4745
              LLLL + +  +GS   +G+    A+L S+I CPAEAN  WRWSFYQPWKD S  LTD +
Sbjct  2509  SLLLLSDVSEYAGSAFKLGHRTSLASLWSRIHCPAEANPCWRWSFYQPWKDLSLELTDLQ  2568

Query  4746  KIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSILN  4889
             KI+E+HACQ LL++ S +L + SL S+++S  D +   VF WERSI+ 
Sbjct  2569  KIDELHACQTLLVIISNVLGKKSLDSQVLSCLDDKISSVFSWERSIIG  2616



>ref|XP_002533083.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29298.1| conserved hypothetical protein [Ricinus communis]
Length=2587

 Score =  1170 bits (3027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/1664 (42%), Positives = 1028/1664 (62%), Gaps = 72/1664 (4%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQE--  179
             +L+NFP ++++S++ + VP S L SI F   S L   SK WP++FF GLE A S +    
Sbjct  960   VLKNFPAVMTISQQ-IRVPLSCLSSIVFQHQSSLSGASKLWPQVFFPGLEKACSMINPQG  1018

Query  180   -GRTEEFGDID-SMEF------ASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNL  335
              G      +I  +M+F      A+AA  LFL++A   +LFP  +S   + L       +L
Sbjct  1019  MGNDAVAQEIMLNMDFDASEATAAAAFGLFLRQAPFHVLFPTIISSNGTCLLEPSKTKDL  1078

Query  336   LLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNT  515
             L+A LSE   D +VS    +LFWF Q  +SYR++PL +LE  +E+C+ +V  ML Q L  
Sbjct  1079  LMAKLSECKSDFVVSYLRLLLFWFYQIQVSYRIKPLVKLEEFAEICYILVKHMLDQLLVL  1138

Query  516   KGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPC-----NADFTDTFSGDSMD  680
             K D+ +      L  + ++E  E+IFYHP V A+L  PL C     N DF +     +++
Sbjct  1139  KADSGNP-----LSAELIREAAESIFYHPAVKAALTHPLGCDDNAINDDFAEGNFRGNLE  1193

Query  681   KFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTS---SFEACHARQVTKAFKNVVQK  851
              F  S++ +V H +D HV N+L TTFE      G        +   ++ + KAFK ++Q 
Sbjct  1194  AFYNSSQQKV-HPIDHHVFNMLITTFEYFLSPSGGQHHVLKVDDGESKLLVKAFKTLMQS  1252

Query  852   LFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQ  1031
             L+L  KD+ D CI ++DL PLL   YA+H L +F  PFEL  L  W+  R+++ D +   
Sbjct  1253  LYLELKDKFDLCIRTEDLLPLLQPFYALHALMQFASPFELFGLARWILDRVEVNDLAVLN  1312

Query  1032  SLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYE  1211
             S     L +G  IA   F  LS  + QP   +     F  M E+  D+ L+E++ +++ +
Sbjct  1313  SFTTFALSIGFCIAADAFKILSIYLQQPVRTKTTFYSFGQMEEKSLDVDLIEEVYVRICK  1372

Query  1212  IATHLHLDVADMCLLKAFKVVKTHKVMQQS--NPTLVMAISRFIVNIPVNLLSYCMFQIN  1385
              AT+  LD A  CL+ A   V   K ++    +P L + ISR I+  PV ++S C++  +
Sbjct  1373  FATNFGLDFAYTCLVGAVSAVYRQKCIKPDVLDP-LSLVISRIIMGTPVEVVSQCIYGTS  1431

Query  1386  KRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETS--NPSDPELLMLLPTV  1559
             K KA+LL L  EMSP HLS+FG+L  G+++K VH++     E    + SD + ++LLP  
Sbjct  1432  KIKAKLLVLLVEMSPQHLSVFGYLFLGILNKNVHIKGKMAEEACKMSVSDEDFMLLLPAA  1491

Query  1560  FLYLDSVLIKAGSQV--KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDN-LPLSI  1730
             F YL+SV++K G Q   K F  I SFY  ILL  F +W  +V+ ++F  E+FD  L  S+
Sbjct  1492  FSYLNSVVMKLGMQKYHKQFTDITSFYSEILLRGFCNWNNFVSGNLFQ-ENFDEFLSSSL  1550

Query  1731  EEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQV  1910
             EE +++   +LL  ++ M++   AL+G + K + +M+ F S+    +   + LD +  ++
Sbjct  1551  EELLNLVDASLLGTAMHMLRCHFALSGEM-KMKEQMK-FHSIPVSCTAHEELLDCEVDEI  1608

Query  1911  GTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLL  2090
                S  Q LN +NR  AKI  CR LLF +H  F     +D     + L ST    R++ +
Sbjct  1609  EFYSRNQLLNLINRVTAKIVFCRMLLF-DHACFLPKEADD-----SNLVST---KRLQFI  1659

Query  2091  KMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGCLVKLDS  2267
             + LV +W  +V+KFP  +D+S + +   C  ++R+LE+LIL  I+EL+KEMH  L++L +
Sbjct  1660  QTLVKTWHCMVKKFPSFSDSSSKEKRSGCLQLYRYLELLILNTILELTKEMHDDLIQLQA  1719

Query  2268  LPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSN  2447
             +PF+ +L +++  +RF+DP TL  LR I++ LS+G+FS V  +QL++AHSQF + I S  
Sbjct  1720  VPFLEQLMRSSLLYRFEDPTTLNILRSILTLLSQGEFSSVMYLQLLLAHSQFASTIHSVT  1779

Query  2448  LSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQV  2627
                G SQ G  F P+PS++RS V P  N++     ++LQ    HLKQLE+IKLLR L Q+
Sbjct  1780  ELHG-SQTGALFRPMPSILRSLVSPHPNYD-----NDLQRIDLHLKQLEIIKLLRTLIQL  1833

Query  2628  KARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNIS--IAE  2801
             K   V     Q++GINL++L FLLLSSY ATL DID EI +L+ EI+SI D+++S  +A+
Sbjct  1834  KPDPVCCYSGQDMGINLKELYFLLLSSYGATLGDIDVEIFSLMREIESI-DTSVSEDLAK  1892

Query  2802  WDYLWGNAVVKARKERELV-QTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFP  2978
              DYLWG A ++ RKER L   T S  +++ EV E+ R+ QFRE LPI+P +CA+TV YFP
Sbjct  1893  LDYLWGTAALRIRKERALDWDTSSSVITNKEVFEEHRRSQFREVLPINPNICATTVNYFP  1952

Query  2979  YGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFAN  3158
             Y R      +  ++ +   +M     A       YDPIFIL  S H LSMG+IEP+EFA 
Sbjct  1953  YDR------IMSIELENPKNMR---VAHFPGER-YDPIFILNFSNHNLSMGHIEPLEFAC  2002

Query  3159  LGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDW  3338
             LGLLA+S  S+SSPD + RKL    L KFK+ALE+ QKKKDV+RL LLL+Y+QN I+E  
Sbjct  2003  LGLLAISFISMSSPDIEIRKLSDASLGKFKDALERFQKKKDVLRLHLLLTYIQNGIKERL  2062

Query  3339  QKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRT  3518
             Q+IPS+ A+F AE+SF+LLDPS+DH+ T+ KHLM S +V++K IPLF     S+SV+FR 
Sbjct  2063  QRIPSIIALFAAESSFILLDPSNDHFTTLNKHLMHSSAVDMKHIPLFHTFFHSNSVNFRA  2122

Query  3519  ERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSR  3698
             ERLW+LR++ +GLN DDD  IYI NSI ETLLSFY +PLADNESKELI+Q VKKS KL R
Sbjct  2123  ERLWMLRLVCAGLNLDDDAQIYISNSILETLLSFYTTPLADNESKELILQVVKKSVKLDR  2182

Query  3699  MARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTV--EWL  3872
             M RHL+E+CGL  WLS+V++    +  ++   F   Q  + +EV+ +II   + +   W 
Sbjct  2183  MTRHLVESCGLFPWLSTVLSISSAMLDENKDSFSSLQLVLAIEVIFDIISSGNIIGSAWF  2242

Query  3873  QKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLS  4052
              KY+ EQ  EL+ HL +ILV G +++KE+    + ILQI+  T K+SQKR+  QPHFTLS
Sbjct  2243  GKYSFEQCIELASHLYKILVGGLKLIKENVALIESILQIVISTLKISQKRETCQPHFTLS  2302

Query  4053  VEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQ  4232
              EGLF + +A++          AK+GLEAIL STPPV I     +K+S F+ WA+S AL+
Sbjct  2303  FEGLFGIYQALNAFGTPRSGLNAKSGLEAILNSTPPVDIFHTGREKLSVFLMWAVSTALK  2362

Query  4233  SETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDR  4412
             S+ +     ++    L +  EE+   SLISKLLRWL A+VILGK+S+KL+ +++  S  R
Sbjct  2363  SDCENNFHFKESHASLIIVLEEKPSESLISKLLRWLVAAVILGKLSWKLNDVNTKFS-KR  2421

Query  4413  SKLINLHCLLEWNEESDRENGK-EFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLL  4589
             S  + L   LE+ E+  R +   EF C+E+LAA+IFYLQQ++G ++++  SAVSALC+L+
Sbjct  2422  SSPVTLQSFLEYVEKGCRGSKNYEFDCEEVLAATIFYLQQIIGLNWRMPSSAVSALCILV  2481

Query  4590  LKNPAS--SGSEVLIGNAAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIH  4763
             L  P            +   LCSK+RCP EAN  W+WSF +PW+D    ++D +K++E H
Sbjct  2482  LCGPPKCLDFRHGYCTDVVYLCSKVRCPTEANPDWKWSFDKPWEDPKLEISDLQKMDEYH  2541

Query  4764  ACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSILNLN  4895
             ACQ L+++ S +L +  L S+++S +++    VFEWER I+  N
Sbjct  2542  ACQTLMVIISSVLGKKPLDSQVLSHQNLVNSEVFEWERRIIETN  2585



>gb|EYU23596.1| hypothetical protein MIMGU_mgv1a025361mg [Erythranthe guttata]
Length=2371

 Score =  1140 bits (2948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/1645 (42%), Positives = 971/1645 (59%), Gaps = 204/1645 (12%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             ++LQNFP+++S+S ++L  PFS+L S+FFL+ S L DVSK WPEM F  L S     ++ 
Sbjct  916   EILQNFPLVLSISSELLEAPFSVLSSMFFLQSSFLTDVSKLWPEMLFDALGSVTCCKEKE  975

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
                  GD+DS + ASAA + +L+ A  C+LF   +      L  Q  L  LLL  ++   
Sbjct  976   DNSCKGDLDSKKAASAAFARYLRSAPFCVLFSAIVQSSSCHLFEQSALKKLLLDKVTAVP  1035

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH+VSS  YV+FW N A  SYR+   ++L+M SE CF + + +++Q L+          
Sbjct  1036  SDHLVSSLCYVMFWMNHASSSYRIGSSDDLKMSSETCFILAEYLVKQLLDK--------N  1087

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              S +P  C  E++E I  HP V +SL  PL  + +F+D+  G+ + + L+S K + +++M
Sbjct  1088  LSHIPVNCAAEVVEFILNHPSVTSSLRFPLSGDIEFSDSIFGEFLGELLQSAK-QAVNRM  1146

Query  723   DLHVINLLRTTFELLY-FCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRTDKCIESK  899
             D HV++L++T  E ++  C+ Q S       +Q+++ F+ + QKLFL FK + D CI+S 
Sbjct  1147  DHHVLDLIKTVAEFVFPMCNDQLSEQVINGRKQISRVFEAMEQKLFLIFKTKFDACIKSM  1206

Query  900   DLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAGS  1079
             D  P +P  YA+HTL RFI PF+LLELV+W+FSRID ++ +  QS + + L VGLH+A  
Sbjct  1207  DFKPFVPTFYALHTLIRFISPFKLLELVNWLFSRIDSKNATVHQSSKRNDLFVGLHLASC  1266

Query  1080  VFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLLK  1259
              FD LSA M QP+ E  L   + G  E QFD++L E+I  QV+EI     LD+AD CLLK
Sbjct  1267  TFDILSAYMGQPNPESTLYS-YLGGTETQFDVLLFERIFFQVFEICCRFKLDIADKCLLK  1325

Query  1260  AFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLHL  1439
             A KVVK HK +Q      +M +SR + + P++++S+C+ ++++ KA+LL+L T  SPLH+
Sbjct  1326  AVKVVKMHKSVQDPYLPSIMVLSRIVASTPIDIISHCLHKVDRTKADLLYLITGTSPLHM  1385

Query  1440  SIFG-HLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIK----AGSQV  1604
             S FG  +    +DK   L T +  E SN              L+ DS+L K    A   +
Sbjct  1386  SAFGFSIFEIRLDK---LLTASREEFSN--------------LFSDSLLGKAILIARDHL  1428

Query  1605  KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLM  1784
                E I    WR+ L    +  C    D                  DIF C         
Sbjct  1429  ASNEDISKLDWRLSLF---NQVCPSNAD------------------DIFDC---------  1458

Query  1785  VQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAK  1964
                C   TG L   +  +E  + V       V +++F                       
Sbjct  1459  ---CCGETG-LRSLKQPLEFVNKV-------VAYINF-----------------------  1484

Query  1965  INLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTA  2144
                CR LLF + N   S                L+ SRI+ L+ML+S+W  IV+KFP   
Sbjct  1485  ---CRILLFFDCNGSES--------------PPLEKSRIQFLRMLISTWMLIVKKFPENN  1527

Query  2145  DNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDP  2324
               S  ++ EN S+FRFLE  ++ N+ EL+ E+  CL+KLDSLPF  +L K+   +RF+D 
Sbjct  1528  AYSGNIDGENLSLFRFLEFFVMHNVSELTTEIQNCLIKLDSLPFTEQLVKSFLLYRFEDS  1587

Query  2325  MTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLM  2504
             +TL+ LR +++SLS GKFSC+ +IQL++AHS+F  +I S+N S   +Q GL FTP+ S+M
Sbjct  1588  VTLKMLRTVLTSLSRGKFSCISVIQLLLAHSKFAQSIHSANQSLDSTQFGLVFTPMRSIM  1647

Query  2505  RSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQV-DIEPAQEIGINLR  2681
              S VIP  N +S+  K+    S+  L  LELIKL+RVLFQ+  +Q  +     E GIN R
Sbjct  1648  TSLVIPCTNLDSLYFKNKKSTSEPDLNLLELIKLVRVLFQIYVQQREEANVGDEEGINCR  1707

Query  2682  DLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISI-AEWDYLWGNAVVKARKERELV  2858
             +LV+LLLSSY AT  ++D EI+NL+ EI+S   S+  I A+ DY+WG + +K RK+    
Sbjct  1708  ELVYLLLSSYGATCSEVDKEIYNLMLEIESNDKSSAGIVAQTDYIWGPSSLKMRKD----  1763

Query  2859  QTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDS  3038
                S +L + E  E+ +K++FREN+P+DP MCA TVL+FPY      G  + V       
Sbjct  1764  ---SVDLKNTESFEELQKVKFRENIPVDPNMCAQTVLHFPYNEFVNGGTSSTV-------  1813

Query  3039  MHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRK  3218
             M E CS       IYDPIFILR S HC+S  YIEP+EFA+LGLLA++  S+SS D+ TRK
Sbjct  1814  MTEACST-TDKLQIYDPIFILRFSIHCISRNYIEPIEFASLGLLAITFVSMSSNDEVTRK  1872

Query  3219  LGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLD  3398
             LGY  L KF +ALEKCQKKKDV RL LL++ LQN IE  W++IPS+ AIF AEAS VLLD
Sbjct  1873  LGYEALSKFNSALEKCQKKKDVKRLGLLMTSLQNGIEGQWRRIPSIIAIFCAEASLVLLD  1932

Query  3399  PSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVH  3578
              S+ ++++I ++  +S  VN+K IPLF  L WS S  F+ +RLW+LR+LY GLNT+DD  
Sbjct  1933  ESYANHSSIYEYFNKSRCVNMKDIPLFSTLFWSSSDKFKMDRLWMLRLLYVGLNTEDDAQ  1992

Query  3579  IYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVT  3758
             IY+ N IF+TL+SFY SPL+DN+SKELIIQ V+K+ +  R  R L+E+ GLI WLSS+V 
Sbjct  1993  IYLGNHIFKTLMSFYCSPLSDNDSKELIIQIVEKACQFHRAVRVLVEHGGLILWLSSIVV  2052

Query  3759  SFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEG  3938
             S+                         I   R+ +EWL K+A+EQLSELS +L ++LV  
Sbjct  2053  SY-------------------------ITSPRNNIEWLPKHAMEQLSELSSNLFKLLVSS  2087

Query  3939  AQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPI  4118
               ++KE ST    IL+ LTL  KVSQKR++ QPHFTLS + LF L +        C+   
Sbjct  2088  FDLIKEESTLCNSILKTLTLLLKVSQKREISQPHFTLSEDSLFQLYKTYVFGTQSCFH--  2145

Query  4119  AKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEE  4298
                       +TPPV I +M  + +SKF+ WA++ A+QS+ +                  
Sbjct  2146  ----------NTPPVTIRRMGQENLSKFLRWAVATAIQSKPE------------------  2177

Query  4299  ETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEW----NEESDR  4466
               + S++SKLLRWL ASVI GKIS KL   D++    R    + H L  W    NE+   
Sbjct  2178  --DESIVSKLLRWLIASVIRGKISRKLIDNDNNSFSKRE---SFHSLQSWLSSKNEKVFE  2232

Query  4467  ENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNAA--  4640
             ENG    C ++LAA+IFYL Q+LG +  LLPSAVSALCLLL+  P+SS  E LIG+    
Sbjct  2233  ENG----CDDVLAATIFYLLQILGFNHSLLPSAVSALCLLLV--PSSSELESLIGDGTSL  2286

Query  4641  -ALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSL  4817
              +LC+KI CPAEAN AWRW + + W + S+ ++ +EK++EIHAC+ L++VAS +L + S 
Sbjct  2287  LSLCTKIHCPAEANPAWRWLYDEKWGEVSNEISAAEKLDEIHACERLVMVASNILMKKSG  2346

Query  4818  YSKLISLKDVEKLGVFEWERSILNL  4892
             +S +  LKDVE L V++WERS++ +
Sbjct  2347  FSHIFELKDVENLNVYDWERSLIQI  2371



>ref|XP_006475162.1| PREDICTED: uncharacterized protein LOC102613555 isoform X2 [Citrus 
sinensis]
Length=2578

 Score =  1137 bits (2942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/1603 (43%), Positives = 1011/1603 (63%), Gaps = 48/1603 (3%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +LL++FP+++++S  +LGVP SLL S+ FLE S L + SK WPEMFF+GLE A+S ++  
Sbjct  958   ELLKSFPLVMTISHNLLGVPASLLPSMIFLEQSFLANASKLWPEMFFSGLEIAVSTIRH-  1016

Query  183   RTEEFG------------------DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDL  308
                EF                   D D+ E A+ ALS FLK+A   ++FP  +++    L
Sbjct  1017  EVREFDVCRIPTHSSFDEEVLCNIDFDANESAAGALSFFLKQAPFHVIFPAIMTVGAPYL  1076

Query  309   STQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVD  488
             S    + +LLL  LS+   D ++S    VLF F Q   SYR EP  EL  LSE+C  ++ 
Sbjct  1077  SEPSKVQDLLLDKLSDWRSDCLISYLRLVLFCFFQIQSSYRDEPTAELLQLSEICIVLMK  1136

Query  489   RMLRQFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFS  665
              +  Q L  K +     T  L L  + V E+ ET+  HP V ASL  PL C+ +      
Sbjct  1137  NVFTQLLVLKPNPGHPKTVGLHLSAENVWEVAETVLCHPAVFASLSSPLSCDLESPLGNL  1196

Query  666   GDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYF-CDGQTSSFEACHA--RQVTKAFK  836
             G +++ FL   + + +HK+D HV+++L  T + L+  C    +  E  +   + + KAF 
Sbjct  1197  GHNLETFLSLTQ-QSVHKIDRHVLDMLTATLDHLFSSCTDHYTILEVDNGVCKSLVKAFN  1255

Query  837   NVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED  1016
              +V++LFL  +D+ D CI ++D+ PLLPA YA+H L RFI P +LLELVHWMF ++D+ +
Sbjct  1256  TLVRRLFLELRDKFDLCIATEDVLPLLPAFYALHALIRFISPLKLLELVHWMFRKVDVNE  1315

Query  1017  NSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKIL  1196
              S  +S     L VG  IAG  F++LS  + QP  +    +L W   E  F +  +E+I 
Sbjct  1316  MSICKSCNVYALSVGFCIAGGTFEALSNYLQQPVEKIASYNLLWETEENSFGVNHIEEIY  1375

Query  1197  LQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMF  1376
             ++V ++A +  L +AD CLLK    + +   MQ  +P L + +SR IV  P+ ++S+C++
Sbjct  1376  IEVCKLAINFDLGLADTCLLKIVNCIYSQNYMQSVHP-LNLIMSRVIVKTPIEMISHCVY  1434

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP-SDPELLMLLP  1553
             +    KA++LFL T+MSP+HLS+FG+LL G ++K   L  + +       SD E +MLLP
Sbjct  1435  RTTMTKAKVLFLFTKMSPMHLSVFGNLLVGSLNKDSLLTGSQMWTCGYAFSDEEFMMLLP  1494

Query  1554  TVFLYLDSVLIKAGSQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSI  1730
                 YL+   +K   Q  K+   I+SFY R+LL  F +WK +V+  +F  E     P S 
Sbjct  1495  AALSYLNMNFLKFEKQYHKHLMDILSFYSRMLLSGFRNWKSFVSGYIFQEEYDGFFPSST  1554

Query  1731  EEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQV  1910
             EE +++ + +LL ++VL++    AL G  +K +  ++LF+S+ P      + LDFD ++V
Sbjct  1555  EELLNLVNGSLLGKTVLLLHYHFALNGDSLKTKKLIKLFNSIFPCSGAQNELLDFDINEV  1614

Query  1911  GTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFS-------SGLKEDKMETCAELHSTLD  2069
              + S +QSLN +NR VAK++LCR LLFPE ++          GLK   +++ ++  ++  
Sbjct  1615  KSNSFKQSLNHINRVVAKVSLCRMLLFPEDDQVQFLPKAAEGGLKGISLKSGSDDQNS--  1672

Query  2070  VSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHG  2246
              SR+R + +LV SW+ +V K P  + +  + +  N  S++++LEV ILR+I EL  +M  
Sbjct  1673  -SRMRFMNILVGSWQWMVMKLPSISKDFERNKSANVLSLYKYLEVFILRSIFELVSKMSK  1731

Query  2247  CLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFE  2426
              L++L S+PF+ +L ++  ++RF+D  TL+ LR I++ L EGKFSC   +QL++AHSQF 
Sbjct  1732  GLIELQSIPFLEQLIRSALFYRFEDSTTLKMLRSILTLLLEGKFSCGLYLQLLLAHSQFA  1791

Query  2427  TAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKL  2606
             T+I S + ++     G+   P+ S++R  VI  FN N+  + D  + ++ +  QLE++KL
Sbjct  1792  TSIQSVSAASNAGG-GVLLRPMSSILRFLVIHHFNQNADEKNDK-KTTELYQSQLEVVKL  1849

Query  2607  LRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN  2786
             L+ L Q KA     +  ++  INLR+L  LLL+SY ATL DID EI+++++EI+ I +S+
Sbjct  1850  LKTLLQFKAHPCGADFGRDSDINLRELCLLLLASYGATLSDIDMEIYDVMHEIERIENSD  1909

Query  2787  ISIAEWDYLWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
               IA+ DYLWG A  K RKE  L Q  SCN ++DAE A++ ++ QFRENL IDPK+CA T
Sbjct  1910  NEIAQLDYLWGRAAAKVRKEWILEQDTSCNIMTDAEAAKEQKRSQFRENLAIDPKICAMT  1969

Query  2964  VLYFPYGRP-NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIE  3140
             VLYFPY R  +GP   NK++ D   + HE  S ++ +   YDP+FILR + H LS+G+IE
Sbjct  1970  VLYFPYDRTTDGPSSSNKLKADNLWNTHEIHSPDLQDLQRYDPVFILRFAIHSLSVGFIE  2029

Query  3141  PVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQN  3320
             PVEFA LGLLAV+  SISSPD   RKLGY  L +FKN LEKC KKKDVMRL+LLL+Y+QN
Sbjct  2030  PVEFAGLGLLAVAFVSISSPDVGMRKLGYETLGRFKNELEKCSKKKDVMRLRLLLTYVQN  2089

Query  3321  CIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSD  3500
              IEE WQ+IPSV AIF AEAS +LLDPSHDHY +++K LM+S  VNLKSIPLF +   S 
Sbjct  2090  GIEEPWQRIPSVIAIFAAEASLLLLDPSHDHYTSVSKLLMRSSRVNLKSIPLFHDFFSSS  2149

Query  3501  SVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKK  3680
             SV+FR ERLW+LR+LY+GLN DDD  +YIRNS+ E L+SFY SPL+D+ESKELI+  +KK
Sbjct  2150  SVNFRKERLWMLRLLYAGLNLDDDAQVYIRNSVLEILMSFYASPLSDSESKELILLILKK  2209

Query  3681  SAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHT  3860
             S KL +MA +L+E+CGL SWLSS+++SF G+     K F  AQ  VV+EVVN++I  R+ 
Sbjct  2210  SIKLHKMACYLVEHCGLFSWLSSLLSSFSGMLLGGEKMFLMAQLIVVVEVVNDVISSRNI  2269

Query  3861  VEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPH  4040
              EWLQ++ALEQL + S HL ++LV G ++++E+      IL IL  T K+SQKRK+YQPH
Sbjct  2270  NEWLQRHALEQLVDFSSHLYKLLVGGMKLMRENVPLVNSILLILISTVKISQKRKMYQPH  2329

Query  4041  FTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMS  4220
             FTLS+E  F +C+A+D+         A+  L+ ILMS+P + I +++  K+S F+ WA+S
Sbjct  2330  FTLSLESFFQICQAVDMYNTARSGANAELALKVILMSSPSIDIFRVNQVKLSSFLTWAIS  2389

Query  4221  IALQSETKGVLQVEKCCFPL-NVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSS  4397
              AL+S++  + ++ +    L N+  +   E SL SKLLRWL ASVILGK+  KL    S 
Sbjct  2390  AALKSDSGQMYELRESHLHLRNMLEDAPFEESLTSKLLRWLVASVILGKLFGKLDIPGSK  2449

Query  4398  HSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSAL  4577
              S    + +N     ++  +    N   F C+EILAA+IFYLQQLLG     LPS +SAL
Sbjct  2450  LSKSSYETLN-SLFQDFGNKCVENNKSRFDCKEILAAAIFYLQQLLGLCCGGLPSVISAL  2508

Query  4578  CLLLLKNPAS-SGSEVLIGNA---AALCSKIRCPAEANSAWRW  4694
              LLLL + +  +GS   +G+    A+L S+I CPAEAN  WRW
Sbjct  2509  SLLLLSDVSEYAGSAFKLGHRTSLASLWSRIHCPAEANPCWRW  2551



>ref|XP_010062998.1| PREDICTED: uncharacterized protein LOC104450234 isoform X2 [Eucalyptus 
grandis]
Length=2143

 Score =  1135 bits (2937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 669/1668 (40%), Positives = 1005/1668 (60%), Gaps = 51/1668 (3%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQ-EG  182
             ++++FP ++++++ + GV  S L S+FFLE +LL D+ + WPEM    +++ +  +  EG
Sbjct  479   IIEHFPTVITIAQDISGVSLSFLTSLFFLEHNLLADIFRLWPEMVIRAVKTVLVNVSSEG  538

Query  183   RTEEFGDIDSMEFASAALSL----------------FLKEASLCMLFPITLSIYKSDLST  314
             R  + G + S  F S  L+                  L +    +LFP  L      L+ 
Sbjct  539   RKGDAGGVCSQSFHSEELNSGSGSGASESSSAAFSFLLGQTPFHVLFPAILCFDDPSLAN  598

Query  315   QQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRM  494
                +  LLL   SE   + ++S   +VLFW +Q  +S    P  +L    E+C  +++ +
Sbjct  599   SSKMKKLLLQKASEVNLECLLSCIHFVLFWIHQLQLSRGSMPSVQLRKSFEICSTLLNHI  658

Query  495   LRQFLNTKGDA--SSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSG  668
             L Q LN+K ++  + K    LLP   VQ+ +  IF HP + ASL C L CN         
Sbjct  659   LYQLLNSKINSGFTEKDELILLP-DYVQKAVGCIFSHPALTASLTCLLGCNEMLAGDDVL  717

Query  669   DSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSF---EACHARQVTKAFKN  839
             +++ K L+ +  R + ++D H   LL T            SSF   E     Q+ K F  
Sbjct  718   ENLFKTLDLSSKRSL-EIDSHCFGLLETVSAFFLSLVENHSSFINVETGATIQLVKGFDT  776

Query  840   VVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDN  1019
             +V +L + FK+  + CI++++  PLLP  +A++TL R I PFE+L+LV ++F+ +D+++ 
Sbjct  777   LVHRLLVEFKNELNLCIQTQNFRPLLPTYHALNTLNRLISPFEVLKLVWFVFNIVDMKNT  836

Query  1020  SFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILL  1199
             +  +S R S++ +G   A + F+SL   + Q   +R   DL W   ++ F+  ++E I L
Sbjct  837   TISESCRKSIVYIGCRFAANAFESLGIYLQQQTKKRSQYDLLWRTRDQHFNADIIEDIYL  896

Query  1200  QVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSYCMF  1376
             +V E+++    DVAD+CLLKA       K +Q  N   L   + R IV+ P  ++SYC+ 
Sbjct  897   KVIELSSLYETDVADICLLKAITAACRLKSVQHLNVHPLSSVLLRVIVSTPAQMVSYCIS  956

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQ-TNAIRETSNPSDPELLMLLP  1553
              ++  +A++LFL T++SPLHLSIFG +LSG++  + +L+  N  R  SN      LMLLP
Sbjct  957   GMSMMRAKVLFLLTQLSPLHLSIFGCMLSGVLTPEGNLKYKNHCRGLSNE---HFLMLLP  1013

Query  1554  TVFLYLDSVLIKAGSQVKY-FEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLS-  1727
             T   +++S+ ++ G Q  + F  I  FY  ILL+ F +WK +V++ +F  E +    +S 
Sbjct  1014  TALSFMNSIFLRYGKQCYWNFRYIPLFYSSILLNGFREWKSFVSKSVFR-EGYSEFTISS  1072

Query  1728  IEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQ  1907
              +E ++    + L ++V M+     L    +  + +MELFDSV P   +  D L  D   
Sbjct  1073  ADELLNFVKNSSLGKAVHMLHYHFVLDADSLNIKKQMELFDSVFPDSESRNDLLGCDLRD  1132

Query  1908  VGTCSLEQSLNFVNRTVAKINLCRTLLFPEHN---KFSSGLKEDKMETCAELHSTLDVSR  2078
             + + S+E+ LN +N  +AKI LCR LLFP  N     ++   E   E    + + L+ SR
Sbjct  1133  LNSHSVEEILNLINGALAKILLCRMLLFPSDNHSLSLTNEAPEYSNENSQAIKAGLEPSR  1192

Query  2079  IRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVK  2258
             +R L +LV+SW +I ++F + + +  +   E  S++++ E L+L +I EL  EM   LV+
Sbjct  1193  MRFLCILVNSWEQIAKRFRLDSSSEKEENRECESLYKYFEELMLGSIFELIMEMQDYLVQ  1252

Query  2259  LDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAIC  2438
             L  +PF+ +L +T+  +RF+DP+TL  LR+I++ L + +FSC   +QL++AHSQF + + 
Sbjct  1253  LKVIPFMRQLIRTSLLYRFEDPITLNLLRNILTLLCKEQFSCAPYLQLLLAHSQFTSILH  1312

Query  2439  SSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVL  2618
             S    +   QLG    P+ S++RS  +P  +  S   K + + +K  +K+LE+++LLR L
Sbjct  1313  SVPELSHSLQLGAFLRPMSSILRSVAVPRISRVSHINKKDGESNKHSVKRLEVLQLLRTL  1372

Query  2619  --FQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN-I  2789
               F      ++I+   E GIN + L  L+L SY ATL + D E+ +L+ EI     S  +
Sbjct  1373  IHFSFNGCGMEIDLGNEDGINFQQLHSLILYSYGATLGEGDLELFSLLQEIDCSGGSELV  1432

Query  2790  SIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVL  2969
              + + +YLWG A +K  K  +L Q VS  +      ++ R++QFRENLPIDPK+CA TVL
Sbjct  1433  KLTDTNYLWGKAALKVMKVWDLEQKVSSEVMTDTETDEYRRLQFRENLPIDPKLCALTVL  1492

Query  2970  YFPYGRPNGP--GVVNKVQ-KDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIE  3140
              FPY R         NKVQ  ++ D +H      V  +  YDP+F+L+ S H L +G+IE
Sbjct  1493  DFPYDRAAHEELSFSNKVQINNSKDVIH---IPAVERKQRYDPVFVLQFSLHILPIGFIE  1549

Query  3141  PVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQN  3320
             PVEFA LGLLAV+ + +SSPDD  RKL Y  L  FK ALEKCQKKKD+++L+LLL+Y+QN
Sbjct  1550  PVEFAGLGLLAVAFSCLSSPDDGIRKLAYQTLASFKIALEKCQKKKDIVQLRLLLNYVQN  1609

Query  3321  CIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSD  3500
              IEE WQ+IPS+ AIF AEAS +LL+ S+DHY T++K LM S  +N+KS+PLF   LWS 
Sbjct  1610  GIEEPWQRIPSIIAIFAAEASIILLNSSNDHYPTLSKLLMHSSRINMKSVPLFHEFLWSS  1669

Query  3501  SVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKK  3680
             SV+FR ER WILR++Y GL  DDD  +++RNSIFE LLS Y S  +DNESKELI+Q VKK
Sbjct  1670  SVNFRAERTWILRLVYVGLGIDDDAPVFMRNSIFENLLSLYASSFSDNESKELILQIVKK  1729

Query  3681  SAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHT  3860
             S +L +MA HL+E+CGL SWLSS +     +     KGF F Q  V+LEV++ II  R+ 
Sbjct  1730  SVRLRKMACHLVEHCGLFSWLSSALPHINEMLSGDEKGFYFDQLVVILEVISNIISSRNI  1789

Query  3861  VEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPH  4040
              EWLQK+ALEQLSELS HL + L + A+++ E++    LILQIL  T K+SQKRK++QPH
Sbjct  1790  TEWLQKHALEQLSELSSHLFKFLSDKAELMSENALVIDLILQILVTTLKISQKRKIFQPH  1849

Query  4041  FTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMS  4220
             FTL++EGLF + EA+ +C +    P ++ GL +ILM+ PP +I+ MD +K+  F+ WA+S
Sbjct  1850  FTLAIEGLFQIYEAVKLCDSTQAFPCSEVGLRSILMNAPPPSIIDMDEEKLLHFVLWAIS  1909

Query  4221  IALQSETKGVLQVEKCCFPLNVSSEEET-ENSLISKLLRWLTASVILGKISYKLSKLDSS  4397
             +AL++++  +    +    L + SEEE  E+SL SKLLRWL ASVI GK+S + +  D+ 
Sbjct  1910  VALKADSNEIPHPRESHVCLTILSEEEIREDSLASKLLRWLVASVIHGKLSDRSTYTDAR  1969

Query  4398  HSCDRSKLINLHCLLEWNEESDR-ENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSA  4574
             +S +RS    L+ LL++ +E+ R  +G      + LAA+I YLQQLLG   ++LPS VSA
Sbjct  1970  YS-ERSDPKMLNSLLQFVKETSRGRHGNTSGTGKALAAAILYLQQLLGMDCRVLPSVVSA  2028

Query  4575  LCLLLLK--NPASSGSEVLIGNA--AALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDS  4742
             LCLLL    + A + S++L+     A+  +KI  P EAN AWRWSF+QPWKD +S  TD 
Sbjct  2029  LCLLLYDFCDVAVTESDLLLNGTPVASQLAKISSPLEANPAWRWSFHQPWKDLTSERTDL  2088

Query  4743  EKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             E+++E H CQ LLL+ S  L   S     IS +DVE+ GV+EWERSI+
Sbjct  2089  ERLDERHPCQTLLLIISSTLRTGSSNPLAISPQDVERCGVYEWERSIV  2136



>ref|XP_010062996.1| PREDICTED: uncharacterized protein LOC104450234 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010062997.1| PREDICTED: uncharacterized protein LOC104450234 isoform X1 [Eucalyptus 
grandis]
Length=2606

 Score =  1135 bits (2937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 669/1668 (40%), Positives = 1005/1668 (60%), Gaps = 51/1668 (3%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQ-EG  182
             ++++FP ++++++ + GV  S L S+FFLE +LL D+ + WPEM    +++ +  +  EG
Sbjct  942   IIEHFPTVITIAQDISGVSLSFLTSLFFLEHNLLADIFRLWPEMVIRAVKTVLVNVSSEG  1001

Query  183   RTEEFGDIDSMEFASAALSL----------------FLKEASLCMLFPITLSIYKSDLST  314
             R  + G + S  F S  L+                  L +    +LFP  L      L+ 
Sbjct  1002  RKGDAGGVCSQSFHSEELNSGSGSGASESSSAAFSFLLGQTPFHVLFPAILCFDDPSLAN  1061

Query  315   QQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRM  494
                +  LLL   SE   + ++S   +VLFW +Q  +S    P  +L    E+C  +++ +
Sbjct  1062  SSKMKKLLLQKASEVNLECLLSCIHFVLFWIHQLQLSRGSMPSVQLRKSFEICSTLLNHI  1121

Query  495   LRQFLNTKGDA--SSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSG  668
             L Q LN+K ++  + K    LLP   VQ+ +  IF HP + ASL C L CN         
Sbjct  1122  LYQLLNSKINSGFTEKDELILLP-DYVQKAVGCIFSHPALTASLTCLLGCNEMLAGDDVL  1180

Query  669   DSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSF---EACHARQVTKAFKN  839
             +++ K L+ +  R + ++D H   LL T            SSF   E     Q+ K F  
Sbjct  1181  ENLFKTLDLSSKRSL-EIDSHCFGLLETVSAFFLSLVENHSSFINVETGATIQLVKGFDT  1239

Query  840   VVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDN  1019
             +V +L + FK+  + CI++++  PLLP  +A++TL R I PFE+L+LV ++F+ +D+++ 
Sbjct  1240  LVHRLLVEFKNELNLCIQTQNFRPLLPTYHALNTLNRLISPFEVLKLVWFVFNIVDMKNT  1299

Query  1020  SFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILL  1199
             +  +S R S++ +G   A + F+SL   + Q   +R   DL W   ++ F+  ++E I L
Sbjct  1300  TISESCRKSIVYIGCRFAANAFESLGIYLQQQTKKRSQYDLLWRTRDQHFNADIIEDIYL  1359

Query  1200  QVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSYCMF  1376
             +V E+++    DVAD+CLLKA       K +Q  N   L   + R IV+ P  ++SYC+ 
Sbjct  1360  KVIELSSLYETDVADICLLKAITAACRLKSVQHLNVHPLSSVLLRVIVSTPAQMVSYCIS  1419

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQ-TNAIRETSNPSDPELLMLLP  1553
              ++  +A++LFL T++SPLHLSIFG +LSG++  + +L+  N  R  SN      LMLLP
Sbjct  1420  GMSMMRAKVLFLLTQLSPLHLSIFGCMLSGVLTPEGNLKYKNHCRGLSNE---HFLMLLP  1476

Query  1554  TVFLYLDSVLIKAGSQVKY-FEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLS-  1727
             T   +++S+ ++ G Q  + F  I  FY  ILL+ F +WK +V++ +F  E +    +S 
Sbjct  1477  TALSFMNSIFLRYGKQCYWNFRYIPLFYSSILLNGFREWKSFVSKSVFR-EGYSEFTISS  1535

Query  1728  IEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQ  1907
              +E ++    + L ++V M+     L    +  + +MELFDSV P   +  D L  D   
Sbjct  1536  ADELLNFVKNSSLGKAVHMLHYHFVLDADSLNIKKQMELFDSVFPDSESRNDLLGCDLRD  1595

Query  1908  VGTCSLEQSLNFVNRTVAKINLCRTLLFPEHN---KFSSGLKEDKMETCAELHSTLDVSR  2078
             + + S+E+ LN +N  +AKI LCR LLFP  N     ++   E   E    + + L+ SR
Sbjct  1596  LNSHSVEEILNLINGALAKILLCRMLLFPSDNHSLSLTNEAPEYSNENSQAIKAGLEPSR  1655

Query  2079  IRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVK  2258
             +R L +LV+SW +I ++F + + +  +   E  S++++ E L+L +I EL  EM   LV+
Sbjct  1656  MRFLCILVNSWEQIAKRFRLDSSSEKEENRECESLYKYFEELMLGSIFELIMEMQDYLVQ  1715

Query  2259  LDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAIC  2438
             L  +PF+ +L +T+  +RF+DP+TL  LR+I++ L + +FSC   +QL++AHSQF + + 
Sbjct  1716  LKVIPFMRQLIRTSLLYRFEDPITLNLLRNILTLLCKEQFSCAPYLQLLLAHSQFTSILH  1775

Query  2439  SSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVL  2618
             S    +   QLG    P+ S++RS  +P  +  S   K + + +K  +K+LE+++LLR L
Sbjct  1776  SVPELSHSLQLGAFLRPMSSILRSVAVPRISRVSHINKKDGESNKHSVKRLEVLQLLRTL  1835

Query  2619  --FQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN-I  2789
               F      ++I+   E GIN + L  L+L SY ATL + D E+ +L+ EI     S  +
Sbjct  1836  IHFSFNGCGMEIDLGNEDGINFQQLHSLILYSYGATLGEGDLELFSLLQEIDCSGGSELV  1895

Query  2790  SIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVL  2969
              + + +YLWG A +K  K  +L Q VS  +      ++ R++QFRENLPIDPK+CA TVL
Sbjct  1896  KLTDTNYLWGKAALKVMKVWDLEQKVSSEVMTDTETDEYRRLQFRENLPIDPKLCALTVL  1955

Query  2970  YFPYGRPNGP--GVVNKVQ-KDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIE  3140
              FPY R         NKVQ  ++ D +H      V  +  YDP+F+L+ S H L +G+IE
Sbjct  1956  DFPYDRAAHEELSFSNKVQINNSKDVIH---IPAVERKQRYDPVFVLQFSLHILPIGFIE  2012

Query  3141  PVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQN  3320
             PVEFA LGLLAV+ + +SSPDD  RKL Y  L  FK ALEKCQKKKD+++L+LLL+Y+QN
Sbjct  2013  PVEFAGLGLLAVAFSCLSSPDDGIRKLAYQTLASFKIALEKCQKKKDIVQLRLLLNYVQN  2072

Query  3321  CIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSD  3500
              IEE WQ+IPS+ AIF AEAS +LL+ S+DHY T++K LM S  +N+KS+PLF   LWS 
Sbjct  2073  GIEEPWQRIPSIIAIFAAEASIILLNSSNDHYPTLSKLLMHSSRINMKSVPLFHEFLWSS  2132

Query  3501  SVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKK  3680
             SV+FR ER WILR++Y GL  DDD  +++RNSIFE LLS Y S  +DNESKELI+Q VKK
Sbjct  2133  SVNFRAERTWILRLVYVGLGIDDDAPVFMRNSIFENLLSLYASSFSDNESKELILQIVKK  2192

Query  3681  SAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHT  3860
             S +L +MA HL+E+CGL SWLSS +     +     KGF F Q  V+LEV++ II  R+ 
Sbjct  2193  SVRLRKMACHLVEHCGLFSWLSSALPHINEMLSGDEKGFYFDQLVVILEVISNIISSRNI  2252

Query  3861  VEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPH  4040
              EWLQK+ALEQLSELS HL + L + A+++ E++    LILQIL  T K+SQKRK++QPH
Sbjct  2253  TEWLQKHALEQLSELSSHLFKFLSDKAELMSENALVIDLILQILVTTLKISQKRKIFQPH  2312

Query  4041  FTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMS  4220
             FTL++EGLF + EA+ +C +    P ++ GL +ILM+ PP +I+ MD +K+  F+ WA+S
Sbjct  2313  FTLAIEGLFQIYEAVKLCDSTQAFPCSEVGLRSILMNAPPPSIIDMDEEKLLHFVLWAIS  2372

Query  4221  IALQSETKGVLQVEKCCFPLNVSSEEET-ENSLISKLLRWLTASVILGKISYKLSKLDSS  4397
             +AL++++  +    +    L + SEEE  E+SL SKLLRWL ASVI GK+S + +  D+ 
Sbjct  2373  VALKADSNEIPHPRESHVCLTILSEEEIREDSLASKLLRWLVASVIHGKLSDRSTYTDAR  2432

Query  4398  HSCDRSKLINLHCLLEWNEESDR-ENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSA  4574
             +S +RS    L+ LL++ +E+ R  +G      + LAA+I YLQQLLG   ++LPS VSA
Sbjct  2433  YS-ERSDPKMLNSLLQFVKETSRGRHGNTSGTGKALAAAILYLQQLLGMDCRVLPSVVSA  2491

Query  4575  LCLLLLK--NPASSGSEVLIGNA--AALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDS  4742
             LCLLL    + A + S++L+     A+  +KI  P EAN AWRWSF+QPWKD +S  TD 
Sbjct  2492  LCLLLYDFCDVAVTESDLLLNGTPVASQLAKISSPLEANPAWRWSFHQPWKDLTSERTDL  2551

Query  4743  EKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             E+++E H CQ LLL+ S  L   S     IS +DVE+ GV+EWERSI+
Sbjct  2552  ERLDERHPCQTLLLIISSTLRTGSSNPLAISPQDVERCGVYEWERSIV  2599



>ref|XP_004295819.1| PREDICTED: uncharacterized protein LOC101298301 [Fragaria vesca 
subsp. vesca]
Length=2542

 Score =  1121 bits (2900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/1665 (41%), Positives = 1007/1665 (60%), Gaps = 62/1665 (4%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS-----  167
             ++L NFP I+ +S+ + G P +L  SIFFLE +LL  VSK WPE+FF GL  A++     
Sbjct  898   EILVNFPTIMGISQCLFGFPLTLFSSIFFLEQTLLPSVSKLWPEVFFRGLSMALTNISCK  957

Query  168   ---GLQEGRTEEFGDI-----DSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQG  323
                G+  G  ++ G I     D+ E A+ A SLFL +A   +LFP  + I     S    
Sbjct  958   GRNGIACGSPDQSGAIYGQNSDANEAAAIAFSLFLMKAPFHVLFPAIMCIDGPYASEPSQ  1017

Query  324   LHNLLLANLSERTPD-HIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLR  500
             + +LLLA LS+   D H++S    VLFW  Q   S R+E L +   LSE+C  +V+++L 
Sbjct  1018  IQDLLLAKLSDFATDYHLISYLRLVLFWLYQIRSSCRIEELVDFRQLSEICSVLVEKLLS  1077

Query  501   QFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSM  677
               L  K D+ S  +R L L T  +Q++ ETIFYHP + ASL CPL C+ D  +    D++
Sbjct  1078  SLLVLKADSDS--SRILNLSTHDIQKVAETIFYHPAMIASLSCPLECSEDLAEGNLPDNV  1135

Query  678   DKFLESNKWRVIHKMDLHVINLLRTTFELLY-FCDGQ--TSSFEACHARQVTKAFKNVVQ  848
             D  L  ++ +V H++D H +++L TT + L+  C+    T+  +    ++  K F  +V 
Sbjct  1136  DALLNFSRGKV-HRLDHHALDILATTCKYLFSLCNDHQFTTEVQDQAGKKFVKTFNILVN  1194

Query  849   KLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQ  1028
             KLF   K + D  I S +    LP  YA+H L  +I  FELLEL HWMF+R+D++ N   
Sbjct  1195  KLFQEVKVKFDLSIRSNNGMAFLPTFYALHALSGYISAFELLELAHWMFNRVDMDGN---  1251

Query  1029  QSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVY  1208
                + S +  G  IAG  F +LS  + QP+++R   DLFW M E   +  ++E + +++ 
Sbjct  1252  ---QKSAISFGFWIAGGAFRNLSNYLQQPNTKRKAFDLFWKMEENNINNDIVEAVYIKIS  1308

Query  1209  EIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSYCMFQIN  1385
             +++  L  +V D CLL+A  VV   K MQ+     L + + R I   PV +LS+C+++ +
Sbjct  1309  KLSLLLESEVTDHCLLEAMNVVYRQKSMQKCTFHPLKIVMLRVIATTPVEMLSHCIYRTS  1368

Query  1386  KRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFL  1565
             K KA LL    +MS +HLS FG+LL G +D    L    +R     SD   +MLLP+   
Sbjct  1369  KTKARLLSRLIDMSSMHLSTFGYLLFGTLDTS-SLHKGDVRYALALSDDNYMMLLPSAVA  1427

Query  1566  YLDSVLIKAGSQ-VKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFM  1742
             YL+S L+K G         I SFY +I+L     WK +V+ D+F  E  + LP S EE +
Sbjct  1428  YLNSGLMKLGKPCYSQLRNIPSFYSKIILDGLLHWKNFVSHDVFHEEFGEVLPSSAEEVL  1487

Query  1743  DIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCS  1922
             ++ + +LL +++ M++   AL    ++ + +++ F S  P  +   + L +D   +G+ S
Sbjct  1488  NLINDSLLGKTICMMRYHYALNADSIERKDQLKHFRSFFPPSTGNEELLYWDVGGLGSHS  1547

Query  1923  LEQSLNFVNRTVAKINLCRTLLFPEHNKFSS-------GLKEDKMETCAELHSTLDVSRI  2081
               ++LN VN+  AK++ CR LLFP+  +  S        L++  ++     ++  + S++
Sbjct  1548  FNETLNLVNKVYAKVSFCRMLLFPKDTQVHSLSAEADGNLRDIPLDMG---YNGGNSSQM  1604

Query  2082  RLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKL  2261
             + L +LV  W+ IV++ P     S     ++ S+ R+LE+LIL+ I ELS+EMH  L+++
Sbjct  1605  QFLNILVDMWQCIVKRVP-----SVFCSTDSSSLLRYLEILILKIIFELSREMHDGLIRV  1659

Query  2262  DSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICS  2441
              S+PF+  L K    HRFDDP TLQ LRD++S LS G FS V  +QL++AHSQF   I S
Sbjct  1660  QSIPFLENLMKLALLHRFDDPPTLQMLRDLLSFLSGGIFSRVPYLQLLLAHSQFVPTIRS  1719

Query  2442  SNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLF  2621
                 +  S +G    P+ S++RS V    N N    + +L+ S+ ++KQLE+IKLLR L 
Sbjct  1720  IIKPSHSSHVGTFSRPMSSILRSPVFLTSNQNEDDAECHLETSELYVKQLEVIKLLRTLL  1779

Query  2622  QVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIA  2798
               K +Q   +  +++GI+LR++  LLLSS+ ATL + D EI+NL+  I+ I    ++  A
Sbjct  1780  -FKVQQDGFDSGKDLGIDLREVHLLLLSSFGATLNETDVEIYNLMRTIECIDGLEHVKFA  1838

Query  2799  EWDYLWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDPKMCASTVLYF  2975
               DYLWG+A +K  KER L Q++S + ++DAE  ++  + Q RENL IDPK+CASTVLYF
Sbjct  1839  GMDYLWGSAALKIEKERNLEQSLSYDTMNDAEAVKEYHRNQLRENLSIDPKICASTVLYF  1898

Query  2976  PYGRPNGPGVV--NKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVE  3149
             PY       ++  NK Q D  D +      +V  +  Y+PIFILR S HCLS G+IEP+E
Sbjct  1899  PYQLAASDELLSLNKFQTDLVDDLPVLNCPDVDTKARYNPIFILRFSMHCLSEGFIEPLE  1958

Query  3150  FANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIE  3329
             FA LGLLA++  SISSP D  R LGY  L   ++ L+ CQK+K +  ++LLL +++N I+
Sbjct  1959  FAGLGLLAIAFMSISSPSDKIRSLGYETLGTLQDVLKTCQKRKGITEIKLLLLFVENGIQ  2018

Query  3330  EDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVS  3509
             +  Q+I SV AIF AE S +LLD SH+HYAT+   L +S ++N K +P F N  WS SV+
Sbjct  2019  QIGQRISSVNAIFAAETSLILLDTSHEHYATLLTLLKRSSALNTKIVPFFSNFFWSSSVN  2078

Query  3510  FRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAK  3689
             FR+ERLWILRILY GLN DDD H+YI+NSI ETLLSFY SPL+D ESKELI+Q VKKS K
Sbjct  2079  FRSERLWILRILYVGLNFDDDAHVYIKNSILETLLSFYGSPLSDKESKELILQVVKKSIK  2138

Query  3690  LSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEW  3869
             L ++ARHL+E CGLI WLSS+++   G + +  +   F Q  VV EVVN++   R+  EW
Sbjct  2139  LHKLARHLVEKCGLIPWLSSLLSISSGSRLED-ETLCFLQLGVVSEVVNDVS-SRNITEW  2196

Query  3870  LQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTL  4049
             LQ  ALEQL EL+ HL + L     ++ ++ T    IL+ +  T+K+SQ R +YQPHF +
Sbjct  2197  LQNNALEQLMELTSHLYKFLATDVTLMTDNVTAINRILETIISTFKLSQTRTIYQPHFVV  2256

Query  4050  SVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIAL  4229
             S +GL+ + +A+ V  +       +  L+AILMS PP +I  +  +K+S FI WA+S A+
Sbjct  2257  SFDGLYRIYKAVKVYNSARSCATVEFSLKAILMSAPPASIFYVSGEKLSSFIMWAISSAV  2316

Query  4230  QSETKGVLQVEKCCFPLNVSSEEET--ENSLISKLLRWLTASVILGKISYKLSKLDSSHS  4403
             ++++  +LQ  +    L    EE+   +NSLISKLLRWLTA+VILGK+ +  S +D    
Sbjct  2317  EADSAAMLQFIESHQGLTTIPEEKEVHKNSLISKLLRWLTATVILGKLDWTSSDVDP---  2373

Query  4404  CDRSKLINLHCLLEWNEESDRENG----KEFACQEILAASIFYLQQLLGTSFKLLPSAVS  4571
              + SK +N+  L      +D+  G    K +  +EILA++I YLQQL G ++++LPS ++
Sbjct  2374  -EFSKSLNMESLQSLITHTDKHCGERGRKRYGGEEILASAILYLQQLSGKNYEMLPSVIA  2432

Query  4572  ALCLLLLKNPASSGSEVLIGNAAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKI  4751
             AL LLL     S+G         +L  KIRCP EAN AWRWSF QPWKD    +TDS+K+
Sbjct  2433  ALSLLLSNGSISAGFLHDNETVQSLWLKIRCPDEANLAWRWSFDQPWKDPMLEVTDSQKM  2492

Query  4752  EEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             +E+HAC++LL++ S +L + S   ++ S +D+++ GVFEWERSI+
Sbjct  2493  KELHACELLLVIFSNLLGKQSSEFQVSSTQDIDRFGVFEWERSII  2537



>gb|KDO62639.1| hypothetical protein CISIN_1g0000571mg, partial [Citrus sinensis]
Length=2434

 Score =  1093 bits (2827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/1494 (44%), Positives = 951/1494 (64%), Gaps = 43/1494 (3%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +LL++FP+++++S  +LGVP SLL S+ FLE S L + SK WPEMFF+GLE A+S ++  
Sbjct  946   ELLKSFPLVMTISHNLLGVPASLLPSMIFLEQSFLANASKLWPEMFFSGLEIAVSTIRH-  1004

Query  183   RTEEFG------------------DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDL  308
                EF                   D D+ E A+ ALS FLK+A   ++FP  +++    L
Sbjct  1005  EVREFDVCRIPTHSSFDEEVLCNIDFDANESAAGALSFFLKQAPFHVIFPAIMTVGAPYL  1064

Query  309   STQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVD  488
             S    + +LLL  LS+   D ++S    VLF F Q   SYR EP  EL  LSE+C  ++ 
Sbjct  1065  SEPSKVQDLLLDKLSDWRSDCLISYLRLVLFCFFQIQSSYRDEPTAELLQLSEICIVLMK  1124

Query  489   RMLRQFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFS  665
              +  Q L  K +     T  L L  + V E+ ET+  HP V ASL  PL C+ +      
Sbjct  1125  NVFTQLLVLKPNPGHPKTVGLHLSAENVWEVAETVLCHPAVFASLSSPLSCDLESPLGNL  1184

Query  666   GDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYF-CDGQTSSFEACHA--RQVTKAFK  836
             G +++ FL   + + +HK+D HV+++L  T + L+  C    +  E  +   + + KAF 
Sbjct  1185  GHNLETFLSLTQ-QSVHKIDRHVLDMLTATLDHLFSSCTDHYTILEVDNGVCKSLVKAFN  1243

Query  837   NVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED  1016
              +V++LFL  +D+ D CI ++D+ PLLPA YA+H L RFI P +LLELVHWMF ++D+ +
Sbjct  1244  TLVRRLFLELRDKFDLCIATEDVLPLLPAFYALHALIRFISPLKLLELVHWMFRKVDVNE  1303

Query  1017  NSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKIL  1196
              S  +S     L VG  IAG  F++LS  + QP  +R   +L W   E  F +  +E+I 
Sbjct  1304  MSICKSCNVYALSVGFCIAGGTFEALSNYLQQPVEKRASYNLLWETEENSFGVNHIEEIY  1363

Query  1197  LQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMF  1376
             ++V ++A +  L +AD CLLK    + +   MQ  +P L + +SR IV  P+ ++S+C++
Sbjct  1364  IEVCKLAINFDLGLADTCLLKIVNCIYSQNYMQSVHP-LNLIMSRVIVKTPIEMISHCVY  1422

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP-SDPELLMLLP  1553
             +    KA++LFL T+MSP+HLS+FG+LL G ++K   L  + +       SD E +MLLP
Sbjct  1423  RTTMTKAKVLFLFTKMSPMHLSVFGNLLVGSLNKDSLLTGSQMWTCGYAFSDEEFMMLLP  1482

Query  1554  TVFLYLDSVLIKAGSQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSI  1730
                 YL+   +K   Q  K+   I+SFY R+LL  F +WK +V+  +F  E     P S 
Sbjct  1483  AALSYLNMNFLKFEKQYHKHLMDILSFYSRMLLSGFRNWKSFVSGYIFQEEYDGFFPSST  1542

Query  1731  EEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQV  1910
             EE +++ + +LL ++VL++    AL G  +K +  ++LF+S+ P      + LDFD ++V
Sbjct  1543  EELLNLVNGSLLGKTVLLLHYHFALNGDSLKTKKLIKLFNSIFPCSGAQNELLDFDINEV  1602

Query  1911  GTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFS-------SGLKEDKMETCAELHSTLD  2069
              + S +QSLN +NR VAK++LCR LLFPE ++          GLK   +++ ++  ++  
Sbjct  1603  KSNSFKQSLNHINRVVAKVSLCRMLLFPEDDQVQFLPKAAEGGLKGISLKSGSDDQNS--  1660

Query  2070  VSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHG  2246
              SR+R + +LV SW+ +V K P  + +  + +  N  S++++LEV ILR+I EL  +M  
Sbjct  1661  -SRMRFMNILVGSWQWMVMKLPSISKDFERNKSANVLSLYKYLEVFILRSIFELVSKMSK  1719

Query  2247  CLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFE  2426
              L++L S+PF+ +L ++  ++RF+D  TL+ LR I++ L EGKFSC   +QL++AHSQF 
Sbjct  1720  GLIELQSIPFLEQLIRSALFYRFEDSTTLKMLRSILTLLLEGKFSCGLYLQLLLAHSQFA  1779

Query  2427  TAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKL  2606
             T+I S + ++     G+   P+ S++R  VI  FN N+  + D  + ++ +  QLE++KL
Sbjct  1780  TSIQSVSAASNAGG-GVLLRPMSSILRFLVIHHFNQNADEKNDK-KTTELYQSQLEVVKL  1837

Query  2607  LRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN  2786
             L+ L Q KA     +  ++  INLR+L  LLL+SY ATL DID EI+++++EI+ I +S+
Sbjct  1838  LKTLLQFKAHPCGADFGRDSDINLRELCLLLLASYGATLSDIDMEIYDVMHEIERIENSD  1897

Query  2787  ISIAEWDYLWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
               IA+ DYLWG A  K RKE  L Q  SCN ++DAE A++ ++ QFRENL IDPK+CA T
Sbjct  1898  NEIAQLDYLWGRAAAKVRKEWILEQDTSCNIMTDAEAAKEQKRSQFRENLAIDPKICAMT  1957

Query  2964  VLYFPYGRP-NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIE  3140
             VLYFPY R  +GP   NK++ D   + HE  S ++ +   YDP+FILR + H LS+G+IE
Sbjct  1958  VLYFPYDRTTDGPSSSNKLKADNLWNTHEIHSPDLQDLQRYDPVFILRFAIHSLSVGFIE  2017

Query  3141  PVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQN  3320
             PVEFA LGLLAV+  SISSPD   RKLGY  L +FKN LEKC KKKDVMRL+LLL+Y+QN
Sbjct  2018  PVEFAGLGLLAVAFVSISSPDVGMRKLGYETLGRFKNELEKCSKKKDVMRLRLLLTYVQN  2077

Query  3321  CIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSD  3500
              IEE WQ+IPSV AIF AEAS +LLDPSHDHY +++K LM+S  VNLKSIPLF +   S 
Sbjct  2078  GIEEPWQRIPSVIAIFAAEASLLLLDPSHDHYTSVSKLLMRSSRVNLKSIPLFHDFFSSS  2137

Query  3501  SVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKK  3680
             SV+FR ERLW+LR+LY+GLN DDD  +YIRNS+ E L+SFY SPL+D+ESKELI+  +KK
Sbjct  2138  SVNFRKERLWMLRLLYAGLNLDDDAQVYIRNSVLEILMSFYASPLSDSESKELILLILKK  2197

Query  3681  SAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHT  3860
             S KL +MA +L+E+CGL SWLSS+++SF G+     K F  AQ  VV+EVVN++I  R+ 
Sbjct  2198  SIKLHKMACYLVEHCGLFSWLSSLLSSFSGMLLGGEKMFLMAQLIVVVEVVNDVISSRNI  2257

Query  3861  VEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPH  4040
              EWLQ++ALEQL + S HL ++LV G ++++E+      IL IL  T K+SQKRK+YQPH
Sbjct  2258  NEWLQRHALEQLVDFSSHLYKLLVGGMKLMRENVPLVNSILLILISTVKISQKRKMYQPH  2317

Query  4041  FTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMS  4220
             FTLS+E  F +C+A+D+         A+  L+ ILMS+P + I +++  K+S F+ WA+S
Sbjct  2318  FTLSLESFFQICQAVDMYNTARSGANAELALKVILMSSPSIDIFRVNQVKLSSFLTWAIS  2377

Query  4221  IALQSETKGVLQVEKCCFPL-NVSSEEETENSLISKLLRWLTASVILGKISYKL  4379
              AL+S++  + ++ +    L N+  +   E SL SKLLRWL ASVILGK+  KL
Sbjct  2378  AALKSDSGQMYELRESHLHLRNMLEDAPFEESLTSKLLRWLVASVILGKLFGKL  2431



>gb|KDO62640.1| hypothetical protein CISIN_1g0000571mg, partial [Citrus sinensis]
 gb|KDO62641.1| hypothetical protein CISIN_1g0000571mg, partial [Citrus sinensis]
Length=2041

 Score =  1092 bits (2824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/1494 (44%), Positives = 951/1494 (64%), Gaps = 43/1494 (3%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +LL++FP+++++S  +LGVP SLL S+ FLE S L + SK WPEMFF+GLE A+S ++  
Sbjct  553   ELLKSFPLVMTISHNLLGVPASLLPSMIFLEQSFLANASKLWPEMFFSGLEIAVSTIRH-  611

Query  183   RTEEFG------------------DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDL  308
                EF                   D D+ E A+ ALS FLK+A   ++FP  +++    L
Sbjct  612   EVREFDVCRIPTHSSFDEEVLCNIDFDANESAAGALSFFLKQAPFHVIFPAIMTVGAPYL  671

Query  309   STQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVD  488
             S    + +LLL  LS+   D ++S    VLF F Q   SYR EP  EL  LSE+C  ++ 
Sbjct  672   SEPSKVQDLLLDKLSDWRSDCLISYLRLVLFCFFQIQSSYRDEPTAELLQLSEICIVLMK  731

Query  489   RMLRQFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFS  665
              +  Q L  K +     T  L L  + V E+ ET+  HP V ASL  PL C+ +      
Sbjct  732   NVFTQLLVLKPNPGHPKTVGLHLSAENVWEVAETVLCHPAVFASLSSPLSCDLESPLGNL  791

Query  666   GDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYF-CDGQTSSFEACHA--RQVTKAFK  836
             G +++ FL   + + +HK+D HV+++L  T + L+  C    +  E  +   + + KAF 
Sbjct  792   GHNLETFLSLTQ-QSVHKIDRHVLDMLTATLDHLFSSCTDHYTILEVDNGVCKSLVKAFN  850

Query  837   NVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED  1016
              +V++LFL  +D+ D CI ++D+ PLLPA YA+H L RFI P +LLELVHWMF ++D+ +
Sbjct  851   TLVRRLFLELRDKFDLCIATEDVLPLLPAFYALHALIRFISPLKLLELVHWMFRKVDVNE  910

Query  1017  NSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKIL  1196
              S  +S     L VG  IAG  F++LS  + QP  +R   +L W   E  F +  +E+I 
Sbjct  911   MSICKSCNVYALSVGFCIAGGTFEALSNYLQQPVEKRASYNLLWETEENSFGVNHIEEIY  970

Query  1197  LQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMF  1376
             ++V ++A +  L +AD CLLK    + +   MQ  +P L + +SR IV  P+ ++S+C++
Sbjct  971   IEVCKLAINFDLGLADTCLLKIVNCIYSQNYMQSVHP-LNLIMSRVIVKTPIEMISHCVY  1029

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP-SDPELLMLLP  1553
             +    KA++LFL T+MSP+HLS+FG+LL G ++K   L  + +       SD E +MLLP
Sbjct  1030  RTTMTKAKVLFLFTKMSPMHLSVFGNLLVGSLNKDSLLTGSQMWTCGYAFSDEEFMMLLP  1089

Query  1554  TVFLYLDSVLIKAGSQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSI  1730
                 YL+   +K   Q  K+   I+SFY R+LL  F +WK +V+  +F  E     P S 
Sbjct  1090  AALSYLNMNFLKFEKQYHKHLMDILSFYSRMLLSGFRNWKSFVSGYIFQEEYDGFFPSST  1149

Query  1731  EEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQV  1910
             EE +++ + +LL ++VL++    AL G  +K +  ++LF+S+ P      + LDFD ++V
Sbjct  1150  EELLNLVNGSLLGKTVLLLHYHFALNGDSLKTKKLIKLFNSIFPCSGAQNELLDFDINEV  1209

Query  1911  GTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFS-------SGLKEDKMETCAELHSTLD  2069
              + S +QSLN +NR VAK++LCR LLFPE ++          GLK   +++ ++  ++  
Sbjct  1210  KSNSFKQSLNHINRVVAKVSLCRMLLFPEDDQVQFLPKAAEGGLKGISLKSGSDDQNS--  1267

Query  2070  VSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHG  2246
              SR+R + +LV SW+ +V K P  + +  + +  N  S++++LEV ILR+I EL  +M  
Sbjct  1268  -SRMRFMNILVGSWQWMVMKLPSISKDFERNKSANVLSLYKYLEVFILRSIFELVSKMSK  1326

Query  2247  CLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFE  2426
              L++L S+PF+ +L ++  ++RF+D  TL+ LR I++ L EGKFSC   +QL++AHSQF 
Sbjct  1327  GLIELQSIPFLEQLIRSALFYRFEDSTTLKMLRSILTLLLEGKFSCGLYLQLLLAHSQFA  1386

Query  2427  TAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKL  2606
             T+I S + ++     G+   P+ S++R  VI  FN N+  + D  + ++ +  QLE++KL
Sbjct  1387  TSIQSVSAASNAGG-GVLLRPMSSILRFLVIHHFNQNADEKNDK-KTTELYQSQLEVVKL  1444

Query  2607  LRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN  2786
             L+ L Q KA     +  ++  INLR+L  LLL+SY ATL DID EI+++++EI+ I +S+
Sbjct  1445  LKTLLQFKAHPCGADFGRDSDINLRELCLLLLASYGATLSDIDMEIYDVMHEIERIENSD  1504

Query  2787  ISIAEWDYLWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
               IA+ DYLWG A  K RKE  L Q  SCN ++DAE A++ ++ QFRENL IDPK+CA T
Sbjct  1505  NEIAQLDYLWGRAAAKVRKEWILEQDTSCNIMTDAEAAKEQKRSQFRENLAIDPKICAMT  1564

Query  2964  VLYFPYGRP-NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIE  3140
             VLYFPY R  +GP   NK++ D   + HE  S ++ +   YDP+FILR + H LS+G+IE
Sbjct  1565  VLYFPYDRTTDGPSSSNKLKADNLWNTHEIHSPDLQDLQRYDPVFILRFAIHSLSVGFIE  1624

Query  3141  PVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQN  3320
             PVEFA LGLLAV+  SISSPD   RKLGY  L +FKN LEKC KKKDVMRL+LLL+Y+QN
Sbjct  1625  PVEFAGLGLLAVAFVSISSPDVGMRKLGYETLGRFKNELEKCSKKKDVMRLRLLLTYVQN  1684

Query  3321  CIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSD  3500
              IEE WQ+IPSV AIF AEAS +LLDPSHDHY +++K LM+S  VNLKSIPLF +   S 
Sbjct  1685  GIEEPWQRIPSVIAIFAAEASLLLLDPSHDHYTSVSKLLMRSSRVNLKSIPLFHDFFSSS  1744

Query  3501  SVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKK  3680
             SV+FR ERLW+LR+LY+GLN DDD  +YIRNS+ E L+SFY SPL+D+ESKELI+  +KK
Sbjct  1745  SVNFRKERLWMLRLLYAGLNLDDDAQVYIRNSVLEILMSFYASPLSDSESKELILLILKK  1804

Query  3681  SAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHT  3860
             S KL +MA +L+E+CGL SWLSS+++SF G+     K F  AQ  VV+EVVN++I  R+ 
Sbjct  1805  SIKLHKMACYLVEHCGLFSWLSSLLSSFSGMLLGGEKMFLMAQLIVVVEVVNDVISSRNI  1864

Query  3861  VEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPH  4040
              EWLQ++ALEQL + S HL ++LV G ++++E+      IL IL  T K+SQKRK+YQPH
Sbjct  1865  NEWLQRHALEQLVDFSSHLYKLLVGGMKLMRENVPLVNSILLILISTVKISQKRKMYQPH  1924

Query  4041  FTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMS  4220
             FTLS+E  F +C+A+D+         A+  L+ ILMS+P + I +++  K+S F+ WA+S
Sbjct  1925  FTLSLESFFQICQAVDMYNTARSGANAELALKVILMSSPSIDIFRVNQVKLSSFLTWAIS  1984

Query  4221  IALQSETKGVLQVEKCCFPL-NVSSEEETENSLISKLLRWLTASVILGKISYKL  4379
              AL+S++  + ++ +    L N+  +   E SL SKLLRWL ASVILGK+  KL
Sbjct  1985  AALKSDSGQMYELRESHLHLRNMLEDAPFEESLTSKLLRWLVASVILGKLFGKL  2038



>ref|XP_010675691.1| PREDICTED: uncharacterized protein LOC104891665 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=2589

 Score =  1086 bits (2809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/1664 (40%), Positives = 995/1664 (60%), Gaps = 70/1664 (4%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             D++ N P +++VS K+ G+  S+ M  FFL+ +L+  VSK WP+MF++GL  ++    + 
Sbjct  957   DIVYNLPSVMAVSGKLAGLNCSV-MDYFFLDQNLMRCVSKLWPDMFYSGLRMSVRACSQV  1015

Query  183   RTEEFGDI---------DSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNL  335
               +   D          +  E  S      LKEA   +LFP  +        +   +  L
Sbjct  1016  TQDNDKDTSVKALHSNTEETEHTSIVFGSLLKEAPFYVLFPAIIFCVPE---SHSEIKEL  1072

Query  336   LLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNT  515
             L+A +S    + +VSS   VLFWF+Q   SYR +P E+ E+ SELCF +V  +L      
Sbjct  1073  LVAKVSNLDIEQLVSSVRLVLFWFHQIQTSYRKKPTEQQELHSELCFFLVKHILSLLPTL  1132

Query  516   K---GDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKF  686
             K   G +++    SL  ++C+QE+ +T+F HP VAASL  P   + + T+ F  DS +  
Sbjct  1133  KFVSGSSANNAAFSL--SQCLQEVAKTVFCHPAVAASLSSPFARDYEITEEFLRDSSEGL  1190

Query  687   LESNKWRVIHKMDLHVINLLRTTFE-LLYFCDGQ--TSSFEACHARQVTKAFKNVVQKLF  857
             L       + K +LHV+ LL  T + LL  C  +  +S +  C    + KAF N+VQ++F
Sbjct  1191  LHPCG-EGMRKTELHVLKLLTATSDYLLALCSEKLLSSVYTECK-EYIVKAFGNLVQQIF  1248

Query  858   LTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSL  1037
             L FK R +    S ++T L P +  + +L RFI P ELL L +WMFS ++L ++   +  
Sbjct  1249  LIFKSRFELWCTSGNMT-LFPILCGLVSLMRFISPIELLGLANWMFSVVELPNSKIPKIS  1307

Query  1038  RDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIA  1217
               S L +   IA      LS  M  P+    L+DLFW       D  L E I L+ ++ A
Sbjct  1308  NVSPLYMAFSIACGALSMLSQHMQSPNVTVVLTDLFWANEMRTLDATLFESIYLKAFKFA  1367

Query  1218  THLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKA  1397
             T   +D+AD CLLKA     +    Q   P   M I+R I+  PV ++S+C+ + +  KA
Sbjct  1368  TCFKIDLADTCLLKALTAANSLIHRQDCLP-FSMEITRVIIRTPVRIVSHCLNRTDNTKA  1426

Query  1398  ELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPS--DPELLMLLPTVFLYL  1571
             ++LF   E+S LH S+FG L SG++ +      N+  +  N    D E LMLLP   LY+
Sbjct  1427  KILFRMMEISALHSSVFGQLFSGILGEDTIPTINSPEQICNQLLLDEECLMLLPAAALYV  1486

Query  1572  D----SVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEF  1739
                  ++L K    +K+   +++ Y R+LL  F +W  +V+R +F +E  + LP S+E  
Sbjct  1487  SFSWTNLLEKPSRNIKF---MLTSYSRLLLDGFLNWNDFVSRTVFLVEYGNVLPCSVENL  1543

Query  1740  MDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTC  1919
              D+F+ +LL ++V M+Q   A +G   +   R++L  S+ P      DF+DFD  ++ + 
Sbjct  1544  NDLFNSSLLRKAVQMLQWYFASSGD--RKNKRLKLLCSLYPVSGASHDFMDFDVRKIDSY  1601

Query  1920  SLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKML  2099
             S+ Q  + +NR VAK++LC  LLFPE NK S+    D ++  +   S  + S +R L ML
Sbjct  1602  SVRQLTDLINRVVAKVSLCFVLLFPEGNKCSANEAPD-IQGESFGGSNSEDSSLRFLDML  1660

Query  2100  VSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFI  2279
             V  W+ +V+K P +A+N+  ++     + R LE+  LR I +L  +    L K+DSLPFI
Sbjct  1661  VGIWQLVVKKIP-SANNNSDLKTPIFLLLRSLEMFTLRCIYKLIMKTRSILTKMDSLPFI  1719

Query  2280  VKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTG  2459
               +AK +  HRF DP+TL  LR ++S LS      + ++QL+V HSQ  + + +      
Sbjct  1720  ENMAKVSLLHRFGDPITLNNLRHVLSCLSGANLPVILLLQLLVGHSQLASTVGTVTDPFA  1779

Query  2460  ISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQ  2639
                 G+   P+ S +RS V+P          +NL+ S+ +  +LE++KLLR+LF +KA +
Sbjct  1780  FGSSGMVVKPISSFLRSSVVP-------TESNNLETSETYKSKLEVVKLLRLLFHLKATR  1832

Query  2640  VDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISI-AEWDYLW  2816
              D+    ++G+NLRDL FLLL++Y AT+ +ID EI++L++EI+S   +  +I AE DYLW
Sbjct  1833  CDMVFDDDLGLNLRDLSFLLLTTYGATVSEIDLEIYSLLSEIESAGGAGDNIIAEHDYLW  1892

Query  2817  GNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRP--  2990
             G++ ++  K       V  ++SDAE  EDCR+ QFR+NLPI+PK    TVLYFPYGR   
Sbjct  1893  GSSALRVGKG----IAVKKDISDAE--EDCRRNQFRDNLPINPKFVMQTVLYFPYGRTMC  1946

Query  2991  NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLL  3170
                  ++ V +DT +   E    E+     YDP+F+L LS H L+ G+++P+EFA LGLL
Sbjct  1947  EKSLFMDDVHRDTVNITEEGHCTELGRIERYDPVFVLSLSIHSLATGFLDPMEFAGLGLL  2006

Query  3171  AVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIP  3350
             A++L S+ SP+D  RKL Y V+ +FK+AL +CQ+K++V RL+LLL+YLQN I+E+W+KIP
Sbjct  2007  AIALVSMGSPEDGIRKLAYEVVWRFKDALMRCQRKREVTRLKLLLTYLQNGIKEEWEKIP  2066

Query  3351  SVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLW  3530
             ++ A F+AEAS +LLDPSH+HY  I+K LMQSP +NLKSIPLF +  WS+SV+FRT+R+W
Sbjct  2067  TILAAFVAEASVILLDPSHEHYPAISKFLMQSPWINLKSIPLFHDFFWSNSVTFRTDRMW  2126

Query  3531  ILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARH  3710
             +LR+LY+G+N +DD  +YIRNS+ E LLSFYVSPL+D +SKELI+  VKK  K+ +MA +
Sbjct  2127  MLRLLYAGINIEDDAVVYIRNSVLEILLSFYVSPLSDIDSKELILLVVKKCVKVQKMACY  2186

Query  3711  LIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALE  3890
             L+ENC LISWLSSV+ +      D    F   Q  VVLEVV+E +  +  +EWL K+A+E
Sbjct  2187  LVENCCLISWLSSVL-ALSMTHIDSKDTFFSKQLLVVLEVVHEAVALKGIMEWLHKHAIE  2245

Query  3891  QLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFH  4070
             QLS+L+CHL  +L   ++++ E  +   LIL++      +SQ+R + QP   LS+  L+H
Sbjct  2246  QLSDLTCHLLNLLARCSKLVLETKSLVILILKVTVAL--MSQERNMPQPPLALSMRSLYH  2303

Query  4071  LCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGV  4250
             + +A+DV   G +   A+ GL+AIL + PP  I  +D +++S+F+ WA+S A+Q +++  
Sbjct  2304  VYQAVDVQDGGKFGDCAERGLKAILANAPPTTISDLDLEELSRFLMWAVSTAVQLDSRQA  2363

Query  4251  LQVEKCCFPLNVSSEEE---TENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKL  4421
             LQ  +   PL   +E E    E SLIS LLRWL ASV+L + SY  S  +SS     +  
Sbjct  2364  LQRTQ-VLPLIQCTENEEHMQEESLISTLLRWLVASVVLCRGSYCNSVFNSSFVLREANE  2422

Query  4422  INLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNP  4601
               L  L+E  E    ++       +ILAA+IF+LQQL+G   +LLPS V+AL +LLL++ 
Sbjct  2423  ETLLSLIEHRESIGGDSKLLSGSGKILAATIFHLQQLVGMKCQLLPSVVAALSVLLLRDG  2482

Query  4602  ASSGSEVLIGNA---------AALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIE  4754
             + +    L G+A         ++L SKI CP E N +WRWSFYQPW DH++  TD EKI+
Sbjct  2483  SYATEGDLSGHATCINLRNSVSSLWSKIYCPPEVNPSWRWSFYQPWADHATERTDLEKID  2542

Query  4755  EIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             E HACQ LL++ S +L +N+  ++L+SL+++E  G+FE ER+ L
Sbjct  2543  ESHACQKLLVIISGVLRKNASDNELLSLQELESSGLFERERTNL  2586



>ref|XP_008458087.1| PREDICTED: uncharacterized protein LOC103497624 isoform X1 [Cucumis 
melo]
Length=2449

 Score =  1084 bits (2803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/1590 (42%), Positives = 965/1590 (61%), Gaps = 67/1590 (4%)
 Frame = +3

Query  201   DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERTPDHIVS  380
             + D +E +S   S FLK+A   +LFP  +   +S+      + + LL  LSE T DH++ 
Sbjct  885   EFDKIEASSLGFSTFLKKAPFHVLFPAIMCTRRSNSLVLPKIQDFLLLKLSELTFDHLLL  944

Query  381   SFLYVL-FWFNQAHISYRVepleelemlselCFNIVDRMLRQFL--NTKGDASSKCTRSL  551
              +L ++ FW  Q  ISYR +P  ELE LS++C  +V  +L + L   T+  A      SL
Sbjct  945   PYLRLVLFWMYQIRISYRFKPSVELEKLSQICIVLVQNILAKLLATRTQSGAGGDYKSSL  1004

Query  552   LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESN---KWRVIHKM  722
             L  + VQ++ ETIF HP + +SL C L C  +       D++D  LES      + ++ +
Sbjct  1005  LRLE-VQDVAETIFSHPAIISSLTCSLNCPGNLM----LDAIDLNLESLVQLSRKSVNIL  1059

Query  723   DLHVINLLRTTFE-LLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRTDKCIESK  899
             D H++NLL ++ E L+  CD Q S+F     R V + F   VQ+L   F+DR D   E+ 
Sbjct  1060  DHHIVNLLTSSCEYLVTSCDDQDSTF-----RGVVETFNVFVQRLLSEFRDRFDIFTETM  1114

Query  900   DLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSV--LRVGLHIA  1073
             DL PLLP  +A+H L  FI PF+LLELV W+F R+++     Q+S    +  L  G  IA
Sbjct  1115  DLIPLLPLFFALHALNHFISPFDLLELVIWIFKRVNINGFVVQKSETTQIHGLSFGFGIA  1174

Query  1074  GSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIV-LLEKILLQVYEIATHLHLDVADMC  1250
                F  ++  +  P S+R    L   M E+  D+  ++++I  +    A H   + AD C
Sbjct  1175  VIAFKDVTGYLQLPLSKRLPYHLLRKMDEK--DVCNIIDEIYTKTNVCAVHYKSEFADAC  1232

Query  1251  LLKAFKVVKTHKVMQ-QSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMS  1427
             LL+  K +   K M  +    + +A  RFI+N+P  L+SYC  + NK KAELLF  TE S
Sbjct  1233  LLEVVKAICAKKSMLCEYFDQIHLATFRFIMNMPSELISYCFDRTNKEKAELLFFLTEAS  1292

Query  1428  PLHLSIFGHLLSGMIDKQ-VHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV  1604
              LHLSIFGH +  ++DK   H+         N  + +LLMLLPT   YL+SV+ K G   
Sbjct  1293  SLHLSIFGHFIVNIMDKHSCHMD--------NEMEDKLLMLLPTSLTYLNSVVAKFGKNC  1344

Query  1605  KY-FEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVL  1781
              Y F+ I S Y RIL   F  WK +VT   FD E  D++P + ++F+D+ + +LL ++V 
Sbjct  1345  WYNFKVISSVYSRIL---FRKWKIFVTNSTFDEEFGDSVPSTTQDFIDLVNNSLLGKAVG  1401

Query  1782  MVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVA  1961
             M++   AL G LV  + R+++F+ + P   +  + L F+  ++ + S  Q  NF+++ V+
Sbjct  1402  MLRHYFALNGDLVTVKKRLKVFNYIFPASCSTDEVLGFEVDELDSYSPNQVFNFLSKVVS  1461

Query  1962  KINLCRTLLFPEHNKFSSGLKEDKM--ETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFP  2135
             KI+ CR LLFPE     S  +ED+    + A   +  + SR++ L  LV  W+ IV++F 
Sbjct  1462  KISFCRVLLFPEGCGIQSLPREDESTEHSSARRSNNEESSRLQYLNTLVGIWQWIVKRFV  1521

Query  2136  MTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRF  2315
               +D   + E +N  +FR+LE+ +L NI++LS+EMHG LVKL S+PF+ +L + +  +RF
Sbjct  1522  FISD-IYEKERDNSRLFRYLELFLLNNILDLSREMHGALVKLPSIPFLEQLMRFSLLYRF  1580

Query  2316  DDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLP  2495
             +DP TL  L  I+  LS+GKF+    +QL++AHSQF   I S+   +    +     P+ 
Sbjct  1581  EDPTTLNILYSILDLLSDGKFAVDAYLQLLLAHSQFAPTIQSTPKPS--HSIETFLRPMS  1638

Query  2496  SLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGIN  2675
             S++RS VIP         K + + ++  LK+L ++KL+ +L  +K         ++  IN
Sbjct  1639  SILRSLVIPSSGQQETNFKQDSKATRTDLKRLVIVKLVHILVLMKVCHGGY--GKDDTIN  1696

Query  2676  LRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNI-SIAEWDYLWGNAVVKARKERE  2852
              RDL  LLLSSY AT+ + D  I   +N+I++I  S+  +  + D+LWGNAV+   KER 
Sbjct  1697  FRDLYALLLSSYGATVSETDSTILMTLNDIETIIGSDAKNHVQMDFLWGNAVLGVSKERL  1756

Query  2853  LVQTVSCNLS-DAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPN----GPGVVNKV  3017
             L Q  S N++ DAE  ++  + QFRENLP+DP++C STVL+FPY R           N+V
Sbjct  1757  LEQEPSSNMNNDAEAVKERHRNQFRENLPVDPRICVSTVLWFPYDRTELDEESRLKENRV  1816

Query  3018  QK--DTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASI  3191
             +   D F   +     E      YDPI++LR S H LSMGYIE +EFA LGLLAV+  S+
Sbjct  1817  KDLDDFFKGHYHGTEPER-----YDPIYVLRFSIHALSMGYIEALEFATLGLLAVAFVSL  1871

Query  3192  SSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFI  3371
             SS +D  RKLGYG L   KN +E  +++K   RL+LLL+Y+QN IEE WQ+IPS+ A F 
Sbjct  1872  SSANDKLRKLGYGTLGALKNTVENGKRRKGTTRLRLLLTYVQNGIEEPWQRIPSIIAFFA  1931

Query  3372  AEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYS  3551
             AEASF+LL+PSH HYA I+K L++S  +N KSIPLF+N LWS SV+F++ERLW+LR++Y 
Sbjct  1932  AEASFILLEPSHHHYAAISKFLVRSTRMNSKSIPLFKNFLWSTSVNFKSERLWMLRLVYV  1991

Query  3552  GLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGL  3731
             G+N DDD  +YI+NSI E L SFYVS L+DNESKELI+Q +KKS KL RMA +L+EN GL
Sbjct  1992  GINVDDDARLYIKNSIHEDLQSFYVSSLSDNESKELILQVMKKSVKLQRMAFYLVEN-GL  2050

Query  3732  ISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSC  3911
              SWL S+V++      +  K     Q A+VLEVVN +I FR+  EWLQK ALEQL E S 
Sbjct  2051  FSWLCSIVSTSSRRLTEDQKSIFTKQLALVLEVVNNVISFRNICEWLQKDALEQLMEFSS  2110

Query  3912  HLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAI-D  4088
             ++ +ILV G Q+L         ILQI+T   ++SQKRK++QPHFT S+EGLFH+ +A+  
Sbjct  2111  NIFKILVGGEQLLLIEGALVNQILQIITSVLRISQKRKIFQPHFTFSIEGLFHIYQAVHK  2170

Query  4089  VCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKC  4268
             + C    S  A +GL+ ILM+ P +++L+MD  + S F++WA+S AL+ +++ V   E  
Sbjct  2171  LDCTRLGSNSA-SGLKMILMNMPQISLLRMDPMRCSGFLSWAVSTALEFDSRMVAN-ESH  2228

Query  4269  CFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEW  4448
                ++ S EE ++ SL SKLLRWL+AS ILGK+S K   ++   S +R     L+ LLE 
Sbjct  2229  LGLISESDEEHSDESLTSKLLRWLSASAILGKVSLKFGCMNLRTS-ERLSAETLYSLLEH  2287

Query  4449  NEESDRENG-KEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVL  4625
              + +   N  +EF C+ +LAA+IFYLQQ L +SF +LP  +SALCLLL    A   +++ 
Sbjct  2288  VKNTRDHNSLQEFGCEGLLAANIFYLQQHLQSSFMVLPVVISALCLLLFD--ALISADLF  2345

Query  4626  IGNAAALC---SKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASK  4796
                 A L    SKIRCP E N AWRW+FYQPWKD+S  LT+ +K++E+HACQ L LV S 
Sbjct  2346  HSQGADLAQHLSKIRCPEEVNPAWRWTFYQPWKDYSLELTNLQKMDEVHACQTLQLVISN  2405

Query  4797  MLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             +L++  L  + +  +D+E   VFEWER+++
Sbjct  2406  ILSKKPLDLQFLLPQDIEISRVFEWERNLI  2435



>ref|XP_008458089.1| PREDICTED: uncharacterized protein LOC103497624 isoform X3 [Cucumis 
melo]
Length=2120

 Score =  1083 bits (2801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/1590 (42%), Positives = 965/1590 (61%), Gaps = 67/1590 (4%)
 Frame = +3

Query  201   DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERTPDHIVS  380
             + D +E +S   S FLK+A   +LFP  +   +S+      + + LL  LSE T DH++ 
Sbjct  556   EFDKIEASSLGFSTFLKKAPFHVLFPAIMCTRRSNSLVLPKIQDFLLLKLSELTFDHLLL  615

Query  381   SFLYVL-FWFNQAHISYRVepleelemlselCFNIVDRMLRQFL--NTKGDASSKCTRSL  551
              +L ++ FW  Q  ISYR +P  ELE LS++C  +V  +L + L   T+  A      SL
Sbjct  616   PYLRLVLFWMYQIRISYRFKPSVELEKLSQICIVLVQNILAKLLATRTQSGAGGDYKSSL  675

Query  552   LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESN---KWRVIHKM  722
             L  + VQ++ ETIF HP + +SL C L C  +       D++D  LES      + ++ +
Sbjct  676   LRLE-VQDVAETIFSHPAIISSLTCSLNCPGNLM----LDAIDLNLESLVQLSRKSVNIL  730

Query  723   DLHVINLLRTTFE-LLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRTDKCIESK  899
             D H++NLL ++ E L+  CD Q S+F     R V + F   VQ+L   F+DR D   E+ 
Sbjct  731   DHHIVNLLTSSCEYLVTSCDDQDSTF-----RGVVETFNVFVQRLLSEFRDRFDIFTETM  785

Query  900   DLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSV--LRVGLHIA  1073
             DL PLLP  +A+H L  FI PF+LLELV W+F R+++     Q+S    +  L  G  IA
Sbjct  786   DLIPLLPLFFALHALNHFISPFDLLELVIWIFKRVNINGFVVQKSETTQIHGLSFGFGIA  845

Query  1074  GSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIV-LLEKILLQVYEIATHLHLDVADMC  1250
                F  ++  +  P S+R    L   M E+  D+  ++++I  +    A H   + AD C
Sbjct  846   VIAFKDVTGYLQLPLSKRLPYHLLRKMDEK--DVCNIIDEIYTKTNVCAVHYKSEFADAC  903

Query  1251  LLKAFKVVKTHKVMQ-QSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMS  1427
             LL+  K +   K M  +    + +A  RFI+N+P  L+SYC  + NK KAELLF  TE S
Sbjct  904   LLEVVKAICAKKSMLCEYFDQIHLATFRFIMNMPSELISYCFDRTNKEKAELLFFLTEAS  963

Query  1428  PLHLSIFGHLLSGMIDKQ-VHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV  1604
              LHLSIFGH +  ++DK   H+         N  + +LLMLLPT   YL+SV+ K G   
Sbjct  964   SLHLSIFGHFIVNIMDKHSCHMD--------NEMEDKLLMLLPTSLTYLNSVVAKFGKNC  1015

Query  1605  KY-FEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVL  1781
              Y F+ I S Y RIL   F  WK +VT   FD E  D++P + ++F+D+ + +LL ++V 
Sbjct  1016  WYNFKVISSVYSRIL---FRKWKIFVTNSTFDEEFGDSVPSTTQDFIDLVNNSLLGKAVG  1072

Query  1782  MVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVA  1961
             M++   AL G LV  + R+++F+ + P   +  + L F+  ++ + S  Q  NF+++ V+
Sbjct  1073  MLRHYFALNGDLVTVKKRLKVFNYIFPASCSTDEVLGFEVDELDSYSPNQVFNFLSKVVS  1132

Query  1962  KINLCRTLLFPEHNKFSSGLKEDKM--ETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFP  2135
             KI+ CR LLFPE     S  +ED+    + A   +  + SR++ L  LV  W+ IV++F 
Sbjct  1133  KISFCRVLLFPEGCGIQSLPREDESTEHSSARRSNNEESSRLQYLNTLVGIWQWIVKRFV  1192

Query  2136  MTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRF  2315
               +D   + E +N  +FR+LE+ +L NI++LS+EMHG LVKL S+PF+ +L + +  +RF
Sbjct  1193  FISD-IYEKERDNSRLFRYLELFLLNNILDLSREMHGALVKLPSIPFLEQLMRFSLLYRF  1251

Query  2316  DDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLP  2495
             +DP TL  L  I+  LS+GKF+    +QL++AHSQF   I S+   +    +     P+ 
Sbjct  1252  EDPTTLNILYSILDLLSDGKFAVDAYLQLLLAHSQFAPTIQSTPKPS--HSIETFLRPMS  1309

Query  2496  SLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGIN  2675
             S++RS VIP         K + + ++  LK+L ++KL+ +L  +K         ++  IN
Sbjct  1310  SILRSLVIPSSGQQETNFKQDSKATRTDLKRLVIVKLVHILVLMKVCHGGY--GKDDTIN  1367

Query  2676  LRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNI-SIAEWDYLWGNAVVKARKERE  2852
              RDL  LLLSSY AT+ + D  I   +N+I++I  S+  +  + D+LWGNAV+   KER 
Sbjct  1368  FRDLYALLLSSYGATVSETDSTILMTLNDIETIIGSDAKNHVQMDFLWGNAVLGVSKERL  1427

Query  2853  LVQTVSCNLS-DAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPN----GPGVVNKV  3017
             L Q  S N++ DAE  ++  + QFRENLP+DP++C STVL+FPY R           N+V
Sbjct  1428  LEQEPSSNMNNDAEAVKERHRNQFRENLPVDPRICVSTVLWFPYDRTELDEESRLKENRV  1487

Query  3018  QK--DTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASI  3191
             +   D F   +     E      YDPI++LR S H LSMGYIE +EFA LGLLAV+  S+
Sbjct  1488  KDLDDFFKGHYHGTEPER-----YDPIYVLRFSIHALSMGYIEALEFATLGLLAVAFVSL  1542

Query  3192  SSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFI  3371
             SS +D  RKLGYG L   KN +E  +++K   RL+LLL+Y+QN IEE WQ+IPS+ A F 
Sbjct  1543  SSANDKLRKLGYGTLGALKNTVENGKRRKGTTRLRLLLTYVQNGIEEPWQRIPSIIAFFA  1602

Query  3372  AEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYS  3551
             AEASF+LL+PSH HYA I+K L++S  +N KSIPLF+N LWS SV+F++ERLW+LR++Y 
Sbjct  1603  AEASFILLEPSHHHYAAISKFLVRSTRMNSKSIPLFKNFLWSTSVNFKSERLWMLRLVYV  1662

Query  3552  GLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGL  3731
             G+N DDD  +YI+NSI E L SFYVS L+DNESKELI+Q +KKS KL RMA +L+EN GL
Sbjct  1663  GINVDDDARLYIKNSIHEDLQSFYVSSLSDNESKELILQVMKKSVKLQRMAFYLVEN-GL  1721

Query  3732  ISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSC  3911
              SWL S+V++      +  K     Q A+VLEVVN +I FR+  EWLQK ALEQL E S 
Sbjct  1722  FSWLCSIVSTSSRRLTEDQKSIFTKQLALVLEVVNNVISFRNICEWLQKDALEQLMEFSS  1781

Query  3912  HLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAI-D  4088
             ++ +ILV G Q+L         ILQI+T   ++SQKRK++QPHFT S+EGLFH+ +A+  
Sbjct  1782  NIFKILVGGEQLLLIEGALVNQILQIITSVLRISQKRKIFQPHFTFSIEGLFHIYQAVHK  1841

Query  4089  VCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKC  4268
             + C    S  A +GL+ ILM+ P +++L+MD  + S F++WA+S AL+ +++ V   E  
Sbjct  1842  LDCTRLGSNSA-SGLKMILMNMPQISLLRMDPMRCSGFLSWAVSTALEFDSRMVAN-ESH  1899

Query  4269  CFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEW  4448
                ++ S EE ++ SL SKLLRWL+AS ILGK+S K   ++   S +R     L+ LLE 
Sbjct  1900  LGLISESDEEHSDESLTSKLLRWLSASAILGKVSLKFGCMNLRTS-ERLSAETLYSLLEH  1958

Query  4449  NEESDRENG-KEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVL  4625
              + +   N  +EF C+ +LAA+IFYLQQ L +SF +LP  +SALCLLL    A   +++ 
Sbjct  1959  VKNTRDHNSLQEFGCEGLLAANIFYLQQHLQSSFMVLPVVISALCLLLFD--ALISADLF  2016

Query  4626  IGNAAALC---SKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASK  4796
                 A L    SKIRCP E N AWRW+FYQPWKD+S  LT+ +K++E+HACQ L LV S 
Sbjct  2017  HSQGADLAQHLSKIRCPEEVNPAWRWTFYQPWKDYSLELTNLQKMDEVHACQTLQLVISN  2076

Query  4797  MLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             +L++  L  + +  +D+E   VFEWER+++
Sbjct  2077  ILSKKPLDLQFLLPQDIEISRVFEWERNLI  2106



>gb|KDO62642.1| hypothetical protein CISIN_1g0000571mg, partial [Citrus sinensis]
Length=2074

 Score =  1075 bits (2779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/1527 (43%), Positives = 951/1527 (62%), Gaps = 76/1527 (5%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +LL++FP+++++S  +LGVP SLL S+ FLE S L + SK WPEMFF+GLE A+S ++  
Sbjct  553   ELLKSFPLVMTISHNLLGVPASLLPSMIFLEQSFLANASKLWPEMFFSGLEIAVSTIRH-  611

Query  183   RTEEFG------------------DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDL  308
                EF                   D D+ E A+ ALS FLK+A   ++FP  +++    L
Sbjct  612   EVREFDVCRIPTHSSFDEEVLCNIDFDANESAAGALSFFLKQAPFHVIFPAIMTVGAPYL  671

Query  309   STQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVD  488
             S    + +LLL  LS+   D ++S    VLF F Q   SYR EP  EL  LSE+C  ++ 
Sbjct  672   SEPSKVQDLLLDKLSDWRSDCLISYLRLVLFCFFQIQSSYRDEPTAELLQLSEICIVLMK  731

Query  489   RMLRQFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFS  665
              +  Q L  K +     T  L L  + V E+ ET+  HP V ASL  PL C+ +      
Sbjct  732   NVFTQLLVLKPNPGHPKTVGLHLSAENVWEVAETVLCHPAVFASLSSPLSCDLESPLGNL  791

Query  666   GDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYF-CDGQTSSFEACHA--RQVTKAFK  836
             G +++ FL   + + +HK+D HV+++L  T + L+  C    +  E  +   + + KAF 
Sbjct  792   GHNLETFLSLTQ-QSVHKIDRHVLDMLTATLDHLFSSCTDHYTILEVDNGVCKSLVKAFN  850

Query  837   NVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED  1016
              +V++LFL  +D+ D CI ++D+ PLLPA YA+H L RFI P +LLELVHWMF ++D+ +
Sbjct  851   TLVRRLFLELRDKFDLCIATEDVLPLLPAFYALHALIRFISPLKLLELVHWMFRKVDVNE  910

Query  1017  NSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKIL  1196
              S  +S     L VG  IAG  F++LS  + QP  +R   +L W   E  F +  +E+I 
Sbjct  911   MSICKSCNVYALSVGFCIAGGTFEALSNYLQQPVEKRASYNLLWETEENSFGVNHIEEIY  970

Query  1197  LQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMF  1376
             ++V ++A +  L +AD CLLK    + +   MQ  +P L + +SR IV  P+ ++S+C++
Sbjct  971   IEVCKLAINFDLGLADTCLLKIVNCIYSQNYMQSVHP-LNLIMSRVIVKTPIEMISHCVY  1029

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP-SDPELLMLLP  1553
             +    KA++LFL T+MSP+HLS+FG+LL G ++K   L  + +       SD E +MLLP
Sbjct  1030  RTTMTKAKVLFLFTKMSPMHLSVFGNLLVGSLNKDSLLTGSQMWTCGYAFSDEEFMMLLP  1089

Query  1554  TVFLYLDSVLIKAGSQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSI  1730
                 YL+   +K   Q  K+   I+SFY R+LL  F +WK +V+  +F  E     P S 
Sbjct  1090  AALSYLNMNFLKFEKQYHKHLMDILSFYSRMLLSGFRNWKSFVSGYIFQEEYDGFFPSST  1149

Query  1731  EEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQV  1910
             EE +++ + +LL ++VL++    AL G  +K +  ++LF+S+ P      + LDFD ++V
Sbjct  1150  EELLNLVNGSLLGKTVLLLHYHFALNGDSLKTKKLIKLFNSIFPCSGAQNELLDFDINEV  1209

Query  1911  GTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFS-------SGLKEDKMETCAELHSTLD  2069
              + S +QSLN +NR VAK++LCR LLFPE ++          GLK   +++ ++  ++  
Sbjct  1210  KSNSFKQSLNHINRVVAKVSLCRMLLFPEDDQVQFLPKAAEGGLKGISLKSGSDDQNS--  1267

Query  2070  VSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHG  2246
              SR+R + +LV SW+ +V K P  + +  + +  N  S++++LEV ILR+I EL  +M  
Sbjct  1268  -SRMRFMNILVGSWQWMVMKLPSISKDFERNKSANVLSLYKYLEVFILRSIFELVSKMSK  1326

Query  2247  CLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFE  2426
              L++L S+PF+ +L ++  ++RF+D  TL+ LR I++ L EGKFSC   +QL++AHSQF 
Sbjct  1327  GLIELQSIPFLEQLIRSALFYRFEDSTTLKMLRSILTLLLEGKFSCGLYLQLLLAHSQFA  1386

Query  2427  TAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKL  2606
             T+I S + ++     G+   P+ S++R  VI  FN N+  + D  + ++ +  QLE++KL
Sbjct  1387  TSIQSVSAASNAGG-GVLLRPMSSILRFLVIHHFNQNADEKNDK-KTTELYQSQLEVVKL  1444

Query  2607  LRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN  2786
             L+ L Q KA     +  ++  INLR+L  LLL+SY ATL DID EI+++++EI+ I +S+
Sbjct  1445  LKTLLQFKAHPCGADFGRDSDINLRELCLLLLASYGATLSDIDMEIYDVMHEIERIENSD  1504

Query  2787  ISIAEWDYLWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
               IA+ DYLWG A  K RKE  L Q  SCN ++DAE A++ ++ QFRENL IDPK+CA T
Sbjct  1505  NEIAQLDYLWGRAAAKVRKEWILEQDTSCNIMTDAEAAKEQKRSQFRENLAIDPKICAMT  1564

Query  2964  VLYFPYGRP-NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIE  3140
             VLYFPY R  +GP   NK++ D   + HE  S ++ +   YDP+FILR + H LS+G+IE
Sbjct  1565  VLYFPYDRTTDGPSSSNKLKADNLWNTHEIHSPDLQDLQRYDPVFILRFAIHSLSVGFIE  1624

Query  3141  PVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQN  3320
             PVEFA LGLLAV+  SISSPD   RKLGY  L +FKN LEKC KKKDVMRL+LLL+Y+QN
Sbjct  1625  PVEFAGLGLLAVAFVSISSPDVGMRKLGYETLGRFKNELEKCSKKKDVMRLRLLLTYVQN  1684

Query  3321  CIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLK------------  3464
              IEE WQ+IPSV AIF AEAS +LLDPSHDHY +++K LM+S  VNLK            
Sbjct  1685  GIEEPWQRIPSVIAIFAAEASLLLLDPSHDHYTSVSKLLMRSSRVNLKVYALQILFLSLL  1744

Query  3465  ---------------------SIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHI  3581
                                  SIPLF +   S SV+FR ERLW+LR+LY+GLN DDD  +
Sbjct  1745  CILYLCTMINFVSYSLRFCWQSIPLFHDFFSSSSVNFRKERLWMLRLLYAGLNLDDDAQV  1804

Query  3582  YIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTS  3761
             YIRNS+ E L+SFY SPL+D+ESKELI+  +KKS KL +MA +L+E+CGL SWLSS+++S
Sbjct  1805  YIRNSVLEILMSFYASPLSDSESKELILLILKKSIKLHKMACYLVEHCGLFSWLSSLLSS  1864

Query  3762  FCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGA  3941
             F G+     K F  AQ  VV+EVVN++I  R+  EWLQ++ALEQL + S HL ++LV G 
Sbjct  1865  FSGMLLGGEKMFLMAQLIVVVEVVNDVISSRNINEWLQRHALEQLVDFSSHLYKLLVGGM  1924

Query  3942  QMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIA  4121
             ++++E+      IL IL  T K+SQKRK+YQPHFTLS+E  F +C+A+D+         A
Sbjct  1925  KLMRENVPLVNSILLILISTVKISQKRKMYQPHFTLSLESFFQICQAVDMYNTARSGANA  1984

Query  4122  KTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPL-NVSSEE  4298
             +  L+ ILMS+P + I +++  K+S F+ WA+S AL+S++  + ++ +    L N+  + 
Sbjct  1985  ELALKVILMSSPSIDIFRVNQVKLSSFLTWAISAALKSDSGQMYELRESHLHLRNMLEDA  2044

Query  4299  ETENSLISKLLRWLTASVILGKISYKL  4379
               E SL SKLLRWL ASVILGK+  KL
Sbjct  2045  PFEESLTSKLLRWLVASVILGKLFGKL  2071



>gb|KCW70172.1| hypothetical protein EUGRSUZ_F03461 [Eucalyptus grandis]
Length=2517

 Score =  1074 bits (2777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 622/1496 (42%), Positives = 923/1496 (62%), Gaps = 34/1496 (2%)
 Frame = +3

Query  471   CFNIVDRMLRQFLNTKGDA--SSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNA  644
             C  +++ +L Q LN+K ++  + K    LLP   VQ+ +  IF HP + ASL C L CN 
Sbjct  1025  CSTLLNHILYQLLNSKINSGFTEKDELILLP-DYVQKAVGCIFSHPALTASLTCLLGCNE  1083

Query  645   DFTDTFSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSF---EACHAR  815
                     +++ K L+ +  R + ++D H   LL T            SSF   E     
Sbjct  1084  MLAGDDVLENLFKTLDLSSKRSL-EIDSHCFGLLETVSAFFLSLVENHSSFINVETGATI  1142

Query  816   QVTKAFKNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMF  995
             Q+ K F  +V +L + FK+  + CI++++  PLLP  +A++TL R I PFE+L+LV ++F
Sbjct  1143  QLVKGFDTLVHRLLVEFKNELNLCIQTQNFRPLLPTYHALNTLNRLISPFEVLKLVWFVF  1202

Query  996   SRIDLEDNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDI  1175
             + +D+++ +  +S R S++ +G   A + F+SL   + Q   +R   DL W   ++ F+ 
Sbjct  1203  NIVDMKNTTISESCRKSIVYIGCRFAANAFESLGIYLQQQTKKRSQYDLLWRTRDQHFNA  1262

Query  1176  VLLEKILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPV  1352
              ++E I L+V E+++    DVAD+CLLKA       K +Q  N   L   + R IV+ P 
Sbjct  1263  DIIEDIYLKVIELSSLYETDVADICLLKAITAACRLKSVQHLNVHPLSSVLLRVIVSTPA  1322

Query  1353  NLLSYCMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQ-TNAIRETSNPSD  1529
              ++SYC+  ++  +A++LFL T++SPLHLSIFG +LSG++  + +L+  N  R  SN   
Sbjct  1323  QMVSYCISGMSMMRAKVLFLLTQLSPLHLSIFGCMLSGVLTPEGNLKYKNHCRGLSNE--  1380

Query  1530  PELLMLLPTVFLYLDSVLIKAGSQVKY-FEKIVSFYWRILLHIFSDWKCYVTRDMFDIES  1706
                LMLLPT   +++S+ ++ G Q  + F  I  FY  ILL+ F +WK +V++ +F  E 
Sbjct  1381  -HFLMLLPTALSFMNSIFLRYGKQCYWNFRYIPLFYSSILLNGFREWKSFVSKSVFR-EG  1438

Query  1707  FDNLPLS-IEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVD  1883
             +    +S  +E ++    + L ++V M+     L    +  + +MELFDSV P   +  D
Sbjct  1439  YSEFTISSADELLNFVKNSSLGKAVHMLHYHFVLDADSLNIKKQMELFDSVFPDSESRND  1498

Query  1884  FLDFDPSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHN---KFSSGLKEDKMETCAEL  2054
              L  D   + + S+E+ LN +N  +AKI LCR LLFP  N     ++   E   E    +
Sbjct  1499  LLGCDLRDLNSHSVEEILNLINGALAKILLCRMLLFPSDNHSLSLTNEAPEYSNENSQAI  1558

Query  2055  HSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSK  2234
              + L+ SR+R L +LV+SW +I ++F + + +  +   E  S++++ E L+L +I EL  
Sbjct  1559  KAGLEPSRMRFLCILVNSWEQIAKRFRLDSSSEKEENRECESLYKYFEELMLGSIFELIM  1618

Query  2235  EMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAH  2414
             EM   LV+L  +PF+ +L +T+  +RF+DP+TL  LR+I++ L + +FSC   +QL++AH
Sbjct  1619  EMQDYLVQLKVIPFMRQLIRTSLLYRFEDPITLNLLRNILTLLCKEQFSCAPYLQLLLAH  1678

Query  2415  SQFETAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLE  2594
             SQF + + S    +   QLG    P+ S++RS  +P  +  S   K + + +K  +K+LE
Sbjct  1679  SQFTSILHSVPELSHSLQLGAFLRPMSSILRSVAVPRISRVSHINKKDGESNKHSVKRLE  1738

Query  2595  LIKLLRVL--FQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIK  2768
             +++LLR L  F      ++I+   E GIN + L  L+L SY ATL + D E+ +L+ EI 
Sbjct  1739  VLQLLRTLIHFSFNGCGMEIDLGNEDGINFQQLHSLILYSYGATLGEGDLELFSLLQEID  1798

Query  2769  SISDSN-ISIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDP  2945
                 S  + + + +YLWG A +K  K  +L Q VS  +      ++ R++QFRENLPIDP
Sbjct  1799  CSGGSELVKLTDTNYLWGKAALKVMKVWDLEQKVSSEVMTDTETDEYRRLQFRENLPIDP  1858

Query  2946  KMCASTVLYFPYGRPNGP--GVVNKVQ-KDTFDSMHEDCSAEVANRHIYDPIFILRLSFH  3116
             K+CA TVL FPY R         NKVQ  ++ D +H      V  +  YDP+F+L+ S H
Sbjct  1859  KLCALTVLDFPYDRAAHEELSFSNKVQINNSKDVIH---IPAVERKQRYDPVFVLQFSLH  1915

Query  3117  CLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQ  3296
              L +G+IEPVEFA LGLLAV+ + +SSPDD  RKL Y  L  FK ALEKCQKKKD+++L+
Sbjct  1916  ILPIGFIEPVEFAGLGLLAVAFSCLSSPDDGIRKLAYQTLASFKIALEKCQKKKDIVQLR  1975

Query  3297  LLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPL  3476
             LLL+Y+QN IEE WQ+IPS+ AIF AEAS +LL+ S+DHY T++K LM S  +N+KS+PL
Sbjct  1976  LLLNYVQNGIEEPWQRIPSIIAIFAAEASIILLNSSNDHYPTLSKLLMHSSRINMKSVPL  2035

Query  3477  FQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKE  3656
             F   LWS SV+FR ER WILR++Y GL  DDD  +++RNSIFE LLS Y S  +DNESKE
Sbjct  2036  FHEFLWSSSVNFRAERTWILRLVYVGLGIDDDAPVFMRNSIFENLLSLYASSFSDNESKE  2095

Query  3657  LIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVN  3836
             LI+Q VKKS +L +MA HL+E+CGL SWLSS +     +     KGF F Q  V+LEV++
Sbjct  2096  LILQIVKKSVRLRKMACHLVEHCGLFSWLSSALPHINEMLSGDEKGFYFDQLVVILEVIS  2155

Query  3837  EIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQ  4016
              II  R+  EWLQK+ALEQLSELS HL + L + A+++ E++    LILQIL  T K+SQ
Sbjct  2156  NIISSRNITEWLQKHALEQLSELSSHLFKFLSDKAELMSENALVIDLILQILVTTLKISQ  2215

Query  4017  KRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVS  4196
             KRK++QPHFTL++EGLF + EA+ +C +    P ++ GL +ILM+ PP +I+ MD +K+ 
Sbjct  2216  KRKIFQPHFTLAIEGLFQIYEAVKLCDSTQAFPCSEVGLRSILMNAPPPSIIDMDEEKLL  2275

Query  4197  KFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEET-ENSLISKLLRWLTASVILGKISY  4373
              F+ WA+S+AL++++  +    +    L + SEEE  E+SL SKLLRWL ASVI GK+S 
Sbjct  2276  HFVLWAISVALKADSNEIPHPRESHVCLTILSEEEIREDSLASKLLRWLVASVIHGKLSD  2335

Query  4374  KLSKLDSSHSCDRSKLINLHCLLEWNEESDR-ENGKEFACQEILAASIFYLQQLLGTSFK  4550
             + +  D+ +S +RS    L+ LL++ +E+ R  +G      + LAA+I YLQQLLG   +
Sbjct  2336  RSTYTDARYS-ERSDPKMLNSLLQFVKETSRGRHGNTSGTGKALAAAILYLQQLLGMDCR  2394

Query  4551  LLPSAVSALCLLLLK--NPASSGSEVLIGNA--AALCSKIRCPAEANSAWRWSFYQPWKD  4718
             +LPS VSALCLLL    + A + S++L+     A+  +KI  P EAN AWRWSF+QPWKD
Sbjct  2395  VLPSVVSALCLLLYDFCDVAVTESDLLLNGTPVASQLAKISSPLEANPAWRWSFHQPWKD  2454

Query  4719  HSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
              +S  TD E+++E H CQ LLL+ S  L   S     IS +DVE+ GV+EWERSI+
Sbjct  2455  LTSERTDLERLDERHPCQTLLLIISSTLRTGSSNPLAISPQDVERCGVYEWERSIV  2510



>ref|XP_004149328.1| PREDICTED: uncharacterized protein LOC101215477 [Cucumis sativus]
Length=2446

 Score =  1071 bits (2769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 662/1592 (42%), Positives = 965/1592 (61%), Gaps = 72/1592 (5%)
 Frame = +3

Query  201   DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERTPDHIVS  380
             + D +E +S   S FLK+    +LFP  +  + S+      + + LL  LSE T DH++ 
Sbjct  883   EFDKIEASSLGFSTFLKKTPFHVLFPAIMCTHHSNSLVLLKIQDFLLLKLSELTFDHLLL  942

Query  381   SFLYVL-FWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGD--ASSKCTRSL  551
              +L ++ FW  Q  ISYR +PL ELE LS++C  +V  +L + L T+    A      SL
Sbjct  943   PYLQLVLFWMYQIRISYRFKPLVELEKLSQICIVLVQNILAKLLATRTQSVAVGDYKGSL  1002

Query  552   LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESN---KWRVIHKM  722
             L  + VQ++ ETIF HP V +SL C L C  +       D++D  LES      + ++ +
Sbjct  1003  LRLE-VQDVAETIFSHPAVISSLSCSLNCPGNLV----FDAIDLNLESLVQLSRKSVNIL  1057

Query  723   DLHVINLLRTTFE-LLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRTDKCIESK  899
             D H++NLL T+ E L+  CD Q S+F     R V + F   +Q+L   F+DR D   E+ 
Sbjct  1058  DHHIVNLLTTSCEYLITSCDDQDSTF-----RGVVETFNVFIQRLLSEFRDRFDIFTETM  1112

Query  900   DLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSV--LRVGLHIA  1073
             D  PLLP  +A+H+L  FIFPF+LLELV W+  R++      Q+S    +  L  G  IA
Sbjct  1113  DPIPLLPLFFALHSLNHFIFPFDLLELVIWILKRVNTNGFVVQKSEMTQIHGLSFGFGIA  1172

Query  1074  GSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIV-LLEKILLQVYEIATHLHLDVADMC  1250
                F  ++  +  P S+R    L   M E+  D+  ++++I  +    A H   + AD C
Sbjct  1173  VIAFKDVTGYLQLPLSKRLPYHLLRKMDEK--DVCNIIDEIYTKTNVFAVHYKSEFADAC  1230

Query  1251  LLKAFKVVKTHKVMQ-QSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMS  1427
             LL+  K +   K M  +    + +A  R I+N+P  L+SYC  + NK KA+LLF  TE S
Sbjct  1231  LLEVVKAICAKKSMLCEYFDQIHLATFRSIMNMPSELISYCFDRTNKEKAKLLFFLTEAS  1290

Query  1428  PLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQVK  1607
              LHLSIFGH +  ++D+         R   N  + +LL+LLP+   YL+SV+ K G +  
Sbjct  1291  SLHLSIFGHSIVDIMDRHS-------RHMDNEMEDKLLILLPSSLTYLNSVVAKFGKKCC  1343

Query  1608  YFEKIVS-FYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLM  1784
             Y  K++S  Y RIL   F  WK +VT   FD E  D +P +  +F+D+ + +LL ++V M
Sbjct  1344  YNSKVISSAYSRIL---FRKWKIFVTNSTFDEEFGDLIPSTTRDFIDLVNNSLLGKAVGM  1400

Query  1785  VQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAK  1964
             ++ C AL G LV  + R+++F+ + P   +  + L F+  ++ + S  Q  NF+++ V+K
Sbjct  1401  LRHCFALNGDLVTVKMRLKVFNYIFPASCSTDEVLGFEVDELDSYSPNQVFNFLSKVVSK  1460

Query  1965  INLCRTLLFPEHNKFSS--GLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPM  2138
             I+ CR LLFPE     S  G  E   ++ A   +  + SR++ L  LV  W+ IV++F  
Sbjct  1461  ISFCRVLLFPEGCGIQSFSGEDESTEQSSARRSNNEESSRLQYLNTLVGIWQWIVKRFAF  1520

Query  2139  TADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFD  2318
              +D   + E+    +FR+LE+ +L NI+ELS EMHG LVK  S+PF+ +L + +  +RF+
Sbjct  1521  ISD-IYEKEMGKSRLFRYLELFLLNNILELSTEMHGALVKQPSIPFLEQLMRFSLLYRFE  1579

Query  2319  DPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPS  2498
             DP T+  L  I+  LS+GKF+    +QL++AHSQF   I S+   +    +     P+ S
Sbjct  1580  DPTTVNILYSILDLLSDGKFAVDAYLQLLLAHSQFAPTIQSTPKPS--HSIETFLRPMSS  1637

Query  2499  LMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINL  2678
             ++RS VIP  +      K + + ++  LK+L ++KL+ +L  +K         ++  IN 
Sbjct  1638  ILRSLVIPSSSQRETNFKQDSKATQTDLKRLVIVKLVHILVLMKVCHGGY--GKDDTINF  1695

Query  2679  RDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNI-SIAEWDYLWGNAVVKARKEREL  2855
             R+L  LLLSSY AT+ + D  I   +N+I++I  S+  +  + D+LWGNAV+   KER L
Sbjct  1696  RELYALLLSSYGATVSETDSTILMTLNDIETIIGSDAKNQVQMDFLWGNAVLGVSKERLL  1755

Query  2856  VQTVSCNLS-DAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQK---  3023
              Q  S N+S DAE  ++  + QFRENLP+DP++C STVL+FPY R       ++++K   
Sbjct  1756  EQEPSSNISNDAEAVKERHRNQFRENLPVDPRICVSTVLWFPYDRTESDEE-SRLKKYRV  1814

Query  3024  ----DTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASI  3191
                 D F   +     E      YDPI++LR S H LSMGYIE +EFA LGLLAV+  S+
Sbjct  1815  KDLDDLFKGHYHGTEPER-----YDPIYVLRFSIHALSMGYIEALEFATLGLLAVAFVSL  1869

Query  3192  SSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFI  3371
             SS +D  RKLGYG L   KN +E  +++K   RL+LLL+Y+QN IEE WQ+IPS+ A+F 
Sbjct  1870  SSANDKLRKLGYGTLGALKNTVENGKRRKGTTRLRLLLTYVQNGIEEPWQRIPSIIALFA  1929

Query  3372  AEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYS  3551
             AEASF+LL+PSH HYA I+K L++S  +N KSIPLF+N LWS SV+F++ERLW+LR++Y 
Sbjct  1930  AEASFILLEPSHHHYAAISKFLVRSTRLNSKSIPLFKNFLWSSSVNFKSERLWMLRLVYV  1989

Query  3552  GLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGL  3731
             G+N DDD  +YI+NSI E L SFYVS L+DNESKELI+Q +KKS KL RMA +L+EN GL
Sbjct  1990  GINVDDDARLYIKNSIHEDLQSFYVSSLSDNESKELILQVMKKSVKLQRMAFYLVEN-GL  2048

Query  3732  ISWLSSVV-TSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELS  3908
              SWL S++ TS   +  D    FP  Q A+VLEVVN +I FR+  EWLQK ALEQL E S
Sbjct  2049  FSWLCSIISTSSRRLTEDQKSIFP-KQLALVLEVVNNVISFRNICEWLQKDALEQLMEFS  2107

Query  3909  CHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAI-  4085
              ++ +ILV G Q+L         ILQI+T   ++SQKRK++QPHFT S+EGLFH+ +A+ 
Sbjct  2108  SNIFKILVGGEQLLLIEGALVNQILQIITSVLRISQKRKIFQPHFTFSIEGLFHIYQAVH  2167

Query  4086  DVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEK  4265
              + C    S  A +GL+ ILM+ P +++L+MD K+ S F++WA+S AL+ +++ + + E 
Sbjct  2168  KLDCTRLGSNSA-SGLKMILMNMPQISLLRMDPKRCSGFLSWAVSTALEFDSRMIAK-ES  2225

Query  4266  CCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLIN-LHCLL  4442
                 ++ S EE  + SL SKLLRWL+AS ILGK+S    K D  H     +L   L+ LL
Sbjct  2226  HLGLISESDEEHFDESLTSKLLRWLSASAILGKVSL---KFDCMHLRTSERLSGTLYSLL  2282

Query  4443  EWNEESDRENG-KEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSE  4619
             E  + +  +N  +EF C+ +LAA+IFYLQQ L +SF +LP  +SALCLLL    A   ++
Sbjct  2283  EHVKNTRDDNSLQEFGCEGLLAANIFYLQQHLQSSFMVLPVVISALCLLLFD--ALISAD  2340

Query  4620  VLIGNAAALC---SKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVA  4790
             +     A L    SKIRCP E N AWRW+FYQPWKD+S  LT+ +K++E+HACQ L LV 
Sbjct  2341  LFHSEGADLAQHLSKIRCPEEVNPAWRWTFYQPWKDYSLELTNLQKMDEVHACQTLQLVI  2400

Query  4791  SKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             S +L++  L  +++  +D+E   VFEWER+++
Sbjct  2401  SNILSKKPLDLQVLLPQDIEISRVFEWERNLI  2432



>ref|XP_009763146.1| PREDICTED: uncharacterized protein LOC104215098 isoform X3 [Nicotiana 
sylvestris]
Length=1675

 Score =  1065 bits (2754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/1090 (53%), Positives = 771/1090 (71%), Gaps = 14/1090 (1%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM + F EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  575   EIIQNFPLIMSVSNKLLGVPLSLLMQLCFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  634

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S   S+FL  A   +LFP  L I   DLS Q GL NLL+A L E T
Sbjct  635   RTMDCSVISSMDNKSNTFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLLMAKLYEET  694

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++ S  T
Sbjct  695   SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCSLDT  754

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+++F+ES K  V  KM
Sbjct  755   FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIMDSVNQFVESAKLEV-SKM  813

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC GQ SS E  HA + V  +FKNVV KL +TFK + ++C++S
Sbjct  814   DHHVHNLLKATSELWLSFCHGQGSSSEVYHANKHVISSFKNVVNKLVMTFKQKMNECMKS  873

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  874   KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  930

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M Q H + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVADMCLL
Sbjct  931   SAFSHLAANMQQTHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADMCLL  989

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I +RKAE+LFL  ++SPLH
Sbjct  990   KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITQRKAEILFLVADISPLH  1049

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ELLMLLPTV LYL+S+  K G Q+    
Sbjct  1050  LSVFGKLFSDMMNKYVAVKSCAVQQICGFSDEELLMLLPTVILYLNSIPSKFGGQLCMLH  1109

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+VQL
Sbjct  1110  ENIVSFYWGILKQAFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVVQL  1167

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + R+ +F+SVC  + +  D L FD +Q G  S+E+SLN VNRTVAKI L
Sbjct  1168  FFELRGDLVNVKKRLSIFNSVCSSEYS--DLLGFDLTQDGAYSVEESLNVVNRTVAKIRL  1225

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV +W+ IV++  +   + 
Sbjct  1226  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQTWQLIVKRCSVNVVDF  1285

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+E+ +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DPMTL
Sbjct  1286  SQIEIGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPMTL  1345

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS++S G S  GL FTPLPS+MRS+
Sbjct  1346  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIQSSHISAGHSHFGLIFTPLPSIMRSY  1405

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1406  V-PCIDQDALDLKDNFKLSEECARQLELVKLLKLLFQIRAQQSDIDNVKDIGINLRELVF  1464

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  +D EI++L++EIKS +D    S+A+ D+LWG+A++K RKE +LVQT+S
Sbjct  1465  LLLSSYGASMSAVDLEIYSLMDEIKSTNDLDEGSMAKLDFLWGSALLKVRKENKLVQTIS  1524

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +DCR+I FREN+PIDPK+CA+TVLYFPY R  G G++ K + D  D  +  
Sbjct  1525  HNLSEAEAVDDCRRIHFRENIPIDPKVCATTVLYFPYDRTVGAGILRKPETDNPDVRYAV  1584

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1585  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  1644

Query  3231  VLEKFKNALE  3260
             VL +FK+ALE
Sbjct  1645  VLGRFKSALE  1654



>ref|XP_009763145.1| PREDICTED: uncharacterized protein LOC104215098 isoform X2 [Nicotiana 
sylvestris]
Length=2041

 Score =  1064 bits (2752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/1090 (53%), Positives = 771/1090 (71%), Gaps = 14/1090 (1%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM + F EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  941   EIIQNFPLIMSVSNKLLGVPLSLLMQLCFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  1000

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S   S+FL  A   +LFP  L I   DLS Q GL NLL+A L E T
Sbjct  1001  RTMDCSVISSMDNKSNTFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLLMAKLYEET  1060

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++ S  T
Sbjct  1061  SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCSLDT  1120

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+++F+ES K  V  KM
Sbjct  1121  FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIMDSVNQFVESAKLEV-SKM  1179

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC GQ SS E  HA + V  +FKNVV KL +TFK + ++C++S
Sbjct  1180  DHHVHNLLKATSELWLSFCHGQGSSSEVYHANKHVISSFKNVVNKLVMTFKQKMNECMKS  1239

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  1240  KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  1296

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M Q H + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVADMCLL
Sbjct  1297  SAFSHLAANMQQTHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADMCLL  1355

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I +RKAE+LFL  ++SPLH
Sbjct  1356  KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITQRKAEILFLVADISPLH  1415

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ELLMLLPTV LYL+S+  K G Q+    
Sbjct  1416  LSVFGKLFSDMMNKYVAVKSCAVQQICGFSDEELLMLLPTVILYLNSIPSKFGGQLCMLH  1475

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+VQL
Sbjct  1476  ENIVSFYWGILKQAFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVVQL  1533

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + R+ +F+SVC  + +  D L FD +Q G  S+E+SLN VNRTVAKI L
Sbjct  1534  FFELRGDLVNVKKRLSIFNSVCSSEYS--DLLGFDLTQDGAYSVEESLNVVNRTVAKIRL  1591

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV +W+ IV++  +   + 
Sbjct  1592  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQTWQLIVKRCSVNVVDF  1651

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+E+ +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DPMTL
Sbjct  1652  SQIEIGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPMTL  1711

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS++S G S  GL FTPLPS+MRS+
Sbjct  1712  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIQSSHISAGHSHFGLIFTPLPSIMRSY  1771

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1772  V-PCIDQDALDLKDNFKLSEECARQLELVKLLKLLFQIRAQQSDIDNVKDIGINLRELVF  1830

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  +D EI++L++EIKS +D    S+A+ D+LWG+A++K RKE +LVQT+S
Sbjct  1831  LLLSSYGASMSAVDLEIYSLMDEIKSTNDLDEGSMAKLDFLWGSALLKVRKENKLVQTIS  1890

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +DCR+I FREN+PIDPK+CA+TVLYFPY R  G G++ K + D  D  +  
Sbjct  1891  HNLSEAEAVDDCRRIHFRENIPIDPKVCATTVLYFPYDRTVGAGILRKPETDNPDVRYAV  1950

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1951  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  2010

Query  3231  VLEKFKNALE  3260
             VL +FK+ALE
Sbjct  2011  VLGRFKSALE  2020



>ref|XP_009763144.1| PREDICTED: uncharacterized protein LOC104215098 isoform X1 [Nicotiana 
sylvestris]
Length=2044

 Score =  1064 bits (2752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/1090 (53%), Positives = 771/1090 (71%), Gaps = 14/1090 (1%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +++QNFP+I+SVS K+LGVP SLLM + F EPSLL D SK W E+FFTGL+ A++GL  G
Sbjct  944   EIIQNFPLIMSVSNKLLGVPLSLLMQLCFSEPSLLNDASKRWREIFFTGLDRAVTGLSGG  1003

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
             RT +   I SM+  S   S+FL  A   +LFP  L I   DLS Q GL NLL+A L E T
Sbjct  1004  RTMDCSVISSMDNKSNTFSVFLDRAPFYILFPAILDIDGLDLSNQSGLQNLLMAKLYEET  1063

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              DH++S F Y+LFW NQA +SYR E  E  E LSE CF ++ RML++ +  K ++ S  T
Sbjct  1064  SDHLLSIFRYLLFWLNQAQLSYRNEHFEGFEKLSEACFLLLSRMLKELVVEKFNSCSLDT  1123

Query  543   RSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKM  722
              +      V+EL+ TI  HP VAA LECP P  +DF      DS+++F+ES K  V  KM
Sbjct  1124  FTPFTIHFVKELVVTILDHPAVAAVLECPSPVKSDFACGIIMDSVNQFVESAKLEV-SKM  1182

Query  723   DLHVINLLRTTFEL-LYFCDGQTSSFEACHA-RQVTKAFKNVVQKLFLTFKDRTDKCIES  896
             D HV NLL+ T EL L FC GQ SS E  HA + V  +FKNVV KL +TFK + ++C++S
Sbjct  1183  DHHVHNLLKATSELWLSFCHGQGSSSEVYHANKHVISSFKNVVNKLVMTFKQKMNECMKS  1242

Query  897   KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAG  1076
             K++ PL+P + A+H L  FI PFE+LELVHWM S ID ED S   +   SVL VGLHIAG
Sbjct  1243  KNVIPLVPTLCALHNLIHFISPFEMLELVHWMLSAIDHEDRSVWLT---SVLCVGLHIAG  1299

Query  1077  SVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLL  1256
             S F  L+A M Q H + P   LFWG+ +EQFD++L EKI  QVYEIAT   LDVADMCLL
Sbjct  1300  SAFSHLAANMQQTHEKMPFC-LFWGIQQEQFDVILYEKIFSQVYEIATRFELDVADMCLL  1358

Query  1257  KAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLH  1436
             KA KVVKTHK +Q+ +   +    R + N  VN+LS+CM +I +RKAE+LFL  ++SPLH
Sbjct  1359  KAVKVVKTHKAIQKPSHPFLKITCRAVANTHVNILSHCMLKITQRKAEILFLVADISPLH  1418

Query  1437  LSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV-KYF  1613
             LS+FG L S M++K V +++ A+++    SD ELLMLLPTV LYL+S+  K G Q+    
Sbjct  1419  LSVFGKLFSDMMNKYVAVKSCAVQQICGFSDEELLMLLPTVILYLNSIPSKFGGQLCMLH  1478

Query  1614  EKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQL  1793
             E IVSFYW IL   FS WK YV+R++F +E  +NL  S+E+ +++ S +LL+ +VL+VQL
Sbjct  1479  ENIVSFYWGILKQAFSIWKSYVSREIFQVECCENL--SMEDSLNLISGSLLTNTVLVVQL  1536

Query  1794  CSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINL  1973
                L G LV  + R+ +F+SVC  + +  D L FD +Q G  S+E+SLN VNRTVAKI L
Sbjct  1537  FFELRGDLVNVKKRLSIFNSVCSSEYS--DLLGFDLTQDGAYSVEESLNVVNRTVAKIRL  1594

Query  1974  CRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
             CR LLF E  KF S LK D     +E  S LD++RIRLL +LV +W+ IV++  +   + 
Sbjct  1595  CRALLFSEKRKFPSVLKRDTELIPSEDCSILDLARIRLLNLLVQTWQLIVKRCSVNVVDF  1654

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              Q+E+ +CS+FR+LEV ILRN++E++ EMH CL+ L SLPFI +LAK++  HRF DPMTL
Sbjct  1655  SQIEIGSCSLFRYLEVYILRNLMEITMEMHDCLLNLASLPFIEQLAKSSLLHRFYDPMTL  1714

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
             + LR IISS+SEGKFSC+ IIQL++AHSQF   I SS++S G S  GL FTPLPS+MRS+
Sbjct  1715  RMLRAIISSVSEGKFSCISIIQLLLAHSQFAATIQSSHISAGHSHFGLIFTPLPSIMRSY  1774

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             V P  + +++  KDN ++S++  +QLEL+KLL++LFQ++A+Q DI+  ++IGINLR+LVF
Sbjct  1775  V-PCIDQDALDLKDNFKLSEECARQLELVKLLKLLFQIRAQQSDIDNVKDIGINLRELVF  1833

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISD-SNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY A++  +D EI++L++EIKS +D    S+A+ D+LWG+A++K RKE +LVQT+S
Sbjct  1834  LLLSSYGASMSAVDLEIYSLMDEIKSTNDLDEGSMAKLDFLWGSALLKVRKENKLVQTIS  1893

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NLS+AE  +DCR+I FREN+PIDPK+CA+TVLYFPY R  G G++ K + D  D  +  
Sbjct  1894  HNLSEAEAVDDCRRIHFRENIPIDPKVCATTVLYFPYDRTVGAGILRKPETDNPDVRYAV  1953

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                +V    +YDPIFILR S HCLSMG+IEP+EFA+LGLLA+S  SISSPDDD RKLGY 
Sbjct  1954  HYTDVEKICVYDPIFILRFSVHCLSMGFIEPLEFASLGLLAISAVSISSPDDDMRKLGYE  2013

Query  3231  VLEKFKNALE  3260
             VL +FK+ALE
Sbjct  2014  VLGRFKSALE  2023



>ref|XP_004500064.1| PREDICTED: uncharacterized protein LOC101510812 [Cicer arietinum]
Length=2565

 Score =  1062 bits (2746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/1667 (40%), Positives = 962/1667 (58%), Gaps = 95/1667 (6%)
 Frame = +3

Query  15    NFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGL----QEG  182
             N P  + +S+ +LGVPFSL+ SIFFL+ S+L+  SK WP MF+ GL++AIS L    Q  
Sbjct  949   NLPSSLVISRDLLGVPFSLMSSIFFLDYSVLVHASKMWPVMFYAGLDTAISNLGSDSQNA  1008

Query  183   RTEEFGDI-------------DSMEFASAALSLFLKEASLCMLFPITLSI---YKSDLST  314
                E  D+             D+ E  + A S+ LK+    ++FP  + +   Y S  S 
Sbjct  1009  APIETSDLTLCPDSLTCSQLLDASEADATAFSILLKQTPFHVIFPAMMCMNVPYSSKFSK  1068

Query  315   QQGLHNLLLANLSERTPD-HIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDR  491
              Q    LL+  L E   D  ++ S   VLFW +Q  +S++V P  E+E L  LC  +V  
Sbjct  1069  MQ---ELLIHKLCESINDCSLLPSLHLVLFWTHQIQLSHKVIPSAEIEPLLNLCVILVQN  1125

Query  492   MLRQFL--NTKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFS  665
             +L + L   +  D S K +     +  +QE+I+ IF HP V  SL   L  + + ++  +
Sbjct  1126  LLAKLLVPESGSDTSIKDSAFSSSSHYIQEVIKAIFCHPSVLMSLSFSLGNSPNISNGNT  1185

Query  666   GDSMD--KFLESNKWRVIHKMDLHVINL-LRTTFEL--LYFCDGQTSSFEACHARQVTKA  830
             G S D    + S  ++      L+++ + L   + L  L+ C  +        A    K 
Sbjct  1186  GTSFDILNVISSEGFKKFGNPILNILTMALDNMWSLFGLHLCGSKAQDV----ANNFLKI  1241

Query  831   FKNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDL  1010
             FK + QKLFL  KDR + CI +KD+ PLLP ++A+HTL+RF+ PF+LLELV WMF R+ +
Sbjct  1242  FKGLQQKLFLDVKDRFELCIGTKDMVPLLPTLHALHTLRRFLSPFQLLELVDWMFKRVGM  1301

Query  1011  EDNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEK  1190
             +D       + S + VG  +A   F++LS    Q    R   DLFW M E      + E 
Sbjct  1302  DD----LPTKISFVSVGCSLAAVAFNTLSIYFQQSSGNRVPYDLFWEMGENNVQADIFEH  1357

Query  1191  ILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSY  1367
             I  +V E +    +D AD CL +A   +   K MQQ     L++ + + I+  PV +LS 
Sbjct  1358  IYGKVVEFSLKFEIDCADSCLHEAVNALYNQKTMQQETFHPLLLVMWKIIMITPVKMLSL  1417

Query  1368  CMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETS-NPSDPELLM  1544
             C++++N +KA+ L +  E+S LH SIFGHL  G++++ +H     I +     S+ + ++
Sbjct  1418  CLYKLNAKKAKFLHILIELSSLHSSIFGHLFLGIVNRSLHHDVGVIGDFDITLSEDQFML  1477

Query  1545  LLPTVFLYLDSVLIKAGS-QVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLP  1721
             LLP    YL  +  + G    + F++I  FY +ILL  FS WK ++++D+F+ E   ++P
Sbjct  1478  LLPASLSYLRLIFKRFGYLNHEDFKQIPHFYSKILLKGFSQWKSFLSQDIFEEEYVASVP  1537

Query  1722  LSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDP  1901
              S++E + + +C+LL +S+ M+Q   AL G  +K + R+ LF S+CP+ ++  + +D D 
Sbjct  1538  SSVQELLSLINCSLLGKSIHMLQYHFALNGDSLKLKKRLNLFKSICPKSASHDELMDCDS  1597

Query  1902  SQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRI  2081
               + + SL QSLN +NR VAKI+LC+ LLF  H +    LKE  M+      S L+ SRI
Sbjct  1598  QFIDSYSLGQSLNIINRVVAKISLCKMLLF--HKEAGGDLKEVAMDR----RSKLEASRI  1651

Query  2082  RLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSV-FRFLEVLILRNIVELSKEMHGCLVK  2258
               + +LV  W+ IV+KF +T+D S   +  + S+ +  LEV +L NI+EL+ EM   L++
Sbjct  1652  HYMNVLVDIWQLIVQKFSLTSDQSGTGKSTDISLLYNHLEVFVLTNILELAVEMQNDLIQ  1711

Query  2259  LDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAIC  2438
               S+ F+ +L ++   +RF D MT++ L+ I++ L+EG  S    +QL++AHSQF   + 
Sbjct  1712  SQSIAFLEQLIRSALLYRFSDSMTMKTLQVIVTRLNEGGLSYDLYLQLLLAHSQFAPTLH  1771

Query  2439  SSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVL  2618
             S     G         P+ S+++  VIP  +H     K     +K     LE++KLL +L
Sbjct  1772  SVRRPAGS-----FLKPVSSILKCLVIPSLDHFEHDGKQKDPTTKFSKGPLEIVKLLWIL  1826

Query  2619  FQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIA  2798
                KA Q  ++   EIGINL++L  LL  SY ATL ++D  I+N++ +I+S++ S     
Sbjct  1827  LWSKAHQTGLDSQNEIGINLKELHALLHHSYGATLSEVDLAIYNVMKQIESVTGS-----  1881

Query  2799  EWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFP  2978
                                 Q V  N   +E  E+  + Q R+N PIDP +C STVLYFP
Sbjct  1882  ------------------CPQNVELN---SEAIEEWTRSQQRDNFPIDPDICVSTVLYFP  1920

Query  2979  YGRPNGPGV--VNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEF  3152
             Y R     V  VNK++ D           EV  R  YDP+FIL+ S H LS  YIEPVEF
Sbjct  1921  YDRSISEEVPSVNKIETDNVRKKIHSSHVEVRER--YDPVFILQFSIHGLSKAYIEPVEF  1978

Query  3153  ANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEE  3332
             A  GLLA++  S+SS D   R+L YG L+KFKNALEKCQK+KDVM L+LLL+ +QN IEE
Sbjct  1979  AGSGLLAIAFVSMSSHDHGIRRLAYGTLDKFKNALEKCQKRKDVMGLRLLLNSVQNSIEE  2038

Query  3333  DWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSF  3512
              WQ+IPSV A+F AEAS VLLD SHDHYA I+  L+QS  +N+K+IPLF N +WS S++F
Sbjct  2039  PWQRIPSVIALFAAEASCVLLDSSHDHYAAISTFLIQSSKLNMKAIPLFDNFIWSSSINF  2098

Query  3513  RTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKL  3692
             + ER W+LR++Y+GLN+DDD  IYIR+S+ E+L+SFYVSPL+D  SK+LII+ +KKS K+
Sbjct  2099  KAERSWMLRLVYAGLNSDDDAMIYIRSSVLESLMSFYVSPLSDVVSKDLIIEVIKKSIKV  2158

Query  3693  SRMARHLIENCGLISWLSSV--VTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVE  3866
              +MARHL+++C L SWLSS+  V    G+  D  + F      VVL+VVN++I   +  +
Sbjct  2159  QKMARHLVKHCSLFSWLSSLISVNRRVGLNGDENRFF-LKHVLVVLKVVNDVISSGNMSK  2217

Query  3867  WLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFT  4046
             WLQ + LEQL+ELS +L   ++    M  E        L+++    K SQKRK+ QP F+
Sbjct  2218  WLQNHGLEQLTELSSNLFSFVLHDVTMADETVGLVNPFLEMIAWVLKFSQKRKICQPRFS  2277

Query  4047  LSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIA  4226
             LS+EGL+ + +A  VC     S   +  LEAILM+ PP +I  MD +++  FI WA++ A
Sbjct  2278  LSIEGLYQIYQAGSVCNQATKSINPELALEAILMNAPPNSIFLMDPERLHNFIIWAITTA  2337

Query  4227  LQSETKGVLQV-EKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHS  4403
             L SE+   L+  E      N   EE  ++SL+SK LRWLTASVI+GK+  K SK   S  
Sbjct  2338  LASESSQRLRSNESRIIVKNNLGEEYHDDSLVSKFLRWLTASVIVGKLHQK-SKDMYSRF  2396

Query  4404  CDRSKLINLHCLLEWNEE-SDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALC  4580
              + +KL +LH LL   E  S+R        +E+LA++IFYLQ L G + +LLPS VSALC
Sbjct  2397  AETNKLESLHSLLVHVENTSERGLDINIGSEELLASTIFYLQLLPGINQELLPSVVSALC  2456

Query  4581  LLLLKN---PASSGSEVLIGNA--AALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSE  4745
              L       P      +   N   ++ CS++RCP EAN  WRWSFYQP KDHS  LT +E
Sbjct  2457  FLTFGASNLPVERTDLLQSYNTFFSSNCSRVRCPPEANPEWRWSFYQPKKDHSLELTGTE  2516

Query  4746  KIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
              +EE H+C  LL+V + +L    L S  +S  DVE   + +WERS+L
Sbjct  2517  NMEEYHSCLNLLVVVANVLGGKKLESARLSPLDVEISSLIQWERSLL  2563



>emb|CAN83957.1| hypothetical protein VITISV_039906 [Vitis vinifera]
Length=2715

 Score =  1056 bits (2730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/1349 (46%), Positives = 863/1349 (64%), Gaps = 48/1349 (4%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGL---  173
             D+L+NFP +++VS+ + GVPF+LL SI F + SLL   SK WP++FF+GL+    GL   
Sbjct  960   DILKNFPSVITVSQDLQGVPFALLSSISFHDRSLLARASKLWPDIFFSGLQRV--GLMIH  1017

Query  174   QEGRTEEFGDIDSM----------------EFASAALSLFLKEASLCMLFPITLSIYKSD  305
              +G+ ++   I S                 E AS A SLFL++A   +LFP  ++I    
Sbjct  1018  SKGKGDDNCRIPSHSLSAEEIFPKTDFGLSESASVAFSLFLQQAPFHVLFPAIMNIDGPY  1077

Query  306   LSTQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIV  485
             L     +  LLLA LSE+T D+++ S  +VLFW +Q    YR+ PL ELE L E+CF +V
Sbjct  1078  LLEPSKVQQLLLAKLSEQTTDYLILSLRHVLFWIHQIQSYYRIRPLGELEHLFEVCFILV  1137

Query  486   DRMLRQFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTF  662
             +RML + L  + D  S C+ ++ +P   VQE+ E IF HP V  SL CPL C+ + T   
Sbjct  1138  ERMLDELLVLRPD--SDCSTTIGVPFSTVQEVAEIIFCHPAVMVSLSCPLSCHEELTKGT  1195

Query  663   SGDSMDKFLESNKWRVIHKMDLHVINLLRTTFE-LLYFCDGQT--SSFEACHARQVTKAF  833
              GDS++ FL S+K  V HKMD HV+NLL +T + L+  CDGQ   S  +    +Q+ K F
Sbjct  1196  IGDSLETFLRSSKHSV-HKMDHHVLNLLISTSDYLVALCDGQNPISKVDDSAKKQLVKVF  1254

Query  834   KNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLE  1013
             K ++Q+L L  + R D CI +K+  P L A YA H L  FI PF+L EL +WMFSR+DL 
Sbjct  1255  KALLQRLLLELRSRFDVCIRTKNFVPFLQAFYASHILSHFISPFKLFELAYWMFSRVDLN  1314

Query  1014  DNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKI  1193
             D +  +    S L V   IA   FD LS+    P +++   DLFW M E+ FDI++ EKI
Sbjct  1315  DLTTGEFDNMSALSVVFCIASGAFDMLSSYFQHPITKKVQFDLFWEMEEKSFDIIVFEKI  1374

Query  1194  LLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAI--SRFIVNIPVNLLSY  1367
               +  E AT   L+ AD+CLLKA KV+   K  Q  +  L +++  SR IV+ PV  +S+
Sbjct  1375  YKKALEFATCFKLEFADVCLLKAVKVMYRQKFEQHQSFLLPLSLVSSRVIVSTPVKXISH  1434

Query  1368  CMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLML  1547
             C+ + +  +A+LLFL  E+SPLH S+FGHL SG+++K +  + N +     PSD   +ML
Sbjct  1435  CINRPSMIRAKLLFLLIEVSPLHSSVFGHLFSGLLNKGLPHKDNVVE---TPSDEGFMML  1491

Query  1548  LPTVFLYLDSVLIKAGSQVKY-FEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPL  1724
             LP    YL S  +K G Q    F+ I S Y RILL  F DWK +V+R +F IE  + LP 
Sbjct  1492  LPAALSYLKSTSLKFGKQYYTCFKGIPSLYSRILLDGFLDWKGFVSRSIFQIEDGEFLPS  1551

Query  1725  SIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPS  1904
             S E+  ++ + +LL +S+ M+    A +G+ +K + R +LFD + P  S     LD D S
Sbjct  1552  STEDLSNLVNSSLLGKSIHMLWFYFAFSGHSMKKKKRFKLFDVIFPC-SGQDGMLDCDVS  1610

Query  1905  QVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKM---ETCAELH-STLDV  2072
             ++ + SL QSLNFVNR VAKI+LCR LLFP   +  S  KE      +T  E+  +  D 
Sbjct  1611  EIDSYSLNQSLNFVNRVVAKISLCRMLLFPGDCQVKSLSKESDGPVEDTPLEMGLNREDS  1670

Query  2073  SRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGC  2249
             SRIRL+ +LV++W+KIVE+F   +DNS ++   +C  +F+FLEV ILRN++EL++EMH  
Sbjct  1671  SRIRLINILVNTWQKIVERFSCVSDNSGKVTDTDCLPLFKFLEVFILRNVLELAREMHNS  1730

Query  2250  LVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFET  2429
             L++L SLPF+ KL + +  HRF+D  TL+ LR +++SLSEGKFS V ++QL++AHSQF  
Sbjct  1731  LIQLHSLPFLEKLTRLSLLHRFEDATTLKMLRSVLTSLSEGKFSHVLLLQLLLAHSQFAP  1790

Query  2430  AICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLL  2609
              I S + S G SQ+G+   P+ S++RS      +  +I   +N + S   +KQLE+IKLL
Sbjct  1791  TIQSVSKSPGCSQVGVFSKPMSSILRSLTFTCTDQGTIDGNNNFERSDLCVKQLEVIKLL  1850

Query  2610  RVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISD-SN  2786
             R+L   K      +  + I IN R+L+ LLLSSY A   ++D EI++L++EI+S     +
Sbjct  1851  RLLLCFKGHWDXSDLEKNIDINARELISLLLSSYGAMXNEVDLEIYSLMHEIESNDRLKS  1910

Query  2787  ISIAEWDYLWGNAVVKARKER-ELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
              SIA+ DYLWG++ ++ RKER + ++  + N+ DAE  E+ ++ QFRENLPIDPK+C +T
Sbjct  1911  GSIADMDYLWGSSALRIRKERVQELEISANNIXDAEAVEERQRSQFRENLPIDPKLCVNT  1970

Query  2964  VLYFPYGR--PNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYI  3137
             VLYFPY R   +GP  +NKV  D    M +     V N   YDP+FIL  S H LSM YI
Sbjct  1971  VLYFPYNRTASDGPISLNKVHPDNVKDMIQGYPPHVENVPRYDPVFILHFSIHSLSMRYI  2030

Query  3138  EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQ  3317
             EPVEF+ LGLLAV+  S+SSPDD  RKLGY  L +FKNALE CQK+KDVM+L+LLL+Y+Q
Sbjct  2031  EPVEFSALGLLAVAFVSLSSPDDMIRKLGYETLGRFKNALEMCQKRKDVMQLRLLLTYMQ  2090

Query  3318  NCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWS  3497
             N IEE WQ+IPSVTAIF AEASF+LLDPSH+HY+TI+K LM+S  VN+K IPLF N +WS
Sbjct  2091  NGIEEPWQRIPSVTAIFAAEASFILLDPSHEHYSTISKLLMRSTGVNMKCIPLFNNFIWS  2150

Query  3498  DSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVK  3677
              S++F++ERLWILR+ Y+GLN +DD  IYIRNSI ET+LSFY SP +DNESKELI+Q VK
Sbjct  2151  SSINFKSERLWILRLSYAGLNLEDDAQIYIRNSILETILSFYASPFSDNESKELILQIVK  2210

Query  3678  KSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVN---EIIF  3848
             KS KL +MAR+L+E+CGLISWLSS ++ F        + F   Q  +V E +     +  
Sbjct  2211  KSVKLHKMARYLVEHCGLISWLSSALSFFSERLSGDQRSFWLKQLTIVTEPLTWACVVAP  2270

Query  3849  FRHTVEWLQKYALEQLSELSCHLCQILVE  3935
             F H  + +    + +L++L  HL  +L+E
Sbjct  2271  FTHMAQGMFGVGMSKLNKL-LHLHWVLME  2298


 Score =   242 bits (617),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 140/295 (47%), Positives = 198/295 (67%), Gaps = 4/295 (1%)
 Frame = +3

Query  3825  EVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTW  4004
             +V+N +I  R+ + WLQK ALEQLSE++ HL ++L+   Q++K++ T    ILQIL  T 
Sbjct  2418  KVINNVISSRNIIGWLQKDALEQLSEVALHLYKLLIGAVQLMKDNVTLVNSILQILISTL  2477

Query  4005  KVSQKRKVYQPHFTLSVEGLFHLCEA-IDVCCNGCYSPIAKTGLEAILMSTPPVAILQMD  4181
             K SQKRK+YQP FT+S+EGLF + +A +DV      SP ++ GL+ ILMS+PP+ I QM 
Sbjct  2478  KFSQKRKIYQPRFTISIEGLFKIYQAVVDVSSVPRSSPASEFGLKVILMSSPPLNIFQMK  2537

Query  4182  CKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEE-TENSLISKLLRWLTASVIL  4358
              +++S+F+ W +S ALQ E  G LQ+ +      V SEEE +++SL+SKLLRWLTASVIL
Sbjct  2538  QEELSEFVGWTISTALQPECTGTLQLAESYLHFRVFSEEEPSQDSLLSKLLRWLTASVIL  2597

Query  4359  GKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKE-FACQEILAASIFYLQQLL  4535
             G +S+K + LD  +  +RS    L  LLE  ++   ENG+  F C+EILAASIFYLQQLL
Sbjct  2598  GMLSWKSTDLD-INILERSNSKTLLSLLEHVKKGSGENGRNAFHCEEILAASIFYLQQLL  2656

Query  4536  GTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNAAALCSKIRCPAEANSAWRWSF  4700
             G + ++LPS VSALCLLLL + ++S    +I  + A    +   ++A  A  WS+
Sbjct  2657  GLNSRVLPSVVSALCLLLLSDASNSAVPRIICYSDAQLLLLGECSKAQFATGWSY  2711



>ref|XP_004163080.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224336 
[Cucumis sativus]
Length=2375

 Score =  1051 bits (2717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/1527 (42%), Positives = 931/1527 (61%), Gaps = 71/1527 (5%)
 Frame = +3

Query  393   VLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGD--ASSKCTRSLLPTKC  566
             VLFW  Q  ISYR +PL ELE LS++C  +V  +L + L T+    A      SLL  + 
Sbjct  877   VLFWMYQIRISYRFKPLVELEKLSQICIVLVQNILAKLLATRTQSVAVGDYKGSLLRLE-  935

Query  567   VQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESN---KWRVIHKMDLHVI  737
             VQ++ ETIF HP V +SL C L C  +       D++D  LES      + ++ +D H++
Sbjct  936   VQDVAETIFSHPAVISSLSCSLNCPGNLV----FDAIDLNLESLVQLSRKSVNILDHHIV  991

Query  738   NLLRTTFE-LLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRTDKCIESKDLTPL  914
             NLL T+ E L+  CD Q S+F     R V + F   +Q+L   F+DR D   E+ D  PL
Sbjct  992   NLLTTSCEYLITSCDDQDSTF-----RGVVETFNVFIQRLLSEFRDRFDIFTETMDPIPL  1046

Query  915   LPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSV--LRVGLHIAGSVFD  1088
             LP  +A+H+L  FIFPF+LLELV W+  R++      Q+S    +  L  G  IA   F 
Sbjct  1047  LPLFFALHSLNHFIFPFDLLELVIWILKRVNTNGFVVQKSEMTQIHGLSFGFGIAVIAFK  1106

Query  1089  SLSACMWQPHSERPLSDLFWGMLEEQFDIV-LLEKILLQVYEIATHLHLDVADMCLLKAF  1265
              ++  +  P S+R    L   M E+  D+  ++++I  +    A H   + AD CLL+  
Sbjct  1107  DVTGYLQLPLSKRLPYHLLRKMDEK--DVCNIIDEIYTKTNVFAVHYKSEFADACLLEVV  1164

Query  1266  KVVKTHKVMQ-QSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLHLS  1442
             K +   K M  +    + +A  R I+N+P  L+SYC  + NK KA+LLF   E S LHLS
Sbjct  1165  KAICAKKSMLCEYFDQIHLATFRSIMNMPSELISYCFDRTNKEKAKLLFFLXEASSLHLS  1224

Query  1443  IFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQVKYFEKI  1622
             IFGH +  ++D+         R   N  + +LL+LLP+   YL+SV+ K G +  Y  K+
Sbjct  1225  IFGHSIVDIMDRHS-------RHMDNEMEDKLLILLPSSLTYLNSVVAKFGKKCCYNSKV  1277

Query  1623  VS-FYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQLCS  1799
             +S  Y RIL   F  WK +VT   FD E  D +P +  +F+D+ + +LL ++V M++ C 
Sbjct  1278  ISSAYSRIL---FRKWKIFVTNSTFDEEFGDLIPSTTRDFIDLVNNSLLGKAVGMLRHCF  1334

Query  1800  ALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINLCR  1979
             AL G LV  + R+++F+ + P   +  + L F+  ++ + S  Q  NF+++ V+KI+ CR
Sbjct  1335  ALNGDLVTVKMRLKVFNYIFPASCSTDEVLGFEVDELDSYSPNQVFNFLSKVVSKISFCR  1394

Query  1980  TLLFPEHNKFSS--GLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS  2153
              LLFPE     S  G  E   ++ A   +  + SR++ L  LV  W+ IV++F   +D  
Sbjct  1395  VLLFPEGCGIQSFSGEDESTEQSSARRSNNEESSRLQYLNTLVGIWQWIVKRFAFISD-I  1453

Query  2154  CQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTL  2333
              + E+    +FR+LE+ +L NI+ELS EMHG LVK  S+PF+ +L + +  +RF+DP T+
Sbjct  1454  YEKEMGKSRLFRYLELFLLNNILELSTEMHGALVKQPSIPFLEQLMRFSLLYRFEDPTTV  1513

Query  2334  QKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSF  2513
               L  I+  LS+GKF+    +QL++AHSQF   I S+   +    +     P+ S++RS 
Sbjct  1514  NILYSILDLLSDGKFAVDAYLQLLLAHSQFAPTIQSTPKPS--HSIETFLRPMSSILRSL  1571

Query  2514  VIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
             VIP  +      K + + ++  LK+L ++KL+ +L  +K         ++  IN R+L  
Sbjct  1572  VIPSSSQRETNFKQDSKATQTDLKRLVIVKLVHILVLMKVCHGGY--GKDDTINFRELYA  1629

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNI-SIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLLSSY AT+ + D  I   +N+I++I  S+  +  + D+LWGNAV+   KER L Q  S
Sbjct  1630  LLLSSYGATVSETDSTILMTLNDIETIIGSDAKNQVQMDFLWGNAVLGVSKERLLEQEPS  1689

Query  2871  CNLS-DAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQK-------D  3026
              N+S DAE  ++  + QFRENLP+DP++C STVL+FPY R       ++++K       D
Sbjct  1690  SNISNDAEAVKERHRNQFRENLPVDPRICVSTVLWFPYDRTESDEE-SRLKKYRVKDLDD  1748

Query  3027  TFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDD  3206
              F   +     E      YDPI++LR S H LSMGYIE +EFA LGLLAV+  S+SS +D
Sbjct  1749  LFKGHYHGTEPER-----YDPIYVLRFSIHALSMGYIEALEFATLGLLAVAFVSLSSAND  1803

Query  3207  DTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASF  3386
               RKLGYG L   KN +E  +++K   RL+LLL+Y+QN IEE WQ+IPS+ A+F AEASF
Sbjct  1804  KLRKLGYGTLGALKNTVENGKRRKGTTRLRLLLTYVQNGIEEPWQRIPSIIALFAAEASF  1863

Query  3387  VLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTD  3566
             +LL+PSH HYA I+K L++S  +N KSIPLF+N LWS SV+F++ERLW+LR++Y G+N D
Sbjct  1864  ILLEPSHHHYAAISKFLVRSTRLNSKSIPLFKNFLWSSSVNFKSERLWMLRLVYVGINVD  1923

Query  3567  DDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLS  3746
             DD  +YI+NSI E L SFYVS L+DNESKELI+Q +KKS KL RMA +L+EN GL SWL 
Sbjct  1924  DDARLYIKNSIHEDLQSFYVSSLSDNESKELILQVMKKSVKLQRMAFYLVEN-GLFSWLC  1982

Query  3747  SVV-TSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQ  3923
             S++ TS   +  D    FP  Q A+VLEVVN +I FR+  EWLQK ALEQL E S ++ +
Sbjct  1983  SIISTSSRRLTEDQKSIFP-KQLALVLEVVNNVISFRNICEWLQKDALEQLMEFSSNIFK  2041

Query  3924  ILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAI-DVCCN  4100
             ILV G Q+L         ILQI+T   ++SQKRK++QPHFT S+EGLFH+ +A+  + C 
Sbjct  2042  ILVGGEQLLLIEGALVNQILQIITSVLRISQKRKIFQPHFTFSIEGLFHIYQAVHKLDCT  2101

Query  4101  GCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPL  4280
                S  A +GL+ ILM+ P +++L+MD K+ S F++WA+S AL+ +++ + + E     +
Sbjct  2102  RLGSNSA-SGLKMILMNMPQISLLRMDPKRCSGFLSWAVSTALEFDSRMIAK-ESHLGLI  2159

Query  4281  NVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLIN-LHCLLEWNEE  4457
             + S EE  + SL SKLLRWL+AS ILGK+S    K D  H     +L   L+ LLE  + 
Sbjct  2160  SESDEEHFDESLTSKLLRWLSASAILGKVSL---KFDCMHLRTSERLSGTLYSLLEHVKN  2216

Query  4458  SDRENG-KEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGN  4634
             +  +N  +EF C+ +LAA+IFYLQQ L +SF +LP  +SALCLLL    A   +++    
Sbjct  2217  TRDDNSLQEFGCEGLLAANIFYLQQHLQSSFMVLPVVISALCLLLFD--ALISADLFHSE  2274

Query  4635  AAALC---SKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLA  4805
              A L    SKIRCP E N AWRW+FYQPWKD+S  LT+ +K++E+HACQ L LV S +L+
Sbjct  2275  GADLAQHLSKIRCPEEVNPAWRWTFYQPWKDYSLELTNLQKMDEVHACQTLQLVISNILS  2334

Query  4806  RNSLYSKLISLKDVEKLGVFEWERSIL  4886
             +  L  +++  +D+E   VFEWER+++
Sbjct  2335  KKPLDLQVLLPQDIEISRVFEWERNLI  2361



>ref|XP_010267868.1| PREDICTED: uncharacterized protein LOC104604974, partial [Nelumbo 
nucifera]
Length=2413

 Score =  1037 bits (2682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/1435 (43%), Positives = 885/1435 (62%), Gaps = 57/1435 (4%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLE---------  155
             ++++NFP ++ + +   GVP S L S+FFLE  LL +V+  WP +  +GLE         
Sbjct  991   NIVENFPSVIVILQH-FGVPQSFLSSMFFLERDLLANVADVWPHILLSGLEMVRAMMGSN  1049

Query  156   ---------SAISGLQEGRTE-EFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSD  305
                      S I+ +  G       D DS+E ASAA S FLK+    MLFP  L+I  S 
Sbjct  1050  YKDDNTYLTSDITNVSSGEGLLSCVDFDSIESASAAFSSFLKDVPFYMLFPAILTIGNSC  1109

Query  306   LSTQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIV  485
                   + +LLL+  SE + D   +S   +LFW +Q  +SYR+ PL ELE L   CF ++
Sbjct  1110  FLDMTRMQDLLLSKFSEESSDGSFASLRLLLFWVHQIQLSYRIRPLGELEKLFGTCFVLI  1169

Query  486   DRMLRQFLNTKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFS  665
               +L + L    D     T + +P     E++ETIF HP V A L  PL CN +  D   
Sbjct  1170  KHLLTRLLLVNPDIDGLETMTYIP-----EIVETIFKHPAVTAFLSLPLCCNEELRDGSF  1224

Query  666   GDSMDKFLESNKWRVIHKMDLHVINLLRTTFE-LLYFCDGQTSSFEACHA--RQVTKAFK  836
             GDS++ F+ S+K RV H +D H++++L    E LL  C    S  E  +    Q+ K+F 
Sbjct  1225  GDSLEAFMSSSKHRV-HPLDHHILDILTIVSEYLLNSCSSYNSMPEVNYTAKEQLIKSFN  1283

Query  837   NVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED  1016
              + Q+L L FK++ D CI  KD  PL+P  Y  H L  F+ PFELLELV W+F  +D  D
Sbjct  1284  ALAQQLVLVFKEKFDLCIGIKDFMPLVPTFYVFHALSHFMCPFELLELVEWIFCEVDQND  1343

Query  1017  NSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKIL  1196
              +  +  + + L +GL+IA   F  LS+   + ++      LF  + E    I LLEKI 
Sbjct  1344  FTDCKDSKVAALSLGLYIADGAFVMLSSSADRLNTNMLTFHLFSEIDEGASKICLLEKIY  1403

Query  1197  LQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTL--VMAISRFIVNIPVNLLSYC  1370
              +V E+AT   LD A +CLLKA  VV     ++     L   MAISR I+  P+ +LS+C
Sbjct  1404  SKVVELATCSELDCAYLCLLKAVNVVYKQNYIKPQAALLPISMAISRMILGSPMKMLSHC  1463

Query  1371  MFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP--SDPELLM  1544
             +++++  KA+LLF+ TE+SPLHLS+FG +   +++K + +  + +R + N   SD E +M
Sbjct  1464  IYEMSSTKAKLLFVLTEVSPLHLSLFGEMFLHLLNKDLPVNGD-MRVSCNYTLSDEEFVM  1522

Query  1545  LLPTVFLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPL  1724
             LLP VF YL+S+  +   Q ++FE I+S Y +ILL  FS+WK YV+ D+F  E +  LP 
Sbjct  1523  LLPVVFSYLNSIRFRNQYQ-EHFECILSLYSKILLVRFSNWKSYVSGDIFQ-EEYGELPT  1580

Query  1725  SIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPS  1904
             S E+F+ + + +LL ++V M++   +++   ++ + R++LFD++CP+   C DFLDFD +
Sbjct  1581  STEKFLKLVNSSLLGKAVQMLKYYFSISKDSMRLKKRLKLFDAICPRSGACGDFLDFDFT  1640

Query  1905  QVGTCSLEQSLNFVNRTVAKINLCRTLLFP---EHNKFSSGLKEDKMETCAELHSTL-DV  2072
             ++   SLEQ LNF+N+ V K++  + LLFP   +H   ++    D  E    + S   D 
Sbjct  1641  EINMSSLEQVLNFINKVVGKVSFSKLLLFPWEYQHQAVATETDGDPKEMPLGVGSNREDF  1700

Query  2073  SRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCS-VFRFLEVLILRNIVELSKEMHGC  2249
              R+R + +LV+SW KIV +FP+ AD+S + E  NC+ +FR LE  +L +IVELSK+M   
Sbjct  1701  ERLRFMNILVNSWHKIVNQFPIVADDSEKSENTNCTKLFRHLESFVLGSIVELSKQMQNS  1760

Query  2250  LVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFET  2429
             L+KL S+PF+    ++T  HRF DP T++ L  ++S LSEGKFS      L++AHSQF +
Sbjct  1761  LIKLHSIPFLKHFIRSTLLHRFQDPTTMEALHIVLSLLSEGKFSFGMAFNLLLAHSQFVS  1820

Query  2430  AICSSNL---STGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQ---HLKQL  2591
              I  S+    S+G+S  G+   P+ S++R+FV    +H S    D    S     + K+L
Sbjct  1821  TILWSDSISESSGLSHAGILLRPISSILRTFV----SHTSESAIDGKSSSGACDLYKKKL  1876

Query  2592  ELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKS  2771
              +IKLLRVL+ +K    +    +++G+N ++L+ LLLS Y ATL ++D EI NL+ EI+S
Sbjct  1877  GVIKLLRVLYHLKGHNHNSHSGKDVGMNSKELLSLLLSCYGATLSEVDLEIFNLMLEIES  1936

Query  2772  ISDSNI-SIAEWDYLWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDP  2945
                S   SIAE DYLWG + +K R+E+ L + +S N + D E  E+ R+ QFREN+PI+P
Sbjct  1937  TEGSECGSIAEMDYLWGCSALKLRREQVLEKVLSSNNIVDCETVEERRRRQFRENIPINP  1996

Query  2946  KMCASTVLYFPYGRP--NGPGVVNKVQKDTFDSMHEDCSAEVANR-HIYDPIFILRLSFH  3116
             K+C +TVL+FPY R   N    V K QKD    M E   +    R   YDP FILR S H
Sbjct  1997  KLCVTTVLHFPYDRVVYNAATPVEKSQKDINVHMIEKTPSTSLERIQRYDPAFILRFSIH  2056

Query  3117  CLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQ  3296
              LSMGY+EP EFA LGLLA++  SISSPD+  RKLGY VL +FK+ALE C+ +K+ +R +
Sbjct  2057  GLSMGYVEPSEFAGLGLLAIAFLSISSPDEGIRKLGYEVLARFKSALEVCRNRKEGLRFR  2116

Query  3297  LLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPL  3476
             LLL+YLQN I+E WQ+IPS+TAIF AEAS +LLDPSHDHY TITK LM+SP VNLK +PL
Sbjct  2117  LLLTYLQNGIDEPWQRIPSITAIFSAEASLILLDPSHDHYPTITKLLMRSPRVNLKCVPL  2176

Query  3477  FQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKE  3656
             F     S SVSF+T+RLWILR+ Y+GLN D D  I+IR  + E LL FY S  +D +S+ 
Sbjct  2177  FNTFFGSTSVSFKTDRLWILRLSYAGLNLDLDAQIFIRKLLLEILLGFYFSSFSDYDSQI  2236

Query  3657  LIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVN  3836
             LI++ +KKS KL  +AR+L+E+CGLISWLSS ++      +   K     Q  +V+EVV 
Sbjct  2237  LILEILKKSVKLHILARYLVEHCGLISWLSSALSVSSERLHGDEKNIFLRQITIVVEVVK  2296

Query  3837  EIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQ  4016
             ++I FR+ +EWLQKYA EQLSELS HL ++L+ G +++K++      IL I+  T ++SQ
Sbjct  2297  DVISFRNIIEWLQKYAFEQLSELSSHLHKLLIIGLELIKQNVPLVNSILHIVFSTLRISQ  2356

Query  4017  KRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYS-PIAKTGLEAILMSTPPVAILQM  4178
             KR++YQPHFTLSVEGLF L +AID   +   S P  +  L+AILMSTPP AIL M
Sbjct  2357  KRRIYQPHFTLSVEGLFQLYQAIDDGFSNMRSGPNTELLLKAILMSTPPTAILHM  2411



>ref|XP_010675692.1| PREDICTED: uncharacterized protein LOC104891665 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=2553

 Score =  1028 bits (2657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/1664 (39%), Positives = 969/1664 (58%), Gaps = 106/1664 (6%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             D++ N P +++VS K+ G+  S+ M  FFL+ +L+  VSK WP+MF++GL  ++    + 
Sbjct  957   DIVYNLPSVMAVSGKLAGLNCSV-MDYFFLDQNLMRCVSKLWPDMFYSGLRMSVRACSQV  1015

Query  183   RTEEFGDI---------DSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNL  335
               +   D          +  E  S      LKEA   +LFP  +        +   +  L
Sbjct  1016  TQDNDKDTSVKALHSNTEETEHTSIVFGSLLKEAPFYVLFPAIIFCVPE---SHSEIKEL  1072

Query  336   LLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNT  515
             L+A +S    + +VSS   VLFWF+Q   SYR +P E+ E+ SELCF +V  +L      
Sbjct  1073  LVAKVSNLDIEQLVSSVRLVLFWFHQIQTSYRKKPTEQQELHSELCFFLVKHILSLLPTL  1132

Query  516   K---GDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKF  686
             K   G +++    SL  ++C+QE+ +T+F HP VAASL  P   + + T+ F  DS +  
Sbjct  1133  KFVSGSSANNAAFSL--SQCLQEVAKTVFCHPAVAASLSSPFARDYEITEEFLRDSSEGL  1190

Query  687   LESNKWRVIHKMDLHVINLLRTTFE-LLYFCDGQ--TSSFEACHARQVTKAFKNVVQKLF  857
             L       + K +LHV+ LL  T + LL  C  +  +S +  C    + KAF N+VQ++F
Sbjct  1191  LHPCG-EGMRKTELHVLKLLTATSDYLLALCSEKLLSSVYTECK-EYIVKAFGNLVQQIF  1248

Query  858   LTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSL  1037
             L FK R +    S ++T L P +  + +L RFI P ELL L +WMFS ++L ++   +  
Sbjct  1249  LIFKSRFELWCTSGNMT-LFPILCGLVSLMRFISPIELLGLANWMFSVVELPNSKIPKIS  1307

Query  1038  RDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIA  1217
               S L +   IA      LS  M  P+    L+DLFW       D  L E I L+ ++ A
Sbjct  1308  NVSPLYMAFSIACGALSMLSQHMQSPNVTVVLTDLFWANEMRTLDATLFESIYLKAFKFA  1367

Query  1218  THLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKA  1397
             T   +D+AD CLLKA     +    Q   P   M I+R I+  PV ++S+C+ + +  KA
Sbjct  1368  TCFKIDLADTCLLKALTAANSLIHRQDCLP-FSMEITRVIIRTPVRIVSHCLNRTDNTKA  1426

Query  1398  ELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPS--DPELLMLLPTVFLYL  1571
             ++LF   E+S LH S+FG L SG++ +      N+  +  N    D E LMLLP   LY+
Sbjct  1427  KILFRMMEISALHSSVFGQLFSGILGEDTIPTINSPEQICNQLLLDEECLMLLPAAALYV  1486

Query  1572  D----SVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEF  1739
                  ++L K    +K+   +++ Y R+LL  F +W  +V+R +F +E  + LP S+E  
Sbjct  1487  SFSWTNLLEKPSRNIKF---MLTSYSRLLLDGFLNWNDFVSRTVFLVEYGNVLPCSVENL  1543

Query  1740  MDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTC  1919
              D+F+ +LL ++V M+Q   A +G   +   R++L  S+ P      DF+DFD  ++ + 
Sbjct  1544  NDLFNSSLLRKAVQMLQWYFASSGD--RKNKRLKLLCSLYPVSGASHDFMDFDVRKIDSY  1601

Query  1920  SLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKML  2099
             S+ Q  + +NR VAK++LC  LLFPE NK S+    D ++  +   S  + S +R L ML
Sbjct  1602  SVRQLTDLINRVVAKVSLCFVLLFPEGNKCSANEAPD-IQGESFGGSNSEDSSLRFLDML  1660

Query  2100  VSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFI  2279
             V  W+ +V+K P +A+N+  ++     + R LE+  LR I +L  +    L K+DSLPFI
Sbjct  1661  VGIWQLVVKKIP-SANNNSDLKTPIFLLLRSLEMFTLRCIYKLIMKTRSILTKMDSLPFI  1719

Query  2280  VKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTG  2459
               +AK +  HRF DP+TL  LR ++S LS      + ++QL+V HSQ  + + +      
Sbjct  1720  ENMAKVSLLHRFGDPITLNNLRHVLSCLSGANLPVILLLQLLVGHSQLASTVGTVTDPFA  1779

Query  2460  ISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQ  2639
                 G+   P+ S +RS V+P          +NL+ S+ +  +LE++KLLR+LF +KA +
Sbjct  1780  FGSSGMVVKPISSFLRSSVVP-------TESNNLETSETYKSKLEVVKLLRLLFHLKATR  1832

Query  2640  VDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISI-AEWDYLW  2816
              D+    ++G+NLRDL FLLL++Y AT+ +ID EI++L++EI+S   +  +I AE DYLW
Sbjct  1833  CDMVFDDDLGLNLRDLSFLLLTTYGATVSEIDLEIYSLLSEIESAGGAGDNIIAEHDYLW  1892

Query  2817  GNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRP--  2990
             G++ ++  K       V  ++SDAE  EDCR+ QFR+NLPI+PK    TVLYFPYGR   
Sbjct  1893  GSSALRVGKG----IAVKKDISDAE--EDCRRNQFRDNLPINPKFVMQTVLYFPYGRTMC  1946

Query  2991  NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLL  3170
                  ++ V +DT +   E                      HC  +G IE          
Sbjct  1947  EKSLFMDDVHRDTVNITEEG---------------------HCTELGRIE----------  1975

Query  3171  AVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIP  3350
                   + SP+D  RKL Y V+ +FK+AL +CQ+K++V RL+LLL+YLQN I+E+W+KIP
Sbjct  1976  -----RMGSPEDGIRKLAYEVVWRFKDALMRCQRKREVTRLKLLLTYLQNGIKEEWEKIP  2030

Query  3351  SVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLW  3530
             ++ A F+AEAS +LLDPSH+HY  I+K LMQSP +NLKSIPLF +  WS+SV+FRT+R+W
Sbjct  2031  TILAAFVAEASVILLDPSHEHYPAISKFLMQSPWINLKSIPLFHDFFWSNSVTFRTDRMW  2090

Query  3531  ILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARH  3710
             +LR+LY+G+N +DD  +YIRNS+ E LLSFYVSPL+D +SKELI+  VKK  K+ +MA +
Sbjct  2091  MLRLLYAGINIEDDAVVYIRNSVLEILLSFYVSPLSDIDSKELILLVVKKCVKVQKMACY  2150

Query  3711  LIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALE  3890
             L+ENC LISWLSSV+ +      D    F   Q  VVLEVV+E +  +  +EWL K+A+E
Sbjct  2151  LVENCCLISWLSSVL-ALSMTHIDSKDTFFSKQLLVVLEVVHEAVALKGIMEWLHKHAIE  2209

Query  3891  QLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFH  4070
             QLS+L+CHL  +L   ++++ E  +   LIL++      +SQ+R + QP   LS+  L+H
Sbjct  2210  QLSDLTCHLLNLLARCSKLVLETKSLVILILKVTVAL--MSQERNMPQPPLALSMRSLYH  2267

Query  4071  LCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGV  4250
             + +A+DV   G +   A+ GL+AIL + PP  I  +D +++S+F+ WA+S A+Q +++  
Sbjct  2268  VYQAVDVQDGGKFGDCAERGLKAILANAPPTTISDLDLEELSRFLMWAVSTAVQLDSRQA  2327

Query  4251  LQVEKCCFPLNVSSEEE---TENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKL  4421
             LQ  +   PL   +E E    E SLIS LLRWL ASV+L + SY  S  +SS     +  
Sbjct  2328  LQRTQ-VLPLIQCTENEEHMQEESLISTLLRWLVASVVLCRGSYCNSVFNSSFVLREANE  2386

Query  4422  INLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNP  4601
               L  L+E  E    ++       +ILAA+IF+LQQL+G   +LLPS V+AL +LLL++ 
Sbjct  2387  ETLLSLIEHRESIGGDSKLLSGSGKILAATIFHLQQLVGMKCQLLPSVVAALSVLLLRDG  2446

Query  4602  ASSGSEVLIGNA---------AALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIE  4754
             + +    L G+A         ++L SKI CP E N +WRWSFYQPW DH++  TD EKI+
Sbjct  2447  SYATEGDLSGHATCINLRNSVSSLWSKIYCPPEVNPSWRWSFYQPWADHATERTDLEKID  2506

Query  4755  EIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             E HACQ LL++ S +L +N+  ++L+SL+++E  G+FE ER+ L
Sbjct  2507  ESHACQKLLVIISGVLRKNASDNELLSLQELESSGLFERERTNL  2550



>gb|KHN13336.1| Nucleolar pre-ribosomal-associated protein 1 [Glycine soja]
Length=2463

 Score =  1022 bits (2643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/1666 (39%), Positives = 950/1666 (57%), Gaps = 93/1666 (6%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQ-EG  182
             +L N P    +   ++GVPFSLL+S+ FL+ S+L   SK WP MF+ GL+ A+S L  +G
Sbjct  850   ILTNMPSHAVIPHDLVGVPFSLLLSVLFLDYSVLHHASKLWPAMFYAGLDMAMSDLGIDG  909

Query  183   RTEE-FGD---------------IDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLST  314
             R     G                +D+ E  +   S+FLK+    ++FP  + +    +S 
Sbjct  910   RNAAPVGTSDLALHPDSLTCSQLLDASEVDAVTFSIFLKQVPFHVIFPAMMCMSGPYISK  969

Query  315   QQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRM  494
                +   LL  LSE     ++ +   +LFW ++    Y V P+ E+E L  LC  +V  +
Sbjct  970   LSKIQEFLLHKLSESNDSSLLPNLRLILFWTHRIQSCYDVNPIAEIEQLLNLCVILVGSL  1029

Query  495   LRQFLNTKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDS  674
             L Q L  +         +   ++   ++I+TIF HP V  SL   L    +  +   G+ 
Sbjct  1030  LAQLLVPESGYDWSINSAFYSSRRNIQVIKTIFCHPCVLISLSFSLGSCQNLAN---GNV  1086

Query  675   MDKFLESNKWRVIHKMDLH-----VINLLRTTFELLYFCDGQ---TSSFEACHARQVTKA  830
              + F   N   V+     H     ++ +L  T E ++   G     S+ E   A    KA
Sbjct  1087  ENDF---NMLNVVSNEGFHNFGNPILKILTMTLEYMWSLFGAHLCPSTAEDV-ANNFVKA  1142

Query  831   FKNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDL  1010
             FK + QKLFL  +DR +  I +KD+ PLLP +YA HTL RF+ PF+LLELV WMFSR  +
Sbjct  1143  FKGLQQKLFLDVRDRFELYICTKDVMPLLPTLYASHTLHRFLSPFQLLELVDWMFSRDKV  1202

Query  1011  EDNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEK  1190
             +D      ++ S L VG  +A   F +LS    Q    R   DLFW M ++     + E+
Sbjct  1203  DD----LPIKKSSLFVGCSLAADAFSALSIYFQQSTENRAPYDLFWEMSQKNMKTDIFEQ  1258

Query  1191  ILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSY  1367
             I  +V + +    +D AD CLL+A  ++   K++QQ     L   + + I+  P+ +L +
Sbjct  1259  IYSKVVDFSVCFEIDSADRCLLEAVNLLYKQKIVQQETFHPLTSVMWKIIMVTPLKVLFH  1318

Query  1368  CMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP--SDPELL  1541
             C+++ N +KA  L + TE+S LH  IFGHL  G ++K +H     +  T +P  S+ + L
Sbjct  1319  CIYKTNAKKAAFLHILTELSSLHSLIFGHLFLGTVNKSIHHDIGVMEHTFDPTLSEDQFL  1378

Query  1542  MLLPTVFLYLDSVLIKAGSQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNL  1718
             +LLP    Y   +  +   Q  K FE I  FY +ILL  FS WK + ++D+F+ +  +  
Sbjct  1379  LLLPASLSYFSLISKRLREQSHKDFEHIPYFYSKILLKGFSQWKSFSSKDIFEEQYGEFF  1438

Query  1719  PLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFD  1898
             P S +E + +   +LL +S+ M++   AL G + K + R+ LF S+CP+ ++  D +D D
Sbjct  1439  PSSAQELLRLIDLSLLGKSIHMLKYHFALNGPM-KLKKRLNLFKSICPKFASHDDLMDCD  1497

Query  1899  PSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSR  2078
                + + SL QSLN +NR VAKI+LC+ LLF  H +     K+       ++ S L  SR
Sbjct  1498  CQVIDSYSLHQSLNIINRVVAKISLCKVLLF--HEEAGGNFKD----VAVKMKSKLGRSR  1551

Query  2079  IRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSV-FRFLEVLILRNIVELSKEMHGCLV  2255
             IR + +LV  W+ IV+KF + +D S   +  N S+ +  LE  +L+NI+EL+ EM   L+
Sbjct  1552  IRFINILVDIWQFIVKKFSLASDQSRTPKGTNISLLYNHLEGFLLKNILELAGEMQNDLI  1611

Query  2256  KLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAI  2435
             +L ++ F+ +L ++   +RF D  T++ LR I+S LSEG+ S    +QL++AHSQF    
Sbjct  1612  QLQAISFLEQLIRSALLYRFGDFTTMKTLRVILSQLSEGRLSYDLYLQLLLAHSQF----  1667

Query  2436  CSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRV  2615
              +  L +   Q G    P+ S+++  VIP  +H     K    M++     LE++K+L +
Sbjct  1668  -APTLHSVCKQAGSFLKPVSSILKCLVIPSLDHCENDVKHRGLMTELSSGPLEIVKMLWI  1726

Query  2616  LFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISI  2795
             L +VKA Q+D++   +I +NL++L  LL  SY AT+  ID EI+NL+  I+S+S      
Sbjct  1727  LLRVKAHQIDLDNGNDINVNLKELHALLCHSYGATVNWIDLEIYNLMQHIESMSGL----  1782

Query  2796  AEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYF  2975
                                L Q V     D+E  E   + Q  +  PIDP +C STVLYF
Sbjct  1783  -------------------LSQNVKL---DSETIEKWYRSQHSDTFPIDPDICVSTVLYF  1820

Query  2976  PYGRP--NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVE  3149
             PY R   +    VNK++ DT     +   ++V ++  YDP+FILR S H LS  YIEPVE
Sbjct  1821  PYDRTIFDELPSVNKIEPDTVRK--KVLHSQVEDKERYDPVFILRFSIHSLSKAYIEPVE  1878

Query  3150  FANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIE  3329
             FA  GLLA++  S+SSPD   R+L YG L+KFKNALE CQKKKDV+ L+LLL+ +QN IE
Sbjct  1879  FAGSGLLAIAFVSMSSPDQGIRRLAYGTLDKFKNALE-CQKKKDVLGLRLLLNSVQNSIE  1937

Query  3330  EDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVS  3509
             E WQ+IPSV A+F AEAS VLLDP+H HYA I+  L  S  +N++ IP+F N  WS SV+
Sbjct  1938  EPWQRIPSVIALFAAEASCVLLDPAHGHYAAISTFLTHSSKLNMRVIPMFDNFFWSTSVN  1997

Query  3510  FRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAK  3689
             F+ ER W+LR++Y+G+N+DDDV +YIRNSI E L+SFYVSPL+D  SK LII+ +KKS K
Sbjct  1998  FKAERSWMLRLVYAGMNSDDDVALYIRNSILEKLMSFYVSPLSDFVSKNLIIEVIKKSVK  2057

Query  3690  LSRMARHLIENCGLISWLSSVVT-SFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVE  3866
             L ++ RHL+++C L SW SS+++ +   +K D  K F      V L+VVN++I      +
Sbjct  2058  LHKITRHLVKHCSLFSWFSSLISVARQRLKVDEHKLF-LKHVLVALKVVNDVISSGSISK  2116

Query  3867  WLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFT  4046
             WLQ + LEQL ELS +L   L   A +  E        LQ++    K+SQKRK+YQPHFT
Sbjct  2117  WLQNHGLEQLMELSSNLFNFLFHDATLANETVVLVNPFLQMIASVLKLSQKRKIYQPHFT  2176

Query  4047  LSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIA  4226
             LS+EG++ + +A   C     S   +  LEAI+MS PP +I  M+ +++  F+ WA + A
Sbjct  2177  LSIEGVYQMYQAGSACNQATKSIKPELALEAIIMSAPPASIFLMNQERLQSFLIWATTTA  2236

Query  4227  LQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSC  4406
             LQS++   L   +  F  N   E+  ENS++S  LRWL ASVI+GK+  K    DS ++ 
Sbjct  2237  LQSKSLQRLGSTESQFLRNNLREDFQENSVVSTFLRWLIASVIIGKLHKKSYNWDSEYA-  2295

Query  4407  DRSKLINLHCLL-EWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCL  4583
             +   L +LH LL      S + N  +   +E+LA++IF+LQ  LG + ++LPS V ALCL
Sbjct  2296  ETHNLESLHSLLVHVKNTSGQRNDIDIGAEEVLASTIFHLQLRLGVNHEVLPSVVCALCL  2355

Query  4584  LLLKNP--ASSGSEVLIG-NA--AALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEK  4748
             L+      A S +++L   NA  A+  S+++CP EAN  WRWSFYQPWKD S  LTDS+K
Sbjct  2356  LMFGASKFAVSRTDLLKDYNALIASHSSRVQCPPEANPTWRWSFYQPWKDDSLELTDSQK  2415

Query  4749  IEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             +EE HAC  LL++ S +L    L S  +S  D+EK G+F+WERS+L
Sbjct  2416  MEEYHACLTLLVIVSNVLGGKKLESASLSPVDLEKSGLFQWERSLL  2461



>ref|XP_010644442.1| PREDICTED: uncharacterized protein LOC100264016 isoform X5 [Vitis 
vinifera]
Length=2215

 Score =  1009 bits (2608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/1257 (47%), Positives = 815/1257 (65%), Gaps = 44/1257 (4%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGL---  173
             D+L+NFP +++VS+ + GVPF+LL SI F + SLL   SK WP++FF+GL+    GL   
Sbjct  968   DILKNFPSVITVSQDLQGVPFALLSSISFHDRSLLARASKLWPDIFFSGLQRV--GLMIH  1025

Query  174   QEGRTEEFGDIDSM----------------EFASAALSLFLKEASLCMLFPITLSIYKSD  305
              +G+ ++   I S                 E AS A SLFL++A   +LFP  ++I    
Sbjct  1026  SKGKGDDNCRIPSHSLSAEEIFPKTDFGLSESASVAFSLFLQQAPFHVLFPAIMNIDGPY  1085

Query  306   LSTQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIV  485
             L     +  LLLA LSE+T D+++ S  +VLFW +Q    YR+ PL ELE L E+CF +V
Sbjct  1086  LLEPSKVQQLLLAKLSEQTTDYLILSLRHVLFWIHQIRSYYRIRPLGELEHLFEVCFILV  1145

Query  486   DRMLRQFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTF  662
             +RML + L  + D  S C+ ++ +P   VQE+ E IF HP V  SL CPL C+ + T   
Sbjct  1146  ERMLDELLVLRPD--SDCSTTIGVPFSTVQEVAEIIFCHPAVMVSLSCPLSCHEELTKGT  1203

Query  663   SGDSMDKFLESNKWRVIHKMDLHVINLLRTTFE-LLYFCDGQT--SSFEACHARQVTKAF  833
              GDS++ FL S+K  V HKMD HV+NLL +T + L+  CDGQ   S  +    +Q+ K F
Sbjct  1204  IGDSLETFLRSSKHSV-HKMDHHVLNLLISTSDYLVALCDGQNPISKVDDSAKKQLVKVF  1262

Query  834   KNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLE  1013
             K ++Q+L L  + R D CI +K+  P L A YA H L  FI PF+L EL +WMFSR+DL 
Sbjct  1263  KALLQRLLLELRSRFDVCIRTKNFVPFLQAFYASHILSHFISPFKLFELAYWMFSRVDLN  1322

Query  1014  DNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKI  1193
             D +  +    S L V   IA   FD LS+    P +++   DLFW M E+ FDI++ EKI
Sbjct  1323  DLTTGEFDNMSALSVVFCIASGAFDMLSSYFQHPITKKVQFDLFWEMEEKSFDIIVFEKI  1382

Query  1194  LLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAI--SRFIVNIPVNLLSY  1367
              ++  E AT   L+ AD+CLLKA KV+   K  Q  +  L +++  SR IV+ PV ++S+
Sbjct  1383  YMKALEFATCFKLEFADVCLLKAVKVMYRQKFEQHQSFLLPLSLVSSRVIVSTPVKMISH  1442

Query  1368  CMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLML  1547
             C+ + +  +A+LLFL  E+SPLH S+FGHL SG+++K +  + N +     PSD   +ML
Sbjct  1443  CINRPSMIRAKLLFLLIEVSPLHSSVFGHLFSGLLNKGLPHKDNVVE---TPSDEGFMML  1499

Query  1548  LPTVFLYLDSVLIKAGSQVKY-FEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPL  1724
             LP    YL S  +K G Q    F+ I S Y RILL  F DWK +V+R +F IE  + LP 
Sbjct  1500  LPAALSYLKSTSLKFGKQYYTCFKGIPSLYSRILLDGFLDWKGFVSRSIFQIEDGEFLPS  1559

Query  1725  SIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPS  1904
             S E+  ++ + +LL +S+ M+    A +G+ +K + R +LFD + P  S     LD D S
Sbjct  1560  STEDLSNLVNSSLLGKSIHMLWFYFAFSGHSMKKKKRFKLFDVIFPC-SGQDGMLDCDVS  1618

Query  1905  QVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKM---ETCAELH-STLDV  2072
             ++ + SL QSLNFVNR VAKI+LCR LLFP   +  S  KE      +T  E+  +  D 
Sbjct  1619  EIDSYSLNQSLNFVNRVVAKISLCRMLLFPGDCQVKSLSKESDGPVEDTPLEMGLNREDS  1678

Query  2073  SRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGC  2249
             SRIRL+ +LV++W+KIVE+F   +DNS ++   +C  +F+FLEV ILRN++EL++EMH  
Sbjct  1679  SRIRLINILVNTWQKIVERFSCVSDNSGKVTDTDCLPLFKFLEVFILRNVLELAREMHNS  1738

Query  2250  LVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFET  2429
             L++L SLPF+ KL + +  HRF+D  TL+ LR +++SLSEGKFS V ++QL++AHSQF  
Sbjct  1739  LIQLHSLPFLEKLTRLSLLHRFEDATTLKMLRSVLTSLSEGKFSHVLLLQLLLAHSQFAP  1798

Query  2430  AICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLL  2609
              I S + S G SQ+G+   P+ S++RS      +  +I   +N + S   +KQLE+IKLL
Sbjct  1799  TIQSVSKSPGCSQVGVFSKPMSSILRSLTFTCTDQGTIDGNNNFERSDLCVKQLEVIKLL  1858

Query  2610  RVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISD-SN  2786
             R+L   K      +  + I IN R+L+ LLLSSY A L ++D EI++L++EI+S     +
Sbjct  1859  RLLLCFKGHWDGSDLEKNIDINARELISLLLSSYGAMLNEVDLEIYSLMHEIESNDRLKS  1918

Query  2787  ISIAEWDYLWGNAVVKARKER-ELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
              SIA+ DYLWG++ ++ RKER + ++  + N+ DAE  E+ ++ QFRENLPIDPK+C +T
Sbjct  1919  GSIADMDYLWGSSALRIRKERVQELEISANNILDAEAVEERQRSQFRENLPIDPKLCVNT  1978

Query  2964  VLYFPYGR--PNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYI  3137
             VLYFPY R   +GP  +NKV  D    M +     V N   YDP+FIL  S H LSM YI
Sbjct  1979  VLYFPYNRTASDGPISLNKVHPDNVKDMIQGYPPHVENVPRYDPVFILHFSIHSLSMRYI  2038

Query  3138  EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQ  3317
             EPVEF+ LGLLAV+  S+SSPDD  RKLGY  L +FKNALE CQK+KDVM+L+LLL+Y+Q
Sbjct  2039  EPVEFSALGLLAVAFVSLSSPDDMIRKLGYETLGRFKNALEMCQKRKDVMQLRLLLTYMQ  2098

Query  3318  NCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWS  3497
             N IEE WQ+IPSVTAIF AEASF+LLDPSH+HY+TI+K LM+S  VN+K IPLF N +WS
Sbjct  2099  NGIEEPWQRIPSVTAIFAAEASFILLDPSHEHYSTISKLLMRSTGVNMKCIPLFNNFIWS  2158

Query  3498  DSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQ  3668
              S++F++ERLWILR+ Y+GLN +DD  IYIRNSI ET+LSFY SP +DNESKELI+Q
Sbjct  2159  SSINFKSERLWILRLSYAGLNLEDDAQIYIRNSILETILSFYASPFSDNESKELILQ  2215



>ref|XP_010545221.1| PREDICTED: uncharacterized protein LOC104817664 isoform X2 [Tarenaya 
hassleriana]
Length=2194

 Score =  1009 bits (2608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/1667 (38%), Positives = 956/1667 (57%), Gaps = 92/1667 (6%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS-GLQEG  182
             +LQ F  +++VS  + G PFS+L  I FLE + L  +SK +  +F  G E   S  L +G
Sbjct  571   ILQYFAPVMTVSWALFGAPFSVLCPIAFLEENFLSKLSKQFANIFVQGSEITRSMNLDQG  630

Query  183   RTEEFGDI--------------DSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQ  320
               +   DI              D  E  S+A S+FL +A   +LFP+ +S+  S L   Q
Sbjct  631   TGDGEIDISDHSSLAEEIIRKMDISETGSSAFSIFLNQAPFHILFPLIMSMDVSCLEEPQ  690

Query  321   GLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLR  500
              + +LLL  + E     IVS     LFWF Q   S +V P   L  LSE+C  ++  +  
Sbjct  691   RIADLLLIKILESKGHCIVSYIRLTLFWFFQVRSSSKVRPASVLSQLSEICLFLMKHLFS  750

Query  501   QFLNTKGDASSKCTRSLLPT-KCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSM  677
             Q    K D+ +  ++ ++ + K   E+++T+  HP+V A LE PL C+  F        +
Sbjct  751   QMSKLKLDSEASPSKLVMSSDKWKHEVVQTVLCHPMVLAFLESPLSCSTAFEAQNFEICL  810

Query  678   DKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQKLF  857
               FL   +  VI ++D H+++LL +TFE   F +   +    C   +    FK++V +L 
Sbjct  811   ATFLPKGR-PVISEIDHHILDLLASTFENFLFDEEHITLEMDCGVDKSAMTFKSLVDRLL  869

Query  858   LTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSL  1037
             L ++ + + C  +++ TPLL   Y+IH L RFI PF+LL L     SR+D E  + + S 
Sbjct  870   LEYRLKLELCAGTENFTPLLQVSYSIHALLRFISPFQLLNLARLTLSRVDEEGQTIKSS-  928

Query  1038  RDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIA  1217
               ++L VGL IAG  F+ LS    QP S+R + DL W   E  +D  L+E I     + +
Sbjct  929   -GAILGVGLGIAGGAFEMLSLYFQQPPSKRQIYDLLWEFEENNYDSDLIEDIFGLACKFS  987

Query  1218  THLHLDVADMCLLKAFKVV--KTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKR  1391
             +   LD AD+CLL+A   +    HK     +P L + +S+ +   P  L+ +C+ + N  
Sbjct  988   SSFGLDSADICLLRAVSAMFKGRHKQNYSVHP-LTLILSQTVEKTPKELILHCINRANMT  1046

Query  1392  KAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYL  1571
             +++LLF   E+SPLH S+FG L S +++K         +  S  SD +LLMLLP    YL
Sbjct  1047  RSKLLFYLVELSPLHRSVFGSLFSSVLNKG--------QGESALSDDQLLMLLPAALSYL  1098

Query  1572  DSVLIKAGSQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDI  1748
              S  +    +  +   KI S Y R+LL+ F  W+ +++  MF  +  + +  + EE  ++
Sbjct  1099  GSAFVNLDKKYHRNLVKITSGYSRMLLNGFLRWQSFLSGSMFQEKYEEIVSSTSEEIENL  1158

Query  1749  FSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLE  1928
             F+ +LL +++ M+Q    L+G L K E   E+F S+ P  S C + L+++  ++   S++
Sbjct  1159  FNASLLGKAIHMLQFHFHLSGSLTKTEGLSEVFHSIFPHSSGCDEMLEYELKELDFHSVD  1218

Query  1929  QSLNFVNRTVAKINLCRTLLFPEHNKF-------SSGLKEDKMETCAELHSTLDVSRIRL  2087
             + +N   R+VAK++  R  +FP  +          + +KE  +ET     ST D   I L
Sbjct  1219  KMVNVAIRSVAKVSFLRMWIFPGESGLCDCKGETDNSVKESSLETV----STRDNLSICL  1274

Query  2088  LKMLVSSWRKIVEKFPMTADNSCQMEVEN-----CSVFRFLEVLILRNIVELSKEMHGCL  2252
             + +LV+SW+ IV++     D S +  +E       S+ + LE  ILR+I+E +K M   L
Sbjct  1275  MNILVNSWQCIVKESTSVYDGSFKGNLEGKRHECLSLCKSLEDFILRSILEFAKTMCERL  1334

Query  2253  VKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETA  2432
             V+LDSLPF+ KL K+T  +RF+D +TL++LRDI S LS GK+S    +QL+++HSQF   
Sbjct  1335  VELDSLPFMEKLMKSTLVYRFEDSVTLKRLRDIFSLLSGGKYSYAPYLQLLISHSQFTPT  1394

Query  2433  ICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFN----HNSICRKDNLQMSKQHLKQLELI  2600
             I S + S+    + L F P+ S+++  ++P  N     NS+ R       + H+ QLE++
Sbjct  1395  ISSLSKSSCSHTVEL-FRPVSSILKHLIVPSPNFVGLGNSVLRT-----PEHHMNQLEIV  1448

Query  2601  KLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISD  2780
             +++RVL          +  +E GINLR+L FLLL +Y+A+L +ID EI+NL+++I+ I  
Sbjct  1449  QIVRVLLS--------KCGKEAGINLRELHFLLLCNYSASLSEIDLEIYNLMHDIELIDG  1500

Query  2781  SN-ISIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCA  2957
             S+ ++++E DYLWG A ++ R++  L    + N+ D+  AE  +++     L IDP +CA
Sbjct  1501  SHTLNVSETDYLWGKAAMEIRRDMSL----ALNVGDSVKAESVKEV-----LNIDPTLCA  1551

Query  2958  STVLYFPYGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYI  3137
             STV++FPY R       N++Q  + D + E  S+ + N   YDP F+LR S H LS  +I
Sbjct  1552  STVMFFPYQRSGA----NELQVYS-DVISEKNSSMINNIEQYDPAFVLRFSIHSLSENHI  1606

Query  3138  EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFK---NALEKCQKKKDVMRLQLLLS  3308
             E VEFA+ GLLAV+ AS+SS D + RKLGY  LEKF    N L+  QK   +  L+LLL+
Sbjct  1607  ELVEFASSGLLAVAFASMSSADLEMRKLGYKTLEKFVEKLNPLKSGQKNNRIECLRLLLA  1666

Query  3309  YLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNL  3488
             Y+QN I+E W +IP+V+A+F AEAS +LLD SH+H+A + K +  SP + +K IP+F   
Sbjct  1667  YVQNGIDEQWLRIPTVSAVFAAEASLILLDSSHEHHAALKKFMGSSPRLKMKGIPMFHEF  1726

Query  3489  LWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQ  3668
              WS +V+FR++RLW LR+LY GLN++DD  +YIRNSI ETL+SFY SPLADNE+K LI+Q
Sbjct  1727  FWSTAVNFRSQRLWELRLLYVGLNSEDDAQVYIRNSILETLISFYSSPLADNETKRLILQ  1786

Query  3669  TVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIF  3848
              VKKS K  +MARHL  NCGL SWLSS +  F              Q A VL V+ +++ 
Sbjct  1787  VVKKSVKFIKMARHLTGNCGLFSWLSSTMVMFTAKLLREED----VQLADVLAVITDVLS  1842

Query  3849  FRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKV  4028
              R+ VEWLQ+ ALE+L ELS  L ++L       +E++T    I+ IL+ T K+SQKRK+
Sbjct  1843  SRNVVEWLQRCALEELMELSLCLYRLLFGRLVSTEENATLVDSIVHILSATLKISQKRKM  1902

Query  4029  YQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFIN  4208
             YQPHFTLS+EG+F L EA+  C +   +  A+ GL AILMSTPPV I+ MD   ++ F+ 
Sbjct  1903  YQPHFTLSLEGIFQLYEAVTNCNSPPATASAELGLRAILMSTPPVDIIWMDSDTLTSFLL  1962

Query  4209  WAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKL  4388
             WA S AL+ +     +  +         EE    +++SK LRWL ASVILGK+ Y  +  
Sbjct  1963  WATSTALKCDLGKGSKPNESHQDAKTFPEESQGETMVSKFLRWLIASVILGKLYYNRAHD  2022

Query  4389  DSSHSCDRSKLINLHCLLEWNEESDRENGKEFA-CQEILAASIFYLQQLLGTSFKLLPSA  4565
                  C +S +  L  LLE+ ++  + NG E +  + IL   I +LQQ LGT+FK+LPS 
Sbjct  2023  SDQKLCRKSDIETLQSLLEFVKQRYK-NGSELSNSKHILGVVIMFLQQHLGTNFKILPSV  2081

Query  4566  VSALCLLLLKNPASSGSEVLIGN--AAALCSKIRCPAEANSAWRWSFYQPWKDHSSN-LT  4736
             V AL  +LL N   +      G+    +LCS+I  P EAN AWRWS+YQ WKD SS   T
Sbjct  2082  VCALSFMLLNNGLGNEGLTFAGDDFIKSLCSRISSPPEANPAWRWSYYQAWKDLSSEPST  2141

Query  4737  DSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWER  4877
             D   I+E+HAC+ LLL+ S ML       + +  K +E   VF+ E+
Sbjct  2142  DKLSIDELHACRHLLLIFSDMLGPKPSDPQTLQRKYLEISDVFDCEK  2188



>ref|XP_010545220.1| PREDICTED: uncharacterized protein LOC104817664 isoform X1 [Tarenaya 
hassleriana]
Length=2562

 Score =  1008 bits (2607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/1667 (38%), Positives = 956/1667 (57%), Gaps = 92/1667 (6%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS-GLQEG  182
             +LQ F  +++VS  + G PFS+L  I FLE + L  +SK +  +F  G E   S  L +G
Sbjct  939   ILQYFAPVMTVSWALFGAPFSVLCPIAFLEENFLSKLSKQFANIFVQGSEITRSMNLDQG  998

Query  183   RTEEFGDI--------------DSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQ  320
               +   DI              D  E  S+A S+FL +A   +LFP+ +S+  S L   Q
Sbjct  999   TGDGEIDISDHSSLAEEIIRKMDISETGSSAFSIFLNQAPFHILFPLIMSMDVSCLEEPQ  1058

Query  321   GLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLR  500
              + +LLL  + E     IVS     LFWF Q   S +V P   L  LSE+C  ++  +  
Sbjct  1059  RIADLLLIKILESKGHCIVSYIRLTLFWFFQVRSSSKVRPASVLSQLSEICLFLMKHLFS  1118

Query  501   QFLNTKGDASSKCTRSLLPT-KCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSM  677
             Q    K D+ +  ++ ++ + K   E+++T+  HP+V A LE PL C+  F        +
Sbjct  1119  QMSKLKLDSEASPSKLVMSSDKWKHEVVQTVLCHPMVLAFLESPLSCSTAFEAQNFEICL  1178

Query  678   DKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQKLF  857
               FL   +  VI ++D H+++LL +TFE   F +   +    C   +    FK++V +L 
Sbjct  1179  ATFLPKGR-PVISEIDHHILDLLASTFENFLFDEEHITLEMDCGVDKSAMTFKSLVDRLL  1237

Query  858   LTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSL  1037
             L ++ + + C  +++ TPLL   Y+IH L RFI PF+LL L     SR+D E  + + S 
Sbjct  1238  LEYRLKLELCAGTENFTPLLQVSYSIHALLRFISPFQLLNLARLTLSRVDEEGQTIKSS-  1296

Query  1038  RDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIA  1217
               ++L VGL IAG  F+ LS    QP S+R + DL W   E  +D  L+E I     + +
Sbjct  1297  -GAILGVGLGIAGGAFEMLSLYFQQPPSKRQIYDLLWEFEENNYDSDLIEDIFGLACKFS  1355

Query  1218  THLHLDVADMCLLKAFKVV--KTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKR  1391
             +   LD AD+CLL+A   +    HK     +P L + +S+ +   P  L+ +C+ + N  
Sbjct  1356  SSFGLDSADICLLRAVSAMFKGRHKQNYSVHP-LTLILSQTVEKTPKELILHCINRANMT  1414

Query  1392  KAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYL  1571
             +++LLF   E+SPLH S+FG L S +++K         +  S  SD +LLMLLP    YL
Sbjct  1415  RSKLLFYLVELSPLHRSVFGSLFSSVLNKG--------QGESALSDDQLLMLLPAALSYL  1466

Query  1572  DSVLIKAGSQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDI  1748
              S  +    +  +   KI S Y R+LL+ F  W+ +++  MF  +  + +  + EE  ++
Sbjct  1467  GSAFVNLDKKYHRNLVKITSGYSRMLLNGFLRWQSFLSGSMFQEKYEEIVSSTSEEIENL  1526

Query  1749  FSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLE  1928
             F+ +LL +++ M+Q    L+G L K E   E+F S+ P  S C + L+++  ++   S++
Sbjct  1527  FNASLLGKAIHMLQFHFHLSGSLTKTEGLSEVFHSIFPHSSGCDEMLEYELKELDFHSVD  1586

Query  1929  QSLNFVNRTVAKINLCRTLLFPEHNKF-------SSGLKEDKMETCAELHSTLDVSRIRL  2087
             + +N   R+VAK++  R  +FP  +          + +KE  +ET     ST D   I L
Sbjct  1587  KMVNVAIRSVAKVSFLRMWIFPGESGLCDCKGETDNSVKESSLETV----STRDNLSICL  1642

Query  2088  LKMLVSSWRKIVEKFPMTADNSCQMEVEN-----CSVFRFLEVLILRNIVELSKEMHGCL  2252
             + +LV+SW+ IV++     D S +  +E       S+ + LE  ILR+I+E +K M   L
Sbjct  1643  MNILVNSWQCIVKESTSVYDGSFKGNLEGKRHECLSLCKSLEDFILRSILEFAKTMCERL  1702

Query  2253  VKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETA  2432
             V+LDSLPF+ KL K+T  +RF+D +TL++LRDI S LS GK+S    +QL+++HSQF   
Sbjct  1703  VELDSLPFMEKLMKSTLVYRFEDSVTLKRLRDIFSLLSGGKYSYAPYLQLLISHSQFTPT  1762

Query  2433  ICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFN----HNSICRKDNLQMSKQHLKQLELI  2600
             I S + S+    + L F P+ S+++  ++P  N     NS+ R       + H+ QLE++
Sbjct  1763  ISSLSKSSCSHTVEL-FRPVSSILKHLIVPSPNFVGLGNSVLR-----TPEHHMNQLEIV  1816

Query  2601  KLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISD  2780
             +++RVL          +  +E GINLR+L FLLL +Y+A+L +ID EI+NL+++I+ I  
Sbjct  1817  QIVRVLLS--------KCGKEAGINLRELHFLLLCNYSASLSEIDLEIYNLMHDIELIDG  1868

Query  2781  SN-ISIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCA  2957
             S+ ++++E DYLWG A ++ R++  L    + N+ D+  AE  +++     L IDP +CA
Sbjct  1869  SHTLNVSETDYLWGKAAMEIRRDMSL----ALNVGDSVKAESVKEV-----LNIDPTLCA  1919

Query  2958  STVLYFPYGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYI  3137
             STV++FPY R       N++Q  + D + E  S+ + N   YDP F+LR S H LS  +I
Sbjct  1920  STVMFFPYQRSGA----NELQVYS-DVISEKNSSMINNIEQYDPAFVLRFSIHSLSENHI  1974

Query  3138  EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFK---NALEKCQKKKDVMRLQLLLS  3308
             E VEFA+ GLLAV+ AS+SS D + RKLGY  LEKF    N L+  QK   +  L+LLL+
Sbjct  1975  ELVEFASSGLLAVAFASMSSADLEMRKLGYKTLEKFVEKLNPLKSGQKNNRIECLRLLLA  2034

Query  3309  YLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNL  3488
             Y+QN I+E W +IP+V+A+F AEAS +LLD SH+H+A + K +  SP + +K IP+F   
Sbjct  2035  YVQNGIDEQWLRIPTVSAVFAAEASLILLDSSHEHHAALKKFMGSSPRLKMKGIPMFHEF  2094

Query  3489  LWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQ  3668
              WS +V+FR++RLW LR+LY GLN++DD  +YIRNSI ETL+SFY SPLADNE+K LI+Q
Sbjct  2095  FWSTAVNFRSQRLWELRLLYVGLNSEDDAQVYIRNSILETLISFYSSPLADNETKRLILQ  2154

Query  3669  TVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIF  3848
              VKKS K  +MARHL  NCGL SWLSS +  F              Q A VL V+ +++ 
Sbjct  2155  VVKKSVKFIKMARHLTGNCGLFSWLSSTMVMFTAKLLREED----VQLADVLAVITDVLS  2210

Query  3849  FRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKV  4028
              R+ VEWLQ+ ALE+L ELS  L ++L       +E++T    I+ IL+ T K+SQKRK+
Sbjct  2211  SRNVVEWLQRCALEELMELSLCLYRLLFGRLVSTEENATLVDSIVHILSATLKISQKRKM  2270

Query  4029  YQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFIN  4208
             YQPHFTLS+EG+F L EA+  C +   +  A+ GL AILMSTPPV I+ MD   ++ F+ 
Sbjct  2271  YQPHFTLSLEGIFQLYEAVTNCNSPPATASAELGLRAILMSTPPVDIIWMDSDTLTSFLL  2330

Query  4209  WAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKL  4388
             WA S AL+ +     +  +         EE    +++SK LRWL ASVILGK+ Y  +  
Sbjct  2331  WATSTALKCDLGKGSKPNESHQDAKTFPEESQGETMVSKFLRWLIASVILGKLYYNRAHD  2390

Query  4389  DSSHSCDRSKLINLHCLLEWNEESDRENGKEFA-CQEILAASIFYLQQLLGTSFKLLPSA  4565
                  C +S +  L  LLE+ ++  + NG E +  + IL   I +LQQ LGT+FK+LPS 
Sbjct  2391  SDQKLCRKSDIETLQSLLEFVKQRYK-NGSELSNSKHILGVVIMFLQQHLGTNFKILPSV  2449

Query  4566  VSALCLLLLKNPASSGSEVLIGN--AAALCSKIRCPAEANSAWRWSFYQPWKDHSSN-LT  4736
             V AL  +LL N   +      G+    +LCS+I  P EAN AWRWS+YQ WKD SS   T
Sbjct  2450  VCALSFMLLNNGLGNEGLTFAGDDFIKSLCSRISSPPEANPAWRWSYYQAWKDLSSEPST  2509

Query  4737  DSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWER  4877
             D   I+E+HAC+ LLL+ S ML       + +  K +E   VF+ E+
Sbjct  2510  DKLSIDELHACRHLLLIFSDMLGPKPSDPQTLQRKYLEISDVFDCEK  2556



>ref|XP_008458088.1| PREDICTED: uncharacterized protein LOC103497624 isoform X2 [Cucumis 
melo]
Length=2355

 Score =  1000 bits (2586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/1496 (42%), Positives = 903/1496 (60%), Gaps = 62/1496 (4%)
 Frame = +3

Query  201   DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERTPDHIVS  380
             + D +E +S   S FLK+A   +LFP  +   +S+      + + LL  LSE T DH++ 
Sbjct  885   EFDKIEASSLGFSTFLKKAPFHVLFPAIMCTRRSNSLVLPKIQDFLLLKLSELTFDHLLL  944

Query  381   SFLYVL-FWFNQAHISYRVepleelemlselCFNIVDRMLRQFL--NTKGDASSKCTRSL  551
              +L ++ FW  Q  ISYR +P  ELE LS++C  +V  +L + L   T+  A      SL
Sbjct  945   PYLRLVLFWMYQIRISYRFKPSVELEKLSQICIVLVQNILAKLLATRTQSGAGGDYKSSL  1004

Query  552   LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESN---KWRVIHKM  722
             L  + VQ++ ETIF HP + +SL C L C  +       D++D  LES      + ++ +
Sbjct  1005  LRLE-VQDVAETIFSHPAIISSLTCSLNCPGNLM----LDAIDLNLESLVQLSRKSVNIL  1059

Query  723   DLHVINLLRTTFE-LLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRTDKCIESK  899
             D H++NLL ++ E L+  CD Q S+F     R V + F   VQ+L   F+DR D   E+ 
Sbjct  1060  DHHIVNLLTSSCEYLVTSCDDQDSTF-----RGVVETFNVFVQRLLSEFRDRFDIFTETM  1114

Query  900   DLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSV--LRVGLHIA  1073
             DL PLLP  +A+H L  FI PF+LLELV W+F R+++     Q+S    +  L  G  IA
Sbjct  1115  DLIPLLPLFFALHALNHFISPFDLLELVIWIFKRVNINGFVVQKSETTQIHGLSFGFGIA  1174

Query  1074  GSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIV-LLEKILLQVYEIATHLHLDVADMC  1250
                F  ++  +  P S+R    L   M E+  D+  ++++I  +    A H   + AD C
Sbjct  1175  VIAFKDVTGYLQLPLSKRLPYHLLRKMDEK--DVCNIIDEIYTKTNVCAVHYKSEFADAC  1232

Query  1251  LLKAFKVVKTHKVMQ-QSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMS  1427
             LL+  K +   K M  +    + +A  RFI+N+P  L+SYC  + NK KAELLF  TE S
Sbjct  1233  LLEVVKAICAKKSMLCEYFDQIHLATFRFIMNMPSELISYCFDRTNKEKAELLFFLTEAS  1292

Query  1428  PLHLSIFGHLLSGMIDKQ-VHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQV  1604
              LHLSIFGH +  ++DK   H+         N  + +LLMLLPT   YL+SV+ K G   
Sbjct  1293  SLHLSIFGHFIVNIMDKHSCHMD--------NEMEDKLLMLLPTSLTYLNSVVAKFGKNC  1344

Query  1605  KY-FEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVL  1781
              Y F+ I S Y RIL   F  WK +VT   FD E  D++P + ++F+D+ + +LL ++V 
Sbjct  1345  WYNFKVISSVYSRIL---FRKWKIFVTNSTFDEEFGDSVPSTTQDFIDLVNNSLLGKAVG  1401

Query  1782  MVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVA  1961
             M++   AL G LV  + R+++F+ + P   +  + L F+  ++ + S  Q  NF+++ V+
Sbjct  1402  MLRHYFALNGDLVTVKKRLKVFNYIFPASCSTDEVLGFEVDELDSYSPNQVFNFLSKVVS  1461

Query  1962  KINLCRTLLFPEHNKFSSGLKEDKM--ETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFP  2135
             KI+ CR LLFPE     S  +ED+    + A   +  + SR++ L  LV  W+ IV++F 
Sbjct  1462  KISFCRVLLFPEGCGIQSLPREDESTEHSSARRSNNEESSRLQYLNTLVGIWQWIVKRFV  1521

Query  2136  MTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRF  2315
               +D   + E +N  +FR+LE+ +L NI++LS+EMHG LVKL S+PF+ +L + +  +RF
Sbjct  1522  FISD-IYEKERDNSRLFRYLELFLLNNILDLSREMHGALVKLPSIPFLEQLMRFSLLYRF  1580

Query  2316  DDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLP  2495
             +DP TL  L  I+  LS+GKF+    +QL++AHSQF   I S+   +    +     P+ 
Sbjct  1581  EDPTTLNILYSILDLLSDGKFAVDAYLQLLLAHSQFAPTIQSTPKPS--HSIETFLRPMS  1638

Query  2496  SLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGIN  2675
             S++RS VIP         K + + ++  LK+L ++KL+ +L  +K         ++  IN
Sbjct  1639  SILRSLVIPSSGQQETNFKQDSKATRTDLKRLVIVKLVHILVLMKVCHGGY--GKDDTIN  1696

Query  2676  LRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNI-SIAEWDYLWGNAVVKARKERE  2852
              RDL  LLLSSY AT+ + D  I   +N+I++I  S+  +  + D+LWGNAV+   KER 
Sbjct  1697  FRDLYALLLSSYGATVSETDSTILMTLNDIETIIGSDAKNHVQMDFLWGNAVLGVSKERL  1756

Query  2853  LVQTVSCNLS-DAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPN----GPGVVNKV  3017
             L Q  S N++ DAE  ++  + QFRENLP+DP++C STVL+FPY R           N+V
Sbjct  1757  LEQEPSSNMNNDAEAVKERHRNQFRENLPVDPRICVSTVLWFPYDRTELDEESRLKENRV  1816

Query  3018  QK--DTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASI  3191
             +   D F   +     E      YDPI++LR S H LSMGYIE +EFA LGLLAV+  S+
Sbjct  1817  KDLDDFFKGHYHGTEPER-----YDPIYVLRFSIHALSMGYIEALEFATLGLLAVAFVSL  1871

Query  3192  SSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFI  3371
             SS +D  RKLGYG L   KN +E  +++K   RL+LLL+Y+QN IEE WQ+IPS+ A F 
Sbjct  1872  SSANDKLRKLGYGTLGALKNTVENGKRRKGTTRLRLLLTYVQNGIEEPWQRIPSIIAFFA  1931

Query  3372  AEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYS  3551
             AEASF+LL+PSH HYA I+K L++S  +N KSIPLF+N LWS SV+F++ERLW+LR++Y 
Sbjct  1932  AEASFILLEPSHHHYAAISKFLVRSTRMNSKSIPLFKNFLWSTSVNFKSERLWMLRLVYV  1991

Query  3552  GLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGL  3731
             G+N DDD  +YI+NSI E L SFYVS L+DNESKELI+Q +KKS KL RMA +L+EN GL
Sbjct  1992  GINVDDDARLYIKNSIHEDLQSFYVSSLSDNESKELILQVMKKSVKLQRMAFYLVEN-GL  2050

Query  3732  ISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSC  3911
              SWL S+V++      +  K     Q A+VLEVVN +I FR+  EWLQK ALEQL E S 
Sbjct  2051  FSWLCSIVSTSSRRLTEDQKSIFTKQLALVLEVVNNVISFRNICEWLQKDALEQLMEFSS  2110

Query  3912  HLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAI-D  4088
             ++ +ILV G Q+L         ILQI+T   ++SQKRK++QPHFT S+EGLFH+ +A+  
Sbjct  2111  NIFKILVGGEQLLLIEGALVNQILQIITSVLRISQKRKIFQPHFTFSIEGLFHIYQAVHK  2170

Query  4089  VCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKC  4268
             + C    S  A +GL+ ILM+ P +++L+MD  + S F++WA+S AL+ +++ V   E  
Sbjct  2171  LDCTRLGSNSA-SGLKMILMNMPQISLLRMDPMRCSGFLSWAVSTALEFDSRMVAN-ESH  2228

Query  4269  CFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEW  4448
                ++ S EE ++ SL SKLLRWL+AS ILGK+S K   ++   S +R     L+ LLE 
Sbjct  2229  LGLISESDEEHSDESLTSKLLRWLSASAILGKVSLKFGCMNLRTS-ERLSAETLYSLLEH  2287

Query  4449  NEESDRENG-KEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSG  4613
              + +   N  +EF C+ +LAA+IFYLQQ L +SF +LP  +SALCLLL     S+G
Sbjct  2288  VKNTRDHNSLQEFGCEGLLAANIFYLQQHLQSSFMVLPVVISALCLLLFDALISAG  2343



>gb|KEH33828.1| ribosome 60S biogenesis amino-terminal protein [Medicago truncatula]
Length=2566

 Score =   993 bits (2567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 636/1681 (38%), Positives = 946/1681 (56%), Gaps = 112/1681 (7%)
 Frame = +3

Query  15    NFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGL-QEGRTE  191
             N P  V +   +L VPF +L SIFFL+ S+L+  SK WP MF+ GL+ AIS L  + R+ 
Sbjct  939   NLPSGVVILSDLLDVPFPILSSIFFLDYSVLVHASKMWPVMFYAGLDMAISDLGSDSRSA  998

Query  192   ---EFGDIDS---------------MEFASAALSLFLKEASLCMLFPITLSI---YKSDL  308
                E  D+ S                +  + A S+ LK+    ++ P  + +   Y S L
Sbjct  999   APIETSDLTSCPDSLTCSQLLDASDTDADADAFSILLKQTPFHVILPAMMCMNGHYSSKL  1058

Query  309   STQQGLH------NLLLANLSERTPD-HIVSSFLYVLFWFNQAHISYRVepleelemlse  467
             S  Q L+       LLL    E      ++ +   VLFW +Q  +S+ V PL E+E L  
Sbjct  1059  SEMQELNFKKNMQELLLHKSCESISGCSVLPNLQLVLFWTHQIQLSHEVIPLAEIEQLLN  1118

Query  468   lCFNIVDRMLRQFL--NTKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCN  641
             LC  +V  +L Q     +  D S K +     +  +Q++I+TIF HP V  SL   L   
Sbjct  1119  LCVILVQNLLAQLFVPESGSDLSVKNSSFSSTSHYIQKVIKTIFCHPSVLMSLSFSLENC  1178

Query  642   ADFTDTFSGDSMD--KFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHAR  815
              + ++  +G   D    L S  +    K    ++N+L  T   ++   G  S F     +
Sbjct  1179  QNISNGNTGTGFDILNVLSSEGFT---KFGNPILNILTMTLNNMWSLLG--SHFHGSKTQ  1233

Query  816   QVT----KAFKNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELV  983
              V     K FK++ QKLFL  K+R + CI +KD T LLP +Y +HTL +F+ PF+LLELV
Sbjct  1234  DVAINFVKIFKSLQQKLFLDVKERFELCIGTKDTTHLLPTLYVLHTLHKFLSPFQLLELV  1293

Query  984   HWMFSRIDLEDNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEE  1163
              WMF R++++    +  +  S L VG  +A   F SLS    Q    R   +LFW M E 
Sbjct  1294  DWMFKRVEMD----ELPIMPSFLSVGCSVAADAFSSLSFYFQQSSGNRVPYELFWEMGEN  1349

Query  1164  QFDIVLLEKILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIV  1340
                  + E+I  +V + +    +D AD CL +A   +   K MQQ     +++A+ + I+
Sbjct  1350  NVKADIFEQIYSKVIDFSVKYEIDCADRCLHEAVNALYKQKNMQQETFHPMLLAVRKIIM  1409

Query  1341  NIPVNLLSYCMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETS-  1517
             + PV +LS C++++N +K + L + TE+S LH  +FGHL  G++++ +H           
Sbjct  1410  STPVKMLSLCLYKMNAKKVKFLHILTELSSLHSLVFGHLFLGIVNRSLHHDVGVTGAIDV  1469

Query  1518  NPSDPELLMLLPTVFLYLDSVLIKAGS-QVKYFEKIVSFYWRILLHIFSDWKCYVTRDMF  1694
             N S+ + ++LLPT   YL  +  + G      F++I +FY +I L  FS WK ++++D+F
Sbjct  1470  NLSEDQFILLLPTSLSYLRLIFKRFGDLNHGDFKQIPNFYSKIFLKGFSQWKSFLSKDLF  1529

Query  1695  DIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKST  1874
             + E  +++P S++E + +  C+LL +S+ M+Q   AL G  +K + R++LF S+ P+ S+
Sbjct  1530  EEEYGESMPSSVQELLCLTDCSLLGKSIHMLQYHFALNGDSLKLKKRLKLFKSIFPKLSS  1589

Query  1875  CVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAEL  2054
               + +D D   + + SL QS N +N  VAKI+LC+ LLF  H +    LK+       E+
Sbjct  1590  HDELMDCDIQFMDSYSLRQSFNIINHVVAKISLCKMLLF--HEEVGGDLKK----VGEEM  1643

Query  2055  HSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFR-FLEVLILRNIVELS  2231
                L+ SR+  + +LV  W+ IV+KF +T+D     +  N S+    LEV +L NI+EL+
Sbjct  1644  QRKLEASRMHFINVLVDIWQLIVQKFSLTSDQLGTGKTINISLLHNHLEVFVLTNILELA  1703

Query  2232  KEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVA  2411
              EM   L++  S+PF+ +L ++   +RF DP+T++ L+ +++ L+EG  S    +QL++A
Sbjct  1704  VEMQNDLIQSQSIPFLEQLIRSALLYRFSDPLTMKTLQVLVTRLNEGMLSYDLYLQLLLA  1763

Query  2412  HSQFETAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQL  2591
             HSQF     +  L       G    P+ S+++   IP  +H+   +    Q +K     L
Sbjct  1764  HSQF-----APTLHLVRRPAGSFLKPVSSILKCIAIPSLDHSENNKNHKEQTTKLSKGPL  1818

Query  2592  ELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKS  2771
             E++KLL +L   KAR   ++   +IGINL++L  LL  SY +TL +ID  I+N++ +I+S
Sbjct  1819  EIVKLLWILLWTKARHTGLDSQNDIGINLKELHALLHHSYGSTLSEIDLAIYNVMKQIES  1878

Query  2772  ISDSNISIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKM  2951
             ++ S                         Q V  N   +E  E+  + + R+N PIDP +
Sbjct  1879  VTGS-----------------------CPQNVELN---SEAIEEWTRSRQRDNFPIDPDI  1912

Query  2952  CASTVLYFPYGRPNGPGV--VNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLS  3125
             C STVLYFPY R     V  VNK++ D           E+  R  YDP+FIL+ S H LS
Sbjct  1913  CVSTVLYFPYDRSISDEVPSVNKIETDNVRKKIHFSHVELRER--YDPVFILQFSIHGLS  1970

Query  3126  MGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLL  3305
               +IEPVEFA  GLLA++  S+SSPD   R+L Y  L+KFK ALEKCQK+KDVM L+LL+
Sbjct  1971  KAFIEPVEFAGSGLLAIAFVSMSSPDHGIRRLAYATLDKFKKALEKCQKRKDVMGLRLLM  2030

Query  3306  SYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQN  3485
             + +QN IEE WQ+IPSV A+F AEAS VLLD SHDHYA I+  L+QS   N+K +PLF N
Sbjct  2031  NSVQNSIEEPWQRIPSVIALFAAEASCVLLDSSHDHYAAISTFLIQSSKFNMKVVPLFDN  2090

Query  3486  LLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELII  3665
              +WS SV+F+ ER WILR++Y+GLN+DDD  IYIRNSI E L+SFY+SPL+D  SK+LI 
Sbjct  2091  FIWSSSVNFKAERSWILRLVYAGLNSDDDAMIYIRNSILENLMSFYLSPLSDVVSKDLIF  2150

Query  3666  QTVKKSAKLSRMARHLIENCGLISWLSSV--VTSFCGIKYDHWKGFPFAQFAVVLEVVNE  3839
             + +KKS K+ ++ARHL++ C L SWLSS+  V    G+  D  + F      VVL+VVN+
Sbjct  2151  EVIKKSIKVQKIARHLVKRCSLFSWLSSLISVARRVGLNADENRFF-LKHVLVVLKVVND  2209

Query  3840  IIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQK  4019
             +I      +WLQ +  EQL ELS +L  +++    M  E        LQ++    K SQK
Sbjct  2210  VISSGSMSKWLQNHGFEQLMELSSNLFSVVLHDVTMTDETVGLVNPFLQMIVSVLKFSQK  2269

Query  4020  RKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSK  4199
             R++ Q HFTLS++GL+ + +A  VC            LEAILMS PP +I  MD +++  
Sbjct  2270  REICQSHFTLSIQGLYQIFQAGSVCNQATKGINPDLSLEAILMSAPPTSIFLMDEERLQN  2329

Query  4200  FINWAMSIALQSETKGVLQVEKCCFPLNVS-SEEETENSLISKLLRWLTASVILGKISYK  4376
             FI WA++ AL SE+K  L+  +    +     EE  +++L+SK LRWLTASVI+GK+  K
Sbjct  2330  FITWAITTALASESKQRLRSNESRLIVKTELGEESHDDTLVSKFLRWLTASVIIGKLHQK  2389

Query  4377  LSKLDSSHSCDRSKLINLHCLLEWNEESDRENGK-EFACQEILAASIFYLQQLLGTSFKL  4553
              +   S  S + + L +LH LL   E + R+       C+E+LA++IFYLQ L G + +L
Sbjct  2390  SNDTYSVFS-ETNTLESLHSLLVHVENTSRQRHDINTDCEELLASTIFYLQLLPGINQEL  2448

Query  4554  LPSAVSALCLLLLKNPASSGSEVLIGNAAAL----------CSKIRCPAEANSAWRWSFY  4703
             LPS +SALCLL         S + +G    L           S++RCP EAN AWRWSFY
Sbjct  2449  LPSVLSALCLLTF-----GASNISVGRTDLLQDYNTFISSNSSRVRCPPEANPAWRWSFY  2503

Query  4704  QPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSI  4883
             +P KDHS  LT ++ +EE HACQ LL++ + +L    L S  +S  DVE   + +WE+S+
Sbjct  2504  RPRKDHSLELTGTQAMEEYHACQNLLVIVANVLDGKKLESARLSPLDVEISTLIQWEKSL  2563

Query  4884  L  4886
             L
Sbjct  2564  L  2564



>gb|KHM99566.1| Nucleolar pre-ribosomal-associated protein 1 [Glycine soja]
Length=2543

 Score =   988 bits (2554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/1662 (38%), Positives = 947/1662 (57%), Gaps = 85/1662 (5%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGL----  173
             +L N P  V + + ++GVPFSLL+S+ FL+ S+L   SK WP MF+  L+ A+S L    
Sbjct  930   ILTNLPSHVVIPRDLVGVPFSLLLSVLFLDYSVLHHASKLWPVMFYAALDMAMSDLGIDG  989

Query  174   QEGRTEEFGDI-------------DSMEFASAALSLFLKEASLCMLFPITLSIYKSDLST  314
             Q     E  D+             D+ E  +   S+FLK+A   ++FP  + +    +S 
Sbjct  990   QNAAPVETSDLTLHPDSLTCSQLLDASEVDAVTFSIFLKQAPFHVIFPAMMCMNGPYISK  1049

Query  315   QQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRM  494
                +   LL  LSE     ++++   +LFW ++  + Y V P+ E+E L  LC  +V  +
Sbjct  1050  LSKIQEFLLHKLSESNDSLLLTNLQLILFWTHRIQLCYEVNPIAEVEQLLNLCVILVGSL  1109

Query  495   LRQFLNTKGDASSKCTRSLLPTK-CVQELIETIFYHPVVAASLECPLPCNADFTDTFSGD  671
             L Q L  +  +      +    +  +QE+I+TIF HP V  SL   L    + ++    +
Sbjct  1110  LAQLLVPESGSDWSINSAFYSLRHNIQEVIKTIFCHPCVLISLSFSLGSCQNLSNGNVEN  1169

Query  672   SMDKF-LESNKWRVIHKMDLHVINLLRTTFELLYFCDGQ---TSSFEACHARQVTKAFKN  839
              ++   + SN+    H     V+ +L  T E ++   G     S+ E   A  + KAFK 
Sbjct  1170  DINMLNVVSNEG--FHNFGNPVLKILTMTLESMWSLSGAHLCVSTAEDV-ANNIVKAFKR  1226

Query  840   VVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDN  1019
             + QKLFL  ++R +  I ++D+ PLLP +YA+H+L RF+ PF+LLELV+WMFSR + +D 
Sbjct  1227  LQQKLFLDVRNRFELYIRTEDVMPLLPTLYALHSLHRFLSPFQLLELVNWMFSRDEFDD-  1285

Query  1020  SFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILL  1199
                  ++ S + VG  +A   F +LS    Q    R   DLFW M E+     + E+I L
Sbjct  1286  ---LPIKKSSIFVGCSLAADAFSALSIYFQQSTENRAPYDLFWEMGEKNMKADIFEQIYL  1342

Query  1200  QVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSYCMF  1376
             +V + +    +D AD CLL+A  ++   K +QQ     L++ + + I+  P+ +LS+C++
Sbjct  1343  KVVDFSVCYEIDSADRCLLEAVNLLYKQKHLQQETFHPLLLVMWKIIMVTPLKVLSHCIY  1402

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP--SDPELLMLL  1550
             + N +KA  L + +E+S LH  IFGHL  G +++ +H     +  T +P  S+ + L+LL
Sbjct  1403  KTNAKKATFLHILSELSSLHSLIFGHLFLGTVNRSLHHGIGVMEHTFDPTLSEDQFLLLL  1462

Query  1551  PTVFLYLDSVLIKAGSQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLS  1727
             P    Y   +  +   Q  + FE +  FY +ILL  FS WK + ++D+F  +  +  P S
Sbjct  1463  PASLSYFSLISKRLREQSHRDFEHLPYFYSKILLKGFSQWKRFSSKDIFQEQYGEFFPSS  1522

Query  1728  IEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQ  1907
              +E + +   +LL +S+ M++   A  G ++K + R+ LF S+ P+  +  D ++ D   
Sbjct  1523  AQELLCLTDLSLLGKSIHMLKYHFANNGDMMKLKKRLNLFKSIFPKFDSHDDLMNCDCQV  1582

Query  1908  VGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRL  2087
             + + SL QSLN +N  VAKI+LC+ LLF E          D  +   ++ S L   RI  
Sbjct  1583  IDSYSLRQSLNIINCVVAKISLCKILLFHEAGG-------DFKDVAVKMQSKLGRCRIHF  1635

Query  2088  LKMLVSSWRKIVEKFPMTADNSCQMEVENCS-VFRFLEVLILRNIVELSKEMHGCLVKLD  2264
             + +LV  W+ IV+KF + +      +  N S ++  LE  +L++I+EL+ EM   L++L 
Sbjct  1636  INILVDIWQFIVKKFSLASYQCRTAKGTNISLLYNHLEGFLLKSILELAGEMQNDLIQLQ  1695

Query  2265  SLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSS  2444
             ++ F+ +L ++   +RF D  T++ +R I+S LSEG+ S    +QL++AHSQF   + S 
Sbjct  1696  AISFLEQLIRSALLYRFGDFTTMKTVRVILSQLSEGRLSYDLYLQLLLAHSQFAPTLHSV  1755

Query  2445  NLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQ  2624
                    Q G    P+ S+++  VIP  +H     K     ++     LE++K+L +L  
Sbjct  1756  R-----KQAGSLLKPVSSILKCLVIPSLDHCENDVKHRGLTTELSSGPLEIVKILWILLL  1810

Query  2625  VKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEW  2804
             VKARQ+D +   +I +NL++L  LL  SY AT+  ID EI+NL+ +I+S+S         
Sbjct  1811  VKARQIDSDNGNDIDVNLKELHALLRHSYGATVNWIDLEIYNLMQQIESMS---------  1861

Query  2805  DYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYG  2984
               L  NA +                 D+E  E+  K Q R+N PIDP +C STVLYFPY 
Sbjct  1862  GLLSQNAKL-----------------DSETIEEWYKSQHRDNFPIDPDICVSTVLYFPYD  1904

Query  2985  RPNGPGV--VNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFAN  3158
             R     +  +NK++ DT     +   + V ++  YDP+FILR S H LS  Y+ PVEFA 
Sbjct  1905  RTFSDELPSINKIEPDT--PRKKVLYSHVEDKERYDPVFILRFSIHSLSKAYVAPVEFAG  1962

Query  3159  LGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDW  3338
              GLLA++  S+SSPD   R+L YG L+KFKNA+EKCQK+KDVM L+LLL+ +QN IEE W
Sbjct  1963  SGLLAIAFVSLSSPDQGIRRLAYGTLDKFKNAVEKCQKRKDVMGLRLLLNSVQNSIEEPW  2022

Query  3339  QKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRT  3518
             Q+IPSV A+F AEAS VLLDP+HDHYA I+   + S  +N++   +F N  WS SV+F+ 
Sbjct  2023  QRIPSVIALFAAEASCVLLDPAHDHYAAISTFFIHSSKLNMRV--MFDNFFWSTSVNFKA  2080

Query  3519  ERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSR  3698
             ER W+LR++Y+G+N+DDD  IYIRNSI E L+SFYVSPL+D ESK LII+ + KS KL +
Sbjct  2081  ERSWMLRLVYAGMNSDDDAAIYIRNSILEKLMSFYVSPLSDFESKNLIIEVINKSVKLHK  2140

Query  3699  MARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQK  3878
             + RHL+++C L SW SS+++        +          V L+VVN++I      +WLQ 
Sbjct  2141  ITRHLVKHCSLFSWFSSLISVARQRLNGNENKLFLKHVLVALKVVNDVISSGGISKWLQN  2200

Query  3879  YALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVE  4058
             + LEQL ELS +L   L + A +  E        L+++    K+SQKRK+YQPHFTLS+E
Sbjct  2201  HGLEQLMELSSNLFNFLFQDATLTNETVVLVNPFLRMIASVLKLSQKRKIYQPHFTLSIE  2260

Query  4059  GLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSE  4238
             GL+ + +A  VC     S   +  LEAILM+ PPV+I  M+ +++  F+ WA + ALQSE
Sbjct  2261  GLYQMYQAGSVCNQAIKSIKPELALEAILMNAPPVSIFMMNQERLQSFLIWATTTALQSE  2320

Query  4239  TKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSK  4418
             +   L   +  F  N S E+  EN ++S  LRWLTASVI GK+  K    DS  + +   
Sbjct  2321  SLQRLGSNESQFSRNNSREDFRENPVVSTFLRWLTASVINGKLHKKSYNWDSEFA-ETHN  2379

Query  4419  LINLHCLLEWNEE-SDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLK  4595
             L +LH LL   E  S + N  +   +E+LA++IF+LQ  LG + ++LPS V ALCLL+  
Sbjct  2380  LESLHSLLVHVENTSGQRNDIDIGAEEVLASTIFHLQLRLGVNHEVLPSVVCALCLLMFG  2439

Query  4596  NP--ASSGSEVLIGNA---AALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEI  4760
                 A S +++L       ++  S++RCP EAN  WRWSFYQPWKD S  LTDS+K+EE 
Sbjct  2440  ASKFAVSRTDLLKDYNTLISSYSSRVRCPPEANPTWRWSFYQPWKDDSLELTDSQKMEEY  2499

Query  4761  HACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             HAC  LL++ S +L    L S  +S  D+E+ G+F+WE S+L
Sbjct  2500  HACLTLLVIISNVLGAKKLESASLSPVDLERSGLFQWEISLL  2541



>ref|XP_006586082.1| PREDICTED: uncharacterized protein LOC100796806 [Glycine max]
Length=2543

 Score =   986 bits (2550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/1662 (38%), Positives = 947/1662 (57%), Gaps = 85/1662 (5%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGL----  173
             +L N P  V + + ++GVPFSLL+S+ FL+ S+L   SK WP MF+  L+ A+S L    
Sbjct  930   ILTNLPSHVVIPRDLVGVPFSLLLSVLFLDYSVLHHASKLWPVMFYAALDMAMSDLGIDG  989

Query  174   QEGRTEEFGDI-------------DSMEFASAALSLFLKEASLCMLFPITLSIYKSDLST  314
             Q     E  D+             D+ E  +   S+FLK+A   ++FP  + +    +S 
Sbjct  990   QNAAPVETSDLTLHPDSLTCSQLLDASEVDAVTFSIFLKQAPFHVIFPAMMCMNGPYISK  1049

Query  315   QQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRM  494
                +   LL  LSE     ++++   +LFW ++  + Y V P+ E+E L  LC  +V  +
Sbjct  1050  LSKIQEFLLHKLSESNDSLLLTNLQLILFWTHRIQLCYEVNPIAEVEQLLNLCVILVGSL  1109

Query  495   LRQFLNTKGDASSKCTRSLLPTK-CVQELIETIFYHPVVAASLECPLPCNADFTDTFSGD  671
             L Q L  +  +      +    +  +QE+I+TIF HP V  SL   L    + ++    +
Sbjct  1110  LAQLLVPESGSDWSINSAFYSLRHNIQEVIKTIFCHPCVLISLSFSLGSCQNLSNGNVEN  1169

Query  672   SMDKF-LESNKWRVIHKMDLHVINLLRTTFELLYFCDGQ---TSSFEACHARQVTKAFKN  839
              ++   + SN+    H     V+ +L  T E ++   G     S+ E   A  + KAFK 
Sbjct  1170  DINMLNVVSNEG--FHNFGNPVLKILTMTLESMWSLSGAHLCVSTAEDV-ANNIVKAFKR  1226

Query  840   VVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDN  1019
             + QKLFL  ++R +  I ++D+ PLLP +YA+H+L RF+ PF+LLELV+WMFSR + +D 
Sbjct  1227  LQQKLFLDVRNRFELYIRTEDVMPLLPTLYALHSLHRFLSPFQLLELVNWMFSRDEFDD-  1285

Query  1020  SFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILL  1199
                  ++ S + VG  +A   F +LS    Q    R   DLFW M E+     + E+I L
Sbjct  1286  ---LPIKKSSIFVGCSLAADAFSALSIYFQQSTENRAPYDLFWEMGEKNMKADIFEQIYL  1342

Query  1200  QVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSYCMF  1376
             +V + +    +D AD CLL+A  ++   K +QQ     L++ + + I+  P+ +LS+C++
Sbjct  1343  KVVDFSVCYEIDSADRCLLEAVNLLYKQKHLQQETFHPLLLVMWKIIMVTPLKVLSHCIY  1402

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP--SDPELLMLL  1550
             + N +KA  L + +E+S LH  IFGHL  G +++ +H     +  T +P  S+ + L+LL
Sbjct  1403  KTNAKKATFLHILSELSSLHSLIFGHLFLGTVNRSLHHGIGVMEHTFDPTLSEDQFLLLL  1462

Query  1551  PTVFLYLDSVLIKAGSQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLS  1727
             P    Y   +  +   Q  + FE +  FY +ILL  FS WK + ++D+F  +  +  P S
Sbjct  1463  PASLSYFSLISKRLREQSHRDFEHLPYFYSKILLKGFSQWKRFSSKDIFQEQYGEFFPSS  1522

Query  1728  IEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQ  1907
              +E + +   +LL +S+ M++   A  G ++K + R+ LF S+ P+  +  D ++ D   
Sbjct  1523  AQELLCLTDLSLLGKSIHMLKYHFAHNGDMMKLKKRLNLFKSIFPKFDSHDDLMNCDCQV  1582

Query  1908  VGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRL  2087
             + + SL QSLN +N  VAKI+LC+ LLF E          D  +   ++ S L   RI  
Sbjct  1583  IDSYSLRQSLNIINCVVAKISLCKILLFHEAGG-------DFKDVAVKMQSKLGRCRIHF  1635

Query  2088  LKMLVSSWRKIVEKFPMTADNSCQMEVENCS-VFRFLEVLILRNIVELSKEMHGCLVKLD  2264
             + +LV  W+ IV+KF + +      +  N S ++  LE  +L++I+EL+ EM   L++L 
Sbjct  1636  INILVDIWQFIVKKFSLASYQCRTAKGTNISLLYNHLEGFLLKSILELAGEMQNDLIQLQ  1695

Query  2265  SLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSS  2444
             ++ F+ +L ++   +RF D  T++ +R I+S LSEG+ S    +QL++AHSQF   + S 
Sbjct  1696  AISFLEQLIRSALLYRFGDFTTMKTVRVILSQLSEGRLSYDLYLQLLLAHSQFAPTLHSV  1755

Query  2445  NLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQ  2624
                    Q G    P+ S+++  VIP  +H     K     ++     LE++K+L +L  
Sbjct  1756  R-----KQAGSLLKPVSSILKCLVIPSLDHCENDVKHRGLTTELSSGPLEIVKILWILLL  1810

Query  2625  VKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEW  2804
             VKARQ+D +   +I +NL++L  LL  SY AT+  ID EI+NL+ +I+S+S         
Sbjct  1811  VKARQIDSDNGNDIDVNLKELHALLRHSYGATVNWIDLEIYNLMQQIESMS---------  1861

Query  2805  DYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYG  2984
               L  NA +                 D+E  E+  K Q R+N PIDP +C STVLYFPY 
Sbjct  1862  GLLSQNAKL-----------------DSETIEEWYKSQHRDNFPIDPDICVSTVLYFPYD  1904

Query  2985  RPNGPGV--VNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFAN  3158
             R     +  +NK++ DT     +   + V ++  YDP+FILR S H LS  Y+ PVEFA 
Sbjct  1905  RTFSDELPSINKIEPDT--PRKKVLYSHVEDKERYDPVFILRFSIHSLSKAYVAPVEFAG  1962

Query  3159  LGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDW  3338
              GLLA++  S+SSPD   R+L YG L+KFKNA+EKCQK+KDVM L+LLL+ +QN IEE W
Sbjct  1963  SGLLAIAFVSLSSPDQGIRRLAYGTLDKFKNAVEKCQKRKDVMGLRLLLNSVQNSIEEPW  2022

Query  3339  QKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRT  3518
             Q+IPSV A+F AEAS VLLDP+HDHYA I+   + S  +N++   +F N  WS SV+F+ 
Sbjct  2023  QRIPSVIALFAAEASCVLLDPAHDHYAAISTFFIHSSKLNMRV--MFDNFFWSTSVNFKA  2080

Query  3519  ERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSR  3698
             ER W+LR++Y+G+N+DDD  IYIRNSI E L+SFYVS L+D ESK LII+ + KS KL +
Sbjct  2081  ERSWMLRLVYAGMNSDDDAAIYIRNSILEKLMSFYVSSLSDFESKNLIIEVINKSVKLHK  2140

Query  3699  MARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQK  3878
             + RHL+++C L SW SS+++        +          V L+VVN++I      +WLQ 
Sbjct  2141  ITRHLVKHCSLFSWFSSLISVARQRLNGNENKLFLKHVLVALKVVNDVISSGGISKWLQN  2200

Query  3879  YALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVE  4058
             + LEQL ELS +L   L + A +  E        L+++    K+SQKRK+YQPHFTLS+E
Sbjct  2201  HGLEQLMELSSNLFNFLFQDATLTNETVVLVNPFLRMIASVLKLSQKRKIYQPHFTLSIE  2260

Query  4059  GLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSE  4238
             GL+ + +A  VC     S   +  LEAILM+ PPV+I  M+ +++  F+ WA + ALQSE
Sbjct  2261  GLYQMYQAGSVCNQAIKSIKPELALEAILMNAPPVSIFMMNQERLQSFLIWATTTALQSE  2320

Query  4239  TKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSK  4418
             +   L   +  F  N S E+  ENS++S  LRWLTASVI GK+  K    DS  + +   
Sbjct  2321  SLQRLGSNESQFSRNNSREDFRENSVVSTFLRWLTASVINGKLHKKSYNWDSEFA-ETHN  2379

Query  4419  LINLHCLLEWNEE-SDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLK  4595
             L +LH LL   E  S + N  +   +E+LA++IF+LQ  LG + ++LPS V ALCLL+  
Sbjct  2380  LESLHSLLVHVENTSGQRNDIDIGAEEVLASTIFHLQLRLGVNHEVLPSVVCALCLLMFG  2439

Query  4596  NP--ASSGSEVLIGNA---AALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEI  4760
                 A S +++L       ++  S++RCP EAN  WRWSFYQPWKD S  LTDS+K+EE 
Sbjct  2440  ASKFAVSRTDLLKDYNTLISSYSSRVRCPPEANPTWRWSFYQPWKDDSLELTDSQKMEEY  2499

Query  4761  HACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             HAC  LL++ S +L    L S  +S  D+E+ G+F+WE S+L
Sbjct  2500  HACLTLLVIISNVLGAKKLESASLSPVDLERSGLFQWEISLL  2541



>ref|XP_007146471.1| hypothetical protein PHAVU_006G043300g [Phaseolus vulgaris]
 gb|ESW18465.1| hypothetical protein PHAVU_006G043300g [Phaseolus vulgaris]
Length=2547

 Score =   982 bits (2539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/1670 (37%), Positives = 949/1670 (57%), Gaps = 98/1670 (6%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS----GL  173
             +L N P+ V + + ++GVPFSLL+S+ FL+ S+L   SK WP +F+ GL+ A+S    G 
Sbjct  931   MLTNLPLHVVIPRNLVGVPFSLLLSVLFLDYSVLHHASKLWPAVFYAGLDMAMSNLGIGS  990

Query  174   QEGRTEEFGD-------------IDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLST  314
             Q     E  D             +D+ E  +   S+FLK+A   ++FP  + +    +S 
Sbjct  991   QNAAPVENSDHRLYPESLTCSQLLDASEADAVTFSIFLKQAPFHVIFPAMMCMNGPYISK  1050

Query  315   QQGLHNLLLANLSERTPD-HIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDR  491
                +  LLL  LS    D  ++ +   VL W ++  + Y V P+ E+E L  +C  +V  
Sbjct  1051  LSKIQELLLHKLSVSINDCLLLPNLQLVLSWTHRMQLCYEVNPMAEIEQLLNVCVILVGN  1110

Query  492   MLRQFLNTKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGD  671
             +L Q L     +             ++E+I+T+F+HP +  SL   L     + +  +G+
Sbjct  1111  LLVQLLVPASCSDCSINSFFCSRHNIREVIKTVFFHPCILMSLSFSL---GSYQNIANGN  1167

Query  672   SMDKFLESNKWRVI-----HKMDLHVINLLRTTFELLY--FCDGQTSSFEACHARQVTKA  830
               D F   N   V+     HK    ++ +L  T + ++  F     +S     A    K 
Sbjct  1168  VEDDF---NMLNVVSNEGFHKFGNPIVKILSMTLDHMWSLFSSHLWASTAEDVASLFVKD  1224

Query  831   FKNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDL  1010
             FK + QKLFL  +DR + C+ ++D+ PLLP +  +HTL +F+ PFELLELV WMFSR+++
Sbjct  1225  FKGLQQKLFLDVRDRFELCVRTEDVMPLLPTLCTLHTLHKFLSPFELLELVDWMFSRVEV  1284

Query  1011  EDNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEK  1190
             +D   ++SL    L VG  +A   F +LS    Q    R   DLFW M  +     + E+
Sbjct  1285  DDLPIKKSL----LSVGCSLAADAFSALSIYFQQSSENRAPYDLFWEMDVKNMKADIFEQ  1340

Query  1191  ILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSY  1367
             I  +V E +    +D AD CLL+A   + T K MQ+     L++ + + I+  P+ +LS+
Sbjct  1341  IYSRVVECSVCFEVDSADRCLLEAVNALYTQKHMQEETFHPLLLIMWKIIMVTPLKILSH  1400

Query  1368  CMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP--SDPELL  1541
             C+++ N +KA  L + TE+S LH  IFGH   G++++ +H     +   S+   S+ + +
Sbjct  1401  CIYKTNVKKARFLHILTELSSLHSLIFGHSFLGIVNRSLHNDIGVMEHISDLTLSEDQFI  1460

Query  1542  MLLPTVFLYLDSVLIKAGSQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNL  1718
             +LLP    YL  +  + G Q  K  E I  FY ++LL  FS W+ + ++D+F+ +  +  
Sbjct  1461  LLLPASLSYLSLISKRFGEQSPKDCEPIPYFYSKVLLKGFSQWRSFSSKDIFEEQYGELF  1520

Query  1719  PLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFD  1898
             P S++E + +   +LL +S+ M+Q   AL G  +K + R+ LF S+CP+ ++  D +D +
Sbjct  1521  PSSVQELLCLIDHSLLGKSIHMLQYHFALNGDSIKLKKRLNLFKSICPKLASHDDLMDCE  1580

Query  1899  PSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSR  2078
                + + S  QSLN +N  V+KI+LCR LLF  H K   GLK+       ++ S +  SR
Sbjct  1581  SQVIDSYSPCQSLNIINHVVSKISLCRILLF--HEKEDGGLKD----VSVKMQSKMGRSR  1634

Query  2079  IRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSV-FRFLEVLILRNIVELSKEMHGCLV  2255
             IR +  LV  W+ IV+KF + +D S   +  + S+ +  +E  +L++I+EL  +M   L+
Sbjct  1635  IRFINTLVDIWQFIVKKFSLASDQSRTAKGTDISLLYNHMEGFLLKSILELVGKMQNDLI  1694

Query  2256  KLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAI  2435
             +L S+ F+ +L ++   +RF D  T++ LR I+S L+EG+ S    +QL++AHSQF   +
Sbjct  1695  QLQSISFLEQLVRSALLYRFGDFTTMKTLRVILSQLNEGRLSFDLYLQLLLAHSQFAPTL  1754

Query  2436  CSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRV  2615
              S +   G         P+ S+++  VIP  ++     K     +      LE++K+L +
Sbjct  1755  RSVHKPAGS-----FLKPVSSILKCLVIPSIDYRESDVKQTGLTTVLSSGPLEIVKMLWI  1809

Query  2616  LFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSIS---DSN  2786
             L  +KARQ D +   +I INL++L  LL  SY AT+  I+  I+NL+ +I+S+S     N
Sbjct  1810  LLWMKARQTDSDYGNDIKINLKELHALLRHSYGATVSWINLAIYNLMQQIESMSCLLSQN  1869

Query  2787  ISIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTV  2966
             + +                             D+E  E+  +   R+N PIDP +C STV
Sbjct  1870  VKL-----------------------------DSETIEEWYRSHQRDNFPIDPDICVSTV  1900

Query  2967  LYFPYGRPNGPGV--VNKVQKDTF-DSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYI  3137
             LYFP+ R     +   NK++ DT    +H    + V +R  YDP FILR S + LS  Y+
Sbjct  1901  LYFPFDRSISDELPSANKIEPDTVRKKVH---YSHVEDRERYDPAFILRFSIYSLSKAYV  1957

Query  3138  EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQ  3317
             EPVEFA  GLLAV+  S+SS D+  R+L Y  L+KFKNALEKCQK+KDVM L+LLL+ +Q
Sbjct  1958  EPVEFAGSGLLAVAFVSMSSLDNGIRRLAYATLDKFKNALEKCQKRKDVMGLRLLLNSVQ  2017

Query  3318  NCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWS  3497
             N IEE WQ+IPSV ++F AEAS VLLDP++DHYA I+  L+ S  +N++ IP+F N  WS
Sbjct  2018  NSIEEPWQRIPSVISLFAAEASCVLLDPTNDHYAAISTFLIHSSKLNMRVIPMFDNFFWS  2077

Query  3498  DSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVK  3677
              SV+F+ ER WILR++ +GLN+DDD  IYIRNSI ETL+SFYVSPL+D ESK LII+ ++
Sbjct  2078  TSVNFKAERSWILRLVCAGLNSDDDAMIYIRNSILETLMSFYVSPLSDFESKNLIIEVIR  2137

Query  3678  KSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVV-LEVVNEIIFFR  3854
             KS K  ++  HL+++C   SW SS++ S    +++  +   F +  +V L+VVN++I F 
Sbjct  2138  KSVKSHKITCHLVKHCSFFSWFSSLI-SVSRQRFNGEENKVFLKHVLVALKVVNDVISFG  2196

Query  3855  HTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQ  4034
                +WL+ ++LEQL ELS +L   L     +  E        LQ++  T K+SQ RK+YQ
Sbjct  2197  RISKWLKNHSLEQLMELSSNLFNFLFHDGTLANETLFLVNPFLQMVASTLKLSQSRKIYQ  2256

Query  4035  PHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWA  4214
             PHFTLS+EGL+ + +   V   G  S   +  LEAILM+  PV+I  M+ +++  F+ WA
Sbjct  2257  PHFTLSIEGLYQMYQTGSVYNKGKESIKPELALEAILMNASPVSIFSMNQERLQSFLIWA  2316

Query  4215  MSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDS  4394
              + AL+SE+   L   +  F  N   EE  ENS++S LLRWLTASVI+GK+  K    DS
Sbjct  2317  TTTALKSESIRRLGFNEYQFFRNDYREEFRENSVVSTLLRWLTASVIIGKLRKKSDYRDS  2376

Query  4395  SHSCDRSKLINLHCLLEWNEE-SDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVS  4571
                 +     +L+ LL + E  S + N      +E+LA++I YLQ  LG + ++LPS V 
Sbjct  2377  G-VAETHNFESLNSLLVYVENTSGQRNDIGIGAEELLASTILYLQLRLGVNHEVLPSVVC  2435

Query  4572  ALCLLLL--KNPASSGSEVLIGN---AAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLT  4736
             ALCLL+    N A   +++L       ++  S++RCP E N +WRWSFYQPWKD S  LT
Sbjct  2436  ALCLLIFGASNFAVGKTDLLQDYDTLVSSHSSRVRCPPEVNPSWRWSFYQPWKDDSLELT  2495

Query  4737  DSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             DS+++E  HAC  LL++ S +L    L S  +S  D+EK G+F+WERS+L
Sbjct  2496  DSQQMEAYHACLSLLVIISNVLGGKKLESASLSPVDLEKSGLFQWERSLL  2545



>ref|XP_008809188.1| PREDICTED: uncharacterized protein LOC103720976 [Phoenix dactylifera]
 ref|XP_008809189.1| PREDICTED: uncharacterized protein LOC103720976 [Phoenix dactylifera]
Length=2680

 Score =   979 bits (2532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/1698 (38%), Positives = 972/1698 (57%), Gaps = 101/1698 (6%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             D+L+NFP++++++++        L  + F E   L  VS  WP+MF  GLE      +  
Sbjct  1003  DILKNFPLLLTMAQQHFRSHIPFLSLVLFSEQKFLAKVSNLWPDMFICGLEMIEGSDRNN  1062

Query  183   RTEEFGDI---------------DSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQ  317
                + G +               DS E A++A  LFL+ A    LF   LS ++S     
Sbjct  1063  CRVDNGHLIHSNESVSSVSQNHLDSRESAASAFCLFLRHAPFYTLFSAFLS-FESWKKHS  1121

Query  318   QGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRML  497
               + +L  A ++E   D +++   Y LFW  Q   SY+ +P + LE L  +CF +VD + 
Sbjct  1122  TRMLDLFRAKIAEGLIDDLITYLRYALFWSYQILSSYKAKPSDILEELFMICFTLVDYIF  1181

Query  498   RQFLNTKGDAS------SKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDT  659
              + +    D +      + CT     T+ VQ+L++ IF+HPVV+ S+  PL C+ +  D 
Sbjct  1182  DRIVVLASDPAKFQTEGTSCT-----TQYVQDLVDLIFHHPVVSLSVSHPLCCSQEHADE  1236

Query  660   FSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQ---TSSFEACHARQVTKA  830
               GDS + FL S K +  H M+  ++  L   FE L   + Q    S         V + 
Sbjct  1237  SLGDSEEAFLNSLK-QNFHPMNNLMLQFLIKVFEFLLALEYQNSYASEVRGPFTESVLEV  1295

Query  831   FKNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDL  1010
              K +VQK+ L F++  D C+E +DL PL+P          F+ PFELLELV WMFS+++ 
Sbjct  1296  PKLLVQKVVLLFRENFDLCVEKRDLEPLIPCYNIFDAFMHFVSPFELLELVFWMFSKLEN  1355

Query  1011  EDNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEK  1190
             ED+        +V+ + LHIA    + L   + QP  +   S LFW M  + F+  +L++
Sbjct  1356  EDSGCTSVFTSAVI-LCLHIANGTLNMLYNLLQQPKLKSE-SYLFWEMKIKSFNTAILQR  1413

Query  1191  ILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLV---MAISRFIVNIPVNLL  1361
             +  ++ + +   +L+ AD+CL      V + +V  +  P L+   M +SR I+N PV LL
Sbjct  1414  VFYKILDFSISFNLESADICLFSVVDAVYSLRV-AKPQPALLPLYMLLSRMIINSPVKLL  1472

Query  1362  SYCMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPS-----  1526
              +C++  +K KA+ LF   E+SP+H+ +FG +  G++ K + +      + ++ S     
Sbjct  1473  LHCLYPTSKIKAKTLFRLIEVSPMHMRLFGQIFLGILAKHLTVLDALNVDGASASWGKVT  1532

Query  1527  ---------DPELLMLLPTVFLYLDSVLIKAGSQ-VKYFEKIVSFYWRILLHIFSDWKCY  1676
                      + + ++LLP+   YL S L     Q +K F  I +FY++IL+  FS+W  Y
Sbjct  1533  DMNCDYILSEDDFVLLLPSALSYLMSSLCNNRKQDIKLFGSIPTFYFKILMDGFSNWNSY  1592

Query  1677  VTRDMFDIESFDNLPL-SIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDS  1853
             V+R  F  E +D   L S+E+F ++F+ +LL ++  M+     + G  +  + R+++FD 
Sbjct  1593  VSRSNFQ-EEYDEFSLTSMEDFHNLFNNSLLGKAATMLHYFFIINGNSIGKKQRLKIFDD  1651

Query  1854  VCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFS-SGLK--  2024
             +    S   D LD D     T S ++SL  +N   AK+ L R LLFP  +    SG++  
Sbjct  1652  IYSHSS---DLLDCDFKAFNTFSYKESLKLINEISAKMALTRLLLFPPESLMQVSGIEIE  1708

Query  2025  -EDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPMTADNS-CQMEVENCSVFRFLE  2198
               DKM    E    ++ +++R + +LV +   IV  FP   + +      ++C VFRFLE
Sbjct  1709  GLDKMTVEWE-SERMNSAKLRFMSILVKTLDWIVRGFPQNMEGTLTSCSADSCRVFRFLE  1767

Query  2199  VLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKF  2378
               ILRNI++LS ++   L++L S+PF+    ++   +RF+DP+TL+ +R I++SLSEG F
Sbjct  1768  HSILRNIIQLSIKIKTYLIQLPSIPFLKLFIRSCLLNRFEDPVTLKAIRCILASLSEGSF  1827

Query  2379  SCVKIIQLMVAHSQFE-TAIC--SSNLSTGISQLGLTFTPLPSLMRSFVIPLFNH-----  2534
             S  +I+ L++ HSQF  T +C  +++ S+  +  G    P+PS+++S  +   +      
Sbjct  1828  SSTEILDLLLGHSQFVLTILCGDATSDSSSFAPSGTLLQPVPSILKSVDVICIDQITQKG  1887

Query  2535  NSIC------RKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVFL  2696
               IC      + +N  + K   ++LELIKLLRVL+  + R+ +    ++  ++ ++L+FL
Sbjct  1888  GVICDMLSKLKNENCSLEK---RRLELIKLLRVLYHFRNRENNTGLVKDDRMDSKELIFL  1944

Query  2697  LLSSYNATLCDIDFEIHNLVNEIKSISDSNI-SIAEWDYLWGNAVVKARKERELVQTVSC  2873
             LLS+Y ATL + D EI +L+++I+SI  S   +IAE DYLWG++ +K +KE  + +  SC
Sbjct  1945  LLSAYGATLSETDLEILHLMHQIESIEGSEYDTIAEMDYLWGSSALKFKKELTVDKLASC  2004

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVN--KVQKDTFDSMHE  3047
             +       E+  ++ FREN+P+D K+C  TVL+F Y R +   +V+  K+ +D F    E
Sbjct  2005  S------TEERHRMLFRENIPVDTKLCMKTVLHFCYNRSSRTAIVSLKKLLEDNFVDTTE  2058

Query  3048  DCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
               S+       YDP FILR S HCL MGYIE +EF+ LGLLA++  SISSPDDD RKLGY
Sbjct  2059  RPSSNDHLLQRYDPAFILRFSIHCLLMGYIEAIEFSRLGLLAITFVSISSPDDDLRKLGY  2118

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
               L  FK AL+  +K KD ++LQLLL+YLQN I E WQ+IPS+TAIF AEASF LLDPS 
Sbjct  2119  ESLGSFKKALQNYRKSKDALQLQLLLTYLQNGITEPWQQIPSMTAIFAAEASFTLLDPSQ  2178

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
             +H+ TI+K LM+SP  NL S+PLF  L  S S+ F+ +RLWILR++Y+GLN + D  IY+
Sbjct  2179  NHFFTISKLLMRSPKANLMSVPLFHTLFESSSIHFKMDRLWILRLIYAGLNLNCDAKIYM  2238

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFC  3767
             RN + E LLSFY S L+D ESK LI+Q +KKS KL  +  +L++ CGL+ WLS+V+  F 
Sbjct  2239  RNKLLELLLSFYASSLSDPESKILILQIIKKSVKLPMLVHYLVKECGLLPWLSTVLL-FY  2297

Query  3768  G--IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGA  3941
             G  +  DH K        +VL+V+N+++ +R   EWLQ+ A+EQLSE S HL  + V   
Sbjct  2298  GERLGGDH-KESSLRAMELVLKVINDVVSWRTIAEWLQECAVEQLSEFSTHLYGVFVNAI  2356

Query  3942  QMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGC-YSPI  4118
             ++LKE+ +    +L +L  T ++SQKRK++QPHFTLS++GLF L +AI    N   ++  
Sbjct  2357  KLLKENVSLVNSMLHVLGSTLRLSQKRKIFQPHFTLSLKGLFQLYQAIYSEFNNMEFNLT  2416

Query  4119  AKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEE  4298
              +  ++ ILMSTP   +  MD  ++SK + WA+S  L+S +      ++    + +S E+
Sbjct  2417  IELAIDTILMSTPVPVVSHMDRARLSKLLMWAISSVLRSFSDQSYLTKEPDPDMLISYED  2476

Query  4299  ETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLE-WNEESDRENG  4475
               E S ISKLLRW TAS+ILG IS K S +  +H    S    L CLLE   +E + E  
Sbjct  2477  HGEESRISKLLRWATASLILGSISNKASAM-KTHVSLGSSCKTLQCLLEDVIKEGENEQN  2535

Query  4476  KEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGS----EVLIGNAAA  4643
                A  E LA  I YLQQLLG +   L S + ALCLLL  N ++       +V  G  A 
Sbjct  2536  NSHA-NEALAIVILYLQQLLGRNSSGLSSVILALCLLLFPNASNIADKEYLDVNRGQIAL  2594

Query  4644  LCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYS  4823
             LCSKIRCP EAN +WRWSFYQPWKD SS  ++ E++EE  ACQ LL++ S  L       
Sbjct  2595  LCSKIRCPVEANPSWRWSFYQPWKDLSSEQSEMEQMEEEQACQSLLILFSNALGGRPFCL  2654

Query  4824  KLISLKDVEKLGVFEWER  4877
              ++S KDVE+ G+FEWE+
Sbjct  2655  PVLSPKDVEQSGLFEWEK  2672



>ref|XP_010917532.1| PREDICTED: uncharacterized protein LOC105042129 isoform X2 [Elaeis 
guineensis]
Length=2681

 Score =   972 bits (2514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/1689 (38%), Positives = 960/1689 (57%), Gaps = 80/1689 (5%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS-----  167
             D+L+NFP ++++ ++        L  + F E   L  VS  WP+MF +GLE         
Sbjct  1001  DILKNFPFLLTIVRQHFRSHIPFLSLVLFSEQKFLAKVSNLWPDMFISGLEMIEGSDRND  1060

Query  168   -GLQEGRTEEFGD---------IDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQ  317
              G   G +    +         +DS E A++A  LFL+ A    LF   LS ++S     
Sbjct  1061  CGADNGHSIHSNECVSSVTRKHLDSKESAASAFCLFLRHAPFYALFSAFLS-FESWQKHS  1119

Query  318   QGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRML  497
               + +LL A ++E T D +++   Y LFW  Q   SY+ +P + L  L  +CF ++D + 
Sbjct  1120  TRMLDLLRAKIAEGTFDDLITYLRYALFWSYQILSSYKAKPSDNLGELCAICFPLIDYIF  1179

Query  498   RQFLNTKGD-ASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDS  674
              + +    D A  +  ++   TK VQ++++ IF+HPVV+  +  PL C+ +  D   GD 
Sbjct  1180  DRIVVLASDPAKFQTEKTSCITKYVQDVVDLIFHHPVVSLFVSQPLCCSRERADENLGDG  1239

Query  675   MDKFLESNKWRVIHKMDLHVINLLRTTFELLY---FCDGQTSSFEACHARQVTKAFKNVV  845
              + FL S K    H M+  ++  L   FE L    + +G  S         V +  K +V
Sbjct  1240  EEAFLNSLKQN-FHPMNNLMLQFLIKVFEFLLALEYQNGYASKVHDPFTESVLEDPKLLV  1298

Query  846   QKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSF  1025
             QK+ L F+++ D C+E +DL PL+P     H    FI PFELLELV WMFS+++ E +  
Sbjct  1299  QKVVLLFREKFDLCVEKRDLEPLMPIYNIFHAFMHFISPFELLELVFWMFSKLENEVSGC  1358

Query  1026  QQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQV  1205
                L+ + + + L+IA     +L   + QP  +   S LFW    + F+  +++++  ++
Sbjct  1359  TSVLKSAAI-LCLYIANGSLSTLCNLLQQPKLQSE-SHLFWEKKVKSFNTAIVQRVFYKI  1416

Query  1206  YEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLV---MAISRFIVNIPVNLLSYCMF  1376
              + A   +++ AD+ L      V   +V  + +PTL+   M + R I+N PV  L +C++
Sbjct  1417  LDFAISFNVESADIFLFSVVNAVYIQRV-AKPHPTLLPLYMLLPRMIINSPVKFLLHCLY  1475

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHL---------QTNAIRETSNP--  1523
               +K KA+ LF   E+SP+H+ +FG +  G++ K + +           + ++ T     
Sbjct  1476  PTSKIKAKTLFRLIEVSPMHMRLFGKIFLGILGKDLTVLDVLNVDGASASWVKVTDMDCN  1535

Query  1524  ---SDPELLMLLPTVFLYLDSVLIKAGSQ-VKYFEKIVSFYWRILLHIFSDWKCYVTRDM  1691
                S+ + ++LLP    YL S L K   Q +K F  I +FY+RIL+  FS+WK YV+   
Sbjct  1536  NILSEDDFVLLLPAALSYLLSSLCKYNKQDIKLFRSIPTFYFRILIDGFSNWKSYVSGRN  1595

Query  1692  FDIESFDNLPL-SIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQK  1868
             F  E +D   L S+E+F ++F+ +LL +++ M+     + G  V  + R+++FD +    
Sbjct  1596  FQ-EEYDEFSLTSMEDFHNLFNSSLLGKAITMLHYFFIINGNSVGKKQRLKIFDDIYSHS  1654

Query  1869  STCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFS-SGLKEDKMETC  2045
             S   D LD D     TCS ++SL  +N   AKI L R LLFP  +    SG++    +  
Sbjct  1655  S---DLLDCDFKAFSTCSYKESLKMINEISAKIALTRLLLFPPESLMQISGIEIGLGKMT  1711

Query  2046  AELHS-TLDVSRIRLLKMLVSSWRKIVEKFPMTADNSCQM-EVENCSVFRFLEVLILRNI  2219
              E  S  ++ +++R + +LV +  +IV  FP   +++      ++C VFRFLE  ILRNI
Sbjct  1712  VEWESERMNSAKLRFMSILVRTLDRIVRGFPQNMESTATYCSADSCRVFRFLEHSILRNI  1771

Query  2220  VELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQ  2399
             ++LS ++   L++L S+PF+    ++   +RF+D +TL+ +R I+++LSEG FS  +I+ 
Sbjct  1772  IQLSVKIETYLIQLPSIPFLKLFIRSCLLNRFEDHVTLKAIRCILAALSEGNFSSTEILD  1831

Query  2400  LMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHN-----------SIC  2546
             L++ HSQF + I  ++ +   S    + T  PS+++S  I   + N           S  
Sbjct  1832  LLLGHSQFVSTILCTDATLDSSAFAPSGT-FPSILKSVDIVCIDQNTQKGRVTCDRLSKL  1890

Query  2547  RKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLC  2726
             + DN    K   ++LELIKLLRVL+  + R+ +    +  G++ R+L+FLLLS+Y ATL 
Sbjct  1891  KNDNCSREK---RRLELIKLLRVLYHFRNRENNTGLVKVDGMDSRELIFLLLSAYGATLS  1947

Query  2727  DIDFEIHNLVNEIKSISDSNI-SIAEWDYLWGNAVVKARKERELVQTVSCN-LSDAEVAE  2900
             + D EI +L++EI+S+  S   +IAE DY+WG + +K +KE    +  S N + D    E
Sbjct  1948  ETDLEILHLMHEIESLEGSEYDTIAEMDYMWGTSALKFKKELTADKLASLNKIVDCGTTE  2007

Query  2901  DCRKIQFRENLPIDPKMCASTVLYFPYGRPN--GPGVVNKVQKDTFDSMHEDCSAEVANR  3074
             + R++ FREN+P+D  +C  TVL+F Y R +   P  + K+  D F +  E  S+     
Sbjct  2008  EQRRMLFRENIPVDTNLCMKTVLHFCYDRSSQAAPVSLKKLLDDNFVNTTERPSSNSHLL  2067

Query  3075  HIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNA  3254
               YDP FILR S HCL MGYIE +EF+ LGLLA++  SISSPDD  RKLGY  L  FK A
Sbjct  2068  QQYDPAFILRFSIHCLLMGYIEAIEFSRLGLLAITFVSISSPDDGLRKLGYESLGNFKMA  2127

Query  3255  LEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKH  3434
             L+  +K KD ++LQLLL+YLQN I E WQ+IPS+TAIF AEASF LLD S +H+ TI+K 
Sbjct  2128  LQNYRKSKDALQLQLLLTYLQNGITEPWQQIPSMTAIFTAEASFTLLDSSQNHFFTISKL  2187

Query  3435  LMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLL  3614
             LM S  VNL S+PLF  L  S S+ F+ +RLWILR++Y+GLN + D  IY+RN   E LL
Sbjct  2188  LMHSSKVNLMSVPLFHTLFESSSIHFKMDRLWILRLIYAGLNLNSDAKIYMRNKFLELLL  2247

Query  3615  SFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFC-GIKYDHWK  3791
             SFY S L+D ESK LI+Q +KKS KL  +  +L++ CGL+ WLS+V+  +C G+  DH K
Sbjct  2248  SFYASSLSDPESKMLILQIMKKSVKLPMLVHYLVKECGLLPWLSTVLLFYCEGLGGDH-K  2306

Query  3792  GFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFT  3971
                     +VLEV+N+++  R   EWLQ+ ALEQLSE S HL  + V   ++LKE+ +  
Sbjct  2307  ESSLRAVELVLEVINDVVSSRTITEWLQECALEQLSEFSTHLYGVFVGAFKLLKENVSLI  2366

Query  3972  KLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGC-YSPIAKTGLEAILM  4148
               +L ++  T ++SQKRK++QPHFTLS+E LF L + I    N   ++   +  ++ ILM
Sbjct  2367  NSMLHVIVSTLRLSQKRKIFQPHFTLSLESLFRLYQVIYSEFNNMEFNLTIELAIDTILM  2426

Query  4149  STPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKL  4328
             STP   +  MD  ++SK + W +S AL+S +      ++    + +S E+  + S ISKL
Sbjct  2427  STPVPVVSHMDRARLSKLLMWTISSALRSFSDQSYLGKEPDPDMLISCEDHGKESQISKL  2486

Query  4329  LRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLE--WNEESDRENGKEFACQEIL  4502
             LRW TASVILG IS + S++  +H    S    L CLLE    EE + E     A  E L
Sbjct  2487  LRWATASVILGSISNRTSEM-KTHVSLGSSCKTLQCLLEDVIKEEGETEQNNSGA-NEAL  2544

Query  4503  AASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGS----EVLIGNAAALCSKIRCPA  4670
             A  I YLQQLLG +   L S + ALCLLLL N  +       +V  G  + LCSKIRCP 
Sbjct  2545  AIEILYLQQLLGRNSSGLSSVILALCLLLLPNACNIADKEYLDVNHGQVSLLCSKIRCPF  2604

Query  4671  EANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVE  4850
             E N AWRWSFYQPWKD S   ++ E++EE  ACQ LLL+ S  L     Y  ++S KDVE
Sbjct  2605  EVNPAWRWSFYQPWKDLSLEQSEMEQMEEEQACQNLLLLFSNALGGRPSYLPVLSHKDVE  2664

Query  4851  KLGVFEWER  4877
             + G+FEWER
Sbjct  2665  QCGLFEWER  2673



>ref|XP_010917531.1| PREDICTED: uncharacterized protein LOC105042129 isoform X1 [Elaeis 
guineensis]
Length=2682

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/1692 (38%), Positives = 963/1692 (57%), Gaps = 85/1692 (5%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS-----  167
             D+L+NFP ++++ ++        L  + F E   L  VS  WP+MF +GLE         
Sbjct  1001  DILKNFPFLLTIVRQHFRSHIPFLSLVLFSEQKFLAKVSNLWPDMFISGLEMIEGSDRND  1060

Query  168   -GLQEGRTEEFGD---------IDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQ  317
              G   G +    +         +DS E A++A  LFL+ A    LF   LS ++S     
Sbjct  1061  CGADNGHSIHSNECVSSVTRKHLDSKESAASAFCLFLRHAPFYALFSAFLS-FESWQKHS  1119

Query  318   QGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRML  497
               + +LL A ++E T D +++   Y LFW  Q   SY+ +P + L  L  +CF ++D + 
Sbjct  1120  TRMLDLLRAKIAEGTFDDLITYLRYALFWSYQILSSYKAKPSDNLGELCAICFPLIDYIF  1179

Query  498   RQFLNTKGD-ASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDS  674
              + +    D A  +  ++   TK VQ++++ IF+HPVV+  +  PL C+ +  D   GD 
Sbjct  1180  DRIVVLASDPAKFQTEKTSCITKYVQDVVDLIFHHPVVSLFVSQPLCCSRERADENLGDG  1239

Query  675   MDKFLESNKWRVIHKMDLHVINLLRTTFELLY---FCDGQTSSFEACHARQVTKAFKNVV  845
              + FL S K    H M+  ++  L   FE L    + +G  S         V +  K +V
Sbjct  1240  EEAFLNSLKQN-FHPMNNLMLQFLIKVFEFLLALEYQNGYASKVHDPFTESVLEDPKLLV  1298

Query  846   QKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSF  1025
             QK+ L F+++ D C+E +DL PL+P     H    FI PFELLELV WMFS+++ E +  
Sbjct  1299  QKVVLLFREKFDLCVEKRDLEPLMPIYNIFHAFMHFISPFELLELVFWMFSKLENEVSGC  1358

Query  1026  QQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQV  1205
                L+ + + + L+IA     +L   + QP  +   S LFW    + F+  +++++  ++
Sbjct  1359  TSVLKSAAI-LCLYIANGSLSTLCNLLQQPKLQSE-SHLFWEKKVKSFNTAIVQRVFYKI  1416

Query  1206  YEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLV---MAISRFIVNIPVNLLSYCMF  1376
              + A   +++ AD+ L      V   +V  + +PTL+   M + R I+N PV  L +C++
Sbjct  1417  LDFAISFNVESADIFLFSVVNAVYIQRV-AKPHPTLLPLYMLLPRMIINSPVKFLLHCLY  1475

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHL---------QTNAIRETSNP--  1523
               +K KA+ LF   E+SP+H+ +FG +  G++ K + +           + ++ T     
Sbjct  1476  PTSKIKAKTLFRLIEVSPMHMRLFGKIFLGILGKDLTVLDVLNVDGASASWVKVTDMDCN  1535

Query  1524  ---SDPELLMLLPTVFLYLDSVLIKAGSQ-VKYFEKIVSFYWRILLHIFSDWKCYVTRDM  1691
                S+ + ++LLP    YL S L K   Q +K F  I +FY+RIL+  FS+WK YV+   
Sbjct  1536  NILSEDDFVLLLPAALSYLLSSLCKYNKQDIKLFRSIPTFYFRILIDGFSNWKSYVSGRN  1595

Query  1692  FDIESFDNLPL-SIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQK  1868
             F  E +D   L S+E+F ++F+ +LL +++ M+     + G  V  + R+++FD +    
Sbjct  1596  FQ-EEYDEFSLTSMEDFHNLFNSSLLGKAITMLHYFFIINGNSVGKKQRLKIFDDIYSHS  1654

Query  1869  STCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFS-SGLKEDKMETC  2045
             S   D LD D     TCS ++SL  +N   AKI L R LLFP  +    SG++    +  
Sbjct  1655  S---DLLDCDFKAFSTCSYKESLKMINEISAKIALTRLLLFPPESLMQISGIEIGLGKMT  1711

Query  2046  AELHS-TLDVSRIRLLKMLVSSWRKIVEKFPMTADNSCQM-EVENCSVFRFLEVLILRNI  2219
              E  S  ++ +++R + +LV +  +IV  FP   +++      ++C VFRFLE  ILRNI
Sbjct  1712  VEWESERMNSAKLRFMSILVRTLDRIVRGFPQNMESTATYCSADSCRVFRFLEHSILRNI  1771

Query  2220  VELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQ  2399
             ++LS ++   L++L S+PF+    ++   +RF+D +TL+ +R I+++LSEG FS  +I+ 
Sbjct  1772  IQLSVKIETYLIQLPSIPFLKLFIRSCLLNRFEDHVTLKAIRCILAALSEGNFSSTEILD  1831

Query  2400  LMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHN-----------SIC  2546
             L++ HSQF + I  ++ +   S    + T  PS+++S  I   + N           S  
Sbjct  1832  LLLGHSQFVSTILCTDATLDSSAFAPSGT-FPSILKSVDIVCIDQNTQKGRVTCDRLSKL  1890

Query  2547  RKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLC  2726
             + DN    K   ++LELIKLLRVL+  + R+ +    +  G++ R+L+FLLLS+Y ATL 
Sbjct  1891  KNDNCSREK---RRLELIKLLRVLYHFRNRENNTGLVKVDGMDSRELIFLLLSAYGATLS  1947

Query  2727  DIDFEIHNLVNEIKSISDSNI-SIAEWDYLWGNAVVKARKERELVQTVSCN-LSDAEVAE  2900
             + D EI +L++EI+S+  S   +IAE DY+WG + +K +KE    +  S N + D    E
Sbjct  1948  ETDLEILHLMHEIESLEGSEYDTIAEMDYMWGTSALKFKKELTADKLASLNKIVDCGTTE  2007

Query  2901  DCRKIQFRENLPIDPKMCASTVLYFPYGRPN--GPGVVNKVQKDTFDSMHEDCSAEVANR  3074
             + R++ FREN+P+D  +C  TVL+F Y R +   P  + K+  D F +  E   +  +N 
Sbjct  2008  EQRRMLFRENIPVDTNLCMKTVLHFCYDRSSQAAPVSLKKLLDDNFVNTTEQRPS--SNS  2065

Query  3075  HI---YDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKF  3245
             H+   YDP FILR S HCL MGYIE +EF+ LGLLA++  SISSPDD  RKLGY  L  F
Sbjct  2066  HLLQQYDPAFILRFSIHCLLMGYIEAIEFSRLGLLAITFVSISSPDDGLRKLGYESLGNF  2125

Query  3246  KNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATI  3425
             K AL+  +K KD ++LQLLL+YLQN I E WQ+IPS+TAIF AEASF LLD S +H+ TI
Sbjct  2126  KMALQNYRKSKDALQLQLLLTYLQNGITEPWQQIPSMTAIFTAEASFTLLDSSQNHFFTI  2185

Query  3426  TKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFE  3605
             +K LM S  VNL S+PLF  L  S S+ F+ +RLWILR++Y+GLN + D  IY+RN   E
Sbjct  2186  SKLLMHSSKVNLMSVPLFHTLFESSSIHFKMDRLWILRLIYAGLNLNSDAKIYMRNKFLE  2245

Query  3606  TLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFC-GIKYD  3782
              LLSFY S L+D ESK LI+Q +KKS KL  +  +L++ CGL+ WLS+V+  +C G+  D
Sbjct  2246  LLLSFYASSLSDPESKMLILQIMKKSVKLPMLVHYLVKECGLLPWLSTVLLFYCEGLGGD  2305

Query  3783  HWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHS  3962
             H K        +VLEV+N+++  R   EWLQ+ ALEQLSE S HL  + V   ++LKE+ 
Sbjct  2306  H-KESSLRAVELVLEVINDVVSSRTITEWLQECALEQLSEFSTHLYGVFVGAFKLLKENV  2364

Query  3963  TFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGC-YSPIAKTGLEA  4139
             +    +L ++  T ++SQKRK++QPHFTLS+E LF L + I    N   ++   +  ++ 
Sbjct  2365  SLINSMLHVIVSTLRLSQKRKIFQPHFTLSLESLFRLYQVIYSEFNNMEFNLTIELAIDT  2424

Query  4140  ILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLI  4319
             ILMSTP   +  MD  ++SK + W +S AL+S +      ++    + +S E+  + S I
Sbjct  2425  ILMSTPVPVVSHMDRARLSKLLMWTISSALRSFSDQSYLGKEPDPDMLISCEDHGKESQI  2484

Query  4320  SKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLE--WNEESDRENGKEFACQ  4493
             SKLLRW TASVILG IS + S++  +H    S    L CLLE    EE + E     A  
Sbjct  2485  SKLLRWATASVILGSISNRTSEM-KTHVSLGSSCKTLQCLLEDVIKEEGETEQNNSGA-N  2542

Query  4494  EILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGS----EVLIGNAAALCSKIR  4661
             E LA  I YLQQLLG +   L S + ALCLLLL N  +       +V  G  + LCSKIR
Sbjct  2543  EALAIEILYLQQLLGRNSSGLSSVILALCLLLLPNACNIADKEYLDVNHGQVSLLCSKIR  2602

Query  4662  CPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLK  4841
             CP E N AWRWSFYQPWKD S   ++ E++EE  ACQ LLL+ S  L     Y  ++S K
Sbjct  2603  CPFEVNPAWRWSFYQPWKDLSLEQSEMEQMEEEQACQNLLLLFSNALGGRPSYLPVLSHK  2662

Query  4842  DVEKLGVFEWER  4877
             DVE+ G+FEWER
Sbjct  2663  DVEQCGLFEWER  2674



>ref|XP_002869583.1| hypothetical protein ARALYDRAFT_354097 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45842.1| hypothetical protein ARALYDRAFT_354097 [Arabidopsis lyrata subsp. 
lyrata]
Length=2550

 Score =   953 bits (2463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/1666 (38%), Positives = 950/1666 (57%), Gaps = 86/1666 (5%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMF-----FTG-------  149
             +LQNF  ++ VS    G PFS L SI FLE + L ++SK  P++F     FTG       
Sbjct  930   ILQNFAPVMDVSWAFYGTPFSFLQSITFLEENFLGNLSKLSPDLFAPGSEFTGSRNLCEA  989

Query  150   -LESAI--SGLQEGRTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQ  320
              ++S I  SG      E    +++ +  S+A S+FL++A   +L    +S+  S L    
Sbjct  990   TVDSEIDFSGHSSVTEEIRSKMNNCDIESSAFSMFLEQAPFPVLLNAIMSMDISCLPEFP  1049

Query  321   GLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLR  500
              +  LLL  +S+     I S+   ++FW  Q   SY+V+P   L  LSE+C +++  +  
Sbjct  1050  RISELLLLKVSQPKSGSIDSNIQLIMFWLFQIRSSYKVQPAPVLHQLSEICLHLMKNLFS  1109

Query  501   QFLNTK---GDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNA----DFTDT  659
             Q    +   G +S+K   S    K   ++  T+  HPVV A LE PL C         + 
Sbjct  1110  QISEPELVSGSSSNKLFASF--AKWKHQVALTVLCHPVVMALLESPLDCGTLPPVQNVEI  1167

Query  660   FSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKN  839
             FS  S+     +    V  ++D H+++LL +T E     +      E     +   AFK+
Sbjct  1168  FSETSL-----TTGRLVYSEIDQHILDLLVSTCEHFLLDEKHNLWKEDLRENKSIIAFKD  1222

Query  840   VVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDN  1019
             +V++L L F+ + + C  S+    LL     IH L RFI PF+L  + H M S+ID  + 
Sbjct  1223  LVERLLLEFRVKFELCGCSQSYASLLQPSQLIHALLRFISPFKLFIIAHSMLSKID--EG  1280

Query  1020  SFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILL  1199
                      +L +GL IAG  F+ L     QP ++R + DL W + E+ +   ++EK+  
Sbjct  1281  GLASPNSSILLSLGLGIAGGAFEMLVLYSHQPTAKRGVYDLLWELEEKNYASNIIEKVYS  1340

Query  1200  QVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQ-SNPTLVMAISRFIVNIPVNLLSYCMF  1376
                + +T L LD AD+CLLK    +   K  Q  S   LV+ IS  +   P +L+ +C+ 
Sbjct  1341  MACKFSTSLDLDSADICLLKVCGGIFRGKHNQNYSVHPLVLKISLIVGRTPEDLIIHCIN  1400

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPT  1556
             + +  +A++LF   E SPLHL +FG+    M+ K+        ++ S  +D + +MLLP 
Sbjct  1401  RASITRAKILFYLVESSPLHLLVFGNFFFSMLSKK--------QDVSALTDDQFIMLLPA  1452

Query  1557  VFLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEE  1736
             V  YL SV  K          I S Y  IL++ F  W  +++R +F+ E ++ + LS  E
Sbjct  1453  VLSYLTSVFAKLEKPFNRCLDITSVYSNILINGFLQWPRFLSRCIFE-EKYEEILLSTTE  1511

Query  1737  FMD-IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVG  1913
              MD +F+ +L+ ++V M Q   +LT    K +   ++FDS+ P  ST  + LD++  +V 
Sbjct  1512  DMDTMFNASLIGKAVRMFQYHFSLTESPTKEDDLFKVFDSMFPHTSTGKEMLDYEIKEVD  1571

Query  1914  TCSLEQSLNFVNRTVAKINLCRTLLFPEHN-----KFSSGLKEDKMETCAELHSTLDVSR  2078
               S++Q LN   R VAK+ L R  LFPE +     K ++G    K  + +++ S   +  
Sbjct  1572  VQSVDQMLNVAIRVVAKVTLSRICLFPEDSSLCQVKRAAGTCVKK--SSSKIGSNRAILS  1629

Query  2079  IRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGCLV  2255
               LL  LV+SW+ +V+K   +   + + + + C S+ + LE  ILR+I++  + M   LV
Sbjct  1630  NPLLDALVNSWQCVVKKSDGSFKGNSEGKQDKCWSLCKSLENFILRSILQFLENMCEELV  1689

Query  2256  KLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAI  2435
             +LDSLPF+ +L K+   +RF+D  TL+ LR+I S L  GK+S    IQL+++HSQF   I
Sbjct  1690  QLDSLPFLERLMKSVLLYRFEDSKTLKILREIFSLLCRGKYSYAPYIQLLISHSQFTPTI  1749

Query  2436  CSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRV  2615
              S ++S+  S  G  F P+ S++   +I   + NS+  K     +  + KQLE++K+LRV
Sbjct  1750  SSLSISS--SHTGELFRPVSSILNHLIIS--SPNSVGVKRCCLEAPNYAKQLEIVKILRV  1805

Query  2616  LFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSI-SDSNIS  2792
             L          +  ++ GINL++L F LL SY ATL +ID EI+ L+++IK I ++  ++
Sbjct  1806  LL--------FKCGKDPGINLKELHFFLLCSYGATLSEIDLEIYKLMHDIKLIDAEQTLN  1857

Query  2793  IAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLY  2972
             ++E D LWG A +K R+     Q  S N+  AE+ ED ++  F+ENL +DPK+CASTVL+
Sbjct  1858  VSETD-LWGKAALKLREGLRFKQDAS-NVGQAELVEDVQQSLFKENLCVDPKICASTVLF  1915

Query  2973  FPYGRPNGPGVVNKVQKDTF----DSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIE  3140
             FPY R          + D F    D ++E CS  + +   YDP FIL  S   LS+GYIE
Sbjct  1916  FPYQR-------TTEKSDNFYLYDDPINEKCSPVIEDIERYDPAFILHFSIDSLSVGYIE  1968

Query  3141  PVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQN  3320
             PVEFA+LGLLAV+  S+SS D   RKLGY  L+ F +ALE C+K K V  L+LLL Y+QN
Sbjct  1969  PVEFASLGLLAVAFVSMSSADLGMRKLGYETLQIFLDALENCRKNKHVTGLRLLLMYVQN  2028

Query  3321  CIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSD  3500
              +EE WQ+IP+V+AIF AE S +LLDPSH+HY  I K L  S ++ L+ IPLF +  WS 
Sbjct  2029  GVEEPWQRIPTVSAIFAAETSLILLDPSHEHYVPINKLLQSSSTLKLRGIPLFHDFFWSS  2088

Query  3501  SVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKK  3680
             +V+FR++R W LR++  GL +DDDV IYI+NSI ET++SF  SPLAD+E+K LI+Q V+K
Sbjct  2089  AVNFRSQRFWELRLVCLGLKSDDDVQIYIKNSILETVISFSSSPLADDETKRLILQVVRK  2148

Query  3681  SAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHT  3860
             S K  +MARHL+ENCGL SW SS +++F         G       VVLE++ +++  R+ 
Sbjct  2149  SVKFHKMARHLVENCGLFSWCSSFISNFTTKPI----GDKDLHLVVVLEIITDVLASRNI  2204

Query  3861  VEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPH  4040
              EWLQ++ LE L E+S  L ++L  G   ++ + T   LILQIL+ T K+SQKRK+YQPH
Sbjct  2205  TEWLQRFGLEGLMEISSRLYKLLGGGLVSVQANGTSVDLILQILSATLKISQKRKMYQPH  2264

Query  4041  FTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMS  4220
             FT+++EG+F L E +    +      A++GL  ILMSTPPV I+ MD  K+ +F+ W  S
Sbjct  2265  FTITIEGIFQLFEGVANFGSPQVEASAESGLITILMSTPPVDIICMDVDKLRRFLLWGTS  2324

Query  4221  IALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSH  4400
              AL+S+ K   +  +      + +E+  E +L++K LRWL+ASVILGK+  K S  D + 
Sbjct  2325  TALKSDLKKGSKPIESHQDTKILTEDPQEETLVAKFLRWLSASVILGKLYSKASDFDQT-  2383

Query  4401  SCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFK-LLPSAVSAL  4577
                ++K   L  LL + ++ + E+  + + + I+   I +LQQLL T+++ LLPS V AL
Sbjct  2384  VLSKTKPETLLTLLGYFKKRNLEDSMKNS-EHIIGEVIVHLQQLLCTNYRVLLPSVVFAL  2442

Query  4578  CLLLLKNPASSG-SEVLIGNAAALCSKIRCPAEANSAWRWSFYQPWKDHSS-NLTDSEKI  4751
              L+LL N   +G S+       +LCSKI  P EA   WRWS+YQ W+D SS   TD +KI
Sbjct  2443  SLMLLHNDLGTGESDGDYKLIKSLCSKISSPPEAIPGWRWSYYQAWRDLSSEQATDLDKI  2502

Query  4752  EEIHACQMLLLVASKMLARNSLYS-KLISLKDVEKLGVFEWERSIL  4886
              E+HACQ LLL+ S ML      S +++  K  +   VFEWERS++
Sbjct  2503  NELHACQHLLLIFSDMLGETPWESQQMLPRKSFDMSHVFEWERSLV  2548



>ref|XP_006413117.1| hypothetical protein EUTSA_v10024185mg [Eutrema salsugineum]
 gb|ESQ54570.1| hypothetical protein EUTSA_v10024185mg [Eutrema salsugineum]
Length=2382

 Score =   947 bits (2447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/1662 (37%), Positives = 937/1662 (56%), Gaps = 78/1662 (5%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS-GLQEG  182
             +L++F  +++VS    G+PFS L SI +LE + L ++SK  P++F  G E   S  LQEG
Sbjct  762   VLKSFARVMAVSSAFYGIPFSFLQSITYLEENFLGNLSKLSPDLFARGSELTDSRNLQEG  821

Query  183   R-------------TEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQG  323
                           TEE       +  S+A S+F ++AS  +L    +S+  S L     
Sbjct  822   TEESEIDFSDPSLITEEIKRKMDRDIESSAFSMFSEQASFHVLLAAIMSMDISSLPEFPR  881

Query  324   LHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQ  503
             +  LLL  +S+   D   S+   +L+W  Q   + +++P   L  LSE+C  ++  +  Q
Sbjct  882   ISELLLLKVSQSKSDSFESNIQLILYWLFQIRSTCKIQPAPVLCQLSEICLRLMKHLFSQ  941

Query  504   FLNTKGDASSKCTRSLLPTKCV--QELIETIFYHPVVAASLECPLPCNA----DFTDTFS  665
              L  +   S   + +LL +  +   ++ +T+  HPVV A L+ PL C+        + FS
Sbjct  942   ILEPEL-VSGPSSDNLLASSAMWKDQVAQTVLCHPVVRALLDSPLDCSTLPQVQNVEIFS  1000

Query  666   GDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVV  845
               S+     +    VI ++D H+++LL +T E   F +            +  KAFK++V
Sbjct  1001  ETSL-----TTGRLVISEIDEHILDLLASTCEHFLFDEKHIVQKGDLRENKSIKAFKDLV  1055

Query  846   QKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED-NS  1022
             ++L L F+ +   C+ S+   PLL     IH L RFI PF+LL L   M   ID+E+  S
Sbjct  1056  ERLLLEFRVKLKLCVGSQSYAPLLQTTQIIHALLRFISPFKLLNLARSML--IDVEELTS  1113

Query  1023  FQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQ  1202
                S+   ++ +GL IAG  F+ L     QP ++R + DL W + E  +D  L+E++   
Sbjct  1114  PNLSM---IVSLGLDIAGRAFEMLILYSQQPAAKRKVYDLLWELEENNYDSNLIEEVYGM  1170

Query  1203  VYEIATHLHLDVADMCLLKAFKVVKTHKVMQQ-SNPTLVMAISRFIVNIPVNLLSYCMFQ  1379
               + +T   LD AD+CLLK    V   K  Q  +   L + IS+ +   P +L+S+C+ +
Sbjct  1171  ACKFSTSFSLDSADICLLKVGSGVFRGKHNQNYTVHPLTLIISQIVGRTPEDLISHCIIR  1230

Query  1380  INKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTV  1559
              +  + ++LF   E SPLHL++FGH    M+ K+        ++ S  +D + +MLLP V
Sbjct  1231  ASMTRTKILFYLVESSPLHLAVFGHFFCRMLSKK--------QDDSALTDDQFIMLLPAV  1282

Query  1560  FLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLS--IE  1733
               Y  SV  K          I S Y  IL + F  W  +++  +F+ E ++ + LS   E
Sbjct  1283  LSYWTSVFAKLEKPCSRCLDITSVYSNILCNGFLQWPKFLSGCIFE-EKYEEILLSSSTE  1341

Query  1734  EFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVG  1913
             +   +F  +LL ++V M Q   ALT    K +  +++F S+ P  S   + LD++  +V 
Sbjct  1342  DIDTMFDASLLGKAVRMFQHHFALTESPTKTDDLLKVFHSMFPHISAGKEMLDYELKEVD  1401

Query  1914  TCSLEQSLNFVNRTVAKINLCRTLLFPEHNK---FSSGLKEDKMETCAELHSTLDVSRIR  2084
               S+E   N   R +AK+ L R  LFPE  +   F         E+  E+ S  +     
Sbjct  1402  VQSVEYVFNVAIRVIAKVELSRICLFPEDKRMCHFERQTGSCMKESSPEMGSNRERLLKP  1461

Query  2085  LLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVF-RFLEVLILRNIVELSKEMHGCLVKL  2261
             LL  LV+SW+ +V++   +   + + +   C    + LE  ILR++++  ++M+  LV L
Sbjct  1462  LLNALVNSWQCVVKRSDGSFKGNSEGKQNKCRFLCKSLENFILRSLLQFLEDMYEVLVHL  1521

Query  2262  DSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICS  2441
             DSLPF+ KL K+   +RF+D  TL+ LR++ S LS GK+S    IQL+++HSQF   I S
Sbjct  1522  DSLPFLEKLMKSVLLYRFEDSKTLKILREVFSLLSRGKYSYAPYIQLLISHSQFTPTISS  1581

Query  2442  SNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLF  2621
              ++ +  S  G  F P  S+++  +IP  + NS+        +  ++KQLE++K+LR+L 
Sbjct  1582  LSILS--SHTGELFRPASSILKYLIIP--SPNSVGVGSCCLEAPDYVKQLEIVKILRILL  1637

Query  2622  QVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN-ISIA  2798
                      +   + GINL++L FLLL SY ATL +ID E++ L+++I+ I D + ++++
Sbjct  1638  S--------KCGTDSGINLKELHFLLLCSYGATLSEIDLELYKLMHDIELIDDEHRLNVS  1689

Query  2799  EWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFP  2978
             E  +LWG A +K R+     Q  S +  +A+  E+ R   F+ENL +DPK CA TVLYFP
Sbjct  1690  ETGHLWGKAALKIREGLRFSQDAS-DGGEADKVENLRHSLFKENLCVDPKRCALTVLYFP  1748

Query  2979  YGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFAN  3158
               R   P V +      +D + + CS  + +  +YDP FIL  S H LSM YIEPVEFA+
Sbjct  1749  NQRT--PEVSD--NSCLYDPISKKCSTVIEDIELYDPAFILPFSVHSLSMRYIEPVEFAS  1804

Query  3159  LGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVM-RLQLLLSYLQNCIEED  3335
             LGLLAV+  S+SS D   RKLGY  LE F +ALE C+  K V   ++LLL ++QN +EE 
Sbjct  1805  LGLLAVAFVSMSSADIGMRKLGYETLEIFLDALECCKMNKHVKDGIRLLLLHVQNGVEEQ  1864

Query  3336  WQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFR  3515
             WQ+IP+V+A+F +E S +LLD SH+HY  I K L  S ++ L+ IPLF +  WS + + R
Sbjct  1865  WQRIPTVSAVFASETSLILLDSSHEHYVPIVKFLKSSSTMKLRGIPLFLDFFWSSAFNSR  1924

Query  3516  TERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLS  3695
             ++RLW LR+L  GL +DDD HIYIRNSI E L+S + SPLAD+E+K LI+Q V+KS K  
Sbjct  1925  SQRLWELRLLCVGLKSDDDAHIYIRNSILEELMSVFSSPLADDETKGLILQVVRKSVKFH  1984

Query  3696  RMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQ  3875
             +M RHL+E CGL SWLSS++++F         G    +  VVLEV+ +++  R+  EWLQ
Sbjct  1985  KMVRHLVEKCGLFSWLSSLISTFTTKPI----GDEDLRLVVVLEVMTDVLASRNVTEWLQ  2040

Query  3876  KYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSV  4055
             ++ALE+L E+S  L ++L  G   ++E+ T   LILQIL+ T K+SQKRK+YQPHFT++V
Sbjct  2041  RFALEELMEISSRLYRLLGGGLVSVQENGTLVDLILQILSATLKISQKRKMYQPHFTITV  2100

Query  4056  EGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQS  4235
             EG+F L EA+  C +      A++GL  ILMSTPPV I+ MD  K+ +F+ W  SIAL+S
Sbjct  2101  EGVFQLFEAVANCGSLQVEASAESGLNTILMSTPPVDIICMDVDKLRRFLLWGTSIALKS  2160

Query  4236  ETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRS  4415
             + K   +  +        +EE    ++++K LRWL ASVILGK+  K +  D +    R+
Sbjct  2161  DLKKGSKPSESHQDAKTLTEEPQAETMVAKFLRWLLASVILGKLYSKANDSDPT-VLSRT  2219

Query  4416  KLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLK  4595
             K   L  LLE+ +  + E G E   + ++   I +LQQL+ T++ +LPS V AL L+LL+
Sbjct  2220  KPETLLTLLEYFKTRNLE-GSETKSEHVIGEVIVHLQQLMCTNYGVLPSVVCALSLMLLR  2278

Query  4596  NPASSGSEVLIGN---AAALCSKIRCPAEANSAWRWSFYQPWKDHS-SNLTDSEKIEEIH  4763
             N   +      G+     +LCS+I  P EA  AWRWS+YQ WKD S  + TD EKI+E+H
Sbjct  2279  NGLGTAGSESKGDYKLIKSLCSRISSPPEATPAWRWSYYQAWKDLSLESATDLEKIDELH  2338

Query  4764  ACQMLLLVASKMLARNSLYSKLISL-KDVEKLGVFEWERSIL  4886
             ACQ L ++ S ML      S+ + L K  +   VFEWER ++
Sbjct  2339  ACQHLFVIISDMLGETPRDSQQVLLQKSFDMSTVFEWERGLV  2380



>gb|KDP45875.1| hypothetical protein JCGZ_15319 [Jatropha curcas]
Length=1854

 Score =   926 bits (2392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/1307 (42%), Positives = 804/1307 (62%), Gaps = 50/1307 (4%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEGR  185
             LL+NFP+++++ +  L VP   L ++ FLE S L  V K WP++F TGLE A+S +    
Sbjct  317   LLKNFPMVMTIFQH-LQVPLPFLSTVIFLEQSFLAGVLKLWPKVFVTGLEKAVSMINPQV  375

Query  186   TEEFG---------DIDSME-FASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNL  335
              E+           D D+ E  A+ A  +FL +A   +LFP  +S     L     + +L
Sbjct  376   AEDNAFAQETMLNMDFDASESTAAVAFGIFLSQAPFHVLFPAIISSSGHCLFEPSKIKDL  435

Query  336   LLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNT  515
             L+A LS+ T D +VS F  +LFWF Q  +SYR++P  +L+ L+E+C+ ++  ML Q L  
Sbjct  436   LIAKLSKCTSDFVVSYFRLLLFWFYQMQLSYRIKPSAKLKELAEICYFLMKHMLAQLLVL  495

Query  516   KGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNA-----DFTDTFSGDSMD  680
             K +     ++  L  K +QE++ETIF HP + AS + PL C+      DFT+    D+++
Sbjct  496   KPN-----SKDPLSAKIIQEVVETIFCHPSMRASFKYPLDCDENFIDEDFTEGNFWDNVE  550

Query  681   KFLESNKWRVIHKMDLHVINLLRTTFE-LLYFCDGQTS--SFEACHARQVTKAFKNVVQK  851
              FL  ++ + IH++D H +++L TTF  LL   +GQ      E    +++ KAFK ++Q+
Sbjct  551   AFLNFSQQK-IHQIDRHFLDILATTFNFLLSSSNGQHYLLKVEDGMRKRLVKAFKALIQR  609

Query  852   LFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQ  1031
             L +   D+ D CI+++D+ PLL + YA+H L  F  PFEL +L HW+F RI+ +  +  +
Sbjct  610   LRVQLMDQVDLCIKTEDVLPLLQSFYALHALLHFTCPFELFDLAHWIFDRIEAKGLNAHK  669

Query  1032  SLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYE  1211
             S R S   +G  IAG  F  LS  + QP + RPL   FW M E   ++ L+E I  +V +
Sbjct  670   SCRTSAFSIGFCIAGDAFKILSTYLQQPATMRPLFHTFWEMQETNLNVNLIEGIYFRVLK  729

Query  1212  IATHLHLDVADMCLLKAFKVVKTHKVMQ-QSNPTLVMAISRFIVNIPVNLLSYCMFQINK  1388
              AT+  LD A  CLL+A   V   K M   S   L M +SR I++ PV +LS+C++  +K
Sbjct  730   FATNFELDFAYSCLLEAVNAVHWKKNMLCNSLDPLSMVLSRVILSTPVEILSHCIYGTSK  789

Query  1389  RKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP--SDPELLMLLPTVF  1562
              KA+LL    +MSPLHLS+FG+L  G+++K+ HL+   ++E++    SD + ++LLP  F
Sbjct  790   TKAKLLLFLVDMSPLHLSVFGYLFLGILNKKCHLKGKMVKESNEMPLSDEDFMLLLPAAF  849

Query  1563  LYLDSVLIKAGSQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNL-PLSIEE  1736
              YL+SV +K   Q  K F  I SFY +ILL    +WK +V+  +F  E++D L P SIEE
Sbjct  850   SYLNSVFMKFEKQYHKQFTNIPSFYSKILLSGCCNWKSFVSGYVFQ-ENYDELVPSSIEE  908

Query  1737  FMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGT  1916
              +++   +LL +++ M++   A++G + K   R+ +F S+  +     + LD D  ++  
Sbjct  909   LINLVDASLLGKAMHMLRYHFAISGDM-KTRERLNIFTSILTRSDGHDELLDSDVDEIKL  967

Query  1917  CSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCA----ELHSTLDVSRIR  2084
              SL QSLN +NR VAK++ CR LLF   NK  S  KE+   + A     + +    SR++
Sbjct  968   YSLSQSLNLINRVVAKVSFCRMLLFQADNKILSPPKEEDGNSKAISLKMVSNKESRSRMQ  1027

Query  2085  LLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGCLVKL  2261
              +K+LV +W+ +V+KFP+ AD S   +  +C  ++R LE+ IL+ I+EL+ EM   L+ L
Sbjct  1028  FIKILVGTWQCMVKKFPLVADGSSGEKSSDCLQLYRHLELFILKTILELTAEMCDVLILL  1087

Query  2262  DSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICS  2441
               +PF+ +L +++  +RF+DP TL  LR I++ LS GKFS    +QL+++HSQF + ICS
Sbjct  1088  QDIPFLEQLMRSSLLYRFEDPKTLGILRSILTLLSGGKFSSTLYLQLLLSHSQFLSTICS  1147

Query  2442  SNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLF  2621
                S   SQ+G  F P+ S++RS VIP  N      K++LQ  K  +K+LE++KLLRVLF
Sbjct  1148  ITDSCS-SQIGEFFRPMSSILRSLVIPHPN-----SKNDLQTIKPSMKELEIVKLLRVLF  1201

Query  2622  QVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNIS--I  2795
             Q+K  Q       +  INL++L  L LSSY ATL ++D EI+NL+++I+ I D +IS  +
Sbjct  1202  QLKP-QSGGSSVTDTDINLKELYLLFLSSYGATLSELDLEIYNLMHDIECI-DKSISEDL  1259

Query  2796  AEWDYLWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDPKMCASTVLY  2972
              + DYLWG+A +K RK R L Q  S N ++D E  E+ ++ QFRE LP+DPKMC +TVL+
Sbjct  1260  VQLDYLWGSAALKIRKIRALDQDSSSNIMTDEEAFEEHKRSQFREILPVDPKMCLATVLH  1319

Query  2973  FPYGRPNGPGVVN--KVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPV  3146
             FPY R      ++  + + +   + H      V     YDPIF+LR   H L MGYIEP+
Sbjct  1320  FPYNRIVSDDCLSLKRFEPEHLRNFHMTNCHGVDKICRYDPIFMLRFCIHVLPMGYIEPL  1379

Query  3147  EFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCI  3326
             EFA LGLLA++  SISSP    RKLGY  L ++KNALE+CQKKK++MRL LLL+Y+QN I
Sbjct  1380  EFAGLGLLAITFISISSPSLGLRKLGYESLMRYKNALERCQKKKEIMRLHLLLTYIQNGI  1439

Query  3327  EEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSV  3506
             +E WQ+IPSV A+F AE+SF+LLDPS+DH+  I+KHLM S  VN++ IP+F  L  S S 
Sbjct  1440  KEAWQQIPSVIALFAAESSFILLDPSNDHFTAISKHLMHSSKVNMEQIPMFDTLFRSSSA  1499

Query  3507  SFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSA  3686
             +FR ERLW+LR+  +GLN DDD  I+    I +TLLSFY +PLADNESKELI+Q VKKS 
Sbjct  1500  NFRAERLWMLRLTCAGLNVDDDAKIFKNGFIIKTLLSFYATPLADNESKELILQVVKKSV  1559

Query  3687  KLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLE  3827
             +   M  HL+++ GL+ WLS ++    G   +  + F   Q  V +E
Sbjct  1560  RFHDMTTHLVKDSGLLPWLSHILQISYGTLDEKERSFSSLQLVVAIE  1606


 Score =   156 bits (394),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 135/240 (56%), Gaps = 5/240 (2%)
 Frame = +3

Query  4188  KVSKFINWAMSIALQSETKGVLQVEKCCFPLNV-SSEEETENSLISKLLRWLTASVILGK  4364
             K+S F+ WA+S AL+SE+K      +    L + S E  +E+SLISKLLRWL A+VILGK
Sbjct  1610  KLSGFLMWAVSTALKSESKKNFNFRRSHASLMIFSKETASEDSLISKLLRWLVAAVILGK  1669

Query  4365  ISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTS  4544
             +S KL   +   S   S    L  L          N  +F   E+LA +IFYLQQ +   
Sbjct  1670  LSRKLHDANYKFSKRSSSKSLLSFLTYVENGIIESNNSKFDGHEVLAETIFYLQQFIELD  1729

Query  4545  FKLLPSAVSALCLLLLKNPASSGSEVLIGNAAALCS---KIRCPAEANSAWRWSFYQPWK  4715
               L  S V ALCLLL    +S   +   G   AL S   K+RCP EA   WRW+F QP+ 
Sbjct  1730  GPLFSSVVCALCLLL-SFGSSEHPDFKHGYRTALVSLSSKVRCPPEAKPKWRWTFEQPFG  1788

Query  4716  DHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSILNLN  4895
               S   +D +K+EE HACQ L+++ S +L +  L S+++S +D E   VFEWER++L  N
Sbjct  1789  RSSFIFSDLQKMEEHHACQTLMVIISNILGKKPLDSQVLSFQDKENSDVFEWERTMLEPN  1848



>ref|XP_006282527.1| hypothetical protein CARUB_v10003963mg [Capsella rubella]
 gb|EOA15425.1| hypothetical protein CARUB_v10003963mg [Capsella rubella]
Length=2547

 Score =   941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/1675 (38%), Positives = 952/1675 (57%), Gaps = 104/1675 (6%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISG---LQ  176
             +LQNF  +++VS    G+ FS L SIFFLE + L ++SK   ++F  G  S I+G   L 
Sbjct  927   ILQNFAPVMAVSWAFYGISFSFLQSIFFLEENFLGNLSKLSLDLFVRG--SDITGSRNLW  984

Query  177   EGRTEEFGD--------------IDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLST  314
             EG  +   D              +D  +  S+A S+ ++ A   +L    +S+  S L  
Sbjct  985   EGTVDSEIDFSCHSSIAEEIRSKMDIRDIESSAFSMLIEHAPFPILLTAIMSMDISCLPV  1044

Query  315   QQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRM  494
                +  LLL  + +     I S+   +LFW  Q   SY+V+P   L  LSE+C  ++  +
Sbjct  1045  FPRISELLLLKVLQPKSGSIDSNIQVILFWLFQIRSSYKVQPAPVLCQLSEICLRLMKHL  1104

Query  495   LRQFLNTK---GDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNA---DFTD  656
               Q    K   G +S+K   S    K   ++ +T+  HPVV A LE PL C++      +
Sbjct  1105  FSQISEMKLVSGPSSNKLLASFAKQK--HQVAQTVLCHPVVMALLESPLDCSSRQVQNVE  1162

Query  657   TFSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFE-ACHARQVTKAF  833
              FS +S+     + +  V  ++D H+++LL +T + L+  D + + ++        T A+
Sbjct  1163  IFSENSL-----TTERLVFSEIDQHILDLLVSTCDFLF--DEKHNVWKWDVRENNSTIAY  1215

Query  834   KNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLE  1013
             K+ V++L L F+ + + C++S++   LL     IH L RFI PF+LL + H M S+ID +
Sbjct  1216  KDFVERLLLEFRVKFELCVDSQNYASLLQLSQLIHALLRFISPFQLLNVAHSMLSKIDEK  1275

Query  1014  DNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKI  1193
             +++ Q S +  +L +GL IAG  F+ L     QP + R + DL W + E  +D  L+EK+
Sbjct  1276  ESASQNSSK--ILSLGLGIAGGAFEMLIFYSHQPTATRGVYDLLWELEENNYDSNLIEKV  1333

Query  1194  LLQVYEIATHLHLD-VADMCLLKAFKVVKTHKVMQQ-SNPTLVMAISRFIVNIPVNLLSY  1367
                  + +T   LD  AD+CLLK    +   K  +  S   LV+ IS  +   P +L+ +
Sbjct  1334  YSMACKFSTSSGLDSAADICLLKVCGGISRGKHYKNCSVHRLVLIISLIVGRTPEDLIIH  1393

Query  1368  CMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLML  1547
             C+ Q N  +A++LF   E SPLH  +FG+    M+ K+      A+R      D + +ML
Sbjct  1394  CIKQANITRAKILFYLVESSPLHRLVFGNFFCSMLSKKQ--DDTALR------DDQFIML  1445

Query  1548  LPTVFLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLS  1727
             LP V  YL S+  K          I S Y  IL++ F  W  +++R +F+ E ++ + LS
Sbjct  1446  LPAVLSYLTSLSAKFEKPCNRCLDITSVYSNILINGFLQWPQFLSRSIFE-EKYEEILLS  1504

Query  1728  IEEFMD-IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPS  1904
               E +D +F+ +LL ++V M Q   +LT    K +   +LF+S+ P  S   + LD++  
Sbjct  1505  TTEDIDTMFNASLLGKAVRMFQYHFSLTESPTKEDDLFKLFNSIFPHTSARKEMLDYEIK  1564

Query  1905  QVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKM---ETCAELHSTLDVS  2075
             +V   S++Q  N   R VAK+ L    LFPE +      +E      E   +  S   V 
Sbjct  1565  EVDVQSVDQMFNVAIRVVAKVTLSMICLFPEDSSMCHLKREAGASLKERSPKFRSNRAVL  1624

Query  2076  RIRLLKMLVSSWRKIVEKFPMT-ADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCL  2252
                LL  LV+ W+ +V+K   +   NS   + +   + + LE  ILR+I++  + M   +
Sbjct  1625  SKPLLDALVNCWQCVVKKSDGSFTGNSEGKQEKYWYLCKSLENFILRSILQFLENMCEEV  1684

Query  2253  VKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETA  2432
             V+LDSLPF+ +L K+   +RF+D  TL+ LR+I S LS GK+S    IQL+++HSQF   
Sbjct  1685  VQLDSLPFLERLMKSILLYRFEDSKTLKILREIFSLLSRGKYSYAPYIQLLISHSQFTPT  1744

Query  2433  ICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLR  2612
             I  S+LS   S  G  F P+ S+++  +I   + NS+  K     +  + KQLE++K+LR
Sbjct  1745  I--SSLSISPSHTGELFRPVSSILKHVIIS--SPNSVRAKSCRFEAPYYAKQLEIVKILR  1800

Query  2613  VLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSI-SDSNI  2789
             VL          +  +  GINL++L FLLL SY ATL +ID EI  L+++IK + ++  +
Sbjct  1801  VLLS--------KCGKGSGINLKELHFLLLCSYGATLSEIDLEIFKLMHDIKLVDAEHTL  1852

Query  2790  SIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVL  2969
             +++E D LWG A +K R+     Q  S  + +++  ED R+  F+ENL +DPKMCA TVL
Sbjct  1853  NVSETDCLWGKAALKIREGLRFSQDAS-YVGESDFLEDVRQSLFKENLCVDPKMCALTVL  1911

Query  2970  YFPYGRPNGPGVVNKVQKDTF---DSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIE  3140
             +FPY R        +V  + +   D ++E CS  + +   YDP+FILR+S   LSMG+IE
Sbjct  1912  FFPYQR------TTEVSDNLYLYDDPVNEKCSPVMEDIERYDPVFILRISIDSLSMGFIE  1965

Query  3141  PVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQN  3320
             PVEFA+LGLLAV+  S+SS D   RKLGY  LE + +ALE C+K K V  L+LLL Y+QN
Sbjct  1966  PVEFASLGLLAVAFVSMSSADLGMRKLGYETLEIYLDALESCRKNKHVTALRLLLMYVQN  2025

Query  3321  CIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSD  3500
              +EE WQ+IP+V+AIF AE S + LDPSH+HY  I K L  S ++ L+ IPLF +  WS 
Sbjct  2026  GVEEPWQRIPTVSAIFAAETSLIFLDPSHEHYVPINKLLKSSSTLKLRGIPLFHDFFWSS  2085

Query  3501  SVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKK  3680
             +V+FR++R W+LR++ +GL +DDD  IYIRNSI ET++SF  SPL D+E+K LI+Q V+K
Sbjct  2086  AVNFRSQRFWVLRLVCAGLKSDDDAQIYIRNSILETVMSFSSSPLTDDETKGLILQVVRK  2145

Query  3681  SAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHT  3860
             S K  +M+RHL+ENCGL SW SS +++F      +  G        VLEV+ +++  R+ 
Sbjct  2146  SVKFHKMSRHLVENCGLFSWCSSFISTFT----TNPIGDEDFCLVAVLEVITDVLASRNV  2201

Query  3861  VEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPH  4040
              EWLQ+  LE L E S  L +IL  G   ++E+ T   LILQIL+ T K+SQKRK+YQPH
Sbjct  2202  TEWLQRCGLEGLMEFSSRLYRILGGGLVSVQENDTSVDLILQILSATLKISQKRKMYQPH  2261

Query  4041  FTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMS  4220
             FT+++EG+F L E +    +      ++ GL  ILMS PPV I+ MD  K+ +F+ WA S
Sbjct  2262  FTITIEGIFQLFEGVANSGSPQVEASSERGLITILMSIPPVDIIGMDVDKLRRFLLWATS  2321

Query  4221  IALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSH  4400
              AL+S+   V +           +EE  E +++ K LRWL ASVILGK+  K SK  ++H
Sbjct  2322  TALKSDHTRVSKSSDSHQDSKKLTEEPQEETMVVKFLRWLLASVILGKLYSKASK--ANH  2379

Query  4401  SC----DRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQ-LLGTSFK-LLPS  4562
             S      ++K   L  LL++ ++ + ++  E + ++I+   I YLQ+ LL  +++ LLPS
Sbjct  2380  SVPTVLSKTKPETLLTLLDYFKKRNVDDSMENS-EQIICEIIVYLQKHLLCKNYRVLLPS  2438

Query  4563  AVSALCLLLLKNPASSGSEVLIGN---AAALCSKIRCPAEANSAWRWSFYQPWKDHSS-N  4730
              V AL L+LL N    G+E L G+     +LC+KI CP EA   WRWS+YQ W D SS  
Sbjct  2439  VVFALSLMLLHNYL--GTEDLNGDYKLIKSLCAKISCPPEAIPGWRWSYYQAWWDLSSEQ  2496

Query  4731  LTDSEKIEEIHACQMLLLVASKMLA---RNSLYSKLISLKDVEKLGVFEWERSIL  4886
              TD +KI E+HACQ LLL+ S ML    R SL+      +D +   VFEWERS++
Sbjct  2497  ATDLDKIGELHACQHLLLIFSDMLGETPRESLH------RDFDLSQVFEWERSLV  2545



>gb|KFK29207.1| hypothetical protein AALP_AA7G103100 [Arabis alpina]
Length=2525

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/1670 (37%), Positives = 935/1670 (56%), Gaps = 98/1670 (6%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS-GLQEG  182
             +L+NF  +++VS    G  FS L SI FLE + L ++SK  P++F  G E   S  L EG
Sbjct  909   ILENFASVMAVSSAFYGTSFSFLESITFLEENFLGNLSKLSPDLFAQGSEFTGSWNLCEG  968

Query  183   R-------------TEEFGD-IDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQ  320
                           TEE    +D  +  S+  S+FL++A+  +L    +S+  S L    
Sbjct  969   TVDSEIGFSGHSSITEEISSKMDICDIESSPFSMFLEQATFPVLLTAIMSMDISCLPEFP  1028

Query  321   GLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLR  500
              +  LLL  +S+   D+  S+ L +LFW  Q   SY+++P   L  L+E+C  ++  +  
Sbjct  1029  RISELLLLKVSQPQSDNFGSNILLILFWLFQIRSSYKIQPAPVLCQLAEICSGLMKHLFF  1088

Query  501   QFLNTKGDASSKCTRSLLPT--KCVQELIETIFYHPVVAASLECPLPCNA----DFTDTF  662
             Q ++     S   + +LL +  K   ++  T+  HPVV A LE PL C+        + F
Sbjct  1089  Q-ISEPQLVSGPSSNTLLASSAKWKDKVAHTVLCHPVVMALLESPLDCSTLPRVQNVEIF  1147

Query  663   SGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNV  842
             S   +          VI ++D H+++LL +T E   F +            +   AFK +
Sbjct  1148  SETPL-----ITNMLVISEIDQHILDLLASTCENFLFDEKHIVRKGDLRVDESVVAFKAL  1202

Query  843   VQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNS  1022
             V +L L    + + C+ S++   LL     IH L RFI P +LL+L   M S+ID+   S
Sbjct  1203  VARLLLELMVKFELCVNSQNFALLLQPAQLIHALLRFISPLKLLDLARSMLSKIDVGLPS  1262

Query  1023  FQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQ  1202
              + S+   +L + + IAG  FD L     QP ++R + DL W + E+ +D  L+E++   
Sbjct  1263  TKSSM---ILSLVMDIAGGAFDMLIKYSQQPAAKRGVYDLLWELEEKNYDSNLIEEVYRI  1319

Query  1203  VYEIATHLHLDVADMCLLK-AFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQ  1379
                 +T   L+ AD+C+LK A  + +       S   L + IS+ +   P +L+ +C+ Q
Sbjct  1320  ACNFSTSFGLNSADICVLKVAGGIFRGKHHQNYSVNQLTLIISQIVGRTPEDLIFHCINQ  1379

Query  1380  INKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTV  1559
             ++  +A++LF   E SPLHLS+FG+    M+ K+        ++    +D + +MLLP V
Sbjct  1380  VSMTRAKILFYLVESSPLHLSVFGNYFFSMLSKK--------QDDPALTDEQFIMLLPAV  1431

Query  1560  FLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEF  1739
               YL SV  K          I S Y  IL++ F  W  ++   +F+ E ++ + LS  E 
Sbjct  1432  LSYLTSVFAKIEKPCSRCLDITSVYSNILINGFIQWPRFLAGCIFE-EKYEEILLSTTEN  1490

Query  1740  MD-IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGT  1916
             +D +F+ +LL ++V M Q   ALT    K     ++F S+    S   + LD++  +V  
Sbjct  1491  IDTMFNASLLGKAVRMFQYHFALTESPTKKGDLFKVFHSMFSHPSAGKEMLDYEIKEVDV  1550

Query  1917  CSLEQSLNFVNRTVAKINLCRTLLFPE-----HNKFSSG--LKEDKMETCAELHSTLDVS  2075
              SL+Q  N   R VAK+ L R  LFPE     H K  +G  +KE  +E    + S  +  
Sbjct  1551  QSLDQMFNVAIRVVAKVTLSRICLFPEDSSMCHRKREAGGCVKESSLE----MGSNRENL  1606

Query  2076  RIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGCL  2252
                LL  LV+SW  +V+K   +     + + E C S+ + LE  ILR+I++  + M   L
Sbjct  1607  SKPLLNALVNSWHCVVKKSDGSFKGRSEGKQEKCWSLCKSLENFILRSILKFLENMCEEL  1666

Query  2253  VKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETA  2432
             V L SLPF+ KL K+    RF+DP TL+ LR+I + LS GK+S    IQL+++HSQF   
Sbjct  1667  VHLGSLPFLEKLMKSVLLFRFEDPKTLRILREIFTLLSRGKYSNAPYIQLLISHSQFTPT  1726

Query  2433  ICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLR  2612
             I S  +S+  S  G  F P+  +++  +I   + NS+        +  +LK+LE++K LR
Sbjct  1727  ISSLTISSAHS--GELFRPVSGILKHLII--LSPNSVGVGSRCLEAPDYLKKLEIVKFLR  1782

Query  2613  VLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSI-SDSNI  2789
             VL          +  ++ GINL++L FLLL SY ATL ++D EI+ L+++I+ I ++  +
Sbjct  1783  VLLS--------KCGKDSGINLKELHFLLLCSYGATLSEVDVEIYKLMHDIELIGAEPTL  1834

Query  2790  SIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVL  2969
             +I+E DYLWG A +K R+     Q  S ++ ++++ ED R+  F+ENL +DPK+CA TVL
Sbjct  1835  NISETDYLWGKAALKIREGLRFSQDAS-DVGESDLVEDVRQSLFKENLCVDPKLCALTVL  1893

Query  2970  YFPYGRPNGPGVVNKVQKDTF---DSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIE  3140
             +FP  R        ++  +++     + E  S  + +   YDP FILR S H LSMGYIE
Sbjct  1894  FFPDQR------TAEISDNSYLYDYQISEKWSPVIEDTERYDPAFILRFSIHSLSMGYIE  1947

Query  3141  PVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQN  3320
             PVEF ++GLLAV+  S+SS D   RKLGY  LE F +ALE C+K K V  L+LLL Y+QN
Sbjct  1948  PVEFTSIGLLAVAFVSMSSADLGMRKLGYENLEIFLDALESCRKNKQVAGLRLLLMYVQN  2007

Query  3321  CIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSD  3500
              +EE WQ+IP+V+A+F AE S +LLD SH+HY  I K L  S ++ L+ IPLF +  WS 
Sbjct  2008  GVEEPWQRIPTVSAVFAAETSLILLDSSHEHYVPINKLLKSSSTLKLRGIPLFHDFFWSS  2067

Query  3501  SVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKK  3680
             +V+FR++RLW LR++ +GL +DDD  IYIRNSI ETL+SF  SPL D+E+K LI+Q V+K
Sbjct  2068  AVNFRSQRLWELRLVCAGLKSDDDAQIYIRNSILETLMSFSSSPLTDDETKGLILQVVRK  2127

Query  3681  SAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHT  3860
             S K  +MARHL+ENCGL SW SS +++F         G    +  VVLEV+ +++   + 
Sbjct  2128  SVKFHKMARHLVENCGLFSWCSSFISTFTTKPI----GDEDFRLVVVLEVMTDVLATTNV  2183

Query  3861  VEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPH  4040
              EWLQ+YALE L E+S  L ++L  G   ++E+ T   LILQIL+ T K+SQKRK++QPH
Sbjct  2184  TEWLQQYALEGLMEISSRLYRLLGGGLVSVQENGTLVDLILQILSATLKISQKRKMFQPH  2243

Query  4041  FTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMS  4220
             FT+++EG+F + E    C        A+ GL+ ILM TPP+ I+ MD   + +F+ W  S
Sbjct  2244  FTITIEGIFQVFETAANCDTPQVEASAERGLDTILMGTPPIEIICMDVDNLKRFLLWGTS  2303

Query  4221  IALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSH  4400
             IAL+S+ +   +  +      + +EE  E ++++K LRWL ASVILGK+  K + +D + 
Sbjct  2304  IALKSDLRKGSKPSESHEDTKILTEEPQEETMVAKFLRWLLASVILGKLYSKDNDMDPT-  2362

Query  4401  SCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALC  4580
                ++K   L  LLE+ +  + E G +   + I+   I YLQQLL T++++LPS VSAL 
Sbjct  2363  VLSKTKPETLLTLLEYFKTRNLE-GNKTKSEHIIGEVIVYLQQLLCTNYRVLPSVVSALS  2421

Query  4581  LLLLKN------PASSGSEVLIGNAAALCSKIRCPAEANSAWRWSFYQPWKDHS-SNLTD  4739
             L+LL N        S+G   LI    +LCS+I  P EA    RWS+YQ  KD S    TD
Sbjct  2422  LMLLHNGLGIAGSESNGDYKLI---KSLCSRI-SPPEA----RWSYYQASKDISLEPATD  2473

Query  4740  SEKIEEIHACQMLLLVASKMLARNSLYSKLISL-KDVEKLGVFEWERSIL  4886
              EKI E+HACQ LLL+ S ML      S+   L K  +   VFEWER ++
Sbjct  2474  LEKISELHACQHLLLIFSDMLGEKPGESQQGMLHKSFDMSSVFEWERGLV  2523



>ref|XP_009393325.1| PREDICTED: uncharacterized protein LOC103979039 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=2291

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/1698 (37%), Positives = 941/1698 (55%), Gaps = 92/1698 (5%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAI-SGLQE  179
             D+L+N  ++++++          L  + FLEP  L +V   WP MF   LE    S   +
Sbjct  603   DVLRNLHLLLTIAPLHFTSYIQFLSYVLFLEPRFLAEVVNLWPNMFRACLEKIRNSDRND  662

Query  180   GRTEEFGDIDSMEF------------------ASAALSLFLKEASLCMLFPITL--SIYK  299
              R      +D  +F                  A+ +L LFL+ A    LF   +    Y+
Sbjct  663   CRGNNDHSLDRNDFMHLTEISLFSDSLVTEELAATSLGLFLRRAPFYALFSAFMCSGSYR  722

Query  300   S------DLSTQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleeleml  461
             S      D+     +  LL   ++E + D +V     VLFW +Q   SY  EP + LE L
Sbjct  723   SHSTRMMDILHSPDIVGLLKIKVTEGSTDDLVLFLRCVLFWAHQIRSSYEAEPSDTLEEL  782

Query  462   selCFNIVDRMLRQFL-NTKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPC  638
              ++CF +VD +  Q L +  G   S        TK VQ++IE I  HP+VA S++ P+ C
Sbjct  783   FQICFTVVDCIFEQVLVDFAGPTGSVTVERSSSTKYVQDVIELILNHPLVALSVQYPICC  842

Query  639   NADFTDTFSGDSMDKFLESNKWRVIHKMDLHVINLLRTTF-ELLY-----FCDGQTSSFE  800
             +         DS D  L  +K    H MD  V+ LL   F E LY      C  QT  F+
Sbjct  843   SRTLAVDKLYDSTDSLLTYSKQN-FHDMDSLVLQLLIKVFKEFLYGTIGSHCSSQTYVFD  901

Query  801   ACHARQVTKAFKNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLEL  980
                  +V K  +N++QK  L F+++ D  +E +D + +LP  Y IH++ +F  PF+LLEL
Sbjct  902   ----ERVLKVARNLIQKTALLFREKFDASVERRDFSTVLPYFYIIHSMMQFFSPFDLLEL  957

Query  981   VHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAGSVFDSLSACM-WQPHSERPLSDLFWGML  1157
              HWMF ++++ D S   SL  +VL   L IA    D L   + W  H+       F+ + 
Sbjct  958   AHWMFGKVEI-DISGCSSLLSAVL-FCLPIADGALDLLYGYLKWSHHTSELYH--FYRIS  1013

Query  1158  EEQFDIVLLEKILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNP--TLVMAISR  1331
                F++ +L+K+   + ++     +  A+ CLLKA  +V   + ++       L M  S 
Sbjct  1014  NRSFNVTILQKVYYSILDLVIRFDIKSANSCLLKAVNIVYNQRHLKPHTTCLPLYMLFSG  1073

Query  1332  FIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVH----LQTN  1499
              +++ P+ L+  C+   +K KA +L L  E+SPLH+S+FG +   + +K       L T+
Sbjct  1074  MVIHSPLKLVLCCLSPTSKIKATILSLLMEVSPLHMSVFGQIFLAIFNKDSSDFDVLNTD  1133

Query  1500  AIRETSNP----------SDPELLMLLPTVFLYLDSVLIKAGSQVKYFEKIVSFYWRILL  1649
                   N           S+ + ++LLP    Y+ S        +K+   I+ FY +ILL
Sbjct  1134  GASPLRNEVAIKNFNYSLSEDDFVILLPAALSYVTS----HKKDLKFIGSILIFYSKILL  1189

Query  1650  HIFSDWKCYVTRDMFDIESFDNLPL-SIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKF  1826
                S+WK YV+  +F  E +  LP+ S E+F +    +LL ++V M+     L G  V  
Sbjct  1190  ENLSNWKSYVSGSVFQ-EEYHELPVTSYEDFHNCLKRSLLGKAVTMLHYFFVLNGGSVTK  1248

Query  1827  EARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNK  2006
             + R+++FDSV P      + LD D   + +CS + SL  V    AKI+  R LL P  + 
Sbjct  1249  KQRLKIFDSVFPHS---FELLDHDIKILNSCSHQDSLKLVIEIYAKISFTRLLLSPVESL  1305

Query  2007  FSSGLKEDKMETCAELHST-LDVSRIRLLKMLVSSWRKIVEKFPMTADNSCQM-EVENCS  2180
                   E+  E   +  S  L+ +++R + +LV+S  +IV  FP   D S +    +N S
Sbjct  1306  TQCLEPEESNEMTQKKESKRLNRAKLRFITILVNSLDQIVRIFPFDGDRSFRSCSSDNYS  1365

Query  2181  VFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISS  2360
             + RFLE  IL NI+ELS E  GCL +L S+PF+    ++   HRF+DP TL+ +R  +++
Sbjct  1366  ICRFLEHYILNNIIELSIESKGCLDQLPSVPFLDHFIRSCLLHRFEDPATLKAIRCFVAA  1425

Query  2361  LSEGK--FSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLT---FTPLPSLMRSFVIPL  2525
             L E K  FS  +I+ L++ HSQF + I SS+  +  S L        PLPS+++S  I  
Sbjct  1426  LPETKRTFSSSEILGLLLGHSQFVSTILSSDSFSNSSALMANESLLQPLPSILKSLDISC  1485

Query  2526  FNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLS  2705
              +H + C            ++LELIKLLRVL+  K+R+ ++      G + R+L+ LLLS
Sbjct  1486  TDHKA-CEFRGTTNPHLEERKLELIKLLRVLYHYKSREYNVGHENIDGKDSRELLVLLLS  1544

Query  2706  SYNATLCDIDFEIHNLVNEIKSISDSNIS-IAEWDYLWGNAVVKARKERELVQTVSCNLS  2882
             +Y ATL + D EI +L++EI+S   S    I+E DYLWG +++K +KE  L Q  S +++
Sbjct  1545  AYGATLSETDLEILHLMHEIESSEGSEYDKISEMDYLWGLSILKIKKEVTLDQLSSSSMT  1604

Query  2883  DA-EVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPN--GPGVVNKVQKDTF-DSMHED  3050
                E AED RK+ FREN+P+D K C +TVL+F Y R +      +  +  D F D++ + 
Sbjct  1605  PGCESAEDLRKLLFRENIPVDTKQCVTTVLHFCYNRSSLTASMSLENLLHDKFGDTIEQS  1664

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYG  3230
                ++     YDP FILR S H L M +I+PVEFA LGLLA++  SISS D++ RKLGY 
Sbjct  1665  LKGDLVLG--YDPAFILRFSLHSLVMDFIKPVEFAQLGLLAIAFLSISSLDEELRKLGYE  1722

Query  3231  VLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHD  3410
             VL +FK A+E C++ KD+++LQLLL+Y QN I E W+++PSV AIF AEASF+LLDP  +
Sbjct  1723  VLGRFKLAVENCRRNKDLLQLQLLLTYFQNGITEPWERVPSVFAIFAAEASFILLDPRQN  1782

Query  3411  HYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIR  3590
             H+ TI K LM SP++N KS+PLF     S S+ F+ ER WIL++L++G+N DDD  IY  
Sbjct  1783  HFLTINKLLMHSPNMNFKSVPLFHAFFGSTSIHFKMERTWILQLLHAGINLDDDAKIYRS  1842

Query  3591  NSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG  3770
             N + E LLSF+ S ++D++S  L++Q VKKS K+  +A +L++ CGL+SWL SV++ F  
Sbjct  1843  NKLMEFLLSFHASSMSDSQSSFLVLQIVKKSVKVPILADYLLKECGLLSWLFSVLSFFGE  1902

Query  3771  IKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQML  3950
                   K F  +   +VL+VV +++  R   EWLQ+ ALEQLS+LS +L  + V   ++L
Sbjct  1903  RLGRKEKQFSLSVMELVLKVVTDVVSTRSISEWLQECALEQLSQLSSYLHVLFVNELKVL  1962

Query  3951  KEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIA-KT  4127
             KE+ +   L L ++  T ++S KR +YQPHFT+S EGLF L  AI+   +  +  +  + 
Sbjct  1963  KENVSVVNLFLHVMISTIRLSHKRMIYQPHFTISFEGLFQLYLAINDEFSSTHCAVTNEL  2022

Query  4128  GLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSET-KGVLQVEKCCFPLNVSSEEET  4304
             G+  ILM TP     ++D  ++ K + WA+S +LQSE+ K  L  +     L V  E++ 
Sbjct  2023  GVMTILMCTPVPVKSKLDKARLVKLVRWAISASLQSESQKNYLFKQSYPHLLLVHKEQQD  2082

Query  4305  ENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEW-NEESDRENGKE  4481
                L+SKL+RW+TASVILG +S K   + +  S  RS    LH LLE+  +E      + 
Sbjct  2083  NELLMSKLMRWVTASVILGSMSNKYLNIKTEFSLKRSSFATLHSLLEFIVKEKGSFREEN  2142

Query  4482  FACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPAS-SGSEVLIGN---AAALC  4649
             F+  E +AA + YLQQ++ +S   LPS + ALCLLLL + +S +G++ L  N    + LC
Sbjct  2143  FSADEAIAAMLLYLQQIMRSSIN-LPSVIFALCLLLLSDGSSTTGTDFLDENHIQISQLC  2201

Query  4650  SKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKL  4829
             SKIRCP E N AWRWSF QPW+D +S  T+  ++EE  AC+ LL++ S  LA       +
Sbjct  2202  SKIRCPVETNPAWRWSFDQPWRDATSEPTEINQMEEEQACRSLLVIFSTALAGKQSGFPV  2261

Query  4830  ISLKDVEKLGVFEWERSI  4883
             +S  D+EK G+FEWER I
Sbjct  2262  LSYLDLEKSGLFEWERCI  2279



>ref|NP_194431.3| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE85283.1| uncharacterized protein AT4G27010 [Arabidopsis thaliana]
Length=2374

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/1662 (38%), Positives = 935/1662 (56%), Gaps = 90/1662 (5%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISG-LQEG  182
             +LQNF  ++ VS    G PFS L SI FLE + L ++SK  P++F +G E   SG L EG
Sbjct  766   ILQNFASVMDVSWAFYGTPFSFLQSITFLEENFLGNLSKLSPDLFASGSEFTGSGNLCEG  825

Query  183   R-------------TEEF-GDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQ  320
                           TEE    +D+ +  S+A S+FLK+A   +L    +S+  S L    
Sbjct  826   TVDSEIDFSGHSSVTEEIRSKMDNRDMESSAFSIFLKQAPFPVLLNAIMSMDISCLPEFP  885

Query  321   GLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLR  500
              +  LLL  +S+     I S+   +LFW  Q   SY+V+P   L  LSE+C  ++  +  
Sbjct  886   RISELLLLKVSQPKSGSIDSNIQLILFWLFQIRSSYKVQPAPVLHQLSEICLRLMKNLFS  945

Query  501   QFLNTK---GDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNA----DFTDT  659
             Q    +   G +S+K   S    K   ++ ET+  HPVV A LE PL C         + 
Sbjct  946   QISEPELVSGPSSNKLPASF--AKWKHQVAETVLCHPVVMALLESPLDCGTLPPVQNVEI  1003

Query  660   FSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSF-EACHARQVTKAFK  836
             FS  S+     +    V  ++D H++NLL +T E   F +   + + E     +   AFK
Sbjct  1004  FSETSL-----TMGRLVFSEIDQHILNLLVSTCEHFLFDEKPPNLWKEDLRKNKSIIAFK  1058

Query  837   NVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED  1016
             ++V++L L F+ + + C+ S+    LL     IH L RFI PF+L  + H M S+ID E 
Sbjct  1059  DLVERLLLEFRVKFELCVGSQSYVSLLQPAQLIHALLRFISPFKLFNIAHSMLSKIDEEG  1118

Query  1017  NSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKIL  1196
              +   S    +L +GL IAG  F+ L     QP ++R + DL W + E+ +   ++EK+ 
Sbjct  1119  LTSPNS--SIILSLGLGIAGGAFEMLVLYSHQPTAKRGVYDLLWELEEKNYASNIIEKVY  1176

Query  1197  LQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQ-SNPTLVMAISRFIVNIPVNLLSYCM  1373
                 + +T L LD AD+CLLK    +   K  Q  +   LV+ IS  +   P +L+ +C+
Sbjct  1177  SMACKFSTSLDLDSADICLLKVCGGIFRGKHNQNYAVDPLVLKISLIVGRTPEDLIIHCI  1236

Query  1374  FQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLP  1553
              + +  +A++LF   E SPLHL +FGH    M+ K+        ++ S  +D + +MLLP
Sbjct  1237  NRASITRAKILFYLVESSPLHLLVFGHFFFSMLSKK--------QDDSALTDDQFIMLLP  1288

Query  1554  TVFLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIE  1733
              V  YL SV+ K          I S Y  IL++ F  W  ++ R +F+ E  + + LS  
Sbjct  1289  AVLSYLTSVIAKLEKPCNRCLDITSVYSNILINGFLQWPRFLARCIFE-EKHEEILLSTT  1347

Query  1734  EFMD-IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQV  1910
             E M+ +F+ +L+ ++V M Q   +LT    K +   ++F+S+ P  ST  + LD++  +V
Sbjct  1348  EDMETMFNASLIGKAVRMFQYHFSLTESPTKEDDLFKVFNSMFPLSSTGKEMLDYEIKEV  1407

Query  1911  GTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRI---  2081
                S++Q LN   R VAK+ + R  LFPE +     LK        E  S +  +R    
Sbjct  1408  DVQSVDQILNVAIRVVAKVTVSRICLFPEDSSMCH-LKRAAGTCVKESSSKIGCNRAILS  1466

Query  2082  -RLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGCLV  2255
               LL  LV+SW+ +V+K   +   + + + + C S+ + LE  ILR+I++  + M   LV
Sbjct  1467  KPLLDALVNSWQCVVKKSDGSFKGNYEGKQDRCWSLCKSLENFILRSILQFLESMCEELV  1526

Query  2256  KLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAI  2435
             +LDSLPF+ +L K+   +RF+D  TL+ LR+I S LS GK+S    IQ ++ HS+F   I
Sbjct  1527  QLDSLPFLDRLMKSVLLYRFEDSKTLKILREIFSLLSRGKYSYAPYIQRLIYHSRFTPTI  1586

Query  2436  CSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRV  2615
              S ++S+  S  G  F P+ S++   +I   + +S+  K     + ++ KQLE++K+LRV
Sbjct  1587  SSLSISS--SNTGELFRPVSSILNHLII--LSPDSVRVKRCCLEAPKYAKQLEIVKILRV  1642

Query  2616  LFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSI-SDSNIS  2792
             L     +   ++           L FLLL SY ATL +ID EI+ L+++IK I ++  ++
Sbjct  1643  LLSNCGKDSGMKELLSD------LHFLLLCSYGATLREIDLEIYKLMHDIKLIEAEQTLN  1696

Query  2793  IAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLY  2972
             ++E DYLWG A +K R   E +   + ++   ++ ED R+   +ENL +DPK+CA TVL+
Sbjct  1697  VSETDYLWGKAALKIR---EGLSQDASDVCQVDLVEDVRQGLIKENLCVDPKICALTVLF  1753

Query  2973  FPYGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEF  3152
             FPY R          +K     +++D   EV       P+F    +F  + +GYIEPVEF
Sbjct  1754  FPYQR--------TTEKSENFYLYDDPINEV-------PVF--SFNFQLIVLGYIEPVEF  1796

Query  3153  ANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEE  3332
             A+LGLLAV+  S+SS D   RKLGY  L+ F +ALE C+K K V  L+LLL Y+QN +EE
Sbjct  1797  ASLGLLAVAFVSMSSADLGMRKLGYETLQIFLDALENCRKNKHVTGLRLLLMYVQNGVEE  1856

Query  3333  DWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSF  3512
              WQ+IP+V+AIF AE S +LLDPSH+HY  I K L  S ++ L+ IPLF +  WS +V+F
Sbjct  1857  PWQRIPTVSAIFAAETSMILLDPSHEHYVPINKLLKSSSTLKLRGIPLFHDFFWSSAVNF  1916

Query  3513  RTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKL  3692
             R++R W LR++Y GL +DDDV IYI+NSI ET++SF  SPLAD+E+K LI+Q V+KS K 
Sbjct  1917  RSQRFWELRLVYLGLKSDDDVQIYIKNSILETVISFSSSPLADDETKRLILQVVRKSVKF  1976

Query  3693  SRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWL  3872
              ++ARHL+ENCGL SW SS +++F         G       VVLE++ +++  R+  EWL
Sbjct  1977  HKIARHLVENCGLFSWCSSFISNFTTKPI----GDKDLHLVVVLEIITDVLASRNITEWL  2032

Query  3873  QKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLS  4052
             Q++ LE L E+S  L ++L  G   ++E+ T   LILQIL+ T K+SQKR +YQPHFT++
Sbjct  2033  QRFGLEGLMEISSRLYKLLGGGLVSVQENGTSVDLILQILSATLKISQKRNMYQPHFTIT  2092

Query  4053  VEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQ  4232
             +EG+F L E +    +      A++GL  ILMSTPPV IL MD  K+ +F+ W  S AL+
Sbjct  2093  IEGIFQLFEGVANFGSPQVEASAESGLITILMSTPPVDILCMDVDKLRRFLLWGTSTALK  2152

Query  4233  SETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDR  4412
             S+ K   +  +      +  E   E ++++K LRWL+ASVILGK   K S  D +    +
Sbjct  2153  SDFKKGSKPSESHEDTKILIEGPQEETMVAKFLRWLSASVILGKSYSKASDSDPTF-LSK  2211

Query  4413  SKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFK-LLPSAVSALCLLL  4589
             +K   L   LE+ ++ + E+  + + + I+   I +LQQ L T++  LLPS V AL L+L
Sbjct  2212  TKPETLLTSLEYFKKRNLEDSMQNS-EHIIGEVIVHLQQFLSTNYMFLLPSVVFALSLML  2270

Query  4590  LKNPASSG-SEVLIGNAAALCSKIRCPAEANSAWRWSFYQPWKDHSS-NLTDSEKIEEIH  4763
             L N   +G S+       +LCSKI  P EA   WRWS+YQ W+D SS   TD +KI E+H
Sbjct  2271  LHNDLGTGESDGDYKLIKSLCSKISSPPEAIPGWRWSYYQAWRDLSSEQATDLDKINELH  2330

Query  4764  ACQMLLLVASKMLARNSLYSKLISL-KDVEKLGVFEWERSIL  4886
             ACQ LLL+ S ML      S+ + L K  +   VFEWERS++
Sbjct  2331  ACQHLLLIFSAMLGETPQESQQVLLRKSFDMSHVFEWERSLV  2372



>emb|CAB36547.1| putative protein [Arabidopsis thaliana]
 emb|CAB79556.1| putative protein [Arabidopsis thaliana]
Length=2535

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/1662 (38%), Positives = 935/1662 (56%), Gaps = 90/1662 (5%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISG-LQEG  182
             +LQNF  ++ VS    G PFS L SI FLE + L ++SK  P++F +G E   SG L EG
Sbjct  927   ILQNFASVMDVSWAFYGTPFSFLQSITFLEENFLGNLSKLSPDLFASGSEFTGSGNLCEG  986

Query  183   R-------------TEEF-GDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQ  320
                           TEE    +D+ +  S+A S+FLK+A   +L    +S+  S L    
Sbjct  987   TVDSEIDFSGHSSVTEEIRSKMDNRDMESSAFSIFLKQAPFPVLLNAIMSMDISCLPEFP  1046

Query  321   GLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLR  500
              +  LLL  +S+     I S+   +LFW  Q   SY+V+P   L  LSE+C  ++  +  
Sbjct  1047  RISELLLLKVSQPKSGSIDSNIQLILFWLFQIRSSYKVQPAPVLHQLSEICLRLMKNLFS  1106

Query  501   QFLNTK---GDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNA----DFTDT  659
             Q    +   G +S+K   S    K   ++ ET+  HPVV A LE PL C         + 
Sbjct  1107  QISEPELVSGPSSNKLPASF--AKWKHQVAETVLCHPVVMALLESPLDCGTLPPVQNVEI  1164

Query  660   FSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSF-EACHARQVTKAFK  836
             FS  S+     +    V  ++D H++NLL +T E   F +   + + E     +   AFK
Sbjct  1165  FSETSL-----TMGRLVFSEIDQHILNLLVSTCEHFLFDEKPPNLWKEDLRKNKSIIAFK  1219

Query  837   NVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED  1016
             ++V++L L F+ + + C+ S+    LL     IH L RFI PF+L  + H M S+ID E 
Sbjct  1220  DLVERLLLEFRVKFELCVGSQSYVSLLQPAQLIHALLRFISPFKLFNIAHSMLSKIDEEG  1279

Query  1017  NSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKIL  1196
              +   S    +L +GL IAG  F+ L     QP ++R + DL W + E+ +   ++EK+ 
Sbjct  1280  LTSPNS--SIILSLGLGIAGGAFEMLVLYSHQPTAKRGVYDLLWELEEKNYASNIIEKVY  1337

Query  1197  LQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQ-SNPTLVMAISRFIVNIPVNLLSYCM  1373
                 + +T L LD AD+CLLK    +   K  Q  +   LV+ IS  +   P +L+ +C+
Sbjct  1338  SMACKFSTSLDLDSADICLLKVCGGIFRGKHNQNYAVDPLVLKISLIVGRTPEDLIIHCI  1397

Query  1374  FQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLP  1553
              + +  +A++LF   E SPLHL +FGH    M+ K+        ++ S  +D + +MLLP
Sbjct  1398  NRASITRAKILFYLVESSPLHLLVFGHFFFSMLSKK--------QDDSALTDDQFIMLLP  1449

Query  1554  TVFLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIE  1733
              V  YL SV+ K          I S Y  IL++ F  W  ++ R +F+ E  + + LS  
Sbjct  1450  AVLSYLTSVIAKLEKPCNRCLDITSVYSNILINGFLQWPRFLARCIFE-EKHEEILLSTT  1508

Query  1734  EFMD-IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQV  1910
             E M+ +F+ +L+ ++V M Q   +LT    K +   ++F+S+ P  ST  + LD++  +V
Sbjct  1509  EDMETMFNASLIGKAVRMFQYHFSLTESPTKEDDLFKVFNSMFPLSSTGKEMLDYEIKEV  1568

Query  1911  GTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRI---  2081
                S++Q LN   R VAK+ + R  LFPE +     LK        E  S +  +R    
Sbjct  1569  DVQSVDQILNVAIRVVAKVTVSRICLFPEDSSMCH-LKRAAGTCVKESSSKIGCNRAILS  1627

Query  2082  -RLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGCLV  2255
               LL  LV+SW+ +V+K   +   + + + + C S+ + LE  ILR+I++  + M   LV
Sbjct  1628  KPLLDALVNSWQCVVKKSDGSFKGNYEGKQDRCWSLCKSLENFILRSILQFLESMCEELV  1687

Query  2256  KLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAI  2435
             +LDSLPF+ +L K+   +RF+D  TL+ LR+I S LS GK+S    IQ ++ HS+F   I
Sbjct  1688  QLDSLPFLDRLMKSVLLYRFEDSKTLKILREIFSLLSRGKYSYAPYIQRLIYHSRFTPTI  1747

Query  2436  CSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRV  2615
              S ++S+  S  G  F P+ S++   +I   + +S+  K     + ++ KQLE++K+LRV
Sbjct  1748  SSLSISS--SNTGELFRPVSSILNHLII--LSPDSVRVKRCCLEAPKYAKQLEIVKILRV  1803

Query  2616  LFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSI-SDSNIS  2792
             L     +   ++           L FLLL SY ATL +ID EI+ L+++IK I ++  ++
Sbjct  1804  LLSNCGKDSGMKELLSD------LHFLLLCSYGATLREIDLEIYKLMHDIKLIEAEQTLN  1857

Query  2793  IAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLY  2972
             ++E DYLWG A +K R   E +   + ++   ++ ED R+   +ENL +DPK+CA TVL+
Sbjct  1858  VSETDYLWGKAALKIR---EGLSQDASDVCQVDLVEDVRQGLIKENLCVDPKICALTVLF  1914

Query  2973  FPYGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEF  3152
             FPY R          +K     +++D   EV       P+F    +F  + +GYIEPVEF
Sbjct  1915  FPYQR--------TTEKSENFYLYDDPINEV-------PVF--SFNFQLIVLGYIEPVEF  1957

Query  3153  ANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEE  3332
             A+LGLLAV+  S+SS D   RKLGY  L+ F +ALE C+K K V  L+LLL Y+QN +EE
Sbjct  1958  ASLGLLAVAFVSMSSADLGMRKLGYETLQIFLDALENCRKNKHVTGLRLLLMYVQNGVEE  2017

Query  3333  DWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSF  3512
              WQ+IP+V+AIF AE S +LLDPSH+HY  I K L  S ++ L+ IPLF +  WS +V+F
Sbjct  2018  PWQRIPTVSAIFAAETSMILLDPSHEHYVPINKLLKSSSTLKLRGIPLFHDFFWSSAVNF  2077

Query  3513  RTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKL  3692
             R++R W LR++Y GL +DDDV IYI+NSI ET++SF  SPLAD+E+K LI+Q V+KS K 
Sbjct  2078  RSQRFWELRLVYLGLKSDDDVQIYIKNSILETVISFSSSPLADDETKRLILQVVRKSVKF  2137

Query  3693  SRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWL  3872
              ++ARHL+ENCGL SW SS +++F         G       VVLE++ +++  R+  EWL
Sbjct  2138  HKIARHLVENCGLFSWCSSFISNFTTKPI----GDKDLHLVVVLEIITDVLASRNITEWL  2193

Query  3873  QKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLS  4052
             Q++ LE L E+S  L ++L  G   ++E+ T   LILQIL+ T K+SQKR +YQPHFT++
Sbjct  2194  QRFGLEGLMEISSRLYKLLGGGLVSVQENGTSVDLILQILSATLKISQKRNMYQPHFTIT  2253

Query  4053  VEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQ  4232
             +EG+F L E +    +      A++GL  ILMSTPPV IL MD  K+ +F+ W  S AL+
Sbjct  2254  IEGIFQLFEGVANFGSPQVEASAESGLITILMSTPPVDILCMDVDKLRRFLLWGTSTALK  2313

Query  4233  SETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDR  4412
             S+ K   +  +      +  E   E ++++K LRWL+ASVILGK   K S  D +    +
Sbjct  2314  SDFKKGSKPSESHEDTKILIEGPQEETMVAKFLRWLSASVILGKSYSKASDSDPTF-LSK  2372

Query  4413  SKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFK-LLPSAVSALCLLL  4589
             +K   L   LE+ ++ + E+  + + + I+   I +LQQ L T++  LLPS V AL L+L
Sbjct  2373  TKPETLLTSLEYFKKRNLEDSMQNS-EHIIGEVIVHLQQFLSTNYMFLLPSVVFALSLML  2431

Query  4590  LKNPASSG-SEVLIGNAAALCSKIRCPAEANSAWRWSFYQPWKDHSS-NLTDSEKIEEIH  4763
             L N   +G S+       +LCSKI  P EA   WRWS+YQ W+D SS   TD +KI E+H
Sbjct  2432  LHNDLGTGESDGDYKLIKSLCSKISSPPEAIPGWRWSYYQAWRDLSSEQATDLDKINELH  2491

Query  4764  ACQMLLLVASKMLARNSLYSKLISL-KDVEKLGVFEWERSIL  4886
             ACQ LLL+ S ML      S+ + L K  +   VFEWERS++
Sbjct  2492  ACQHLLLIFSAMLGETPQESQQVLLRKSFDMSHVFEWERSLV  2533



>ref|XP_009393324.1| PREDICTED: uncharacterized protein LOC103979039 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=2689

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/1702 (37%), Positives = 946/1702 (56%), Gaps = 100/1702 (6%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAI-SGLQE  179
             D+L+N  ++++++          L  + FLEP  L +V   WP MF   LE    S   +
Sbjct  1001  DVLRNLHLLLTIAPLHFTSYIQFLSYVLFLEPRFLAEVVNLWPNMFRACLEKIRNSDRND  1060

Query  180   GRTEEFGDIDSMEF------------------ASAALSLFLKEASLCMLFPITL--SIYK  299
              R      +D  +F                  A+ +L LFL+ A    LF   +    Y+
Sbjct  1061  CRGNNDHSLDRNDFMHLTEISLFSDSLVTEELAATSLGLFLRRAPFYALFSAFMCSGSYR  1120

Query  300   S------DLSTQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleeleml  461
             S      D+     +  LL   ++E + D +V     VLFW +Q   SY  EP + LE L
Sbjct  1121  SHSTRMMDILHSPDIVGLLKIKVTEGSTDDLVLFLRCVLFWAHQIRSSYEAEPSDTLEEL  1180

Query  462   selCFNIVDRMLRQFL-NTKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPC  638
              ++CF +VD +  Q L +  G   S        TK VQ++IE I  HP+VA S++ P+ C
Sbjct  1181  FQICFTVVDCIFEQVLVDFAGPTGSVTVERSSSTKYVQDVIELILNHPLVALSVQYPICC  1240

Query  639   NADFTDTFSGDSMDKFLESNKWRVIHKMDLHVINLLRTTF-ELLY-----FCDGQTSSFE  800
             +         DS D  L  +K    H MD  V+ LL   F E LY      C  QT  F+
Sbjct  1241  SRTLAVDKLYDSTDSLLTYSKQN-FHDMDSLVLQLLIKVFKEFLYGTIGSHCSSQTYVFD  1299

Query  801   ACHARQVTKAFKNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLEL  980
                  +V K  +N++QK  L F+++ D  +E +D + +LP  Y IH++ +F  PF+LLEL
Sbjct  1300  ----ERVLKVARNLIQKTALLFREKFDASVERRDFSTVLPYFYIIHSMMQFFSPFDLLEL  1355

Query  981   VHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAGSVFDSLSACM-WQPHSERPLSDL--FWG  1151
              HWMF ++++ D S   SL  +VL   L IA    D L   + W  H+    S+L  F+ 
Sbjct  1356  AHWMFGKVEI-DISGCSSLLSAVL-FCLPIADGALDLLYGYLKWSHHT----SELYHFYR  1409

Query  1152  MLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNP--TLVMAI  1325
             +    F++ +L+K+   + ++     +  A+ CLLKA  +V   + ++       L M  
Sbjct  1410  ISNRSFNVTILQKVYYSILDLVIRFDIKSANSCLLKAVNIVYNQRHLKPHTTCLPLYMLF  1469

Query  1326  SRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVH----LQ  1493
             S  +++ P+ L+  C+   +K KA +L L  E+SPLH+S+FG +   + +K       L 
Sbjct  1470  SGMVIHSPLKLVLCCLSPTSKIKATILSLLMEVSPLHMSVFGQIFLAIFNKDSSDFDVLN  1529

Query  1494  TNAIRETSNP----------SDPELLMLLPTVFLYLDSVLIKAGSQVKYFEKIVSFYWRI  1643
             T+      N           S+ + ++LLP    Y+ S        +K+   I+ FY +I
Sbjct  1530  TDGASPLRNEVAIKNFNYSLSEDDFVILLPAALSYVTS----HKKDLKFIGSILIFYSKI  1585

Query  1644  LLHIFSDWKCYVTRDMFDIESFDNLPL-SIEEFMDIFSCNLLSRSVLMVQLCSALTGYLV  1820
             LL   S+WK YV+  +F  E +  LP+ S E+F +    +LL ++V M+     L G  V
Sbjct  1586  LLENLSNWKSYVSGSVFQ-EEYHELPVTSYEDFHNCLKRSLLGKAVTMLHYFFVLNGGSV  1644

Query  1821  KFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEH  2000
               + R+++FDSV P      + LD D   + +CS + SL  V    AKI+  R LL P  
Sbjct  1645  TKKQRLKIFDSVFPHS---FELLDHDIKILNSCSHQDSLKLVIEIYAKISFTRLLLSPVE  1701

Query  2001  NKFSSGLKEDKMETCAELHST-LDVSRIRLLKMLVSSWRKIVEKFPMTADNSCQM-EVEN  2174
             +       E+  E   +  S  L+ +++R + +LV+S  +IV  FP   D S +    +N
Sbjct  1702  SLTQCLEPEESNEMTQKKESKRLNRAKLRFITILVNSLDQIVRIFPFDGDRSFRSCSSDN  1761

Query  2175  CSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDII  2354
              S+ RFLE  IL NI+ELS E  GCL +L S+PF+    ++   HRF+DP TL+ +R  +
Sbjct  1762  YSICRFLEHYILNNIIELSIESKGCLDQLPSVPFLDHFIRSCLLHRFEDPATLKAIRCFV  1821

Query  2355  SSLSEGK--FSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLT---FTPLPSLMRSFVI  2519
             ++L E K  FS  +I+ L++ HSQF + I SS+  +  S L        PLPS+++S  I
Sbjct  1822  AALPETKRTFSSSEILGLLLGHSQFVSTILSSDSFSNSSALMANESLLQPLPSILKSLDI  1881

Query  2520  PLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLL  2699
                +H + C            ++LELIKLLRVL+  K+R+ ++      G + R+L+ LL
Sbjct  1882  SCTDHKA-CEFRGTTNPHLEERKLELIKLLRVLYHYKSREYNVGHENIDGKDSRELLVLL  1940

Query  2700  LSSYNATLCDIDFEIHNLVNEIKSISDSNIS-IAEWDYLWGNAVVKARKERELVQTVSCN  2876
             LS+Y ATL + D EI +L++EI+S   S    I+E DYLWG +++K +KE  L Q  S +
Sbjct  1941  LSAYGATLSETDLEILHLMHEIESSEGSEYDKISEMDYLWGLSILKIKKEVTLDQLSSSS  2000

Query  2877  LSDA-EVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPN--GPGVVNKVQKDTF-DSMH  3044
             ++   E AED RK+ FREN+P+D K C +TVL+F Y R +      +  +  D F D++ 
Sbjct  2001  MTPGCESAEDLRKLLFRENIPVDTKQCVTTVLHFCYNRSSLTASMSLENLLHDKFGDTIE  2060

Query  3045  EDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLG  3224
             +    ++     YDP FILR S H L M +I+PVEFA LGLLA++  SISS D++ RKLG
Sbjct  2061  QSLKGDLVLG--YDPAFILRFSLHSLVMDFIKPVEFAQLGLLAIAFLSISSLDEELRKLG  2118

Query  3225  YGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPS  3404
             Y VL +FK A+E C++ KD+++LQLLL+Y QN I E W+++PSV AIF AEASF+LLDP 
Sbjct  2119  YEVLGRFKLAVENCRRNKDLLQLQLLLTYFQNGITEPWERVPSVFAIFAAEASFILLDPR  2178

Query  3405  HDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIY  3584
              +H+ TI K LM SP++N KS+PLF     S S+ F+ ER WIL++L++G+N DDD  IY
Sbjct  2179  QNHFLTINKLLMHSPNMNFKSVPLFHAFFGSTSIHFKMERTWILQLLHAGINLDDDAKIY  2238

Query  3585  IRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSF  3764
               N + E LLSF+ S ++D++S  L++Q VKKS K+  +A +L++ CGL+SWL SV++ F
Sbjct  2239  RSNKLMEFLLSFHASSMSDSQSSFLVLQIVKKSVKVPILADYLLKECGLLSWLFSVLSFF  2298

Query  3765  CGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQ  3944
                     K F  +   +VL+VV +++  R   EWLQ+ ALEQLS+LS +L  + V   +
Sbjct  2299  GERLGRKEKQFSLSVMELVLKVVTDVVSTRSISEWLQECALEQLSQLSSYLHVLFVNELK  2358

Query  3945  MLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIA-  4121
             +LKE+ +   L L ++  T ++S KR +YQPHFT+S EGLF L  AI+   +  +  +  
Sbjct  2359  VLKENVSVVNLFLHVMISTIRLSHKRMIYQPHFTISFEGLFQLYLAINDEFSSTHCAVTN  2418

Query  4122  KTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSET-KGVLQVEKCCFPLNVSSEE  4298
             + G+  ILM TP     ++D  ++ K + WA+S +LQSE+ K  L  +     L V  E+
Sbjct  2419  ELGVMTILMCTPVPVKSKLDKARLVKLVRWAISASLQSESQKNYLFKQSYPHLLLVHKEQ  2478

Query  4299  ETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEW---NEESDRE  4469
             +    L+SKL+RW+TASVILG +S K   + +  S  RS    LH LLE+    + S RE
Sbjct  2479  QDNELLMSKLMRWVTASVILGSMSNKYLNIKTEFSLKRSSFATLHSLLEFIVKEKGSFRE  2538

Query  4470  NGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPAS-SGSEVLIGN---A  4637
               + F+  E +AA + YLQQ++ +S   LPS + ALCLLLL + +S +G++ L  N    
Sbjct  2539  --ENFSADEAIAAMLLYLQQIMRSSIN-LPSVIFALCLLLLSDGSSTTGTDFLDENHIQI  2595

Query  4638  AALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSL  4817
             + LCSKIRCP E N AWRWSF QPW+D +S  T+  ++EE  AC+ LL++ S  LA    
Sbjct  2596  SQLCSKIRCPVETNPAWRWSFDQPWRDATSEPTEINQMEEEQACRSLLVIFSTALAGKQS  2655

Query  4818  YSKLISLKDVEKLGVFEWERSI  4883
                ++S  D+EK G+FEWER I
Sbjct  2656  GFPVLSYLDLEKSGLFEWERCI  2677



>ref|NP_001154270.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE85284.1| uncharacterized protein AT4G27010 [Arabidopsis thaliana]
Length=2402

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/1690 (37%), Positives = 935/1690 (55%), Gaps = 118/1690 (7%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISG-LQEG  182
             +LQNF  ++ VS    G PFS L SI FLE + L ++SK  P++F +G E   SG L EG
Sbjct  766   ILQNFASVMDVSWAFYGTPFSFLQSITFLEENFLGNLSKLSPDLFASGSEFTGSGNLCEG  825

Query  183   R-------------TEEF-GDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQ  320
                           TEE    +D+ +  S+A S+FLK+A   +L    +S+  S L    
Sbjct  826   TVDSEIDFSGHSSVTEEIRSKMDNRDMESSAFSIFLKQAPFPVLLNAIMSMDISCLPEFP  885

Query  321   GLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLR  500
              +  LLL  +S+     I S+   +LFW  Q   SY+V+P   L  LSE+C  ++  +  
Sbjct  886   RISELLLLKVSQPKSGSIDSNIQLILFWLFQIRSSYKVQPAPVLHQLSEICLRLMKNLFS  945

Query  501   QFLNTK---GDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNA----DFTDT  659
             Q    +   G +S+K   S    K   ++ ET+  HPVV A LE PL C         + 
Sbjct  946   QISEPELVSGPSSNKLPASF--AKWKHQVAETVLCHPVVMALLESPLDCGTLPPVQNVEI  1003

Query  660   FSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSF-EACHARQVTKAFK  836
             FS  S+     +    V  ++D H++NLL +T E   F +   + + E     +   AFK
Sbjct  1004  FSETSL-----TMGRLVFSEIDQHILNLLVSTCEHFLFDEKPPNLWKEDLRKNKSIIAFK  1058

Query  837   NVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED  1016
             ++V++L L F+ + + C+ S+    LL     IH L RFI PF+L  + H M S+ID E 
Sbjct  1059  DLVERLLLEFRVKFELCVGSQSYVSLLQPAQLIHALLRFISPFKLFNIAHSMLSKIDEEG  1118

Query  1017  NSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKIL  1196
              +   S    +L +GL IAG  F+ L     QP ++R + DL W + E+ +   ++EK+ 
Sbjct  1119  LTSPNS--SIILSLGLGIAGGAFEMLVLYSHQPTAKRGVYDLLWELEEKNYASNIIEKVY  1176

Query  1197  LQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQ-SNPTLVMAISRFIVNIPVNLLSYCM  1373
                 + +T L LD AD+CLLK    +   K  Q  +   LV+ IS  +   P +L+ +C+
Sbjct  1177  SMACKFSTSLDLDSADICLLKVCGGIFRGKHNQNYAVDPLVLKISLIVGRTPEDLIIHCI  1236

Query  1374  FQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLP  1553
              + +  +A++LF   E SPLHL +FGH    M+ K+        ++ S  +D + +MLLP
Sbjct  1237  NRASITRAKILFYLVESSPLHLLVFGHFFFSMLSKK--------QDDSALTDDQFIMLLP  1288

Query  1554  TVFLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIE  1733
              V  YL SV+ K          I S Y  IL++ F  W  ++ R +F+ E  + + LS  
Sbjct  1289  AVLSYLTSVIAKLEKPCNRCLDITSVYSNILINGFLQWPRFLARCIFE-EKHEEILLSTT  1347

Query  1734  EFMD-IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQV  1910
             E M+ +F+ +L+ ++V M Q   +LT    K +   ++F+S+ P  ST  + LD++  +V
Sbjct  1348  EDMETMFNASLIGKAVRMFQYHFSLTESPTKEDDLFKVFNSMFPLSSTGKEMLDYEIKEV  1407

Query  1911  GTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRI---  2081
                S++Q LN   R VAK+ + R  LFPE +     LK        E  S +  +R    
Sbjct  1408  DVQSVDQILNVAIRVVAKVTVSRICLFPEDSSMCH-LKRAAGTCVKESSSKIGCNRAILS  1466

Query  2082  -RLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGCLV  2255
               LL  LV+SW+ +V+K   +   + + + + C S+ + LE  ILR+I++  + M   LV
Sbjct  1467  KPLLDALVNSWQCVVKKSDGSFKGNYEGKQDRCWSLCKSLENFILRSILQFLESMCEELV  1526

Query  2256  KLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAI  2435
             +LDSLPF+ +L K+   +RF+D  TL+ LR+I S LS GK+S    IQ ++ HS+F   I
Sbjct  1527  QLDSLPFLDRLMKSVLLYRFEDSKTLKILREIFSLLSRGKYSYAPYIQRLIYHSRFTPTI  1586

Query  2436  CSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRV  2615
              S ++S+  S  G  F P+ S++   +I   + +S+  K     + ++ KQLE++K+LRV
Sbjct  1587  SSLSISS--SNTGELFRPVSSILNHLII--LSPDSVRVKRCCLEAPKYAKQLEIVKILRV  1642

Query  2616  LFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSI-SDSNIS  2792
             L     +   ++           L FLLL SY ATL +ID EI+ L+++IK I ++  ++
Sbjct  1643  LLSNCGKDSGMKELLSD------LHFLLLCSYGATLREIDLEIYKLMHDIKLIEAEQTLN  1696

Query  2793  IAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLY  2972
             ++E DYLWG A +K R   E +   + ++   ++ ED R+   +ENL +DPK+CA TVL+
Sbjct  1697  VSETDYLWGKAALKIR---EGLSQDASDVCQVDLVEDVRQGLIKENLCVDPKICALTVLF  1753

Query  2973  FPYGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEF  3152
             FPY R          +K     +++D   EV       P+F    +F  + +GYIEPVEF
Sbjct  1754  FPYQR--------TTEKSENFYLYDDPINEV-------PVF--SFNFQLIVLGYIEPVEF  1796

Query  3153  ANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALE------------------------  3260
             A+LGLLAV+  S+SS D   RKLGY  L+ F +ALE                        
Sbjct  1797  ASLGLLAVAFVSMSSADLGMRKLGYETLQIFLDALEMGKDIVEGNILAFPICTEDFNWFC  1856

Query  3261  ----KCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATIT  3428
                  C+K K V  L+LLL Y+QN +EE WQ+IP+V+AIF AE S +LLDPSH+HY  I 
Sbjct  1857  KGLMNCRKNKHVTGLRLLLMYVQNGVEEPWQRIPTVSAIFAAETSMILLDPSHEHYVPIN  1916

Query  3429  KHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFET  3608
             K L  S ++ L+ IPLF +  WS +V+FR++R W LR++Y GL +DDDV IYI+NSI ET
Sbjct  1917  KLLKSSSTLKLRGIPLFHDFFWSSAVNFRSQRFWELRLVYLGLKSDDDVQIYIKNSILET  1976

Query  3609  LLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHW  3788
             ++SF  SPLAD+E+K LI+Q V+KS K  ++ARHL+ENCGL SW SS +++F        
Sbjct  1977  VISFSSSPLADDETKRLILQVVRKSVKFHKIARHLVENCGLFSWCSSFISNFTTKPI---  2033

Query  3789  KGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTF  3968
              G       VVLE++ +++  R+  EWLQ++ LE L E+S  L ++L  G   ++E+ T 
Sbjct  2034  -GDKDLHLVVVLEIITDVLASRNITEWLQRFGLEGLMEISSRLYKLLGGGLVSVQENGTS  2092

Query  3969  TKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILM  4148
               LILQIL+ T K+SQKR +YQPHFT+++EG+F L E +    +      A++GL  ILM
Sbjct  2093  VDLILQILSATLKISQKRNMYQPHFTITIEGIFQLFEGVANFGSPQVEASAESGLITILM  2152

Query  4149  STPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKL  4328
             STPPV IL MD  K+ +F+ W  S AL+S+ K   +  +      +  E   E ++++K 
Sbjct  2153  STPPVDILCMDVDKLRRFLLWGTSTALKSDFKKGSKPSESHEDTKILIEGPQEETMVAKF  2212

Query  4329  LRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAA  4508
             LRWL+ASVILGK   K S  D +    ++K   L   LE+ ++ + E+  + + + I+  
Sbjct  2213  LRWLSASVILGKSYSKASDSDPTF-LSKTKPETLLTSLEYFKKRNLEDSMQNS-EHIIGE  2270

Query  4509  SIFYLQQLLGTSFK-LLPSAVSALCLLLLKNPASSG-SEVLIGNAAALCSKIRCPAEANS  4682
              I +LQQ L T++  LLPS V AL L+LL N   +G S+       +LCSKI  P EA  
Sbjct  2271  VIVHLQQFLSTNYMFLLPSVVFALSLMLLHNDLGTGESDGDYKLIKSLCSKISSPPEAIP  2330

Query  4683  AWRWSFYQPWKDHSS-NLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISL-KDVEKL  4856
              WRWS+YQ W+D SS   TD +KI E+HACQ LLL+ S ML      S+ + L K  +  
Sbjct  2331  GWRWSYYQAWRDLSSEQATDLDKINELHACQHLLLIFSAMLGETPQESQQVLLRKSFDMS  2390

Query  4857  GVFEWERSIL  4886
              VFEWERS++
Sbjct  2391  HVFEWERSLV  2400



>ref|XP_002891275.1| hypothetical protein ARALYDRAFT_314107 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67534.1| hypothetical protein ARALYDRAFT_314107 [Arabidopsis lyrata subsp. 
lyrata]
Length=2475

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 604/1647 (37%), Positives = 905/1647 (55%), Gaps = 94/1647 (6%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS-GLQEG  182
             +L+NF  ++++S  + G  FS L SI FLE + L ++SK  P++F  GLE   S  L+EG
Sbjct  887   ILENFASVMAISWDLYGTSFSFLQSIAFLEENFLGNLSKLSPDLFVRGLELTRSRNLREG  946

Query  183   RTE---EFGDIDSMEFA-----------SAALSLFLKEASLCMLFPITLSIYKSDLSTQQ  320
               +   +F D  S+  A           S+ALS+F ++A   +L    +S+  S +    
Sbjct  947   IVDSEIDFADYSSVTEAIKSKVEIRDIYSSALSMFFEQAPFPVLLNEIMSMDISCVPEFP  1006

Query  321   GLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLR  500
              L  LLL  + +   D+I S    +LFW  Q   SY+++P   L  +SE+C  ++  +  
Sbjct  1007  RLAELLLLKVWQPKSDNIESDIRLILFWLFQIRSSYKIQPAPVLCRISEICLRLLKHLFS  1066

Query  501   QFLNTKGDASSKCTRSLLP--TKCVQELIETIFYHPVVAASLECPLPCNA----DFTDTF  662
             Q ++ +G  S   +  L+    K   ++ +T+  HPVV A LE PL C           F
Sbjct  1067  Q-ISERGFVSGPSSDKLVAPFAKWKHQVAQTVLCHPVVMALLESPLDCGTLPPVHNVKIF  1125

Query  663   SGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNV  842
             S  S+     +    VI ++D  +++LL +  E   F +            +    FK++
Sbjct  1126  SETSL-----TTSRLVICEIDQQILDLLVSICEHFLFDERHIVQDGDLRENKSITVFKDL  1180

Query  843   VQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNS  1022
             VQ+L L F+D+ + C+ S+   PLL     IH L RFI PF+LLEL   M S+ID E+  
Sbjct  1181  VQRLLLLFRDKFELCVGSQSYAPLLQPSQLIHALLRFISPFKLLELARSMLSKIDEEE--  1238

Query  1023  FQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQ  1202
                     ++ +GL IAG  F+ L +    P ++R + DL W + EE +D +L+E++   
Sbjct  1239  LASPNLSMIISLGLDIAGGAFEMLISYSHLPAAKRGVYDLLWELKEENYDSILIEEVYSM  1298

Query  1203  VYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSYCMFQ  1379
                 +T   L  AD CLLK    +   K  +  N   L + IS+ +   P +L+ + + Q
Sbjct  1299  ACRFSTSFGLVSADTCLLKVGSSIFRGKHNRHCNVHPLTVIISQIVGRTPKDLIIHYINQ  1358

Query  1380  INKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTV  1559
              +  +A++LF   E SPLHLS+FGH    M+ KQ            + SD + +ML P V
Sbjct  1359  PSMTRAKILFYLVESSPLHLSVFGHSFFSMLSKQ-----------QDGSD-QFIMLPPAV  1406

Query  1560  FLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEF  1739
               YL SV  K  +       I S Y   L + F  W  +++  +F+ E ++ + +S  E 
Sbjct  1407  LSYLASVYAKIETPCSRCLDITSLYSNKLTNGFHQWPSFLSGWIFE-EKYEEILMSTTED  1465

Query  1740  MD-IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGT  1916
             +D +F+ +LL  +V M Q   AL     K +  +++F S+ P  S      D++  ++  
Sbjct  1466  IDTMFNASLLGMAVRMFQCHFALNESPTKIDDLLKVFYSMFPHASAGKKMFDYEIKEMDA  1525

Query  1917  CSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKM  2096
              S+    N   R VAK+   R  LFPE +      K   +    E    +   R  LL  
Sbjct  1526  QSVHYMFNVAIRVVAKVEFSRICLFPEDSSICH-FKSQAVSCAKESSPEMGSCRESLLNA  1584

Query  2097  LVSSWRKIVEKFPMTADNSCQMEVENCSVF-RFLEVLILRNIVELSKEMHGCLVKLDSLP  2273
             LV SW  +V++       + + + + C    + LE  ILR+I+++ K M   LV LDSLP
Sbjct  1585  LVESWPCVVKRSDGYFQGNSERKQDKCWFLCKSLENFILRSILKILKYMCEELVNLDSLP  1644

Query  2274  FIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLS  2453
             F+ KL K+   +RF+D  TL+ LRDI S LS GK+SC   IQL+V+HSQF   I S+   
Sbjct  1645  FLEKLMKSVLLYRFEDSKTLKLLRDIFSLLSRGKYSCTLYIQLLVSHSQFTPTILSA---  1701

Query  2454  TGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKA  2633
                S+ G    P+ S+++   IP  + NS+        +  ++KQLE++K+LRVL     
Sbjct  1702  ---SRTGELLRPVSSILKHLSIP--SPNSVGVGSCCLEAPDYVKQLEIVKILRVLLS---  1753

Query  2634  RQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN-ISIAEWDY  2810
                  +  +  GINL++L FL L SY AT+ +ID E++ L+++I+ I D   ++++E DY
Sbjct  1754  -----KCGKGSGINLKELRFLFLCSYGATMSEIDLELYKLMHDIELIEDEQRLNVSETDY  1808

Query  2811  LWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRP  2990
             LWG A +K R+     Q       +A + E+ ++I F+ENL IDPK+CA T+LYFPY R 
Sbjct  1809  LWGKAALKIREGLRFSQDAYYG-GEAGLVENLQQILFKENLWIDPKICAQTLLYFPYQR-  1866

Query  2991  NGPGVVNKVQKDTF---DSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANL  3161
                    +V  +++   D + E CS  +     YDP +IL  S H LSMG IEPV+FA+ 
Sbjct  1867  -----TAEVSDNSYISDDPVSEKCSPVIER---YDPAYILPFSIHSLSMGCIEPVKFASS  1918

Query  3162  GLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQ  3341
             GLLAV+LAS SS D   RKLGY  L  F +AL++C+K ++VM L LLL +++N +++ W+
Sbjct  1919  GLLAVALASTSSADLGMRKLGYETLGIFVHALKRCEKNENVMGLMLLLMHVENGVDKRWK  1978

Query  3342  KIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTE  3521
             +IP+V A F A  S +LLD SH+ YA I K L  S ++NLK IPLF +  WS +V  R++
Sbjct  1979  RIPTVCAYFAAVTSLILLDSSHELYAPINKLLKSSSTLNLKGIPLFYDFFWSSTVVLRSQ  2038

Query  3522  RLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRM  3701
             RLW LR++  GL ++DD  +YIRNS+ ETL+SF  SPLAD+E+K LI+Q V+KS K  ++
Sbjct  2039  RLWELRLVCVGLESEDDAQLYIRNSVLETLMSFSSSPLADDETKGLILQVVRKSVKFHKI  2098

Query  3702  ARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKY  3881
             ARHL+ENCGL+ W SS ++ F         G   ++   VLEV+ + +  R+   WLQ+ 
Sbjct  2099  ARHLVENCGLLLWCSSFISMFATKPI----GDEDSRLVAVLEVITDTLASRNVTVWLQRS  2154

Query  3882  ALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEG  4061
             ALE+L E+S  L + L  G   +KE+ T   LILQIL+ T K+SQKRK+YQPHFT+++EG
Sbjct  2155  ALEELMEISSRLYRFLGGGLVSVKENGTLVDLILQILSATLKISQKRKLYQPHFTITIEG  2214

Query  4062  LFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSET  4241
             +  L EA+  C +      A+ GL+ ILMSTPP+ I+ MD  K+ +F+ W  S AL+S+ 
Sbjct  2215  ICQLFEAVANCDSPQVEASAERGLDVILMSTPPIDIICMDVDKLRRFLFWGSSTALKSDF  2274

Query  4242  KGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKL  4421
             +   +  +        SEE  E ++++K LRWL ASVILGK+  + + LDS+   +    
Sbjct  2275  EKGSKPSESHKDTKTHSEEAQEETMVAKFLRWLLASVILGKLYSEANDLDSTVLSETKP-  2333

Query  4422  INLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGT-SFKLLPSAVSALCLLLLKN  4598
                  LLE+ ++ + E G     + IL   I YLQ+LL T +  LLPS V AL L+LL+N
Sbjct  2334  ---ETLLEYLKQRNIE-GSMTKSEHILGEVIVYLQKLLCTNNMVLLPSVVFALSLMLLRN  2389

Query  4599  ----PASSGSEVLIGNAAALCSKIRCPAEANSAWRWSFYQPWKDHSSN-LTDSEKIEEIH  4763
                  A + SE       +LCS+I CP EA   WRWS+YQ WKD S+   TD +KI+   
Sbjct  2390  GLFLTADTESEGDYKLIRSLCSRISCPPEAIPVWRWSYYQGWKDLSTGPATDPKKID---  2446

Query  4764  ACQMLLLVASKMLARNSLYSKLISLKD  4844
             ACQ LLL+ S ML      S+ + L+D
Sbjct  2447  ACQQLLLIFSDMLGTMPQESQQVLLRD  2473



>emb|CDX89286.1| BnaA01g16070D [Brassica napus]
Length=2425

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/1677 (36%), Positives = 900/1677 (54%), Gaps = 111/1677 (7%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEGR  185
             +L+NF  ++++S  + G  FS+L ++ FLE + + D+SK  P++   G E       E  
Sbjct  810   ILENFDSVMAISWTLYGTSFSILQAMAFLEENFVGDLSKLSPDLLVRGSELTGETCFEDH  869

Query  186   ---TEEF-GDIDSMEFASAALSLFLKEASLCMLFPITLSIYKS-DLSTQQGLHNLLLANL  350
                TEE    +D  +  S A   FL++    + FP  L+  KS D+S    +  LLL  +
Sbjct  870   SSITEEIKSKMDVCDTESPAFPTFLEQ----LPFPELLTAIKSMDISWLPRVSELLLLKV  925

Query  351   SERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDAS  530
             S    D   S  L +LF       SY+V+P      LS++C     R+++   +   +  
Sbjct  926   SHPKSDSFESVKL-ILFHLYHIRSSYKVQPAPVHCQLSKICL----RLMKHLFSQISELE  980

Query  531   SKCTRSLLPT-KCVQELIETIFYHPVVAASLECPLPCNA----DFTDTFSGDSMDKFLES  695
                 + L P+ K   ++ +T+  HPVV A LE PL C         + F   S+     +
Sbjct  981   PSSDKVLAPSAKWKHQVAQTVLCHPVVMALLESPLDCGTLPLVQNVEIFPETSL-----A  1035

Query  696   NKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDR  875
                 V+ ++D H+++LL TT E   F +            +   AFK +V+ L L F+ +
Sbjct  1036  TGRIVLSEIDQHILDLLATTCEHFLFDETHIVQKGELRDHKSIVAFKTLVETLLLEFRGK  1095

Query  876   TDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLR  1055
              + C+ ++   PLL     IH L RF  PF+LL L   M   +D+E+          ++ 
Sbjct  1096  LELCVGTQSYAPLLQPSQVIHALLRFTSPFKLLNLARSML--VDVEE--LASPNLSKIVS  1151

Query  1056  VGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLD  1235
             +GL IAG  F+ L+    Q  ++R + DL W + E+ +D  LLE++       +T   L 
Sbjct  1152  LGLDIAGGAFEMLTLYSQQTAAKRKIYDLLWDLEEKNYDSNLLEEVYSLACRFSTSFGLV  1211

Query  1236  VADMCLLKAFKVVKTHKVMQQSNPTLV-MAISRFIVNIPVNLLSYCMFQINKRKAELLFL  1412
              AD CLLK    +   K  Q S+  L+ + IS+ +   P +L+ +C+ Q +  +A++LF 
Sbjct  1212  SADTCLLKVGGAIFRGKHNQHSSAHLLTVIISQIVGRTPEDLIIHCINQASMTRAKILFY  1271

Query  1413  ATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKA  1592
               E SPLH S+FGH    M+ KQ        +  S  +D + +MLLP V  YL  +  K 
Sbjct  1272  FVESSPLHRSVFGHFFYSMLSKQ--------QGDSALTDDQFIMLLPAVLSYLSPIFAKP  1323

Query  1593  GSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMD-IFSCNLLS  1769
                      I S Y  IL++ F  W  + +  +FD E ++ + LS  E +D +F  +LL 
Sbjct  1324  EKPWSRCLDITSVYSNILINGFLQWPKFSSGCIFD-EKYEEILLSTTEDIDTMFKASLLG  1382

Query  1770  RSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVN  1949
             ++V M Q   A T    K E  +++F S+ P  S   + LD    +V   S++   N   
Sbjct  1383  KAVRMFQDHFAWTESPTKREDLLKVFQSMFPHTSAGKEMLDCRIKEVDVQSVDCMFNVAI  1442

Query  1950  RTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEK  2129
             R VAK+ L R  LFP  +           ++ +E+ S  +     LL  LV  W+ +V++
Sbjct  1443  REVAKVELSRICLFPASSNHKRQAGSCVKKSSSEMGSNNESLFTPLLSYLVDRWQCVVKR  1502

Query  2130  FPMTADNSCQMEVENCSVF-RFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFW  2306
             F  +   + + + + C +  + LE  ILRNI++  ++M   LV LDSLPF+  L K+   
Sbjct  1503  FDGSFKGNAERKQDKCGLLCKSLENFILRNILKFLEDMCEELVHLDSLPFLEGLMKSVLL  1562

Query  2307  HRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFT  2486
             +RFDD  TL+ LR+I S LS GK+S    IQL+++HSQF   I  S+LS+  S  G  F 
Sbjct  1563  YRFDDSRTLKILREIFSLLSRGKYSYAPYIQLLISHSQFTPTI--SSLSS--SHTGELFR  1618

Query  2487  PLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEI  2666
             P+ S+++  +IP  + +S+        +  ++KQLE++K+LRVL          +  ++ 
Sbjct  1619  PISSILKHLIIP--SPDSVRVGSCSLQAPDYMKQLEIVKILRVLLS--------KCGKDS  1668

Query  2667  GINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN-ISIAEWDYLWGNAVVKARK  2843
             GI L++L FLLL SY ATL +ID E++ L+ +I+ + + + + ++E  YLWG A +K R+
Sbjct  1669  GIILKELHFLLLCSYGATLSEIDIELYRLIRDIELVDEEHTLDVSETGYLWGKAALKMRE  1728

Query  2844  ERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQK  3023
                L Q  S    D ++ ED R   F+ENL +DPK+CA TVLYFP             Q+
Sbjct  1729  GLRLSQDASDGGED-DLVEDLRLRLFKENLCVDPKICALTVLYFPD------------QR  1775

Query  3024  DTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPD  3203
                D + E+ S  V +   YDP FILR S H LS+GYIEP+EFA+LGLLAV+ AS+SS D
Sbjct  1776  SADDPVIEEFSPIVEDIERYDPAFILRFSIHSLSVGYIEPLEFASLGLLAVAFASMSSAD  1835

Query  3204  DDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEAS  3383
                RKL Y  L  F + LE C + K V  ++LLL  L+N +EE WQ+IP+V+A+F AEAS
Sbjct  1836  LGMRKLAYDTLMMFLDVLESCTRNKQVKWIRLLLLCLKNGVEEPWQRIPTVSAVFAAEAS  1895

Query  3384  FVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNT  3563
              +LL+ SH+HY  I K L  SPS+NL+ IPLF   LWS + +F+++RLW LR++  GL +
Sbjct  1896  LILLNSSHEHYVPIKKLLKSSPSLNLRGIPLFHEFLWSSAFNFKSQRLWELRLVCVGLKS  1955

Query  3564  DDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
             DDD  +Y RNSI E ++SF+ +PLAD+E+K LI+Q V+KS K    ARHL++NCGL SW 
Sbjct  1956  DDDAKLYTRNSILEDMMSFFSTPLADDETKGLILQVVRKSVKF--QARHLVQNCGLFSWC  2013

Query  3744  SSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQK---------------  3878
             SS+++ F         G       +VL V+ +++  R   +WLQ                
Sbjct  2014  SSLISMFTTKPI----GDEDFHLVIVLNVITDVLASRSVTQWLQGEEMRGGPYGECGQKS  2069

Query  3879  --------------YALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQ  4016
                           + LE L E+S  LC++LV G   ++E++T   LILQIL+ T K+SQ
Sbjct  2070  IIESDHNNNRIDHPFPLEGLVEISSRLCRLLVGGLVSIQENTTLVDLILQILSATLKISQ  2129

Query  4017  K-RKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKV  4193
             K RK+YQPHFT+++ G+  L EA+  C +      A+ GLE ILMSTPP  ++ MD  K+
Sbjct  2130  KVRKIYQPHFTITIGGILQLFEAVANCDSPQVEASAERGLETILMSTPPFELICMDIDKL  2189

Query  4194  SKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISY  4373
               F+ W  S AL+S+ +      +        ++E  E S+++K LRWL ASVILGK+  
Sbjct  2190  RMFLLWGTSTALKSDLRKGSNPSESRQDTKTLTKEPQEESMVAKFLRWLCASVILGKLYS  2249

Query  4374  KLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKL  4553
             K +  D S    ++K   L  LL++ +  + E G E   + I+  +I +LQQLL T++ +
Sbjct  2250  KANDSDPS-VLSKTKPETLLTLLDYLKTRNLE-GSETKSEHIIGEAIVHLQQLLSTNYSV  2307

Query  4554  LPSAVSALCLLLLKNP---ASSGSEVLIGNAAALCSKIRCPAEANSAWRWSFYQPWKDHS  4724
             LPS V AL  +LL+N    A S S        +LC  I  P EA   WRWS+YQ WKD S
Sbjct  2308  LPSVVCALSSMLLRNGLEIAGSESGCDYKLIESLCCGISSPPEATPDWRWSYYQAWKDLS  2367

Query  4725  SN-LTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISL-KDVEKLGVFEWERSILN  4889
             S   TD + I+E HACQ LLL+ S ML      S+++ L K  +   VF+WER ++ 
Sbjct  2368  SEPATDLQNIDERHACQHLLLIFSDMLRVEPGKSQMVLLHKSFDMSSVFDWERGLVE  2424



>emb|CDY29264.1| BnaC01g19160D [Brassica napus]
Length=2448

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/1692 (36%), Positives = 911/1692 (54%), Gaps = 116/1692 (7%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEGR  185
             +L+NF  ++++S  + G  FS+L +I FLE + L D+SK  P++   G E     + + R
Sbjct  808   ILKNFDSVMAISWSLYGTSFSILQAIAFLEENFLGDLSKLSPDLLVRGSELTGETVFDDR  867

Query  186   ---TEEF-GDIDSMEFASAALSLFLKEASLCMLFPITLSIYKS-DLSTQQGLHNLLLANL  350
                TEE    +D  +  S A   FL++    + FP  L+  KS D+S    +  LLL  +
Sbjct  868   SSITEEIKSKMDVCDTESPAFPTFLEQ----LPFPELLTAIKSMDISWLPRISELLLLKV  923

Query  351   SERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDAS  530
             S    D    S   +LF       SY+V+P   L  LSE+C     R+++ F +   +  
Sbjct  924   SHPKSDSF-ESIKLILFHLYHIRSSYKVQPSPVLCQLSEICL----RLIKHFFSQISELE  978

Query  531   SKCTRSLLPT-KCVQELIETIFYHPVVAASLECPLPCNA----DFTDTFSGDSMDKFLES  695
                 + L P+ K   ++ +T+  HPVV A LE PL C         + F   S+     +
Sbjct  979   PSSEKVLAPSAKWKHQVAQTVLCHPVVMALLESPLDCGTLPQVQNVEIFPETSL-----A  1033

Query  696   NKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDR  875
                 V+ ++D H+++LL +T E   F +            +   AFKN+V+ L L F+ +
Sbjct  1034  TGMIVLSEIDQHILDLLASTCEHFLFDERHIVQKGELRENKSIVAFKNLVETLLLEFRSK  1093

Query  876   TDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLR  1055
                C+ ++   PLL     IH L RFI PF+LL L   M   ID+E+          ++ 
Sbjct  1094  LKLCVGTQSYAPLLQPSQVIHALLRFISPFKLLNLARSML--IDVEE--LASPNLSKIVS  1149

Query  1056  VGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLD  1235
             +GL IAG  F+ L+    QP ++R   DL W + E  +D  LLE++       +T   L 
Sbjct  1150  LGLDIAGRAFEMLTLYSQQPAAKRKTYDLLWDLEENNYDSNLLEEVYSLACRFSTSFGLV  1209

Query  1236  VADMCLLKAFKVVKTHKVMQQSNPTLV-MAISRFIVNIPVNLLSYCMFQINKRKAELLFL  1412
              ADMCLLK    +   K  Q S+  L+ + IS+ +   P +L+ +C+ Q +  +A++LF 
Sbjct  1210  SADMCLLKVGGGIFRGKHNQHSSAHLLTLIISQIVGRTPEDLIIHCINQASMTRAKILFY  1269

Query  1413  ATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKA  1592
               E SPLH S+FGH    M+ KQ   Q +A       +D +L+MLLP V  YL  V  K 
Sbjct  1270  LVESSPLHRSVFGHFFYTMLSKQ---QGDAAL-----TDDQLIMLLPAVLSYLSPVFAKP  1321

Query  1593  GSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMD-IFSCNLLS  1769
                      I SFY  IL + F  W  + +  +F+ E ++ + LS  E +D +F  +LL 
Sbjct  1322  EKPCSRCLDITSFYSNILRNGFLQWPKFSSGCIFE-EKYEEILLSANEDIDTMFKASLLG  1380

Query  1770  RSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVN  1949
             ++V M Q   A T    K E  +++F S+ P  S   + LD +  +V   S++   N   
Sbjct  1381  KAVRMFQEHLAWTESPTKTEDLLKVFQSMFPHTSAGKEMLDCEIKEVDVQSVDCMFNVAI  1440

Query  1950  RTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEK  2129
             R VAK+ L R  LFP  + F         E  +E+ S  +     LL  LV  W+ +V++
Sbjct  1441  REVAKVELSRICLFPADSNFKRQAASCVKENPSEMGSNKESLFTALLDYLVDRWQCVVKR  1500

Query  2130  FPMTADNSCQMEVENCSVF-RFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFW  2306
             F  +     + + + C +  + LE  ILRNI++  ++M   LV LDSLPF+  L K+   
Sbjct  1501  FDGSFKGKSEEKQDKCGLLCKSLENFILRNILKFLEDMCEELVHLDSLPFLEGLMKSVLL  1560

Query  2307  HRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFT  2486
             +RF+D MTL+ LR+I   LS GK+S    IQL+++HSQF   I  S+LS+  S  G  F 
Sbjct  1561  YRFEDSMTLKILREIFCVLSRGKYSYASYIQLLISHSQFTPTI--SSLSS--SHTGDLFR  1616

Query  2487  PLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEI  2666
             P+ S+++  +IP  + +S+        +  ++KQLE++K+LRVL          +  ++ 
Sbjct  1617  PISSILKHLIIP--SPSSVGVGSCRLQAPDYVKQLEIVKILRVLLS--------KCGKDS  1666

Query  2667  GINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN-ISIAEWDYLWGNAVVKARK  2843
             GI L++L FLLL SY ATL +ID E++ L+ +I+ I + + + ++E  YLWG A +K R+
Sbjct  1667  GIILKELHFLLLCSYGATLREIDIELYRLIRDIELIDEEHTLDVSETGYLWGKAALKMRE  1726

Query  2844  ERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQK  3023
                L Q  S    D ++ ED R+  F+ENL +DPK+CA TVLYF Y R       + +  
Sbjct  1727  GLRLSQDASDGGED-DLVEDLRQRLFKENLCVDPKICALTVLYFSYQRSAEVSDNSYLSD  1785

Query  3024  DTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPD  3203
             D    +      ++ +   YDP FILR S H LS+GYIEP+EFA+LGLLAV+  S+SS D
Sbjct  1786  DPISEVLSFILIQLKDIERYDPAFILRFSLHSLSVGYIEPLEFASLGLLAVAFVSMSSAD  1845

Query  3204  DDTRKLGYGVLEKFKNALE---------------------------------------KC  3266
                RKL Y  L+ F + LE                                         
Sbjct  1846  LGMRKLAYDTLKMFLDVLEVIVILCLTYMYALPVLTAYQSFSLLSSVNWFYKGTLLRFSG  1905

Query  3267  QKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQS  3446
              + K V  ++LLL  L+N +EE WQ+IP+V+A+F AEAS +LL+ SH+HY  I K L  S
Sbjct  1906  TRNKQVKWIKLLLLCLKNGVEEPWQRIPTVSAVFAAEASLILLNSSHEHYVPIKKLLKSS  1965

Query  3447  PSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYV  3626
             PS+NL+ IPLF   LWS + +F+++RLW LR++  GL +DDD  +YI+NSI E L+SF+ 
Sbjct  1966  PSLNLRGIPLFHEFLWSSTFNFKSQRLWELRLVCVGLKSDDDAKLYIKNSILEDLMSFFS  2025

Query  3627  SPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCG--IKYDHWKGFP  3800
             +PLAD+E+K LI+Q ++KS K  + ARHL++NCGL SW SS+++ F    I+ + ++   
Sbjct  2026  TPLADDETKGLILQVLRKSVKFHKTARHLVQNCGLFSWCSSLISMFTTKPIRDEDFR---  2082

Query  3801  FAQFAVVLEVVNEIIFFRHTVEWLQKYALEQ-LSELSCHLCQILVEGAQMLKEHSTFTKL  3977
                  VVLEV+ +++  R   EWLQ+  ++    E S  LC++L +G   ++E+ST   L
Sbjct  2083  ---LVVVLEVITDVLASRSVTEWLQEEEIKGPYEEFSSRLCRLLGDGLVSVQENSTLVDL  2139

Query  3978  ILQILTLTWKVSQK-RKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMST  4154
             ILQIL+ T K+SQ  RK+YQPHFT++++G+  L EA+  C +      A+ GL+ ILMST
Sbjct  2140  ILQILSATLKISQNLRKMYQPHFTITIDGILQLFEAVANCDSPEVEASAERGLDTILMST  2199

Query  4155  PPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLR  4334
             PP  ++ MD  K+ +F+ W  S AL+S+ K   +  +        +EE  E ++++K LR
Sbjct  2200  PPFELICMDADKLRRFLLWGTSTALKSDLKKGSKPSESHQDTKTLTEEPQEETMVAKFLR  2259

Query  4335  WLTASVILGKISYKLSKLDSSHSCDRSKLI--NLHCLLEWNEESDRENGKEFACQEILAA  4508
             WL ASVILGK+    SK + S     SK    +L  LLE+ +  + E G E   + I+  
Sbjct  2260  WLLASVILGKL---YSKANDSEPAVLSKTTPESLLTLLEYFKTMNLE-GSETKSEHIIGE  2315

Query  4509  SIFYLQQLLGTSFKLLPSAVSALCLLLLKNP---ASSGSEVLIGNAAALCSKIRCPAEAN  4679
              I YLQQL  T++ +LPS V AL  LLL+N    A S S+       +LCS+I  P EA 
Sbjct  2316  VIVYLQQLSSTNYSVLPSVVCALSSLLLRNGLEIAGSESDGDYKLIKSLCSRISSPPEAT  2375

Query  4680  SAWRWSFYQPWKDHSSN-LTDSEKIEEIHACQMLLLVASKML-ARNSLYSKLISLKDVEK  4853
               WRWS++Q  KD SS    D +KI+E HACQ LLL+ S ML  +     K++  K  + 
Sbjct  2376  PDWRWSYHQAQKDLSSEPARDLQKIDERHACQHLLLIFSDMLRVKPGESQKVLLHKSFDM  2435

Query  4854  LGVFEWERSILN  4889
               +F+WER ++ 
Sbjct  2436  SSLFDWERGLVE  2447



>ref|NP_565039.4| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE35296.1| uncharacterized protein AT1G72270 [Arabidopsis thaliana]
Length=2845

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/1666 (36%), Positives = 921/1666 (55%), Gaps = 119/1666 (7%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS-GLQEG  182
             +L+NF  +++VS  + G  FS L+SI FLE + L ++SK  P++F  GLE  +S  L+EG
Sbjct  1200  ILKNFASVMAVSWDLYGTSFSFLLSIIFLEKNFLGNLSKLSPDLFMRGLELTVSRNLREG  1259

Query  183   RTE---EFGD-----------IDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQ  320
               +   +F D           +D  +  S A S+FL++    +L    +S+  S L    
Sbjct  1260  TVDSEIDFADHSSTTEKIKSKMDIPDIESLAFSVFLEQTPFPVLLNEIMSMDISCLPEFP  1319

Query  321   GLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLR  500
              L  LLL  +S+   D I S    +LFW  Q    Y+V+P   L   SE+C  ++  +  
Sbjct  1320  RLTELLLLKVSQPKSDSIESDIRLILFWLFQIRSLYKVQPHPVLCQQSEICLRLMRHLFS  1379

Query  501   QFLNTKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNA----DFTDTFSG  668
             Q   +K D  S  +      K   ++ +T+  HPVV A LE P  C+        + FS 
Sbjct  1380  QI--SKLDLVSGPSAD----KLKHQVPQTVLSHPVVMALLESPADCDTLPRVQNVEVFS-  1432

Query  669   DSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQ  848
                +  L + +   I ++D H+++LL +T E   F +          A +   AFK +V+
Sbjct  1433  ---ETLLTAGRLG-ISEIDQHILDLLASTCENFLFEESHIERKGDLRADKSIMAFKVLVE  1488

Query  849   KLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQ  1028
             +L L F+D+ + C+ S+   PLL     I  L +FI PF+LL L H M S+      +++
Sbjct  1489  RLLLVFRDKFELCVGSQSYAPLLQHPQLIQALLKFISPFKLLYLAHSMLSK------TYE  1542

Query  1029  QSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVY  1208
             + L   +L  GL IAG  F+ L     QP ++R + D  W + ++ +D  ++E++     
Sbjct  1543  EELASPILSFGLDIAGGAFEMLILYSRQPAAKRRVYDFLWELEDKNYDSRIIEQVYSLAC  1602

Query  1209  EIATHLHLDVADMCLLKAFK-VVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQIN  1385
               +T   L  AD CLLK    + +       S   L + +S+ +     +L+ +C+ Q +
Sbjct  1603  RFSTSFGLASADTCLLKVVSGIFRGGNSQHCSVHQLTVIMSQIVGRTSKDLIIHCINQAS  1662

Query  1386  KRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFL  1565
               +A++LF   E SPLHLS+FGH+   M+ K   LQ ++   T    D + +MLLP V L
Sbjct  1663  MSRAKILFYLVESSPLHLSVFGHIFFSMLSK---LQGDSALIT----DDQFVMLLPPVLL  1715

Query  1566  YLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMD  1745
             +L SV  K          I S Y  IL+  F  W  + +  +F+ E ++ + LS  E ++
Sbjct  1716  FLASVFAKLEKSCSKCLDITSLYSNILIKGFLQWPKFCSGCIFE-EKYEEILLSTSEDIE  1774

Query  1746  -IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCS  1922
              +F+ +LL ++V M Q   ALT    K +  +++F S+ P  S   + LD++  +V   S
Sbjct  1775  TMFNASLLGKAVRMFQYHFALTESPTKTDDLLKVFYSMFPHTSAGKEMLDYEIKEVDVKS  1834

Query  1923  LEQSLNFVNRTVAKINLCRTLLFPE-----HNKFSSG--LKEDKMETCAELHSTLDVSRI  2081
             ++Q  N  NR VAK+ L R  LFPE     H K  +G  +KE   E  +   S L+    
Sbjct  1835  VDQMFNITNRLVAKVELSRICLFPEDSCMHHLKRQAGGCVKESSPEMGSNRESLLN----  1890

Query  2082  RLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVF--RFLEVLILRNIVELSKEMHGCLV  2255
              LL   V++W+ +VE+       + + E ++   F  + LE  ILR+I++  + M   L 
Sbjct  1891  PLLNAFVNTWQCVVERSDGYYKGNSEREEQDKYWFLCKSLEYFILRSILKFLEGMCEELA  1950

Query  2256  KLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAI  2435
              LDSLPF+ +L      +RF D  TL+ LR+I S LS GK+S     Q +V+HSQF  +I
Sbjct  1951  HLDSLPFLERLMNLILRYRFKDSKTLKILREIFSFLSRGKYSYH--FQDLVSHSQFTESI  2008

Query  2436  CSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDN--LQMSKQHLKQLELIKLL  2609
              S ++S+  S  G    P+ S+++  +IP  N NS+ R +N  L+  + +L Q+E++K+L
Sbjct  2009  SSLSISS--SHTGEVIRPVSSILKLLIIP--NLNSV-RVENCSLEAPEYYLSQIEILKIL  2063

Query  2610  RVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNI  2789
              VL          +  ++ GI L+DL F LL SY AT  +ID + + L+++IK I   + 
Sbjct  2064  GVLL--------CKCGKDSGIFLKDLHFRLLCSYGATPSEIDLQSYKLMHDIKLIVGEHT  2115

Query  2790  SIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVL  2969
                  DYLWGNA +K R      + +  + S +++ ED R+  F+ENL +DPK CA TVL
Sbjct  2116  LNDSEDYLWGNAALKIR------EGLPSDGSYSDIVEDLRQSLFKENLCLDPKRCAQTVL  2169

Query  2970  YFPYGRPNGPGVVNKVQKDTF---DSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIE  3140
             YFPYGR        +   +T+   D + E CS  +     YDP+FILR+S   LSM YIE
Sbjct  2170  YFPYGR------TAEASDNTYIYDDPISEKCSPAIER---YDPVFILRVSVQLLSMVYIE  2220

Query  3141  PVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQN  3320
             PVEFA+LGLLAV+ AS+SS D   RKLGY  L  F + LE C+K   V  L+LLL+Y+QN
Sbjct  2221  PVEFASLGLLAVAFASMSSADLGIRKLGYETLGIFVDVLESCRKNMHVTVLRLLLTYVQN  2280

Query  3321  CIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSD  3500
              +EE WQ+IP+V+A+F AEAS +LLD SH+HY  I K L +S ++ L+ IPLF +   S 
Sbjct  2281  GVEEQWQRIPTVSAVFSAEASLILLDSSHEHYVPIIKLLKRSSTLKLRGIPLFHDFFGSS  2340

Query  3501  SVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKK  3680
             +V+FR++RLW+LR+++ GL +++D  IYIRNSI ET++ F+ SPLAD+E+K LI+Q V+K
Sbjct  2341  TVNFRSQRLWVLRLVFVGLESEEDAQIYIRNSILETVMGFFSSPLADDETKGLILQVVRK  2400

Query  3681  SAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHT  3860
             S KL +MARHL+ENCGL+SW S    SF  +      G   ++F VVLEV+ + +  R+ 
Sbjct  2401  SVKLHKMARHLVENCGLLSWCS----SFFSMLTTKPTGDEDSRFVVVLEVITDALASRND  2456

Query  3861  VEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPH  4040
              EW Q+ ALE L E+S  L  +L +G   ++E+ T       IL+ T K+S KRK  QPH
Sbjct  2457  TEWSQRSALEGLMEISSRLYTLLGDGLVSMQENGT------SILSATLKISHKRKKNQPH  2510

Query  4041  FTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMS  4220
             FT+++EG+F L EA   C +      A+  L+ ILMSTPPV I+ MD  ++ +F+ W  S
Sbjct  2511  FTITIEGIFQLFEAAANCDSPQVEASAEGRLDTILMSTPPVEIICMDVHRLRRFLLWGSS  2570

Query  4221  IALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSH  4400
              AL+S+ K   +  +C    +  ++  TE ++++K LRWL ASVILGK+ Y  +      
Sbjct  2571  TALKSDLKKGSKPGEC----HQDTKTHTEETMVAKFLRWLLASVILGKL-YSEANDSDQI  2625

Query  4401  SCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQ-LLGTSFK-LLPSAVSA  4574
                 +K   L  LLE+ ++ + + G     + I+   I YLQ+ LL  ++  LLPS V A
Sbjct  2626  VLSETKPETLPTLLEYLKKRNLQ-GSVTNSEHIIGEVIVYLQKHLLCRNYGVLLPSVVFA  2684

Query  4575  LCLLLLKNP-ASSGSEVLIGNAA--ALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSE  4745
             L L++L+N   ++G+E   G     +LCS+I  P EA   WRWS++Q     S   TD +
Sbjct  2685  LSLMVLRNGLETTGTESEGGYKVIRSLCSRISSPTEAIPVWRWSYHQDLP--SERATDPK  2742

Query  4746  KIEEIHACQMLLLVASKMLARNSLYSK--LISLKDVEKLGVFEWER  4877
             +I+E++ACQ LLL+ S ML      S+  L+  +  +   VFEWER
Sbjct  2743  EIDELYACQELLLIFSDMLRETPRESQQTLLLGESFDMSSVFEWER  2788



>ref|XP_009142988.1| PREDICTED: uncharacterized protein LOC103866760 isoform X1 [Brassica 
rapa]
Length=2551

 Score =   855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/1688 (35%), Positives = 902/1688 (53%), Gaps = 126/1688 (7%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLE-SAISGLQEG  182
             +L+NF  ++++S  + G  FS+L ++ FLE + L D+SK  P++   G E +    L+EG
Sbjct  929   ILENFDSVMAISWTLYGTSFSILQAMAFLEENFLGDLSKLSPDLLVRGSELTGSRSLREG  988

Query  183   R-------------TEEF-GDIDSMEFASAALSLFLKEASLCMLFPITLSIYKS-DLSTQ  317
                           TEE    +D  +  S A   FL++    + FP  L+  KS D+S  
Sbjct  989   TVYSETCFDDHSSITEEIKSKMDVCDTESPAFPTFLEQ----LPFPELLTAIKSMDISWL  1044

Query  318   QGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRML  497
               +  LLL  +S    D   S  L +LF       SY+V+P      LSE+C     R++
Sbjct  1045  PRVSELLLLKVSHPKSDSFESVKL-ILFHLYHIRSSYKVQPAPVHCQLSEICL----RLM  1099

Query  498   RQFLNTKGDASSKCTRSLLPT-KCVQELIETIFYHPVVAASLECPLPCNA----DFTDTF  662
             +   +   +      + L P+ K   ++ +T+  HPVV A LE PL C         + F
Sbjct  1100  KHLFSQISELEPSSDKVLAPSAKWKHQVAQTVLCHPVVMALLESPLDCGTLPLVQNVEIF  1159

Query  663   SGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNV  842
                S+     +    V+ ++D H+++LL TT E   F +            +   AFK +
Sbjct  1160  PETSL-----ATGRIVLSEIDQHILDLLATTCEHFLFDETHIVQKGELRDHKSIVAFKTL  1214

Query  843   VQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNS  1022
             V+ L L F+ + + C+ ++   PLL     IH L RFI PF+LL L   M   +D+E+  
Sbjct  1215  VETLLLEFRGKLELCVGTQSYAPLLQPSQVIHALLRFISPFKLLNLARSML--VDVEE--  1270

Query  1023  FQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQ  1202
                     ++ +GL IAG  F+ L+    Q  ++R + DL W + E+ +D  LLE++   
Sbjct  1271  LASPNLSKIVSLGLDIAGGAFEMLTLYSQQTAAKRKIYDLLWDLEEKNYDSNLLEEVYSL  1330

Query  1203  VYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLV-MAISRFIVNIPVNLLSYCMFQ  1379
                 +T   L  AD CLLK    +   K  Q S+  L+ + IS+ +   P +L+ +C+ Q
Sbjct  1331  ACRFSTSFGLVSADTCLLKVGGAIFRGKHNQHSSAHLLTVIISQIVGRTPEDLIIHCINQ  1390

Query  1380  INKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTV  1559
              +  +A++LF   E SPLH S+FGH    M+ KQ        +  S  +D + +MLLP V
Sbjct  1391  ASMTRAKILFYFVESSPLHRSVFGHFFYSMLSKQ--------QGDSALTDDQFIMLLPAV  1442

Query  1560  FLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEF  1739
               YL  +  K          I S Y  IL++ F  W  + +  +F+ E ++ + LS  E 
Sbjct  1443  LSYLSPIFAKPEKPWSRCLDITSVYSNILINGFLQWPKFSSGCIFE-EKYEEILLSTTED  1501

Query  1740  MD-IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGT  1916
             +D +F  +LL ++V M     A T    K E  +++F S+ P  S   + LD    +V  
Sbjct  1502  IDTMFKASLLGKAVRMF----AWTESPTKREDLLKVFQSMFPHTSAGKEMLDCRIKEVDV  1557

Query  1917  CSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKM  2096
              S++   N   R VAK+ L R  LFP  +           ++ +E+ S  +     LL  
Sbjct  1558  QSVDCMFNVAIREVAKVELSRICLFPASSNHKRQAGSCVKKSSSEMGSNNESLFTPLLSY  1617

Query  2097  LVSSWRKIVEKFPMTADNSCQMEVENCSVF-RFLEVLILRNIVELSKEMHGCLVKLDSLP  2273
             LV  W+ +V++F  +   + + + + C +  + LE  ILRNI++  ++M   LV LDSLP
Sbjct  1618  LVDRWQCVVKRFDGSFKGNAERKQDKCGLLCKSLENFILRNILKFLEDMCEELVHLDSLP  1677

Query  2274  FIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLS  2453
             F+  L K+   +RFDD  TL+ LR+I S LS GK+S    IQL+++HSQF   I  S+LS
Sbjct  1678  FLEGLMKSVLLYRFDDSRTLKILREIFSLLSRGKYSYAPYIQLLISHSQFTPTI--SSLS  1735

Query  2454  TGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKA  2633
             +  S  G  F P+ S+++  +IP  + +S+        +  ++KQLE++K+LRVL     
Sbjct  1736  S--SHTGELFRPISSILKHLIIP--SPDSVRVGSCSLQAPDYMKQLEIVKILRVLLS---  1788

Query  2634  RQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN-ISIAEWDY  2810
                  +  ++ GI L++L+FLLL SY ATL +ID E++ L+ +I+ + + + + ++E  Y
Sbjct  1789  -----KCGKDSGIILKELLFLLLCSYGATLSEIDIELYRLIRDIELVDEEHTLDVSETGY  1843

Query  2811  LWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRP  2990
             LWG A +K R+   L Q  S    D ++ ED R   F+ENL +DPK+CA TVLYFP    
Sbjct  1844  LWGKAALKMREGLRLSQDASDGGED-DLVEDLRLRLFKENLCVDPKICALTVLYFPD---  1899

Query  2991  NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLL  3170
                      Q+   D + E+ S  V +   YDP FILR S H LS+GYIEP+EFA+LGLL
Sbjct  1900  ---------QRSADDPVSEEFSPIVEDIERYDPAFILRFSIHSLSVGYIEPLEFASLGLL  1950

Query  3171  AVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIP  3350
             AV+ AS+SS D   RKL Y  L  F + LE C + K V  ++LLL  L+N +EE WQ+IP
Sbjct  1951  AVAFASMSSADLGMRKLAYDTLMMFLDVLESCTRNKQVKWIRLLLLCLKNGVEEPWQRIP  2010

Query  3351  SVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLW  3530
             +V+A+F AEAS +LL+ SH+HY  I K L  SPS+NL+ IPLF   LWS + +F+++RLW
Sbjct  2011  TVSAVFAAEASLILLNSSHEHYVPIKKLLKSSPSLNLRGIPLFHEFLWSSAFNFKSQRLW  2070

Query  3531  ILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARH  3710
              LR++  GL +DDD  +Y RNSI E ++SF+ +PLAD+E+K LI+Q V+KS K    ARH
Sbjct  2071  ELRLVCVGLKSDDDAKLYTRNSILEDMMSFFSTPLADDETKGLILQVVRKSVKF--QARH  2128

Query  3711  LIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQK----  3878
             L++NCGL SW SS+++ F         G       +VL V+ +++  R   +WLQ     
Sbjct  2129  LVQNCGLFSWCSSLISMFTTKPI----GDEDFHLVIVLNVITDVLASRSVTQWLQGEEMR  2184

Query  3879  -------------------------YALEQLSELSCHLCQILVEGAQMLKEHSTFTKLIL  3983
                                      + LE L E+S  LC++LV G   ++E +T   LIL
Sbjct  2185  GGPYGECGQKSTTESDHNNNRIDHPFPLEGLVEISSRLCRLLVGGLVSIQESTTLVDLIL  2244

Query  3984  QILTLTWKVSQK-RKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPP  4160
             QIL+ T K+SQK RK+YQPHFT+++ G+  L EA+  C +      A+ GLE ILMSTPP
Sbjct  2245  QILSATLKISQKVRKIYQPHFTITIGGILQLFEAVANCDSPQVEASAERGLETILMSTPP  2304

Query  4161  VAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWL  4340
               ++ MD  K+  F+ W  S AL+S+ +      +        ++E  E S+++K LRWL
Sbjct  2305  FELICMDIDKLRMFLLWGTSTALKSDLRKGSNPSESRQDTKTLTKEPQEESMVAKFLRWL  2364

Query  4341  TASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFY  4520
              ASVILGK+  K +  D S    ++K   L  LL++ +  + E G E   + I+  +I +
Sbjct  2365  CASVILGKLYSKANDSDPS-VLSKTKPETLLTLLDYLKTRNLE-GSETKSEHIIGEAIVH  2422

Query  4521  LQQLLGTSFKLLPSAVSALCLLLLKNP---ASSGSEVLIGNAAALCSKIRCPAEANSAWR  4691
             LQQLL T++ +LPS V AL  +LL+N    A S S        +LC  I  P EA+  WR
Sbjct  2423  LQQLLSTNYSVLPSVVCALSSMLLRNGLEIAGSESGCDYKLIKSLCCGITSPPEASPGWR  2482

Query  4692  WSFYQPWKDHSSN-LTDSEKIEEIHACQMLLLVASKML-ARNSLYSKLISLKDVEKLGVF  4865
             WS++Q WKD SS    D + I+E H CQ LLL+ S ML  +     K++  K  +   VF
Sbjct  2483  WSYHQAWKDLSSEPAKDLQMIDERHGCQHLLLIFSDMLRVKPGESQKVLLHKSFDMSSVF  2542

Query  4866  EWERSILN  4889
             +WER ++ 
Sbjct  2543  DWERGLVE  2550



>ref|XP_002893970.1| hypothetical protein ARALYDRAFT_336756 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70229.1| hypothetical protein ARALYDRAFT_336756 [Arabidopsis lyrata subsp. 
lyrata]
Length=2496

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/1670 (36%), Positives = 891/1670 (53%), Gaps = 167/1670 (10%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS-GLQEG  182
             +L+NF  ++++S  + G  FS L SI FLE + L ++SK  P++F  GLE   S  L+EG
Sbjct  935   ILENFASVMAISWDLYGTSFSFLQSIVFLEENFLGNLSKLSPDLFVRGLELTRSRNLREG  994

Query  183   RTE---EFGDIDSMEFA-----------SAALSLFLKEASLCMLFPITLS-IYKSDLSTQ  317
               +   +F D  S+  A           S+ALS+F ++A     FP+ L+ I   D+S  
Sbjct  995   IVDSEIDFADYSSVTEAIKSKMEIRDIYSSALSMFFEQAP----FPVLLNEIMSMDISCV  1050

Query  318   QGLHNL--LLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDR  491
                  L  LL  + +   D I S    +LFW  Q   SY+++P   L  LSE+C  ++  
Sbjct  1051  PEFPRLAELLLQVWQPKSDSIESDIRLILFWLFQIRSSYKIQPASVLCRLSEICLRLLKH  1110

Query  492   MLRQFLNTKGDASSKCTRSLLP--TKCVQELIETIFYHPVVAASLECPLPCNA----DFT  653
             +  Q ++ +G  S   +  L+    K   ++ +T+  HPVV A LE PL C         
Sbjct  1111  LFSQ-ISERGFVSGPSSDKLVAPFAKWKHQVAQTVLCHPVVMALLESPLDCGTLPPVHNV  1169

Query  654   DTFSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAF  833
               FS  S+     +    VI ++D H+++LL +  E   F +            + +  F
Sbjct  1170  KIFSETSL-----TTSRLVICEIDQHILDLLVSICEHFLFDERHIVQEGDLRENKSSTVF  1224

Query  834   KNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLE  1013
             K++VQ+L L F+D+ + C+ S+   PLL     IH L RFI PF++LEL   M S+ID E
Sbjct  1225  KDLVQRLLLLFRDKFELCVGSQSYAPLLQPSQLIHALLRFISPFKILELARSMLSKIDEE  1284

Query  1014  DNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKI  1193
             + +   S    ++ +GL IAG  F+ L +    P ++R L DL W + EE +D +L+E++
Sbjct  1285  ELASPNS--SMIISLGLDIAGGAFEMLISYSHLPAAKRGLYDLLWELKEENYDSILIEEV  1342

Query  1194  LLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSYC  1370
                    +T   L  AD CLLK    +   K  +  N   L + IS+ +   P +L+ + 
Sbjct  1343  YSMACRFSTSFGLVSADTCLLKVGSSIFRGKHNRHCNVHPLTVIISQIVGRTPKDLIIHY  1402

Query  1371  MFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLL  1550
             + Q +  +A++LF   E SPLHLS+FGH    M+ KQ            + SD + +ML 
Sbjct  1403  INQPSMTRAKILFYLVESSPLHLSVFGHSFFSMLSKQ-----------QDGSD-QFIMLP  1450

Query  1551  PTVFLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSI  1730
             P V  YL SV  K  +       I S Y   L + F  W  +++  +F+ E ++ + +S 
Sbjct  1451  PAVLSYLASVYAKIETPCSRCLDITSLYSNKLTNGFHQWPSFLSGWIFE-EKYEEILMST  1509

Query  1731  EEFMD-IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQ  1907
              E +D +F+ +LL  +V M Q   AL     K +  +++F S+ P  S   +  D++  +
Sbjct  1510  TEDIDTMFNASLLGMAVRMFQCHFALNESPTKIDDLLKVFYSMFPHASAGKEMFDYEIKE  1569

Query  1908  VGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRL  2087
             +   S+    N   R VAK+   R  LFPE +      K   +    E    +   R  L
Sbjct  1570  MDAQSVHYMFNVAIRVVAKVEFSRICLFPEDSSICH-FKSQAVSCARESFPEMGSCRESL  1628

Query  2088  LKMLVSSWRKIVEKFPMTADNSCQMEVENCSVF-RFLEVLILRNIVELSKEMHGCLVKLD  2264
             L  LV SW  +V++       + + + + C    + LE  ILR+I ++ K M   L+ LD
Sbjct  1629  LNALVESWPCVVKRSDGYFKGNSERKQDKCWFLCKSLENFILRSIRKILKYMCEELINLD  1688

Query  2265  SLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSS  2444
             SLPF+ KL K+   +RF+D  TL+ LRDI S LS GK+SC   IQL+V+HSQF   I S+
Sbjct  1689  SLPFLEKLMKSVLLYRFEDSKTLKILRDIFSLLSRGKYSCTLYIQLLVSHSQFTPTILSA  1748

Query  2445  NLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQ  2624
                   S  G    P+ S+++   IP  + NS+        +  ++KQLE++K+LRVL  
Sbjct  1749  ------SHTGELLRPVSSILKHLSIP--SPNSVGVGSCCLEAPDYVKQLEIVKILRVLLS  1800

Query  2625  VKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN-ISIAE  2801
                     +  +  GINL++L FL L SY AT+ +ID E++ L+++I+ I D   ++++E
Sbjct  1801  --------KCGKGSGINLKELRFLFLCSYGATMSEIDLELYKLMHDIELIEDEQRLNVSE  1852

Query  2802  WDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPY  2981
              DYLWG A +K R+     Q       +A + E+ ++I F+ENL IDPK+CA T+LYFPY
Sbjct  1853  TDYLWGKAALKIREGLRFSQDAYYG-GEAGLVENLQQILFKENLWIDPKICAQTLLYFPY  1911

Query  2982  GRPNGPGVVNKVQKDTF---DSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEF  3152
              R        +V  +++   D + E CS  +     YDP +IL  S H LSMG IEPV+F
Sbjct  1912  QR------TAEVSDNSYISDDPVSEKCSPVIER---YDPAYILPFSIHSLSMGCIEPVKF  1962

Query  3153  ANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEE  3332
             A+ GLLAV+LAS SS D   RKLGY  L  F +AL++C+K ++VM L LLL +++N +++
Sbjct  1963  ASSGLLAVALASTSSADLGMRKLGYETLGIFVHALKRCEKNENVMGLMLLLMHVENGVDK  2022

Query  3333  DWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSF  3512
              W++IP+V A F A  S +LLD SH+ YA I K L  S ++NLK IPLF +  WS +V  
Sbjct  2023  RWKRIPTVCAYFAAVTSLILLDSSHELYAPINKLLKSSSTLNLKGIPLFYDFFWSSTVVL  2082

Query  3513  RTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKL  3692
             R++RLW LR++  GL ++DD  +YIRNS+ +TL+SF  SPLAD+E+K LI+Q V+KS K 
Sbjct  2083  RSQRLWELRLVCVGLESEDDAQLYIRNSVLDTLMSFSSSPLADDETKGLILQVVRKSVKF  2142

Query  3693  SRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWL  3872
              ++ARHL+ENCGL+ W SS ++ F         G   ++   VLEV+ + +  R+  EWL
Sbjct  2143  HKIARHLVENCGLLLWCSSFISMFATKPI----GDEDSRLVAVLEVITDTLASRNVTEWL  2198

Query  3873  QKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLS  4052
             Q+ ALE+L E+S  L + L  G   +KE+ T   LILQIL+ T K+SQKRK+YQPHFT++
Sbjct  2199  QRSALEELMEISSRLYRFLGGGLVSMKENGTLVDLILQILSATLKISQKRKLYQPHFTIT  2258

Query  4053  VEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQ  4232
             +EG+F L EA+  C +       + GL+ ILMSTPP+ I+ MD  K+ +F+ W  S AL+
Sbjct  2259  IEGIFQLFEAVANCDSPQVEASVERGLDVILMSTPPIDIICMDVDKLRRFLFWGSSTALK  2318

Query  4233  SETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDR  4412
             S+ K      K   P+   ++ ET       LL +L    I G ++              
Sbjct  2319  SDFK------KGSKPILSETKPET-------LLEYLKQRNIEGSMT--------------  2351

Query  4413  SKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGT-SFKLLPSAVSALCLLL  4589
                                       + IL   I YLQ+LL T +  LLPS V AL L+L
Sbjct  2352  ------------------------KSEHILGEVIVYLQKLLCTNNMVLLPSVVFALSLML  2387

Query  4590  LKNP--ASSG----------SEVLI---------GNAA---ALCSKIRCPAEANSAWRWS  4697
             L+N    ++G          SE+++         G+     +LCS+I CP EA   WRWS
Sbjct  2388  LRNGLFLTAGVKAARFCQPKSEIVLSFCIDTESEGDYKLIRSLCSRISCPPEAIPVWRWS  2447

Query  4698  FYQPWKDHSSN-LTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKD  4844
             +YQ WKD S+   TD +KI+   ACQ LLL+ S ML      S+ + L+D
Sbjct  2448  YYQGWKDLSTGPATDPKKID---ACQQLLLIFSDMLGTMPQESQQVLLRD  2494



>ref|XP_009142994.1| PREDICTED: uncharacterized protein LOC103866760 isoform X2 [Brassica 
rapa]
Length=2546

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/1688 (35%), Positives = 901/1688 (53%), Gaps = 131/1688 (8%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLE-SAISGLQEG  182
             +L+NF  ++++S  + G  FS+L ++ FLE + L D+SK  P++   G E +    L+EG
Sbjct  929   ILENFDSVMAISWTLYGTSFSILQAMAFLEENFLGDLSKLSPDLLVRGSELTGSRSLREG  988

Query  183   R-------------TEEF-GDIDSMEFASAALSLFLKEASLCMLFPITLSIYKS-DLSTQ  317
                           TEE    +D  +  S A   FL++    + FP  L+  KS D+S  
Sbjct  989   TVYSETCFDDHSSITEEIKSKMDVCDTESPAFPTFLEQ----LPFPELLTAIKSMDISWL  1044

Query  318   QGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRML  497
               +  LLL  +S    D   S  L +LF       SY+V+P      LSE+C     R++
Sbjct  1045  PRVSELLLLKVSHPKSDSFESVKL-ILFHLYHIRSSYKVQPAPVHCQLSEICL----RLM  1099

Query  498   RQFLNTKGDASSKCTRSLLPT-KCVQELIETIFYHPVVAASLECPLPCNA----DFTDTF  662
             +   +   +      + L P+ K   ++ +T+  HPVV A LE PL C         + F
Sbjct  1100  KHLFSQISELEPSSDKVLAPSAKWKHQVAQTVLCHPVVMALLESPLDCGTLPLVQNVEIF  1159

Query  663   SGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNV  842
                S+     +    V+ ++D H+++LL TT E   F +            +   AFK +
Sbjct  1160  PETSL-----ATGRIVLSEIDQHILDLLATTCEHFLFDETHIVQKGELRDHKSIVAFKTL  1214

Query  843   VQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNS  1022
             V+ L L F+ + + C+ ++   PLL     IH L RFI PF+LL L   M   +D+E+  
Sbjct  1215  VETLLLEFRGKLELCVGTQSYAPLLQPSQVIHALLRFISPFKLLNLARSML--VDVEE--  1270

Query  1023  FQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQ  1202
                     ++ +GL IAG  F+ L+    Q  ++R + DL W + E+ +D  LLE++   
Sbjct  1271  LASPNLSKIVSLGLDIAGGAFEMLTLYSQQTAAKRKIYDLLWDLEEKNYDSNLLEEVYSL  1330

Query  1203  VYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLV-MAISRFIVNIPVNLLSYCMFQ  1379
                 +T   L  AD CLLK    +   K  Q S+  L+ + IS+ +   P +L+ +C+ Q
Sbjct  1331  ACRFSTSFGLVSADTCLLKVGGAIFRGKHNQHSSAHLLTVIISQIVGRTPEDLIIHCINQ  1390

Query  1380  INKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTV  1559
              +  +A++LF   E SPLH S+FGH    M+ KQ        +  S  +D + +MLLP V
Sbjct  1391  ASMTRAKILFYFVESSPLHRSVFGHFFYSMLSKQ--------QGDSALTDDQFIMLLPAV  1442

Query  1560  FLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEF  1739
               YL  +  K          I S Y  IL++ F  W  + +  +F+ E ++ + LS  E 
Sbjct  1443  LSYLSPIFAKPEKPWSRCLDITSVYSNILINGFLQWPKFSSGCIFE-EKYEEILLSTTED  1501

Query  1740  MD-IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGT  1916
             +D +F  +LL ++V M     A T    K E  +++F S+ P  S   + LD    +V  
Sbjct  1502  IDTMFKASLLGKAVRMF----AWTESPTKREDLLKVFQSMFPHTSAGKEMLDCRIKEVDV  1557

Query  1917  CSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKM  2096
              S++   N   R VAK+ L R  LFP  +           ++ +E+ S  +     LL  
Sbjct  1558  QSVDCMFNVAIREVAKVELSRICLFPASSNHKRQAGSCVKKSSSEMGSNNESLFTPLLSY  1617

Query  2097  LVSSWRKIVEKFPMTADNSCQMEVENCSVF-RFLEVLILRNIVELSKEMHGCLVKLDSLP  2273
             LV  W+ +V++F  +   + + + + C +  + LE  ILRNI++  ++M   LV LDSLP
Sbjct  1618  LVDRWQCVVKRFDGSFKGNAERKQDKCGLLCKSLENFILRNILKFLEDMCEELVHLDSLP  1677

Query  2274  FIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLS  2453
             F+  L K+   +RFDD  TL+ LR+I S LS GK+S    IQL+++HSQF   I  S+LS
Sbjct  1678  FLEGLMKSVLLYRFDDSRTLKILREIFSLLSRGKYSYAPYIQLLISHSQFTPTI--SSLS  1735

Query  2454  TGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKA  2633
             +  S  G  F P+ S+++  +IP  + +S+        +  ++KQLE++K+LRVL     
Sbjct  1736  S--SHTGELFRPISSILKHLIIP--SPDSVRVGSCSLQAPDYMKQLEIVKILRVLLS---  1788

Query  2634  RQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN-ISIAEWDY  2810
                  +  ++ GI L++L+FLLL SY ATL +ID E++ L+ +I+ + + + + ++E  Y
Sbjct  1789  -----KCGKDSGIILKELLFLLLCSYGATLSEIDIELYRLIRDIELVDEEHTLDVSETGY  1843

Query  2811  LWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRP  2990
             LWG A +K R+   L Q  S    D ++ ED R   F+ENL +DPK+CA TVLYFP    
Sbjct  1844  LWGKAALKMREGLRLSQDASDGGED-DLVEDLRLRLFKENLCVDPKICALTVLYFPD---  1899

Query  2991  NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLL  3170
                      Q+   D + E+ S  V +   YDP FILR S H LS+GYIEP+EFA+LGLL
Sbjct  1900  ---------QRSADDPVSEEFSPIVEDIERYDPAFILRFSIHSLSVGYIEPLEFASLGLL  1950

Query  3171  AVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIP  3350
             AV+ AS+SS D   RKL Y  L  F + LE C + K V  ++LLL  L+N +EE WQ+IP
Sbjct  1951  AVAFASMSSADLGMRKLAYDTLMMFLDVLESCTRNKQVKWIRLLLLCLKNGVEEPWQRIP  2010

Query  3351  SVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLW  3530
             +V+A+F AEAS +LL+ SH+HY  I K L  SPS+NL+ IPLF   LWS + +F+++RLW
Sbjct  2011  TVSAVFAAEASLILLNSSHEHYVPIKKLLKSSPSLNLRGIPLFHEFLWSSAFNFKSQRLW  2070

Query  3531  ILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARH  3710
              LR++  GL +DDD  +Y RNSI E ++SF+ +PLAD+E+K LI+Q V+KS K    ARH
Sbjct  2071  ELRLVCVGLKSDDDAKLYTRNSILEDMMSFFSTPLADDETKGLILQVVRKSVKF--QARH  2128

Query  3711  LIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQK----  3878
             L++NCGL SW SS+++ F        K      F +   V+ +++  R   +WLQ     
Sbjct  2129  LVQNCGLFSWCSSLISMFTT------KPIGDEDFHL---VITDVLASRSVTQWLQGEEMR  2179

Query  3879  -------------------------YALEQLSELSCHLCQILVEGAQMLKEHSTFTKLIL  3983
                                      + LE L E+S  LC++LV G   ++E +T   LIL
Sbjct  2180  GGPYGECGQKSTTESDHNNNRIDHPFPLEGLVEISSRLCRLLVGGLVSIQESTTLVDLIL  2239

Query  3984  QILTLTWKVSQK-RKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPP  4160
             QIL+ T K+SQK RK+YQPHFT+++ G+  L EA+  C +      A+ GLE ILMSTPP
Sbjct  2240  QILSATLKISQKVRKIYQPHFTITIGGILQLFEAVANCDSPQVEASAERGLETILMSTPP  2299

Query  4161  VAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWL  4340
               ++ MD  K+  F+ W  S AL+S+ +      +        ++E  E S+++K LRWL
Sbjct  2300  FELICMDIDKLRMFLLWGTSTALKSDLRKGSNPSESRQDTKTLTKEPQEESMVAKFLRWL  2359

Query  4341  TASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFY  4520
              ASVILGK+  K +  D S    ++K   L  LL++ +  + E G E   + I+  +I +
Sbjct  2360  CASVILGKLYSKANDSDPS-VLSKTKPETLLTLLDYLKTRNLE-GSETKSEHIIGEAIVH  2417

Query  4521  LQQLLGTSFKLLPSAVSALCLLLLKNP---ASSGSEVLIGNAAALCSKIRCPAEANSAWR  4691
             LQQLL T++ +LPS V AL  +LL+N    A S S        +LC  I  P EA+  WR
Sbjct  2418  LQQLLSTNYSVLPSVVCALSSMLLRNGLEIAGSESGCDYKLIKSLCCGITSPPEASPGWR  2477

Query  4692  WSFYQPWKDHSSN-LTDSEKIEEIHACQMLLLVASKML-ARNSLYSKLISLKDVEKLGVF  4865
             WS++Q WKD SS    D + I+E H CQ LLL+ S ML  +     K++  K  +   VF
Sbjct  2478  WSYHQAWKDLSSEPAKDLQMIDERHGCQHLLLIFSDMLRVKPGESQKVLLHKSFDMSSVF  2537

Query  4866  EWERSILN  4889
             +WER ++ 
Sbjct  2538  DWERGLVE  2545



>ref|XP_010675693.1| PREDICTED: uncharacterized protein LOC104891665 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=2230

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/1303 (39%), Positives = 770/1303 (59%), Gaps = 55/1303 (4%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             D++ N P +++VS K+ G+  S+ M  FFL+ +L+  VSK WP+MF++GL  ++    + 
Sbjct  957   DIVYNLPSVMAVSGKLAGLNCSV-MDYFFLDQNLMRCVSKLWPDMFYSGLRMSVRACSQV  1015

Query  183   RTEEFGDI---------DSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNL  335
               +   D          +  E  S      LKEA   +LFP  +        +   +  L
Sbjct  1016  TQDNDKDTSVKALHSNTEETEHTSIVFGSLLKEAPFYVLFPAIIFCVPE---SHSEIKEL  1072

Query  336   LLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNT  515
             L+A +S    + +VSS   VLFWF+Q   SYR +P E+ E+ SELCF +V  +L      
Sbjct  1073  LVAKVSNLDIEQLVSSVRLVLFWFHQIQTSYRKKPTEQQELHSELCFFLVKHILSLLPTL  1132

Query  516   K---GDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKF  686
             K   G +++    SL  ++C+QE+ +T+F HP VAASL  P   + + T+ F  DS +  
Sbjct  1133  KFVSGSSANNAAFSL--SQCLQEVAKTVFCHPAVAASLSSPFARDYEITEEFLRDSSEGL  1190

Query  687   LESNKWRVIHKMDLHVINLLRTTFE-LLYFCDGQ--TSSFEACHARQVTKAFKNVVQKLF  857
             L       + K +LHV+ LL  T + LL  C  +  +S +  C    + KAF N+VQ++F
Sbjct  1191  LHPCG-EGMRKTELHVLKLLTATSDYLLALCSEKLLSSVYTECK-EYIVKAFGNLVQQIF  1248

Query  858   LTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSL  1037
             L FK R +    S ++T L P +  + +L RFI P ELL L +WMFS ++L ++   +  
Sbjct  1249  LIFKSRFELWCTSGNMT-LFPILCGLVSLMRFISPIELLGLANWMFSVVELPNSKIPKIS  1307

Query  1038  RDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIA  1217
               S L +   IA      LS  M  P+    L+DLFW       D  L E I L+ ++ A
Sbjct  1308  NVSPLYMAFSIACGALSMLSQHMQSPNVTVVLTDLFWANEMRTLDATLFESIYLKAFKFA  1367

Query  1218  THLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKA  1397
             T   +D+AD CLLKA     +    Q   P   M I+R I+  PV ++S+C+ + +  KA
Sbjct  1368  TCFKIDLADTCLLKALTAANSLIHRQDCLP-FSMEITRVIIRTPVRIVSHCLNRTDNTKA  1426

Query  1398  ELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPS--DPELLMLLPTVFLYL  1571
             ++LF   E+S LH S+FG L SG++ +      N+  +  N    D E LMLLP   LY+
Sbjct  1427  KILFRMMEISALHSSVFGQLFSGILGEDTIPTINSPEQICNQLLLDEECLMLLPAAALYV  1486

Query  1572  D----SVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEF  1739
                  ++L K    +K+   +++ Y R+LL  F +W  +V+R +F +E  + LP S+E  
Sbjct  1487  SFSWTNLLEKPSRNIKF---MLTSYSRLLLDGFLNWNDFVSRTVFLVEYGNVLPCSVENL  1543

Query  1740  MDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTC  1919
              D+F+ +LL ++V M+Q   A +G   +   R++L  S+ P      DF+DFD  ++ + 
Sbjct  1544  NDLFNSSLLRKAVQMLQWYFASSGD--RKNKRLKLLCSLYPVSGASHDFMDFDVRKIDSY  1601

Query  1920  SLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKML  2099
             S+ Q  + +NR VAK++LC  LLFPE NK S+    D ++  +   S  + S +R L ML
Sbjct  1602  SVRQLTDLINRVVAKVSLCFVLLFPEGNKCSANEAPD-IQGESFGGSNSEDSSLRFLDML  1660

Query  2100  VSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFI  2279
             V  W+ +V+K P +A+N+  ++     + R LE+  LR I +L  +    L K+DSLPFI
Sbjct  1661  VGIWQLVVKKIP-SANNNSDLKTPIFLLLRSLEMFTLRCIYKLIMKTRSILTKMDSLPFI  1719

Query  2280  VKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTG  2459
               +AK +  HRF DP+TL  LR ++S LS      + ++QL+V HSQ  + + +      
Sbjct  1720  ENMAKVSLLHRFGDPITLNNLRHVLSCLSGANLPVILLLQLLVGHSQLASTVGTVTDPFA  1779

Query  2460  ISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQ  2639
                 G+   P+ S +RS V+P          +NL+ S+ +  +LE++KLLR+LF +KA +
Sbjct  1780  FGSSGMVVKPISSFLRSSVVP-------TESNNLETSETYKSKLEVVKLLRLLFHLKATR  1832

Query  2640  VDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISI-AEWDYLW  2816
              D+    ++G+NLRDL FLLL++Y AT+ +ID EI++L++EI+S   +  +I AE DYLW
Sbjct  1833  CDMVFDDDLGLNLRDLSFLLLTTYGATVSEIDLEIYSLLSEIESAGGAGDNIIAEHDYLW  1892

Query  2817  GNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRP--  2990
             G++ ++  K       V  ++SDAE  EDCR+ QFR+NLPI+PK    TVLYFPYGR   
Sbjct  1893  GSSALRVGKG----IAVKKDISDAE--EDCRRNQFRDNLPINPKFVMQTVLYFPYGRTMC  1946

Query  2991  NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLL  3170
                  ++ V +DT +   E    E+     YDP+F+L LS H L+ G+++P+EFA LGLL
Sbjct  1947  EKSLFMDDVHRDTVNITEEGHCTELGRIERYDPVFVLSLSIHSLATGFLDPMEFAGLGLL  2006

Query  3171  AVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIP  3350
             A++L S+ SP+D  RKL Y V+ +FK+AL +CQ+K++V RL+LLL+YLQN I+E+W+KIP
Sbjct  2007  AIALVSMGSPEDGIRKLAYEVVWRFKDALMRCQRKREVTRLKLLLTYLQNGIKEEWEKIP  2066

Query  3351  SVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLW  3530
             ++ A F+AEAS +LLDPSH+HY  I+K LMQSP +NLKSIPLF +  WS+SV+FRT+R+W
Sbjct  2067  TILAAFVAEASVILLDPSHEHYPAISKFLMQSPWINLKSIPLFHDFFWSNSVTFRTDRMW  2126

Query  3531  ILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARH  3710
             +LR+LY+G+N +DD  +YIRNS+ E LLSFYVSPL+D +SKELI+  VKK  K+ +MA +
Sbjct  2127  MLRLLYAGINIEDDAVVYIRNSVLEILLSFYVSPLSDIDSKELILLVVKKCVKVQKMACY  2186

Query  3711  LIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNE  3839
             L+ENC LISWLSSV+ +      D    F   Q  VVLE + +
Sbjct  2187  LVENCCLISWLSSVL-ALSMTHIDSKDTFFSKQLLVVLESMKQ  2228



>ref|XP_010235576.1| PREDICTED: uncharacterized protein LOC100836046 [Brachypodium 
distachyon]
Length=2581

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/1672 (34%), Positives = 897/1672 (54%), Gaps = 99/1672 (6%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             D++++FP I+ V K         L S+ FL+   L  ++  WP+MFF  L   +    E 
Sbjct  953   DIIRSFPDIIDVMKTQFPSHLQFLSSVLFLQHDYLAKIASCWPDMFFCSLRKIVDNNVED  1012

Query  183   RTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLS--------IYKSDLSTQQGLHNLL  338
             + E +    S+   S A+S FL     C+L P  LS        I +  +  +     L 
Sbjct  1013  KHENY----SISTESTAMSTFLNVTPSCVLLPSVLSLMFSAPAEIGEDHVLPRDAFVQLF  1068

Query  339   LANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTK  518
                +SE T   +      VLFW N+   SY ++  + LE L  +CF +VD +  +     
Sbjct  1069  QIKISESTISELSFHLRVVLFWSNRLLSSYTIKCSDVLEQLCHVCFTLVDNIFERIRVLT  1128

Query  519   GDASSKCTRSLLPTKCVQELIETIFYHPVVAASLEC--------PLPCN----ADFTDTF  662
              D   K + +  P +C Q+++E++  HP++A S  C         LPC+     D TD  
Sbjct  1129  ADL--KSSAASCPVECFQDIVESVLQHPIIALSFPCEREEVNGLSLPCSISNCPDLTDGS  1186

Query  663   SGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAF---  833
               D  + F   +K   +H +D  V+NLL   ++LL   D   +++     R +   F   
Sbjct  1187  VEDVKEAFASFSKEN-LHPVDGFVLNLLSKLYDLLSLADSFEANYYDNDGRSLQSVFASP  1245

Query  834   KNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLE  1013
             K +++++ L F+++   C++  +   LLP  Y +  L +F+ P +L+EL +WMFS ++  
Sbjct  1246  KVMLERILLLFEEKFKLCMDKGNFGLLLPNFYMVRVLTKFMSPVKLMELANWMFSELERC  1305

Query  1014  DNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKI  1193
              +S   +   +   V L+IA    + +  C+ Q  +++  S   W +     DI  +++ 
Sbjct  1306  VSSCSAAFAPADF-VCLYIADIAMEFMYDCLQQ--TDQRSSCQSWDLKIRNSDIATIQRA  1362

Query  1194  LLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSN-----PTLVMAISRFIVNIPVNL  1358
                +   AT L+L+ AD+CLLK   +++ H   + +          M +S  ++N P+ +
Sbjct  1363  YHIILHFATKLNLEFADVCLLKM--LIRIHDAERSAGQDTKYAAFHMMLSTMVINTPLGI  1420

Query  1359  LSYCMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHL--QTNAIRETSNPSDP  1532
             L +CMF  +K KA+ ++L  E S +H++ FG +L  +++K   +    +    +S   + 
Sbjct  1421  LHHCMFPTSKVKAKAIWLLLEASSMHMNFFGQMLMKVLEKDTSVLQDMDCDSNSSWVHED  1480

Query  1533  ELLMLLPTVFLYLDSVLIKAGSQVKYFEKIVSFYWRILL--HIFSDWKCYVTRDMFDIES  1706
               ++LLP    Y+          V++ E +++FY  ILL  H F  WK +++R +F+ + 
Sbjct  1481  SAVLLLPAALSYMKHHSDSHVQWVEFLEPVLNFYSEILLGNHGFPCWKSFISRSIFEEKF  1540

Query  1707  FDNLPLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDF  1886
              D    S+E+ MD F+  LL +S+ +++    L+   + ++ R+E+  S+CPQ     + 
Sbjct  1541  SDFRYKSVEDIMDYFNDTLLGKSITLLRY--YLSSKEISWKQRLEIITSICPQS---YEL  1595

Query  1887  LDFDPSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTL  2066
             LD D + +   S    L   N   AKI+L R LL P     S+    D+          +
Sbjct  1596  LDSDVNDINPGSPNGILKLTNEMFAKISLIRLLLSPPRILLSNEAALDRES------KRV  1649

Query  2067  DVSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHG  2246
             + +++  + +LV +  KI   FP         E E  ++   LE  IL+NI+ELS E+  
Sbjct  1650  NNAKLNFISILVRTLDKIRSNFPRCDGFLSHSEKEQ-NIICSLEYTILKNIIELSSEIQA  1708

Query  2247  CLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFE  2426
              L +L ++PF+ +  +++  HRF+D + ++ +R I+  LSEGKF+  +I++L+++HS F 
Sbjct  1709  HLNQLKAIPFLNQFIRSSLLHRFNDHVAIKAIRCILVVLSEGKFAAAEILELILSHSHFL  1768

Query  2427  TAICSSNLS---TGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLEL  2597
              AI  S +S   +  +  G    P PS+++S       ++S  ++   Q+   H ++ E+
Sbjct  1769  LAITCSEVSENPSACNPTGSLLQPAPSILKSV------NSSFAKESKFQICIAHKRKREI  1822

Query  2598  IKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSIS  2777
             I+LLRVL+ +K+ Q +     E     R+L FLLLS Y AT+ + D EI +L+NEI+S  
Sbjct  1823  IRLLRVLYDIKSSQQNNSLVNES----RELSFLLLSVYGATMGETDLEILHLMNEIESFE  1878

Query  2778  DSNISIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDC--RKIQFRENLPIDPKM  2951
                 ++AE D+LWGNA +K R+E +L  + S   +  E  E+   R+  FREN+PID K+
Sbjct  1879  CK--TMAEVDHLWGNAALKYREELKLDSSSSEIHNKTENTENNGRRRTLFRENIPIDSKL  1936

Query  2952  CASTVLYFPYGRP--NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLS  3125
             C  TVL F Y R   N    +  +++D F  + +  S       IYDPIFILR S H L 
Sbjct  1937  CIMTVLQFCYKRSPMNSVFSLEHLRQDNFVDILKTTSQSTDMVQIYDPIFILRFSIHTLL  1996

Query  3126  MGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLL  3305
             +GYIEPVEF+ LGLLA++  SISSPD++ RKLGY  L  FK  LE  QK K+  +LQLLL
Sbjct  1997  VGYIEPVEFSRLGLLAITFVSISSPDEELRKLGYESLGTFKKTLEASQKSKEKWQLQLLL  2056

Query  3306  SYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQN  3485
             +YLQN I E WQ+IPS+ AIF AEAS  LLD SH  + TI+K LM S SVNL++IPLF  
Sbjct  2057  TYLQNGIFEPWQRIPSIIAIFAAEASLTLLDGSHTQFNTISKFLMHSASVNLQTIPLFPT  2116

Query  3486  LLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELII  3665
             LL S SV F  +RLW+L++LY+GLN  DD  I  R S+ E  L+F  S +AD+ESK LI+
Sbjct  2117  LLRSSSVHFEADRLWMLQLLYAGLNLTDDAIICKRGSVIELALAFCTSAVADSESKRLIL  2176

Query  3666  QTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEII  3845
             Q +KK  KL  +A+HL ++CG++SWLSSV++S      +  K      F + LEV+N ++
Sbjct  2177  QVLKKCVKLPVLAQHLAKDCGVLSWLSSVISSH-NEGPNSVKNSSSKIFGLALEVLNALM  2235

Query  3846  FFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRK  4025
               R   EWLQ+ ALEQLSE+S +L  +LV+  + L+ +      +L ++  T ++S KRK
Sbjct  2236  SSRFITEWLQETALEQLSEISKYL-YLLVQDDKSLRGNIPMLTSVLNVIASTMRLSMKRK  2294

Query  4026  VYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIA-KTGLEAILMSTPPVAILQMDCKKVSKF  4202
             +YQPHFTL + G+F LC+AID         +  + G++ +LM+ P   + + D  + +  
Sbjct  2295  IYQPHFTLCLHGIFKLCQAIDGNSRSIDLKLTMELGIDVVLMNGPLPILSERDKSRTAMV  2354

Query  4203  INWAMS-IALQSETKGVLQVEKCCFPLNVSSEEETENS-LISKLLRWLTASVILGKIS--  4370
             ++WA S I      K VL+         +S EE   N  L+SK+LRWL AS+ILG+IS  
Sbjct  2355  VSWATSNIFWFCNKKSVLE---------MSCEELLRNECLLSKILRWLVASIILGRISCI  2405

Query  4371  --YKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTS  4544
                K   L  S +   +    L+C  E  E  D          E LA  I YLQ  +  +
Sbjct  2406  SPEKRGNLSMSTNSPGTLQSFLNCTYERVEMVDSH-----IANETLAIIILYLQDHVKKN  2460

Query  4545  FKLLPSAVSALCLLLLKNPASSGSEVLIGNAAALCSKIRCPAEANSAWRWSFYQPWKDHS  4724
                LPS V+ALCLLLL   +        G    LC+KI CPAE+N AWRW +YQPW+D +
Sbjct  2461  SDTLPSVVTALCLLLLDRSSKQDLVDSRGQIEMLCAKIHCPAESNPAWRWHYYQPWRDPA  2520

Query  4725  SNLTDSEKIEEIHACQMLLLVASKMLARNSLYS-KLISLKDVEKLGVFEWER  4877
                T +E++E   AC+ LL++ S   +        ++SL DVEK G+F+WER
Sbjct  2521  LQHTATERMEVEQACRSLLIIFSNAFSAGLPPGIPVLSLGDVEKSGLFQWER  2572



>ref|XP_004958824.1| PREDICTED: uncharacterized protein LOC101763330 isoform X1 [Setaria 
italica]
 ref|XP_004958825.1| PREDICTED: uncharacterized protein LOC101763330 isoform X2 [Setaria 
italica]
Length=2603

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/1661 (34%), Positives = 906/1661 (55%), Gaps = 84/1661 (5%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGL---ESAISGL  173
             D++ +FP ++ V K       + L S+ FL+   L  V+  WP++FF+G+   +  ++  
Sbjct  981   DIISDFPDLLDVVKTHFPCHLAFLSSVLFLQHDYLAKVASCWPDIFFSGIRLFKDDMNAD  1040

Query  174   QEGRTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKS-----DLSTQQGLHNLL  338
                  E+     S+   SA LS FL  +  C L P  LS+  S       + +  L  LL
Sbjct  1041  HVNTVEDKWKNLSVSTESAPLSTFLIVSPFCALLPSVLSLAFSVSDEIREAHKDALLRLL  1100

Query  339   LANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTK  518
                LSE T   +      +LFW +    SY ++    LE L  LCF +VDR+        
Sbjct  1101  QVKLSECTFSEVTLYLRVILFWSHHLLSSYTIKSSNVLEQLCNLCFALVDRVFEHIQVLA  1160

Query  519   GDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESN  698
              D  SK      P + +Q++++ + +HP++A SL   L    + +D  S + +++ L   
Sbjct  1161  ADTQSKSADLPYPVQHIQDIVDFVIHHPIIALSLSRSLSNCRNLSDG-SLEHLEEALVVF  1219

Query  699   KWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQK-------LF  857
                 +H +D  V+ LL  +++LL        SFEA ++R    + +++          + 
Sbjct  1220  SKENLHLLDRFVLKLLGKSYDLLLM----VGSFEANYSRDDGPSHESLFAAPNLLLENIL  1275

Query  858   LTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSL  1037
             L FK++ + C+   +   LLP  Y +  L +F+ P +LL+L +WMF+++    +S   + 
Sbjct  1276  LLFKEKFELCMGKVNFGLLLPNFYMVRALSKFVSPVKLLDLANWMFTKLADCSSSCSPAF  1335

Query  1038  RDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIA  1217
               + L + L+I     + L  C+ Q   +R  S L W +   +  +  +++    V   A
Sbjct  1336  VPAAL-MCLYITDVAMEMLCRCL-QKTGQRSESYLLWNL---EIHVTTIQQAYHIVLHFA  1390

Query  1218  THLHLDVADMCLLKAF-KVVKTHKVMQQSNPTLV--MAISRFIVNIPVNLLSYCMFQINK  1388
             T  +L+ AD CLLK   ++  T +    S   +   M +S  ++N P+++L +C+F  +K
Sbjct  1391  TKWNLEFADHCLLKMLGRIHHTERYAGWSTDYIAFHMILSTLVINTPIDVLHHCIFPASK  1450

Query  1389  RKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHL--QTNAIRETSNPSDPELLMLLPTVF  1562
              KA+ L L  E SP+H+++FG +L     K  +L    ++    S P +   ++LLP   
Sbjct  1451  VKAKALLLLLEASPMHMNLFGKILLETFKKDNYLLQVKDSDSNASWPQEDGAILLLPAAL  1510

Query  1563  LYLDSVLIKAGSQVKYFEKIVSFYWRILL--HIFSDWKCYVTRDMFDIESFDNLPLSIEE  1736
               L       G   ++ E +  FY  +LL    FS WK +VTR +F+ +  D +P  +++
Sbjct  1511  SCLKCHSDDNGRCAEFLEPVSIFYSELLLCDKGFSSWKSFVTRSIFEEDFSDFIPTPVKD  1570

Query  1737  FMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGT  1916
              M  FS  LL +SV+M+      +   +  + R+++  S+ P+ S   + LD D + +  
Sbjct  1571  IMIYFSGTLLGKSVMMLH--HYFSSKEMSRKERLDIVGSIFPESS---ELLDSDVNDINP  1625

Query  1917  CSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKM  2096
              S ++ +   N   AKI+L R LL P     SS +  ++      LH     +++  + +
Sbjct  1626  TSYKRIVKVTNELFAKISLIRLLLSPPRKSLSSEVASER--ESKRLHK----AKLNFISI  1679

Query  2097  LVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPF  2276
             LV +  KI    P ++DN      +   V RFLE +IL+NI+ELS E+   L +L S+PF
Sbjct  1680  LVRTMDKIFMNLP-SSDNILSHSAKEQKVIRFLEYVILKNIIELSSEIQSHLNQLKSIPF  1738

Query  2277  IVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLS-  2453
             + +  +++  HRF+DP+ ++ +R I+  LS+ KFS  +II+L++ HS F + I  + +S 
Sbjct  1739  LSQFIRSSLLHRFNDPVAIKAIRSILVVLSQAKFSADEIIELILGHSNFMSTITCNEVSE  1798

Query  2454  --TGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQV  2627
               +  +  G    P PS+++         +S   ++  Q+  +   ++E+I+LLRVL+ +
Sbjct  1799  YPSACNPSGGMLQPAPSILK------LVDSSFMEENKPQLCTKEKGRVEIIRLLRVLYDI  1852

Query  2628  KARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD  2807
             K+RQ +    +E     R+LVFLLLS Y+ATL + D EI +L+NEI+S     I+  E D
Sbjct  1853  KSRQQNNSQLRES----RELVFLLLSIYDATLSETDLEILHLMNEIESTEYRTIT--EVD  1906

Query  2808  YLWGNAVVKARKEREL--VQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPY  2981
             +LWG+A +K R+E +L   ++ + N+ +AE+ E  R+  FREN+P+D K+CA T L + Y
Sbjct  1907  HLWGSAALKFREELKLDFSKSDTQNIENAEITER-RRALFRENIPVDSKLCAKTALLYCY  1965

Query  2982  GRPNGPGV--VNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFA  3155
              R +      + ++Q++ F    E+ S  +    IYDPIFILR S H L MGYIEP EFA
Sbjct  1966  KRSSRASAFSLEQLQRENFTDSFEETSQRMDAVQIYDPIFILRFSIHTLLMGYIEPAEFA  2025

Query  3156  NLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEED  3335
              LGLLA++L SI+SPD + R LGY  L  FK +LE  Q+ K++ +LQLLL+YLQN I E 
Sbjct  2026  RLGLLAITLVSIASPDQELRMLGYECLGAFKKSLETSQRSKEMWQLQLLLTYLQNGISEQ  2085

Query  3336  WQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFR  3515
             WQ+IPS+  +F AEAS  LLD SH  +  I+  LM S S +L+SIPLF  LL S SV F+
Sbjct  2086  WQRIPSIITVFAAEASLTLLDSSHAQFTAISNFLMHSTSASLQSIPLFPTLLQSSSVHFK  2145

Query  3516  TERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLS  3695
              ERLW+LR+L +G N  DD  IY R  + E  L+F  SP++D+ESK L+++ +KK  KL 
Sbjct  2146  AERLWMLRLLSAGSNLADDAKIYKRGRVLELALAFCSSPVSDSESKVLVLKMLKKCVKLP  2205

Query  3696  RMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQ  3875
              +A HL +  GL+ WLSSV+ S  G   D  +        + LEVVN++I  R   +WLQ
Sbjct  2206  VLAHHLAKESGLLLWLSSVI-SIEG--SDGAESSCSRVTELTLEVVNDLISSRLITDWLQ  2262

Query  3876  KYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSV  4055
             + ALEQLS +S  LC +L+  A++LK +      +L ++T T ++S KRK+YQPHFTLS+
Sbjct  2263  ESALEQLSVISADLCVLLINNAKLLKGNVPLLTSVLSVITSTMRLSMKRKIYQPHFTLSL  2322

Query  4056  EGLFHLCEA-IDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMS--IA  4226
              G+F+LC+A +    +  +    + G++AILM+ P   + +MD  ++S  ++WA S    
Sbjct  2323  HGVFNLCQATVGSSRSAEHKLTMELGIDAILMNGPMPILSEMDKSRISMVVSWATSNIFW  2382

Query  4227  LQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSC  4406
             L S  + +L++     P+N S          SKLLR L ASVILG+IS          + 
Sbjct  2383  LYSNQRSMLEISSKESPINESPP--------SKLLRLLVASVILGRISSISHGKSGDLAR  2434

Query  4407  DRSKLINLHCLLEWNEESDR-ENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCL  4583
               S L  LH  L  N+  +R E  +  +  + LA  I YLQ  +  +   LPS V ALCL
Sbjct  2435  STSSLGTLHSFL--NDAYERVETVESCSANDTLAVIILYLQDHVQKNSDSLPSVVMALCL  2492

Query  4584  LLLKNPASSGSEVLIGNAAA---LCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIE  4754
             LLL   +   ++ L  N      LCSKIRCPAE+N +WRW +YQPWKD ++  T+ E++E
Sbjct  2493  LLLDRSSKQVNKHLADNHGKIEMLCSKIRCPAESNPSWRWHYYQPWKDPAAPRTEMERLE  2552

Query  4755  EIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWER  4877
             E  AC+ LL++ S   + +     ++SL DVEK G+F+WER
Sbjct  2553  EEQACRSLLILFSNAFSASLPEFLVLSLDDVEKSGLFQWER  2593



>ref|XP_006293524.1| hypothetical protein CARUB_v10024544mg [Capsella rubella]
 gb|EOA26422.1| hypothetical protein CARUB_v10024544mg [Capsella rubella]
Length=2248

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/1647 (35%), Positives = 861/1647 (52%), Gaps = 148/1647 (9%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEGR  185
             +L++F  ++ VS  + G PFS L+SI FLE + L  +SK  P++F  GLE A+S     R
Sbjct  728   VLKDFASVMVVSWDLYGTPFSFLLSILFLEENFLGTLSKQSPDLFVRGLELAVS-----R  782

Query  186   TEEFGDIDSM-EFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERT  362
                 G +DSM +F S A  +FL++    +L    +S+  S L     L  LLL  +S+  
Sbjct  783   NLGEGTVDSMIDFESFAFYMFLEQTPFPILLNEIMSMDISSLPEFPRLTELLLLEVSQPK  842

Query  363   PDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCT  542
              D I S    +LFW  Q   SY+V+P   L   SE+C  ++  M  Q             
Sbjct  843   SDSIESDIRLILFWLFQIRSSYKVQPTSVLCQQSEICLRLIKHMFSQV----------SE  892

Query  543   RSLLPTKCV----QELIETIFYHPVVAASLECPLPC----NADFTDTFSGDSMDKFLESN  698
             R L+ T        ++ +T+  HPVV A LE PL C     A   + FS  S+     + 
Sbjct  893   RDLVSTSSSDNWKHQVPQTVLCHPVVMALLESPLDCETLPRAQNPEIFSETSL-----TM  947

Query  699   KWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRT  878
                VI ++D H+++LL +T E +   +            +   AFK+ V++L L F D+ 
Sbjct  948   GRLVISEIDQHIVDLLASTCENVLLNERHIVQKGDLREYKSVMAFKDFVERLLLLFSDKF  1007

Query  879   DKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRV  1058
             + C+ S+   PLL     IH L RFI PF+LL LV    S+ID E+ +   S    +L +
Sbjct  1008  ELCVGSQSYAPLLQPSKLIHALLRFISPFKLLSLVRSTMSKIDEEEMTSPYS--SMILSM  1065

Query  1059  GLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDV  1238
             G+ IAG   D L+    QP +ER + DL W + E+ +D  ++E++       +T   L  
Sbjct  1066  GMDIAGGALDMLTLYSLQPAAERAVYDLLWELDEKNYDSKIIEEVYSMACRFSTSFGLVS  1125

Query  1239  ADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLA  1415
             AD+CLLK    +   K  Q  N   L + +S+ +   P+ L++ C  Q++  KA++LF  
Sbjct  1126  ADICLLKVVGGIFMGKHNQHCNVHPLTLIMSQIVGRTPIALITNCCNQLSMTKAKILFYL  1185

Query  1416  TEMSPLHLSIFGHL-LSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKA  1592
              E SPLHLSIFGH  LS +  KQ         ++S  +D + +MLLP V  YL SV  K 
Sbjct  1186  VESSPLHLSIFGHFFLSNLSKKQ--------DDSSALTDVQFIMLLPAVLSYLASVFAKL  1237

Query  1593  GSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMD-IFSCNLLS  1769
                      I S Y  IL+  F  W  +++  +F+ E ++++ LS  E ++ +F+ +LL 
Sbjct  1238  EKPRSRCLDITSVYSNILIKGFLQWPKFLSGCIFE-EKYEDILLSTSEDIETMFNASLLG  1296

Query  1770  RSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVN  1949
             ++V M Q   AL     K +  ++LF S+ P  S   + LD    +V   S++Q  N   
Sbjct  1297  KAVRMFQYHFALIESSTKTDLLLKLFGSLFPHNSAGKEMLDAHIKEVDVLSIDQKFNVAI  1356

Query  1950  RTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEK  2129
             R +AK+ L R  LFP         KE   E  ++  S L      L+  LV+SW  +V+ 
Sbjct  1357  RIIAKVELSRICLFP---------KESSPEVGSDRESLLQ----PLINALVNSWECVVK-  1402

Query  2130  FPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFW  2306
                ++D+S + + + C  +++ LE  ILR+I+   + M   L  L SLPF+ +L  +   
Sbjct  1403  ---SSDDSFKGKQDKCWFLWKSLENFILRSILMFLEGMCEELCHLASLPFLERLMNSVLR  1459

Query  2307  HRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFT  2486
             +RF+D  TL+ LR+I S LS GK+S    +QL+V+HSQF   I S ++S+  S  G    
Sbjct  1460  YRFEDSKTLKILREIFSLLSRGKYSYAPYLQLLVSHSQFTQTISSLSMSS--SHTGEELR  1517

Query  2487  PLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEI  2666
             P+ S++   +IP  N  S+        +  +LK  E++K+LRVL          +  ++ 
Sbjct  1518  PVSSILEHLIIP--NPVSVRTGYCCLEAPNYLKHFEILKILRVLLS--------KCGKDS  1567

Query  2667  GINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKE  2846
             GI+L++L F+LL SY ATL +ID EI+ L+ +IK I   +      DYLWG A +K R E
Sbjct  1568  GIHLKELHFILLCSYGATLSEIDLEIYKLMQDIKLIVGEHTLNDSEDYLWGKAALKIR-E  1626

Query  2847  RELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKD  3026
                    + +    ++ ED R   F+ENL +DPK+CA TVLYFPY R       N    D
Sbjct  1627  GLCFSPDASDGGATDLVEDLRPSLFKENLCVDPKICAQTVLYFPYER-TAEASDNCYLYD  1685

Query  3027  TFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDD  3206
               D + E  S  +     YDP+FILR S + LSMGYIEPVEFA LGLLAV+ AS+SS D 
Sbjct  1686  --DPISEKFSPGIER---YDPVFILRFSVYSLSMGYIEPVEFARLGLLAVAFASMSSADL  1740

Query  3207  DTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASF  3386
               RKLGY  LE F + LE C++   V  L+ LL Y+QN ++E WQ+IP+V A+F AEAS 
Sbjct  1741  GMRKLGYETLEIFVDVLESCRENTHVTVLRFLLMYVQNGVKEQWQRIPTVNAVFAAEASL  1800

Query  3387  VLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTD  3566
             +L D S +HY  I K L  S +  L+ IPLF +   S +  FR++RLW+LR++  GL ++
Sbjct  1801  ILRDSSQEHYVPIIKLLNSSSTPKLREIPLFHDFFGSSTFRFRSQRLWVLRLVCVGLESE  1860

Query  3567  DDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLS  3746
             DD  IY RNSI +T++ F+ SP AD+E+K LI+Q +  +                     
Sbjct  1861  DDAQIYFRNSILKTVMGFFSSPHADDETKGLILQVITDA---------------------  1899

Query  3747  SVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQI  3926
                                      L   NE        EW Q  A + L E+S  L  +
Sbjct  1900  -------------------------LHSRNE-------TEWSQSSAFDGLMEISSRLYTL  1927

Query  3927  LVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGC  4106
             L  G   ++E+ST   LILQIL+ T K+SQKRK YQPHFT+++EG+F L EA   C +  
Sbjct  1928  LGSGLVSMQENSTSVDLILQILSATLKISQKRKKYQPHFTITMEGIFQLFEAAANCDSPQ  1987

Query  4107  YSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNV  4286
                 A+  L+ ILMSTP V I+ MD  ++ +F+ W  S A++S+ K    + +     + 
Sbjct  1988  LEASAERRLDTILMSTPQVEIICMDVDRLRRFLLWGSSTAMKSDLKKGSNLSES----HQ  2043

Query  4287  SSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHC-LLEWNEESD  4463
              ++  TE + ++K LRWL ASVILGK+ Y  +          +K   L   LLE+ ++ +
Sbjct  2044  DTKTHTEETNVAKFLRWLLASVILGKL-YAEANDSEQIVLSETKAETLPTKLLEYFKKRN  2102

Query  4464  RENGKEFACQEILAASIFYLQQ-LLGTSFK-LLPSAVSALCLLLLKNPASSGSEVLIGNA  4637
              + G     + I+   I YLQ+ LL  +++ LLPS V AL L++L+N   +      G  
Sbjct  2103  LK-GSMTNSEHIIGEVIVYLQKHLLSKNYRVLLPSVVFALSLMVLRNGLQATGTESEGKR  2161

Query  4638  ----AALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLA  4805
                  +LCS+I  P EA   WRWS++Q WKDHS + TD +KI E++AC  LLL+ S M  
Sbjct  2162  LELIKSLCSRISSPPEATPVWRWSYHQAWKDHSDSATDPKKISELYACHELLLIFSDMFG  2221

Query  4806  RNSLYSKLISLKDVEKLGVFEWERSIL  4886
               +    L+  +      VFEWER ++
Sbjct  2222  AET--PLLLHGESFNMSRVFEWERGLV  2246



>ref|XP_006418233.1| hypothetical protein EUTSA_v10009735mg [Eutrema salsugineum]
 gb|ESQ36586.1| hypothetical protein EUTSA_v10009735mg [Eutrema salsugineum]
Length=2411

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/1655 (35%), Positives = 890/1655 (54%), Gaps = 127/1655 (8%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEGR  185
             +L+NF  +++VS  + G  FS L SI FL+ + L ++ K  P++F + + S    L+EG 
Sbjct  854   ILENFDSVMAVSWDLHGTSFSFLHSISFLDENFLGNLLKLSPDLF-SEVTSESRNLREGT  912

Query  186   TE---EFGDIDS--MEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANL  350
              +   +F D  S   E   +    FL++     L    + +  S L     +  LLL  +
Sbjct  913   VDCEIDFADHSSSITEEIKSKTDFFLEQMPFPALLDAVMRMDISCLVEFPRISELLLLKV  972

Query  351   SERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDAS  530
              +   D I S    +L W +Q   SY+ +P   L  LSE+C  ++  +L Q        S
Sbjct  973   LQPKSDSIDSDIRLILNWLSQIRSSYKAQPAPVLCHLSEICLRLMKHLLSQI-----STS  1027

Query  531   SKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNA----DFTDTFSGDSMDKFLESN  698
              K        K  Q + +T+  HPV+ + LE PL C         D FS  S+       
Sbjct  1028  DKLLAPFAKWKHHQ-VAQTVLCHPVMMSLLESPLDCGTLPRLQNVDIFSETSL-------  1079

Query  699   KWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRT  878
                 I ++D H+++LL +  E   F +          A     A K++V++L L FK + 
Sbjct  1080  ----ISEIDQHILDLLVSNCEHFLFVERHIV------ANNSIMAIKDLVERLLLVFKGKF  1129

Query  879   D-KCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLR  1055
             +  C+ S+   PLL     IH L RFI P +L  L   M S+ +L  +S   S+   VL 
Sbjct  1130  EITCVGSQSYAPLLQPSQLIHALLRFISPVKLFYLARSMLSKTEL--SSPNSSM---VLS  1184

Query  1056  VGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLD  1235
             +GL IAG  F+ L     +P ++R + DL W + E  +D  L+E++     + +T L L 
Sbjct  1185  LGLDIAGGAFEMLMLYSHEPAAKRRVYDLLWELEENNYDSNLIEEVYSVACKFSTSLGLV  1244

Query  1236  VADMCLLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLA  1415
              AD  LLK    +   +     NP L + IS+     P +L+ +C+ Q N  +A+++F  
Sbjct  1245  SADNYLLKVVGAI--FRAKHSVNP-LTLIISKITGRTPKDLIIHCINQANMTRAKIVFYL  1301

Query  1416  TEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAG  1595
              E SPLH+S+FGH        ++ L  +           + +MLLP V  YL S+  K  
Sbjct  1302  VESSPLHMSVFGHFFFSKQQDEIGLTND-----------QFIMLLPAVLSYLASLTAKLE  1350

Query  1596  SQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMD-IFSCNLLSR  1772
                +    I S Y  IL++ F  W  +++  +F+ +  + LP +  E +D +F+ +LL +
Sbjct  1351  KPCRRCLDITSVYSNILINGFLQWPKFLSECIFEEKYEEILPSATTEDIDTMFNASLLGK  1410

Query  1773  SVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNR  1952
             +V M+Q   ALT    K E  +++FD +          LD++  +V   S++   N   R
Sbjct  1411  AVRMLQYHFALTESPTKTEDLLKIFDFM----------LDYETKEVDVQSVDDMFNVAIR  1460

Query  1953  TVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKF  2132
              VAK  + R  LFPE +     L     E+C E+ S  +     LL  LV+SW+  V++ 
Sbjct  1461  VVAKAEISRICLFPEDSSSMFHLGTCVKESCPEMGSNRES---LLLNALVNSWQSAVKR-  1516

Query  2133  PMTADNSCQMEVENCSVF--RFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFW  2306
                +D S +   E+   F    LE  IL +I+   +++   LV LDSLPF+ +L ++   
Sbjct  1517  ---SDASFKRNSEDKCWFLCNSLENFILTSILRFLRDVCERLVHLDSLPFLERLMESVLL  1573

Query  2307  HRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFT  2486
             +RF+D  TL+ LR+I+S LS GK+S    +QL+ +HSQF   I S +  TG S     F 
Sbjct  1574  YRFEDSKTLKMLREILSLLSRGKYSYAPYLQLLRSHSQFTPTISSLSSHTGDS-----FR  1628

Query  2487  PLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEI  2666
             P+ S+++  +I + + NS+        +  ++KQLE++K+LRVL          +  ++ 
Sbjct  1629  PVSSILKHLII-IPSPNSVGAGSCCLQAPDYVKQLEIVKILRVLLS--------KCGKDS  1679

Query  2667  GINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSN-ISIAEWDYLWGNAVVKARK  2843
             GINL+++ FLLLSSY AT+ +ID E++ L+++I+ I + N ++++E DYLWG A +K R+
Sbjct  1680  GINLKEVHFLLLSSYGATMSEIDLELYKLMHDIELIDEENRVNVSETDYLWGKAALKMRE  1739

Query  2844  ERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRP-----------  2990
                    ++    +A+  ED R+  F+ENL +DPK+CA TVLYFPY              
Sbjct  1740  -----GLLASYGGEADSVEDIRQSLFKENLCVDPKICAQTVLYFPYQHTAEVSDNSSYLY  1794

Query  2991  NGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLL  3170
             N   +  +V    F        + V  R  YDP FIL+ S H L  GYIEPVEFA+LGLL
Sbjct  1795  NDDPMSKQVPFFNFYFQLLKICSRVIER--YDPAFILQFSEHSLYTGYIEPVEFASLGLL  1852

Query  3171  AVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVM-RLQLLLSYLQNCIEEDWQKI  3347
             AV+  S+SS D   RKLGY  L +F  ALE C   + V  RL LLLSY+QN +EE WQ+I
Sbjct  1853  AVAFVSMSSADLGMRKLGYNTLGRFVEALECCTMNEHVKNRLGLLLSYVQNGVEEQWQRI  1912

Query  3348  PSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERL  3527
             P+V  +F AE S +LLD SH+H+  I K L  S ++ L+ IPLF +   S +V   ++RL
Sbjct  1913  PTVYTVFAAETSLILLDSSHEHHVPIVKFLKTSSTLKLRGIPLFHDFFLSSAVG--SQRL  1970

Query  3528  WILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMAR  3707
             WILR++  GL ++DD  IY+RNS+ E ++SF+ +PLAD+E+K LI++ V+KS K  ++AR
Sbjct  1971  WILRLVCVGLKSEDDAQIYVRNSVLEIVMSFFSTPLADDETKGLILEVVRKSVKFHKLAR  2030

Query  3708  HLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYAL  3887
             HL+ NC L+ W SS ++ F         G  ++ F VVLEV+   +  R+  EWLQ++AL
Sbjct  2031  HLVVNCHLLPWCSSFISMFTRKPI----GDEYSPFLVVLEVITNALASRNVTEWLQRFAL  2086

Query  3888  EQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLF  4067
             E L E+S  L ++L  G   ++E+ T   LILQIL+ T K+SQKR+++QPHFT+++EG+F
Sbjct  2087  EGLMEISSRLYRLLGGGLVSIRENGTCVDLILQILSPTLKMSQKREMHQPHFTITIEGIF  2146

Query  4068  HLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKG  4247
              + EA+  C +      A+ GL+ ILMS+PP+ I+ MD  K+ +F+ W  S AL+ + K 
Sbjct  2147  QIFEAVANCGSPQCEANAERGLDTILMSSPPLDIICMDVGKLRRFLLWGTSTALKIDLKK  2206

Query  4248  VLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLIN  4427
               +  +        +EE  E ++++K LRWL  SVILGK+  +    DS+   ++ K   
Sbjct  2207  GSKPSESHQDSKTRTEEGQEETMVAKFLRWLLVSVILGKLYSEAHDSDSTVLSEK-KPET  2265

Query  4428  LHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKL-LPSAVSALCLLLLKNPA  4604
             L  LLE N +           + ++   I +LQ+L+ T++++ LP+ V AL L+ L N  
Sbjct  2266  LLTLLE-NYKIRNLGDSMTKSEHVIGEVILHLQKLVCTNYRVFLPTVVFALSLMFLHN--  2322

Query  4605  SSGSEVLIGNAAALCSKIRCPAEANSAWRWSFYQPWKDHSSN-LTDSEKIEEIHACQMLL  4781
               G   LI    +LCS+I  P E   AWRWS++Q WKD SS   TD EK++ +HACQ LL
Sbjct  2323  GLGDYKLI---KSLCSRISIPPE---AWRWSYHQAWKDLSSEPATDVEKMDVLHACQDLL  2376

Query  4782  LVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             L+ S ML        L    D+ +  +FEWER ++
Sbjct  2377  LIFSDMLEETPQEVLLRESFDMSR--IFEWERGLV  2409



>ref|XP_007022466.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY13991.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=2493

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/1183 (42%), Positives = 716/1183 (61%), Gaps = 34/1183 (3%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGL-QE  179
             D+L NFP+++++S K LGV   LL SI F E + L+ +S  WPE+F  GLE A+  + Q+
Sbjct  960   DILINFPLVMTISLK-LGVAVPLLSSIIFSEQNFLVGLSNLWPEVFVPGLEMALLEIHQK  1018

Query  180   GRTEEFG-----DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLA  344
             G+ ++ G     D D+++ A+AA SLFLK+    +LFP T+SI    LS    + +LLL+
Sbjct  1019  GKDDDEGMTSNIDFDTIQSAAAAFSLFLKQVPFHVLFPATISIDAPYLSESSKIQDLLLS  1078

Query  345   NLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGD  524
               S+ T D  +S    VLFWF +  +  R + L ELE +S++C  I+  M  Q L  K D
Sbjct  1079  KRSDWTSDCPISFLRLVLFWFYRVRLFCRNKQLNELEQVSDICLIIIKHMFSQLLALKPD  1138

Query  525   -ASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNK  701
                S  T   L  + ++E+ E I  HP + +SL CPL CN + T    G+ ++ FL  + 
Sbjct  1139  FECSMNTEVPLLAETIREVGEIILCHPEMISSLTCPLSCNKEVTTGLLGNGLETFLSLSG  1198

Query  702   WRVIHKMDLHVINLLRTTFEL-LYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRT  878
              RV  K+D HV++LL  T +  L       S  E    R + +AF ++VQ+LFL  KDR 
Sbjct  1199  QRV-RKLDHHVLDLLTATLDFYLSVSKSHYSVIEDEAKRTIRRAFSSLVQRLFLDVKDRF  1257

Query  879   DKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRV  1058
             D C  S DL PLL +  AIH L  FI PFELLEL HWMFSRID+   + + S   S L V
Sbjct  1258  DVCSGSGDLQPLLSSFCAIHALILFISPFELLELGHWMFSRIDVNKLTAENSHVMSALSV  1317

Query  1059  GLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDV  1238
             G  +AG  F+ LS  + QP  ER   D  W + E+ FD+ +LE I ++V + A + +LD 
Sbjct  1318  GFSLAGGGFEVLSTYLQQPLIERAPYDFLWQVEEKTFDVNILEDIYVKVCKFACNFNLDF  1377

Query  1239  ADMCLLKAFKVVKTHKVMQQS--NPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFL  1412
             ADMCLL+A   V   K  Q+   +P+  + +SR +++ PV ++S+C+++ +  KA+LL L
Sbjct  1378  ADMCLLRAVNAVYRQKSSQRGELHPSSAV-MSRVLMSTPVEMVSHCIYRTSIAKAKLLHL  1436

Query  1413  ATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP--SDPELLMLLPTVFLYLDSVLI  1586
               EMSPLHLSIFG L   +++K        ++E S    SD   +MLLP     ++S  +
Sbjct  1437  LIEMSPLHLSIFGQLFLNILNKDFFSNAILMKEISGYALSDDNFMMLLPAALSLVNSAFV  1496

Query  1587  KAGSQ-VKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNL  1763
             K      ++F+ I SFY R+LL+ F  WK +V+ D+F  E  + LP S +E  ++   +L
Sbjct  1497  KFEKHFYRHFKSIPSFYSRMLLNGFVHWKSFVSGDIFQEEYSEFLPSSAQELFNLVDESL  1556

Query  1764  LSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNF  1943
             L +++ +++    L+G  +K + R+ELF+S+     T  + LD   S++   S+ +SLN 
Sbjct  1557  LGKAIHLLRYHFFLSGDSLKLKKRLELFNSIFAYSVTHEELLDCGVSEMDFSSVNKSLNH  1616

Query  1944  VNRTVAKINLCRTLLFPEHNKF-------SSGLKEDKMETCAELHSTLDVSRIRLLKMLV  2102
             +N+ VAKI+ C+ LLFPE +K          GL+E  +   +   +  D SR+  +  LV
Sbjct  1617  INKVVAKISFCKMLLFPEDDKVLFLPKEEDGGLREISLTMGS---NKADSSRMHFMDALV  1673

Query  2103  SSWRKIVEKFPMTADNSCQMEVENCS---VFRFLEVLILRNIVELSKEMHGCLVKLDSLP  2273
              +W+ +V+K P+  + S  +  ++     ++R LEV ILRNI++L+++MH  L+ L S+P
Sbjct  1674  GAWQWMVKKLPLIPEYSISIIAKSGDCLCLYRCLEVFILRNILQLTRKMHSYLILLQSIP  1733

Query  2274  FIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLS  2453
             F+ +L ++T  +RF+D  TL  LR I+  LSEGKFS V  +Q+++ HSQF   I S + S
Sbjct  1734  FVEQLMRSTLLYRFEDSKTLGILRSILILLSEGKFSRVLCLQMLLGHSQFAPMIHSISKS  1793

Query  2454  TGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKA  2633
             +  S+ G  F P+ S++R  V+P    N    KD+ + ++  +KQLE++KLLR L    A
Sbjct  1794  S-TSETGTFFRPMSSILRLLVVPDITSNVKDGKDDQEAAEMCVKQLEILKLLRTLLLSGA  1852

Query  2634  RQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNIS-IAEWDY  2810
                D +   +  INL++L  LLLSSY ATL +ID E+++L+NEI++I  S+   IAE DY
Sbjct  1853  AHSDFDSRNDSSINLKELHLLLLSSYGATLSEIDLEMYSLINEIETIDSSDSKYIAEIDY  1912

Query  2811  LWGNAVVKARKERELVQTVSCN-LSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR  2987
             LWG+A +K RKE  L    S N ++D E A++  KI++R+NLP+DPK+CA+TVL+FPY R
Sbjct  1913  LWGSAAMKVRKEHGLEHGASRNIMTDIEAAQERLKIKYRDNLPVDPKVCAATVLHFPYDR  1972

Query  2988  --PNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANL  3161
                + P  +NK+Q D    M +  S    N   YDP+FI+R S H LS GYIEPVEFA L
Sbjct  1973  TASDRPLSLNKLQSDNIKDMIKLHSPGAGNIQRYDPVFIMRFSIHSLSAGYIEPVEFAGL  2032

Query  3162  GLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQ  3341
             GLLAV+  S+SS D   RKL Y VL +FK +LE+CQ+KKDV RL LLL Y+QN IEE WQ
Sbjct  2033  GLLAVAFVSMSSLDVGMRKLAYEVLSRFKISLERCQRKKDVTRLHLLLMYMQNGIEEPWQ  2092

Query  3342  KIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSI  3470
             +IPSV A+F AE S VLLDP H+HY+T  K LM S  VN+K +
Sbjct  2093  RIPSVIALFAAETSLVLLDPLHEHYSTFNKLLMNSSRVNMKVV  2135


 Score =   317 bits (811),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 177/362 (49%), Positives = 238/362 (66%), Gaps = 6/362 (2%)
 Frame = +3

Query  3816  VVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILT  3995
             V ++VV E+I  +   EWLQ  ALEQL EL+ HL ++LV G +++ EH+ F    LQI+ 
Sbjct  2130  VNMKVVTEVISSKDITEWLQSCALEQLMELASHLYKLLVGGMKLINEHAAFVNPTLQIII  2189

Query  3996  LTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQ  4175
              T K+SQKR++YQPHFTLS+EGLF +  A++    G YS  A+ GLEAIL STPP+ +  
Sbjct  2190  STLKMSQKRQMYQPHFTLSLEGLFQIYRAVNEHDIGRYSGNAECGLEAILTSTPPIDMFC  2249

Query  4176  MDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEET-ENSLISKLLRWLTASV  4352
             MD +K+S F+ WA S AL+SE++ + Q ++    L V  EE   E SL  KLLRWLTAS+
Sbjct  2250  MDREKLSSFLIWATSTALKSESRKMFQCKESGLYLPVILEEAPHEESLTLKLLRWLTASI  2309

Query  4353  ILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGK-EFACQEILAASIFYLQQ  4529
             I GK+S+K +   +  S DRS    L  LLE+  + D+E  K  F C+E+LAA +FYLQQ
Sbjct  2310  IHGKLSWKFNDWIAKFS-DRSNSKTLQSLLEYVPKGDKEGNKSSFDCEEMLAAQVFYLQQ  2368

Query  4530  LLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIG---NAAALCSKIRCPAEANSAWRWSF  4700
              LG +   LPS +SALCLLL  +   +G + ++    +   LCS I CP E+  AWRWSF
Sbjct  2369  SLGINCSALPSVISALCLLLCDDSKVAGLDFMLDFRTSMVTLCSMICCPPESYPAWRWSF  2428

Query  4701  YQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERS  4880
              QPWKDHSS LTD E+I+E+HACQ LL++ S +L R S     +SL+ VE  GV +WERS
Sbjct  2429  DQPWKDHSSELTDLERIDELHACQKLLVMISNVLWRKSSDFLALSLQAVENCGVLKWERS  2488

Query  4881  IL  4886
             I+
Sbjct  2489  II  2490



>emb|CAE03517.2| OSJNBa0053K19.25 [Oryza sativa Japonica Group]
 gb|EEE61726.1| hypothetical protein OsJ_16233 [Oryza sativa Japonica Group]
Length=2615

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/1671 (34%), Positives = 862/1671 (52%), Gaps = 120/1671 (7%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             D++ +FP ++ V K         L S+ FL+   L  V+   P+MFF+ L      L   
Sbjct  1014  DVISSFPKLLHVLKTHFPSNLPFLSSVLFLQHDYLAKVASYCPDMFFSSLRQIKGNL---  1070

Query  183   RTEEFGDIDSMEFA------------SAALSLFLKEASLCMLFPITLS--------IYKS  302
                   D+DS+               SA +S FL     C L P  LS        I K+
Sbjct  1071  ------DVDSVNIVEDKWGKHSTCSESAVISTFLNVTPFCALLPSVLSLAFSAPDEITKA  1124

Query  303   DLSTQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNI  482
                 Q  L +LL A +SE     +      VLFW +    SY V+  + L  L  +CF++
Sbjct  1125  HPLLQDELVHLLQAKISESPLSELTIFLRVVLFWSHHLLSSYTVKCSDILAQLCGVCFSL  1184

Query  483   VDRMLRQFLNTKGD-ASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDT  659
             +D +  +      D A+SK + +  P +C+  ++E++  HP++  SL C L    D  D 
Sbjct  1185  IDSIFERIRVLTADTANSKSSVAFYPVECLNGIVESVVQHPIIGLSLSCSLSNFQDLADG  1244

Query  660   FSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAF--  833
                   + F   +K + +H  D  V+NLL   + L+       +++     + +   F  
Sbjct  1245  SVEYVKEDFASFSKEK-LHLADSFVLNLLSNLYGLVLLAGSFGANYSNNDDQSLESLFGP  1303

Query  834   -KNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDL  1010
              K +++++ L FK++ + C+E ++    LP  Y   TL +F+ P  LLEL +WMFS    
Sbjct  1304  PKLLLERILLLFKEKFELCMEKRNFGLFLPNFYMFRTLAKFVSPVRLLELANWMFST--F  1361

Query  1011  EDNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEK  1190
             E  S             L+ A   F+ L   + Q   +R      WG+     DI  +++
Sbjct  1362  EGFSSSSPAYAPAAFCCLYTADIAFEMLYDYLQQI-DQRSGPCRLWGLEIHNCDIATIQQ  1420

Query  1191  ILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNP---TLVMAISRFIVNIPVNLL  1361
             +   +   AT L+L+ AD+CLLK    +   ++    N     L M +S  + N P+++L
Sbjct  1421  VYNIILHFATKLNLEFADLCLLKMLIRIHHTEISAVRNTDYIALHMMLSTMVANTPIDIL  1480

Query  1362  SYCMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPS---DP  1532
              +CMF  +K KA+ + L    +P+H+ +FG LL+ ++ K   +    +   SN S   + 
Sbjct  1481  HHCMFPTSKVKAKAIQLLLGANPMHMRLFGKLLTDILKKDTSVM-QVVGSDSNASWTHED  1539

Query  1533  ELLMLLPTVFLYLDSVLIKAGSQVKYFEKIVSFYWRILL--HIFSDWKCYVTRDMFDIES  1706
               ++LLP    Y++         V + E +  FY  ILL  + F  WK +VTR +F+ + 
Sbjct  1540  SFILLLPAALSYIEHHSGGNRQCVDFLEPVPVFYREILLSDNGFPCWKSFVTRSIFEEDF  1599

Query  1707  FDNLPLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDF  1886
              D    S+E+ M+ F   LL +S+ M  LC       +  + R+++  S+CPQ S   + 
Sbjct  1600  SDFRHTSVEDIMNYFGDTLLGKSITM--LCYYFYSKEIPRKQRLKIIASICPQSS---EL  1654

Query  1887  LDFDPSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTL  2066
             LD D S V   S    +   N   AKI+L R LL P     ++ +  +K          +
Sbjct  1655  LDSDISFVTPVSCNGIMKLTNELFAKISLIRMLLSPPRGSLNNEIAPEKES------KRV  1708

Query  2067  DVSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHG  2246
             + +++  + +LV +  KI   FP + D       E  +V   LE  IL+NIVELS E+  
Sbjct  1709  NNAKLSFISILVRTLDKIFRNFPHS-DGILLSSPEEQNVVSCLEYAILKNIVELSSEVQS  1767

Query  2247  CLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFE  2426
              L +L  +PF+ +L +++  HRF DP+ ++ +R II  LSEGKF   +I++L++ HS F 
Sbjct  1768  HLNQLKPIPFLNQLIRSSLLHRFSDPVVIKAIRCIIVVLSEGKFPADEILELILGHSHFV  1827

Query  2427  TAICSSNLS---TGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLEL  2597
             + I  S +S   +  +  G    P PS+++S        ++  +++  Q      K++E+
Sbjct  1828  STITCSGVSECPSACNPTGGLLQPAPSILKSV------DSAFAKENKFQDCIPERKKVEI  1881

Query  2598  IKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSIS  2777
             I+LLRVL+ +K+RQ +     E     R+L FLLLS Y ATL + D EI +L+NEI+S  
Sbjct  1882  IRLLRVLYDIKSRQHNSSLLDES----RELGFLLLSVYGATLSETDLEILHLMNEIES--  1935

Query  2778  DSNISIAEWDYLWGNAVVKARKERELVQTVS--CNLSDAEVAEDCRKIQFRENLPIDPKM  2951
                 +I + D+LWG A VK R+E +L  + S    + +AE++ D R+  FREN+PID K+
Sbjct  1936  SECKAITDVDHLWGKAAVKFREELKLEFSASDTHKMENAEIS-DRRRSLFRENIPIDSKL  1994

Query  2952  CASTVLYFPYGRPNGPGV--VNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLS  3125
             C  TVL F Y R +   +  + ++Q+D F  + +  S  +    IYDP+FIL  S H L 
Sbjct  1995  CVMTVLQFCYRRSSRASIFSLEQLQQDNFGDIFKATSQSMDAVRIYDPVFILHFSIHTLL  2054

Query  3126  MGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLL  3305
             MGYIEPVEF+ LGLLA++L SISSPD+D RKLGY  L  FK +LE  QK K+  +LQLLL
Sbjct  2055  MGYIEPVEFSRLGLLAITLVSISSPDEDLRKLGYESLGTFKKSLEASQKSKETWQLQLLL  2114

Query  3306  SYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQN  3485
             +YLQN I E WQ+IPSV AIF AEAS  LLD SH  +ATI+K LM S SVNL+       
Sbjct  2115  TYLQNGISEQWQRIPSVIAIFAAEASLTLLDSSHTQFATISKFLMHSASVNLQ-------  2167

Query  3486  LLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELII  3665
                               +LY+G N  DD  IY R  + E  LS+  S ++D+E+K L +
Sbjct  2168  ------------------LLYAGSNLADDAKIYKRGGVLELALSYGSSAVSDSETKLLTL  2209

Query  3666  QTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEII  3845
             Q +KK  KL  +A HL ++ GL+ WLSSV++S           +        LEVVN++ 
Sbjct  2210  QVLKKCVKLPVLAHHLTKDSGLLLWLSSVISSHVEGLDSVKNSYSSTVIGSALEVVNDLT  2269

Query  3846  FFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRK  4025
               R   EWLQ+ ALEQLS +S +L  +LVE  ++LK +      +L ++  T ++S KRK
Sbjct  2270  SSRLIAEWLQETALEQLSRISKYL-YVLVEDMKLLKGNVPLLTSVLNVIASTMRLSMKRK  2328

Query  4026  VYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIA-KTGLEAILMSTPPVAILQMDCKKVSKF  4202
             +YQPHF+LS+ G+  LC  I          +A + G++ ILM+ P   + +MD    +  
Sbjct  2329  IYQPHFSLSLHGIHKLCRTIGGISRSIEVKLAMQLGIDVILMNGPLPVLSEMDKSMTATV  2388

Query  4203  INWAMS--IALQSETKGVLQVEKCCFPLNVSSEEETENS-LISKLLRWLTASVILGKISY  4373
             ++WA S    L  E + VL++           EE  +N  L+SK+LRWL AS+ILGKIS 
Sbjct  2389  VSWATSNIFWLCDEQRSVLKMPH---------EEPLKNECLLSKMLRWLVASIILGKISC  2439

Query  4374  KLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKL  4553
                +     + D +   +L   L +  +   E     +  E LA  I YLQ+ L  +   
Sbjct  2440  ISHEKCGDLTRDANNFGSLESFLNYTYDEKVETVGSHSADEALAIIILYLQKHLKMNRDF  2499

Query  4554  LPSAVSALCLLLLKNPASSGSEVLIGNAAA---LCSKIRCPAEANSAWRWSFYQPWKDHS  4724
             LPS V+ALCLLLL           IG+      LCS+I+CPAEAN AWRW +YQPWKD +
Sbjct  2500  LPSVVAALCLLLLDRSNKQVIRNFIGDYGQIEMLCSQIQCPAEANPAWRWHYYQPWKDPA  2559

Query  4725  SNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWER  4877
              +  ++E +EE  ACQ LL++ S   +       ++SL DVEK G+F+WER
Sbjct  2560  MHRNEAEHLEEEQACQSLLVMFSNSFSAGLSGFPVLSLGDVEKSGLFQWER  2610



>emb|CAH66826.1| OSIGBa0148A10.3 [Oryza sativa Indica Group]
Length=2615

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/1671 (34%), Positives = 863/1671 (52%), Gaps = 120/1671 (7%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             D++ +FP ++ V K         L S+ FL+   L  V+   P+MFF+ L      L   
Sbjct  1014  DVISSFPKLLHVLKTHFPSNLPFLSSVLFLQHDYLAKVASYCPDMFFSSLRQIKGNL---  1070

Query  183   RTEEFGDIDSMEFA------------SAALSLFLKEASLCMLFPITLS--------IYKS  302
                   D+DS+               SA +S FL     C L P  LS        I K+
Sbjct  1071  ------DVDSVNIVEDKWGKHSTCSESAVISTFLNVTPFCALLPSVLSFAFSAPDEITKA  1124

Query  303   DLSTQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNI  482
                 Q  L +LL A +SE     +      VLFW +    SY V+  + L  L  +CF++
Sbjct  1125  HPLLQDELVHLLQAKISESPLSELTIFLRVVLFWSHHLLSSYTVKCSDILAQLCGVCFSL  1184

Query  483   VDRMLRQFLNTKGD-ASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDT  659
             +D +  +      D A+SK + +  P +C+  ++E++  HP++  SL C L    D  D 
Sbjct  1185  IDSIFERIRVLTADTANSKSSVAFYPVECLNGIVESVVQHPIIGLSLSCSLSNFQDLADG  1244

Query  660   FSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAF--  833
                   + F   +K + +H  D  V+NLL   + L+       +++     + +   F  
Sbjct  1245  SVEYVKEDFASFSKEK-LHLADSFVLNLLSNLYGLVLLAGSFGANYSNNDDQSLESLFGP  1303

Query  834   -KNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDL  1010
              K +++++ L FK++ + C+E ++    LP  Y   TL +F+ P  LLEL +WMFS    
Sbjct  1304  PKLLLERILLLFKEKFELCMEKRNFGLFLPNFYMFRTLAKFVSPVRLLELANWMFST--F  1361

Query  1011  EDNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEK  1190
             E  S             L+ A   F+ L   + Q   +R      WG+     DI  +++
Sbjct  1362  EGFSSSSPAYAPAAYCCLYTADIAFEMLYDYLQQI-DQRSGPCRLWGLEIHNCDIATIQQ  1420

Query  1191  ILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLV---MAISRFIVNIPVNLL  1361
             +   +   AT L+L+ AD+CLLK    +   ++    N   +   M +S  + N P+++L
Sbjct  1421  VYNIILHFATKLNLEFADLCLLKMLIRIHHTEISAVRNTDYIALHMMLSTMVANTPIDIL  1480

Query  1362  SYCMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPS---DP  1532
              +CMF  +K KA+ + L    +P+H+ +FG LL+ ++ K   +    +   SN S   + 
Sbjct  1481  HHCMFPTSKVKAKAIQLLLGANPMHMRLFGKLLTDILKKDTSVM-QVVGSDSNASWTHED  1539

Query  1533  ELLMLLPTVFLYLDSVLIKAGSQVKYFEKIVSFYWRILL--HIFSDWKCYVTRDMFDIES  1706
               ++LLP    Y++      G  V + E +  FY  ILL  + F  WK +VTR +F+ + 
Sbjct  1540  SFILLLPAALSYIEHHSGGNGLCVDFLEPVPVFYREILLSDNGFPCWKSFVTRSIFEEDF  1599

Query  1707  FDNLPLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDF  1886
              D    S+E+ M+ F   LL +S+ M++    L    +  + R+++  S+CPQ S   + 
Sbjct  1600  SDFRHTSVEDIMNYFGDTLLGKSITMLRYYFYLKE--IPRKQRLKIIASICPQSS---EL  1654

Query  1887  LDFDPSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTL  2066
             LD D S V   S    +   N   AKI+L R LL P     ++ +  +K          +
Sbjct  1655  LDSDISFVTPVSCNGIMKLTNELFAKISLIRMLLSPPRGSLNNEIAPEKES------KRV  1708

Query  2067  DVSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHG  2246
             + +++  + +LV +  KI   FP + D       E  +V   LE  IL+NIVELS E+  
Sbjct  1709  NNAKLSFISILVRTLDKIFRNFPHS-DGILLSSPEEQNVVSCLEYAILKNIVELSSEVQS  1767

Query  2247  CLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFE  2426
              L +L  +PF+ +L +++  HRF DP+ ++ +R I+  LSEGKF   +I++L++ HS F 
Sbjct  1768  HLNQLKPIPFLNQLIRSSLLHRFSDPVVIKAIRCILVVLSEGKFPADEILELILGHSHFV  1827

Query  2427  TAICSSNLS---TGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLEL  2597
             + I  S +S   +  +  G    P PS+++S        ++  +++  Q      K++E+
Sbjct  1828  STITCSGVSECPSACNPTGGLLQPAPSILKSV------DSAFAKENKFQDCIPERKKVEI  1881

Query  2598  IKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSIS  2777
             I+LLRVL+ +K+RQ +     E     R+L FLLLS Y ATL + D EI +L+NEI+S  
Sbjct  1882  IRLLRVLYDIKSRQHNSSLLDES----RELGFLLLSVYGATLSETDLEILHLMNEIES--  1935

Query  2778  DSNISIAEWDYLWGNAVVKARKERELVQTVS--CNLSDAEVAEDCRKIQFRENLPIDPKM  2951
                 +I + D+LWG A VK R+E +L  + S    + +AE++ D R+  FREN+PID K+
Sbjct  1936  SECKAITDVDHLWGKAAVKFREELKLEFSASDTHKMENAEIS-DRRRSLFRENIPIDSKL  1994

Query  2952  CASTVLYFPYGRPNGPGV--VNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLS  3125
             C  T L F Y R +   +  + ++Q+D F  + +  S  +    IYDP+FIL  S H L 
Sbjct  1995  CVMTALQFCYRRSSRASIFSLEQLQQDNFGDIFKATSQSMDAVRIYDPVFILHFSIHTLL  2054

Query  3126  MGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLL  3305
             MGYIEPVEF+ LGLLA++L SISSPD+D RKLGY  L  FK +LE  QK K+  +LQLLL
Sbjct  2055  MGYIEPVEFSRLGLLAITLVSISSPDEDLRKLGYESLGTFKKSLEASQKSKETWQLQLLL  2114

Query  3306  SYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQN  3485
             +YLQN I E WQ+IPSV AIF AEAS  LLD SH  +ATI+K LM S SVNL+       
Sbjct  2115  TYLQNGISEQWQRIPSVIAIFAAEASLTLLDSSHTQFATISKFLMHSASVNLQ-------  2167

Query  3486  LLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELII  3665
                               +LY+G N  DD  IY R  + E  LS+  S ++D+E+K L +
Sbjct  2168  ------------------LLYAGSNLADDAKIYKRGGVLELALSYGSSAVSDSETKLLTL  2209

Query  3666  QTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEII  3845
             Q +KK  KL  +A HL ++ GL+ WLSSV++S           +        LEVVN++ 
Sbjct  2210  QVLKKCVKLPVLAHHLTKDSGLLLWLSSVISSHVEGLDSVKNSYSSTVIGSALEVVNDLT  2269

Query  3846  FFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRK  4025
               R   EWLQ+ ALEQLS +S +L  +LVE  ++LK +      +L ++  T ++S KRK
Sbjct  2270  SSRLIAEWLQETALEQLSRISKYL-YVLVEDMKLLKGNVPLLTSVLNVIASTMRLSMKRK  2328

Query  4026  VYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIA-KTGLEAILMSTPPVAILQMDCKKVSKF  4202
             +YQPHF+LS+ G+  LC  I          +A + G++ ILM+ P   + +MD    +  
Sbjct  2329  IYQPHFSLSLHGIHKLCRTIGGISRSIEVKLAMQLGIDVILMNGPLPVLSEMDKSMTATV  2388

Query  4203  INWAMS--IALQSETKGVLQVEKCCFPLNVSSEEETENS-LISKLLRWLTASVILGKISY  4373
             ++WA S    L  E + VL++           EE  +N  L+SK+LRWL AS+ILGKIS 
Sbjct  2389  VSWATSNIFWLCDEQRSVLKMPH---------EEPLKNECLLSKMLRWLVASIILGKISC  2439

Query  4374  KLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKL  4553
                +     + D +   +L   L +  +   E     +  E LA  I YLQ+ L  +   
Sbjct  2440  ISHEKCGDLTRDANNFGSLESFLNYTYDEKVETVGSHSADEALAIIILYLQKHLKMNRDF  2499

Query  4554  LPSAVSALCLLLLKNPASSGSEVLIGNAAA---LCSKIRCPAEANSAWRWSFYQPWKDHS  4724
             LPS V+ALCLLLL           IG+      LCS+I+CPAEAN AWRW +YQPWKD +
Sbjct  2500  LPSVVAALCLLLLDRSNKQVIRNFIGDYGQIEMLCSQIQCPAEANPAWRWHYYQPWKDPA  2559

Query  4725  SNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWER  4877
              +  ++E +EE  ACQ LL++ S   +       ++SL DVEK G+F+WER
Sbjct  2560  MHRNEAEHLEEEQACQSLLVMFSNSFSAGLSGFPVLSLGDVEKSGLFQWER  2610



>gb|KGN44668.1| hypothetical protein Csa_7G368200 [Cucumis sativus]
Length=2037

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/1179 (40%), Positives = 696/1179 (59%), Gaps = 56/1179 (5%)
 Frame = +3

Query  201   DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERTPDHIVS  380
             + D +E +S   S FLK+    +LFP  +  + S+      + + LL  LSE T DH++ 
Sbjct  886   EFDKIEASSLGFSTFLKKTPFHVLFPAIMCTHHSNSLVLLKIQDFLLLKLSELTFDHLLL  945

Query  381   SFLYVL-FWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGD--ASSKCTRSL  551
              +L ++ FW  Q  ISYR +PL ELE LS++C  +V  +L + L T+    A      SL
Sbjct  946   PYLQLVLFWMYQIRISYRFKPLVELEKLSQICIVLVQNILAKLLATRTQSVAVGDYKGSL  1005

Query  552   LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESN---KWRVIHKM  722
             L  + VQ++ ETIF HP V +SL C L C  +       D++D  LES      + ++ +
Sbjct  1006  LRLE-VQDVAETIFSHPAVISSLSCSLNCPGNLV----FDAIDLNLESLVQLSRKSVNIL  1060

Query  723   DLHVINLLRTTFE-LLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRTDKCIESK  899
             D H++NLL T+ E L+  CD Q S+F     R V + F   +Q+L   F+DR D   E+ 
Sbjct  1061  DHHIVNLLTTSCEYLITSCDDQDSTF-----RGVVETFNVFIQRLLSEFRDRFDIFTETM  1115

Query  900   DLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSV--LRVGLHIA  1073
             D  PLLP  +A+H+L  FIFPF+LLELV W+  R++      Q+S    +  L  G  IA
Sbjct  1116  DPIPLLPLFFALHSLNHFIFPFDLLELVIWILKRVNTNGFVVQKSEMTQIHGLSFGFGIA  1175

Query  1074  GSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIV-LLEKILLQVYEIATHLHLDVADMC  1250
                F  ++  +  P S+R    L   M E+  D+  ++++I  +    A H   + AD C
Sbjct  1176  VIAFKDVTGYLQLPLSKRLPYHLLRKMDEK--DVCNIIDEIYTKTNVFAVHYKSEFADAC  1233

Query  1251  LLKAFKVVKTHKVMQ-QSNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMS  1427
             LL+  K +   K M  +    + +A  R I+N+P  L+SYC  + NK KA+LLF  TE S
Sbjct  1234  LLEVVKAICAKKSMLCEYFDQIHLATFRSIMNMPSELISYCFDRTNKEKAKLLFFLTEAS  1293

Query  1428  PLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQVK  1607
              LHLSIFGH +  ++D+         R   N  + +LL+LLP+   YL+SV+ K G +  
Sbjct  1294  SLHLSIFGHSIVDIMDRHS-------RHMDNEMEDKLLILLPSSLTYLNSVVAKFGKKCC  1346

Query  1608  YFEKIVS-FYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLM  1784
             Y  K++S  Y RIL   F  WK +VT   FD E  D +P +  +F+D+ + +LL ++V M
Sbjct  1347  YNSKVISSAYSRIL---FRKWKIFVTNSTFDEEFGDLIPSTTRDFIDLVNNSLLGKAVGM  1403

Query  1785  VQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAK  1964
             ++ C AL G LV  + R+++F+ + P   +  + L F+  ++ + S  Q  NF+++ V+K
Sbjct  1404  LRHCFALNGDLVTVKMRLKVFNYIFPASCSTDEVLGFEVDELDSYSPNQVFNFLSKVVSK  1463

Query  1965  INLCRTLLFPEHNKFSS--GLKEDKMETCAELHSTLDVSRIRLLKMLVSSWRKIVEKFPM  2138
             I+ CR LLFPE     S  G  E   ++ A   +  + SR++ L  LV  W+ IV++F  
Sbjct  1464  ISFCRVLLFPEGCGIQSFSGEDESTEQSSARRSNNEESSRLQYLNTLVGIWQWIVKRFAF  1523

Query  2139  TADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFD  2318
              +D   + E+    +FR+LE+ +L NI+ELS EMHG LVK  S+PF+ +L + +  +RF+
Sbjct  1524  ISD-IYEKEMGKSRLFRYLELFLLNNILELSTEMHGALVKQPSIPFLEQLMRFSLLYRFE  1582

Query  2319  DPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPS  2498
             DP T+  L  I+  LS+GKF+    +QL++AHSQF   I S+   +    +     P+ S
Sbjct  1583  DPTTVNILYSILDLLSDGKFAVDAYLQLLLAHSQFAPTIQSTPKPS--HSIETFLRPMSS  1640

Query  2499  LMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINL  2678
             ++RS VIP  +      K + + ++  LK+L ++KL+ +L  +K         ++  IN 
Sbjct  1641  ILRSLVIPSSSQRETNFKQDSKATQTDLKRLVIVKLVHILVLMKVCHGGY--GKDDTINF  1698

Query  2679  RDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNI-SIAEWDYLWGNAVVKARKEREL  2855
             R+L  LLLSSY AT+ + D  I   +N+I++I  S+  +  + D+LWGNAV+   KER L
Sbjct  1699  RELYALLLSSYGATVSETDSTILMTLNDIETIIGSDAKNQVQMDFLWGNAVLGVSKERLL  1758

Query  2856  VQTVSCNLS-DAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQK---  3023
              Q  S N+S DAE  ++  + QFRENLP+DP++C STVL+FPY R       ++++K   
Sbjct  1759  EQEPSSNISNDAEAVKERHRNQFRENLPVDPRICVSTVLWFPYDRTESDEE-SRLKKYRV  1817

Query  3024  ----DTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASI  3191
                 D F   +     E      YDPI++LR S H LSMGYIE +EFA LGLLAV+  S+
Sbjct  1818  KDLDDLFKGHYHGTEPER-----YDPIYVLRFSIHALSMGYIEALEFATLGLLAVAFVSL  1872

Query  3192  SSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFI  3371
             SS +D  RKLGYG L   KN +E  +++K   RL+LLL+Y+QN IEE WQ+IPS+ A+F 
Sbjct  1873  SSANDKLRKLGYGTLGALKNTVENGKRRKGTTRLRLLLTYVQNGIEEPWQRIPSIIALFA  1932

Query  3372  AEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYS  3551
             AEASF+LL+PSH HYA I+K L++S  +N KSIPLF+N LWS SV+F++ERLW+LR++Y 
Sbjct  1933  AEASFILLEPSHHHYAAISKFLVRSTRLNSKSIPLFKNFLWSSSVNFKSERLWMLRLVYV  1992

Query  3552  GLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQ  3668
             G+N DDD  +YI+NSI E L SFYVS L+DNESKELI+Q
Sbjct  1993  GINVDDDARLYIKNSIHEDLQSFYVSSLSDNESKELILQ  2031



>ref|XP_002448559.1| hypothetical protein SORBIDRAFT_06g029102 [Sorghum bicolor]
 gb|EES12887.1| hypothetical protein SORBIDRAFT_06g029102 [Sorghum bicolor]
Length=2570

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/1662 (33%), Positives = 870/1662 (52%), Gaps = 106/1662 (6%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTG---LESAISGL  173
             D++  FP ++ V K       + L S+ FL+   L  V+  WP++FF+    L+  I+  
Sbjct  973   DVISAFPDLLDVVKTRFPSHVAFLSSVLFLQHDYLAQVASCWPDIFFSSIRLLKDDINVD  1032

Query  174   QEGRTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKS-----DLSTQQGLHNLL  338
                  E+     S+   SA LS FL  +  C L P  L +  S       + +  L  LL
Sbjct  1033  HVSTVEDEWQNLSVSTESAPLSTFLSVSPFCALLPSVLGLAFSLPDEIREADKDALLRLL  1092

Query  339   LANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlse--lCFNIVDRMLRQFLN  512
                LS+ T   +      +LFW +    SY ++      +     LCF ++DR+  +   
Sbjct  1093  EVKLSDCTFSELTLYLRVILFWTHHLLSSYTIKDSNSNNLEQSCHLCFGLLDRVFERIQV  1152

Query  513   TKGDAS-SKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFL  689
                D S SK      P +C+Q++++++  HPV+  SL C L    +  D  S + +++ L
Sbjct  1153  LTADLSQSKSAYPSYPVQCIQDIVDSVLRHPVITLSLSCSLSNCQNLADG-SLEHLEEAL  1211

Query  690   ESNKWRVIHKMDLHVINLLRTTFE---LLYFCDGQTSSFEACHARQVTKAFKNVVQKLFL  860
                    +H +D  V+NLL   ++   +     G  +  +  H   +  A   +++ + L
Sbjct  1212  AIFAKENLHLIDCFVLNLLGKLYDLLLIFGSYGGNYTDNDPSH-ESLFAAPNLLLENIIL  1270

Query  861   TFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLR  1040
              FKD+ + C++  +   LLP  Y +  L +F  P +LL L +WMFS++D   +S    + 
Sbjct  1271  LFKDKFELCMDKVNFGLLLPNFYMVRALSKFFSPVKLLNLANWMFSKLDGHSSSSPAFV-  1329

Query  1041  DSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIAT  1220
               V+ + L+I     + L  C  Q   +R  S LF  +     DI  +++    +   AT
Sbjct  1330  -PVVLMCLYITDVAMEML-CCYLQKTGQRSESHLFGDLEIHNSDINAMQQAYHIILHFAT  1387

Query  1221  HLHLDVADMCLLKAF-KVVKTHKVMQQSNPTLV--MAISRFIVNIPVNLLSYCMFQINKR  1391
               +++ AD CLLK   ++  T +    +   +   M +S   +N P++ L +C+F+ +K 
Sbjct  1388  KWNIEFADHCLLKMLCRIHHTERYAGWNTDYIAFHMILSTMAINTPIDTLHHCIFRTSKV  1447

Query  1392  KAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSN--PSDPELLMLLPTVFL  1565
             KA+ + L  E SP+HL+ F  +   +++K   L      +++N        ++LLP    
Sbjct  1448  KAKAILLLLEASPMHLNFFSQIFLEILNKDTSLLQVKDSDSNNLWAQADGAILLLPAALS  1507

Query  1566  YLDSVLIKAGSQVKYFEKIVSFYWRILL--HIFSDWKCYVTRDMFDIESFDNLPLSIEEF  1739
              L       G   ++ E +  FY  +LL    FS WK +VTR +F+ +  D  P S+E+ 
Sbjct  1508  CLKFHSDDDGQCAEFLEPVPIFYSELLLCDKGFSSWKSFVTRSIFEEDFRDFTPTSVEDI  1567

Query  1740  MDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTC  1919
             M  FS  LL +SV M+    A     + ++ R+E+  S+ P+ S   + LD D + +   
Sbjct  1568  MVYFSSTLLGKSVTMLHYYFA--SKEISWKRRLEIVSSIIPESS---ELLDSDVNDINPT  1622

Query  1920  SLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHST-LDVSRIRLLKM  2096
             S    + F N   AK++L R LL P         K    E  +E  S  +  +++  + +
Sbjct  1623  SCNGIMKFTNELFAKVSLIRLLLSPR--------KSLSNEVASERESKRVHKAKLNFISI  1674

Query  2097  LVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPF  2276
             LV +  +I+  FP++ DN      +   V  FLE +IL+NI+ELS E+   L +L S+PF
Sbjct  1675  LVRTIDRILMNFPLS-DNIFSHSTKERKVIGFLEYVILKNIIELSSEIQSYLNQLKSIPF  1733

Query  2277  IVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLS-  2453
             + +  +++  HRF+DP+T++ +R I+  LS G+FS  +I++L++ HS F + I  + +S 
Sbjct  1734  LAQFIRSSLLHRFNDPVTIKAIRCILVVLSHGRFSADEILELILGHSNFVSTITCNEVSE  1793

Query  2454  --TGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQV  2627
               +  +  G    P PS+++         +S   ++  ++S    +++E I+LLRVL+ +
Sbjct  1794  YPSACNTTGGMLQPAPSILK------LVDSSFMEENKAEISIAEKRRVETIRLLRVLYDI  1847

Query  2628  KARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD  2807
             K+RQ +     E     R+LVFLLLS Y ATL + D EI +L+NEI+S      +I E D
Sbjct  1848  KSRQQNNSQLSES----RELVFLLLSVYGATLSETDLEILHLMNEIES--PECRTITEVD  1901

Query  2808  YLWGNAVVKARKEREL--VQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPY  2981
             +LWG + +K R+E +L   ++ + +  +AE+ E  R+  FREN+P+D K+CA T L + Y
Sbjct  1902  HLWGTSALKFREELKLDFSKSDTHSTENAEITER-RRTLFRENIPVDSKLCAKTSLLYCY  1960

Query  2982  GRPNGPGV--VNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFA  3155
              R +   V  + ++Q+D F    E  S  +    IYDPIFILR S H L MGYIEP EFA
Sbjct  1961  KRSSRASVFSLEQLQRDNFADSFEVTSQRMDIVQIYDPIFILRFSIHTLHMGYIEPAEFA  2020

Query  3156  NLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEED  3335
              LGLLA++L SI+SPD + R LGY  L  FKN+LE  Q+ K+  +LQLLL+YLQN I E 
Sbjct  2021  RLGLLAITLVSIASPDHELRMLGYECLGTFKNSLEYAQRSKETWQLQLLLTYLQNGISEQ  2080

Query  3336  WQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFR  3515
             WQKIPS+ A+F AEAS  LLD SH  +  I   LM S SV+L+                 
Sbjct  2081  WQKIPSIIAVFAAEASLTLLDGSHAQFTVIRNFLMHSTSVSLQ-----------------  2123

Query  3516  TERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLS  3695
                     +L +G N  DD  IY R  + E +L+F  S ++D ESK L+++ +KK  KL 
Sbjct  2124  --------LLSAGSNLPDDAKIYKRGRVLELVLAFCSSSVSDFESKVLVLKVLKKCVKLP  2175

Query  3696  RMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQ  3875
              +A HL++  G++ WL SV++                   + LEV+N +I  R   +WLQ
Sbjct  2176  VLAHHLVKESGILLWLLSVISVRSEGSVGSESSCSRVT-ELALEVINGLISSRIITDWLQ  2234

Query  3876  KYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSV  4055
             + ALEQLS +S +L  +L+  A++LK ++     +L ++  T ++S KRK+YQPHFTLS+
Sbjct  2235  ETALEQLSSISSYLSVLLINNAKLLKGNARLLTSVLSVIASTMRLSMKRKIYQPHFTLSL  2294

Query  4056  EGLFHLCEAIDVCCNGCYSPIA-KTGLEAILMSTPPVAILQMDCKKVSKFINWAMS--IA  4226
              G+F+LC+AI          +A + G++AILM+ P   + +MD  ++S  ++WA S    
Sbjct  2295  HGVFNLCQAIGGSSRSTEHKLAMELGIDAILMNGPIPILSEMDKSRISMVVSWATSSIFW  2354

Query  4227  LQSETKGVLQVEKCCFPLNVSSEEETEN-SLISKLLRWLTASVILGKISYKLSKLDSSHS  4403
             L S  + +L+         +S +E   N SL+SK+LR L ASVILGKIS          +
Sbjct  2355  LYSNQRSLLE---------ISCKEPPRNESLLSKILRLLAASVILGKISSISHGKSVDLT  2405

Query  4404  CDRSKLINLHCLLEWNEESDR-ENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALC  4580
              + S L +L   L   +  +R E     +  + LA  I YLQ  +  +   LPS V+ALC
Sbjct  2406  RNTSSLESLRSFL--GDACERVETATSCSANDTLAVIILYLQDHVAKNSDSLPSVVTALC  2463

Query  4581  LLLLKNPASSGSEVLIGNAAA---LCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKI  4751
             LLLL   +   ++ L  N      LCSKIRCP E+N AWRW +YQPWKD + + T+ E++
Sbjct  2464  LLLLDRSSKQVNKHLADNRGKIEMLCSKIRCPTESNPAWRWHYYQPWKDSALHRTEMERL  2523

Query  4752  EEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWER  4877
             EE  AC+ LL++ S   +       ++SL DVEK GVF+WER
Sbjct  2524  EEEQACRSLLVLFSNAFSACLSEFPVLSLDDVEKSGVFQWER  2565



>gb|AAG51799.1|AC067754_15 hypothetical protein; 75067-63678 [Arabidopsis thaliana]
Length=2777

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/1666 (34%), Positives = 870/1666 (52%), Gaps = 187/1666 (11%)
 Frame = +3

Query  6     LLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS-GLQEG  182
             +L+NF  +++VS  + G  FS L+SI FLE + L ++SK  P++F  GLE  +S  L+EG
Sbjct  1200  ILKNFASVMAVSWDLYGTSFSFLLSIIFLEKNFLGNLSKLSPDLFMRGLELTVSRNLREG  1259

Query  183   RTE---EFGD-----------IDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQ  320
               +   +F D           +D  +  S A S+FL++    +L    +S+  S L    
Sbjct  1260  TVDSEIDFADHSSTTEKIKSKMDIPDIESLAFSVFLEQTPFPVLLNEIMSMDISCLPEFP  1319

Query  321   GLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLR  500
              L  LLL  +S+   D I S    +LFW  Q    Y+V+P   L   SE+C  ++  +  
Sbjct  1320  RLTELLLLKVSQPKSDSIESDIRLILFWLFQIRSLYKVQPHPVLCQQSEICLRLMRHLFS  1379

Query  501   QFLNTKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNA----DFTDTFSG  668
             Q   +K D  S  +      K   ++ +T+  HPVV A LE P  C+        + FS 
Sbjct  1380  QI--SKLDLVSGPSAD----KLKHQVPQTVLSHPVVMALLESPADCDTLPRVQNVEVFS-  1432

Query  669   DSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQ  848
                +  L + +   I ++D H+++LL +T E   F +          A +   AFK +V+
Sbjct  1433  ---ETLLTAGRLG-ISEIDQHILDLLASTCENFLFEESHIERKGDLRADKSIMAFKVLVE  1488

Query  849   KLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQ  1028
             +L L F+D+ + C+ S+   PLL     I  L +FI PF+LL L H M S+      +++
Sbjct  1489  RLLLVFRDKFELCVGSQSYAPLLQHPQLIQALLKFISPFKLLYLAHSMLSK------TYE  1542

Query  1029  QSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVY  1208
             + L   +L  GL IAG  F+ L     QP ++R + D  W + ++ +D  ++E++     
Sbjct  1543  EELASPILSFGLDIAGGAFEMLILYSRQPAAKRRVYDFLWELEDKNYDSRIIEQVYSLAC  1602

Query  1209  EIATHLHLDVADMCLLKAFK-VVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMFQIN  1385
               +T   L  AD CLLK    + +       S   L + +S+ +     +L+ +C+ Q +
Sbjct  1603  RFSTSFGLASADTCLLKVVSGIFRGGNSQHCSVHQLTVIMSQIVGRTSKDLIIHCINQAS  1662

Query  1386  KRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFL  1565
               +A++LF   E SPLHLS+FGH+   M+ K   LQ ++   T    D + +MLLP V L
Sbjct  1663  MSRAKILFYLVESSPLHLSVFGHIFFSMLSK---LQGDSALIT----DDQFVMLLPPVLL  1715

Query  1566  YLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMD  1745
             +L SV  K          I S Y  IL+  F  W  + +  +F+ E ++ + LS  E ++
Sbjct  1716  FLASVFAKLEKSCSKCLDITSLYSNILIKGFLQWPKFCSGCIFE-EKYEEILLSTSEDIE  1774

Query  1746  -IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCS  1922
              +F+ +LL ++V M Q   ALT    K +  +++F S+ P  S   + LD++  +V   S
Sbjct  1775  TMFNASLLGKAVRMFQYHFALTESPTKTDDLLKVFYSMFPHTSAGKEMLDYEIKEVDVKS  1834

Query  1923  LEQSLNFVNRTVAKINLCRTLLFPE-----HNKFSSG--LKEDKMETCAELHSTLDVSRI  2081
             ++Q  N  NR VAK+ L R  LFPE     H K  +G  +KE   E  +   S L+    
Sbjct  1835  VDQMFNITNRLVAKVELSRICLFPEDSCMHHLKRQAGGCVKESSPEMGSNRESLLN----  1890

Query  2082  RLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVF--RFLEVLILRNIVELSKEMHGCLV  2255
              LL   V++W+ +VE+       + + E ++   F  + LE  ILR+I++  + M   L 
Sbjct  1891  PLLNAFVNTWQCVVERSDGYYKGNSEREEQDKYWFLCKSLEYFILRSILKFLEGMCEELA  1950

Query  2256  KLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAI  2435
              LDSLPF+ +L      +RF D  TL+ LR+I S LS GK+S     Q +V+HSQF  +I
Sbjct  1951  HLDSLPFLERLMNLILRYRFKDSKTLKILREIFSFLSRGKYSYH--FQDLVSHSQFTESI  2008

Query  2436  CSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDN--LQMSKQHLKQLELIKLL  2609
              S ++S+  S  G    P+ S+++  +IP  N NS+ R +N  L+  + +L Q+E++K+L
Sbjct  2009  SSLSISS--SHTGEVIRPVSSILKLLIIP--NLNSV-RVENCSLEAPEYYLSQIEILKIL  2063

Query  2610  RVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNI  2789
              VL          +  ++ GI L+DL F LL SY AT  +ID + + L+++IK I   + 
Sbjct  2064  GVLL--------CKCGKDSGIFLKDLHFRLLCSYGATPSEIDLQSYKLMHDIKLIVGEHT  2115

Query  2790  SIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVL  2969
                  DYLWGNA +K R      + +  + S +++ ED R+  F+ENL +DPK CA TVL
Sbjct  2116  LNDSEDYLWGNAALKIR------EGLPSDGSYSDIVEDLRQSLFKENLCLDPKRCAQTVL  2169

Query  2970  YFPYGRPNGPGVVNKVQKDTF---DSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIE  3140
             YFPYGR        +   +T+   D + E CS  +     YDP+FILR+S   LSM YIE
Sbjct  2170  YFPYGR------TAEASDNTYIYDDPISEKCSPAIER---YDPVFILRVSVQLLSMVYIE  2220

Query  3141  PVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQN  3320
             PVEFA+LGLLAV+ AS+SS D   RKLGY  L  F + LE                    
Sbjct  2221  PVEFASLGLLAVAFASMSSADLGIRKLGYETLGIFVDVLE--------------------  2260

Query  3321  CIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSD  3500
                     IP    +F            HD + + T        VN +S       LW  
Sbjct  2261  -------GIP----LF------------HDFFGSST--------VNFRS-----QRLW--  2282

Query  3501  SVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKK  3680
                       +LR+++ GL +++D  IYIRNSI ET++ F+ SPLAD+E+K LI+Q V+K
Sbjct  2283  ----------VLRLVFVGLESEEDAQIYIRNSILETVMGFFSSPLADDETKGLILQVVRK  2332

Query  3681  SAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHT  3860
             S KL +MARHL+ENCGL+SW S    SF  +      G   ++F VVLEV+ + +  R+ 
Sbjct  2333  SVKLHKMARHLVENCGLLSWCS----SFFSMLTTKPTGDEDSRFVVVLEVITDALASRND  2388

Query  3861  VEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPH  4040
              EW Q+ ALE L E+S  L  +L +G   ++E+ T       IL+ T K+S KRK  QPH
Sbjct  2389  TEWSQRSALEGLMEISSRLYTLLGDGLVSMQENGT------SILSATLKISHKRKKNQPH  2442

Query  4041  FTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMS  4220
             FT+++EG+F L EA   C +      A+  L+ ILMSTPPV I+ MD  ++ +F+ W  S
Sbjct  2443  FTITIEGIFQLFEAAANCDSPQVEASAEGRLDTILMSTPPVEIICMDVHRLRRFLLWGSS  2502

Query  4221  IALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSH  4400
              AL+S+ K   +  +C    +  ++  TE ++++K LRWL ASVILGK+ Y  +      
Sbjct  2503  TALKSDLKKGSKPGEC----HQDTKTHTEETMVAKFLRWLLASVILGKL-YSEANDSDQI  2557

Query  4401  SCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQ-LLGTSFK-LLPSAVSA  4574
                 +K   L  LLE+ ++ + + G     + I+   I YLQ+ LL  ++  LLPS V A
Sbjct  2558  VLSETKPETLPTLLEYLKKRNLQ-GSVTNSEHIIGEVIVYLQKHLLCRNYGVLLPSVVFA  2616

Query  4575  LCLLLLKNP-ASSGSEVLIGNAA--ALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSE  4745
             L L++L+N   ++G+E   G     +LCS+I  P EA   WRWS++Q     S   TD +
Sbjct  2617  LSLMVLRNGLETTGTESEGGYKVIRSLCSRISSPTEAIPVWRWSYHQDLP--SERATDPK  2674

Query  4746  KIEEIHACQMLLLVASKMLARNSLYSK--LISLKDVEKLGVFEWER  4877
             +I+E++ACQ LLL+ S ML      S+  L+  +  +   VFEWER
Sbjct  2675  EIDELYACQELLLIFSDMLRETPRESQQTLLLGESFDMSSVFEWER  2720



>emb|CBI26624.3| unnamed protein product [Vitis vinifera]
Length=2565

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/954 (45%), Positives = 600/954 (63%), Gaps = 27/954 (3%)
 Frame = +3

Query  471   CFNIVDRMLRQFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNAD  647
             CF +V+RML + L  + D  S C+ ++ +P   VQE+ E IF HP V  SL CPL C+ +
Sbjct  987   CFILVERMLDELLVLRPD--SDCSTTIGVPFSTVQEVAEIIFCHPAVMVSLSCPLSCHEE  1044

Query  648   FTDTFSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFE-LLYFCDGQT--SSFEACHARQ  818
              T    GDS++ FL S+K  V HKMD HV+NLL +T + L+  CDGQ   S  +    +Q
Sbjct  1045  LTKGTIGDSLETFLRSSKHSV-HKMDHHVLNLLISTSDYLVALCDGQNPISKVDDSAKKQ  1103

Query  819   VTKAFKNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFS  998
             + K FK ++Q+L L  + R D CI +K+  P L A YA H L  FI PF+L EL +WMFS
Sbjct  1104  LVKVFKALLQRLLLELRSRFDVCIRTKNFVPFLQAFYASHILSHFISPFKLFELAYWMFS  1163

Query  999   RIDLEDNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIV  1178
             R+DL D +  +    S L V   IA   FD LS+    P +++   DLFW M E+ FDI+
Sbjct  1164  RVDLNDLTTGEFDNMSALSVVFCIASGAFDMLSSYFQHPITKKVQFDLFWEMEEKSFDII  1223

Query  1179  LLEKILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAI--SRFIVNIPV  1352
             + EKI ++  E AT   L+ AD+CLLKA KV+   K  Q  +  L +++  SR IV+ PV
Sbjct  1224  VFEKIYMKALEFATCFKLEFADVCLLKAVKVMYRQKFEQHQSFLLPLSLVSSRVIVSTPV  1283

Query  1353  NLLSYCMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDP  1532
              ++S+C+ + +  +A+LLFL  E+SPLH S+FGHL SG+++K +  + N +     PSD 
Sbjct  1284  KMISHCINRPSMIRAKLLFLLIEVSPLHSSVFGHLFSGLLNKGLPHKDNVVE---TPSDE  1340

Query  1533  ELLMLLPTVFLYLDSVLIKAGSQVKY-FEKIVSFYWRILLHIFSDWKCYVTRDMFDIESF  1709
               +MLLP    YL S  +K G Q    F+ I S Y RILL  F DWK +V+R +F IE  
Sbjct  1341  GFMMLLPAALSYLKSTSLKFGKQYYTCFKGIPSLYSRILLDGFLDWKGFVSRSIFQIEDG  1400

Query  1710  DNLPLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFL  1889
             + LP S E+  ++ + +LL +S+ M+    A +G+ +K + R +LFD + P  S     L
Sbjct  1401  EFLPSSTEDLSNLVNSSLLGKSIHMLWFYFAFSGHSMKKKKRFKLFDVIFPC-SGQDGML  1459

Query  1890  DFDPSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKM---ETCAELH-  2057
             D D S++ + SL QSLNFVNR VAKI+LCR LLFP   +  S  KE      +T  E+  
Sbjct  1460  DCDVSEIDSYSLNQSLNFVNRVVAKISLCRMLLFPGDCQVKSLSKESDGPVEDTPLEMGL  1519

Query  2058  STLDVSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSK  2234
             +  D SRIRL+ +LV++W+KIVE+F   +DNS ++   +C  +F+FLEV ILRN++EL++
Sbjct  1520  NREDSSRIRLINILVNTWQKIVERFSCVSDNSGKVTDTDCLPLFKFLEVFILRNVLELAR  1579

Query  2235  EMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAH  2414
             EMH  L++L SLPF+ KL + +  HRF+D  TL+ LR +++SLSEGKFS V ++QL++AH
Sbjct  1580  EMHNSLIQLHSLPFLEKLTRLSLLHRFEDATTLKMLRSVLTSLSEGKFSHVLLLQLLLAH  1639

Query  2415  SQFETAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLE  2594
             SQF   I S + S G SQ+G+   P+ S++RS      +  +I   +N + S   +KQLE
Sbjct  1640  SQFAPTIQSVSKSPGCSQVGVFSKPMSSILRSLTFTCTDQGTIDGNNNFERSDLCVKQLE  1699

Query  2595  LIKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSI  2774
             +IKLLR+L   K      +  + I IN R+L+ LLLSSY A L ++D EI++L++EI+S 
Sbjct  1700  VIKLLRLLLCFKGHWDGSDLEKNIDINARELISLLLSSYGAMLNEVDLEIYSLMHEIESN  1759

Query  2775  SD-SNISIAEWDYLWGNAVVKARKER-ELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPK  2948
                 + SIA+ DYLWG++ ++ RKER + ++  + N+ DAE  E+ ++ QFRENLPIDPK
Sbjct  1760  DRLKSGSIADMDYLWGSSALRIRKERVQELEISANNILDAEAVEERQRSQFRENLPIDPK  1819

Query  2949  MCASTVLYFPYGR--PNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCL  3122
             +C +TVLYFPY R   +GP  +NKV  D    M +     V N   YDP+FIL  S H L
Sbjct  1820  LCVNTVLYFPYNRTASDGPISLNKVHPDNVKDMIQGYPPHVENVPRYDPVFILHFSIHSL  1879

Query  3123  SMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALE----KCQK  3272
             SM YIEPVEF+ LGLLAV+  S+SSPDD  RKLGY  L +FKNALE    +CQ+
Sbjct  1880  SMRYIEPVEFSALGLLAVAFVSLSSPDDMIRKLGYETLGRFKNALESLTYRCQE  1933


 Score =   600 bits (1547),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 306/548 (56%), Positives = 406/548 (74%), Gaps = 8/548 (1%)
 Frame = +3

Query  3264  CQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQ  3443
             CQK+KDVM+L+LLL+Y+QN IEE WQ+IPSVTAIF AEASF+LLDPSH+HY+TI+K LM+
Sbjct  2007  CQKRKDVMQLRLLLTYMQNGIEEPWQRIPSVTAIFAAEASFILLDPSHEHYSTISKLLMR  2066

Query  3444  SPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFY  3623
             S  VN+K IPLF N +WS S++F++ERLWILR+ Y+GLN +DD  IYIRNSI ET+LSFY
Sbjct  2067  STGVNMKCIPLFNNFIWSSSINFKSERLWILRLSYAGLNLEDDAQIYIRNSILETILSFY  2126

Query  3624  VSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPF  3803
              SP +DNESKELI+Q VKKS KL +MAR+L+E+CGLISWLSS ++ F        + F  
Sbjct  2127  ASPFSDNESKELILQIVKKSVKLHKMARYLVEHCGLISWLSSALSFFSERLSGDQRSFWL  2186

Query  3804  AQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLIL  3983
              Q  +V EV+N +I  R+ + WLQK ALEQLSE++ HL ++L+   Q++K++ T    IL
Sbjct  2187  KQLTIVTEVINNVISSRNIIGWLQKDALEQLSEVALHLYKLLIGAVQLMKDNVTLVNSIL  2246

Query  3984  QILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEA-IDVCCNGCYSPIAKTGLEAILMSTPP  4160
             QIL  T K SQKRK+YQP FT+S+EGLF + +A +DV      SP ++ GL+ ILMS+PP
Sbjct  2247  QILISTLKFSQKRKIYQPRFTISIEGLFKIYQAVVDVSSVPRSSPASEFGLKVILMSSPP  2306

Query  4161  VAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEE-TENSLISKLLRW  4337
             + I QM  +++ +F+ W +S ALQ E  G LQ+ +      V SEEE +++SL+SKLLRW
Sbjct  2307  LNIFQMKQEELQEFVGWTISTALQPECTGTLQLAESYLHFRVFSEEEPSQDSLLSKLLRW  2366

Query  4338  LTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKE-FACQEILAASI  4514
             LTASVILG +S+K + LD  +  +RS    L  LLE  ++   ENG+  F C+EILAASI
Sbjct  2367  LTASVILGMLSWKSTDLD-INILERSNSKTLLSLLEHVKKGSGENGRNAFHCEEILAASI  2425

Query  4515  FYLQQLLGTSFKLLPSAVSALCLLLLKNPA-SSGSEVLIG---NAAALCSKIRCPAEANS  4682
             FYLQQLLG + ++LPS VSALCLLLL + + S+GSE ++G   + A+LCS+I CP EAN 
Sbjct  2426  FYLQQLLGLNSRVLPSVVSALCLLLLSDASNSAGSEFMLGHESHVASLCSRIHCPVEANP  2485

Query  4683  AWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGV  4862
             AWRWSFYQPWKD +S  TD +K++E+HACQ LL+V S  L + SL +  +S +DVE  GV
Sbjct  2486  AWRWSFYQPWKDLTSEPTDLQKMDELHACQSLLVVISNFLGKKSLDAPFLSHQDVENSGV  2545

Query  4863  FEWERSIL  4886
             ++WERSI+
Sbjct  2546  YKWERSII  2553


 Score = 62.4 bits (150),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  3    DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLE  155
            D+L+NFP +++VS+ + GVPF+LL SI F + SLL   SK WP++FF+GL+
Sbjct  900  DILKNFPSVITVSQDLQGVPFALLSSISFHDRSLLARASKLWPDIFFSGLQ  950



>ref|XP_009767852.1| PREDICTED: uncharacterized protein LOC104218932 isoform X5 [Nicotiana 
sylvestris]
Length=537

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/538 (61%), Positives = 418/538 (78%), Gaps = 6/538 (1%)
 Frame = +3

Query  3285  MRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLK  3464
             MRL+LL+SYLQN IE+ WQ+I S+TA+F+AEASFVLLDPSHDHY+ I+ +LM+SPS N+K
Sbjct  1     MRLRLLMSYLQNGIEKPWQRISSITAVFVAEASFVLLDPSHDHYSAISAYLMRSPSANMK  60

Query  3465  SIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADN  3644
              IPLFQN  WS S +F  ERLWILR+LYSGLN +DD  IYIRN+IFETLLSFYVSP++ +
Sbjct  61    GIPLFQNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIRNAIFETLLSFYVSPISSH  120

Query  3645  ESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVL  3824
             ESKELI+Q VKKS  + +MAR+L+E CGLISW S VV+S   + +   +   F +  V+L
Sbjct  121   ESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVVSS---LSWSPCRSDSFVELTVIL  177

Query  3825  EVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTW  4004
             E +NE+I  RHT+EW+QKYALEQL ELSC+L ++LVE  ++ K  +   KLILQI+T  +
Sbjct  178   EALNEVILSRHTIEWMQKYALEQLVELSCNLYKMLVERVEIFKGKTQLVKLILQIVTSAF  237

Query  4005  KVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDC  4184
             K+SQKRKVYQPHFT+S+E L  LCE +D CC+G  SP+A+ GLEA+LMSTPPV ILQMD 
Sbjct  238   KISQKRKVYQPHFTISIESLLQLCEVVDECCDGRQSPVAQIGLEAVLMSTPPVNILQMDK  297

Query  4185  KKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGK  4364
             +KVSKF+ WA  IALQ + + +  +E     + + +EEET++SLIS L+RWL ASVI+GK
Sbjct  298   EKVSKFVRWATLIALQPKIENIHGLENFACIVRLQAEEETDDSLISMLVRWLAASVIVGK  357

Query  4365  ISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTS  4544
             +S + S  D  HS DRSKL NL  L+EWNE+   E  + FAC+  LA+SIF+LQQL  T+
Sbjct  358   LSPRFSNSDLCHSFDRSKLNNLLSLMEWNEQRCEETNRAFACEGTLASSIFFLQQLQCTN  417

Query  4545  FKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIRCPAEANSAWRWSFYQPWK  4715
             + +LPS VSALCLLLL + +S+ S++L G+A   A LCSKI CPAEAN AWRWSFYQPWK
Sbjct  418   YIVLPSVVSALCLLLLSSLSSAESDILAGDAVQWATLCSKINCPAEANPAWRWSFYQPWK  477

Query  4716  DHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSILN  4889
             DHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +D+EKL VF+WERSILN
Sbjct  478   DHSSELTDAEKLEENQACEMLLVVISKLLERNSLYSQFFSFQDLEKLCVFDWERSILN  535



>ref|XP_009767848.1| PREDICTED: uncharacterized protein LOC104218932 isoform X2 [Nicotiana 
sylvestris]
Length=551

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/545 (60%), Positives = 418/545 (77%), Gaps = 6/545 (1%)
 Frame = +3

Query  3285  MRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLK  3464
             MRL+LL+SYLQN IE+ WQ+I S+TA+F+AEASFVLLDPSHDHY+ I+ +LM+SPS N+K
Sbjct  1     MRLRLLMSYLQNGIEKPWQRISSITAVFVAEASFVLLDPSHDHYSAISAYLMRSPSANMK  60

Query  3465  SIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADN  3644
              IPLFQN  WS S +F  ERLWILR+LYSGLN +DD  IYIRN+IFETLLSFYVSP++ +
Sbjct  61    GIPLFQNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIRNAIFETLLSFYVSPISSH  120

Query  3645  ESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVL  3824
             ESKELI+Q VKKS  + +MAR+L+E CGLISW S VV+S   + +   +   F +  V+L
Sbjct  121   ESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVVSS---LSWSPCRSDSFVELTVIL  177

Query  3825  EVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTW  4004
             E +NE+I  RHT+EW+QKYALEQL ELSC+L ++LVE  ++ K  +   KLILQI+T  +
Sbjct  178   EALNEVILSRHTIEWMQKYALEQLVELSCNLYKMLVERVEIFKGKTQLVKLILQIVTSAF  237

Query  4005  KVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDC  4184
             K+SQKRKVYQPHFT+S+E L  LCE +D CC+G  SP+A+ GLEA+LMSTPPV ILQMD 
Sbjct  238   KISQKRKVYQPHFTISIESLLQLCEVVDECCDGRQSPVAQIGLEAVLMSTPPVNILQMDK  297

Query  4185  KKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGK  4364
             +KVSKF+ WA  IALQ + + +  +E     + + +EEET++SLIS L+RWL ASVI+GK
Sbjct  298   EKVSKFVRWATLIALQPKIENIHGLENFACIVRLQAEEETDDSLISMLVRWLAASVIVGK  357

Query  4365  ISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTS  4544
             +S + S  D  HS DRSKL NL  L+EWNE+   E  + FAC+  LA+SIF+LQQL  T+
Sbjct  358   LSPRFSNSDLCHSFDRSKLNNLLSLMEWNEQRCEETNRAFACEGTLASSIFFLQQLQCTN  417

Query  4545  FKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIRCPAEANSAWRWSFYQPWK  4715
             + +LPS VSALCLLLL + +S+ S++L G+A   A LCSKI CPAEAN AWRWSFYQPWK
Sbjct  418   YIVLPSVVSALCLLLLSSLSSAESDILAGDAVQWATLCSKINCPAEANPAWRWSFYQPWK  477

Query  4716  DHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSILNLN  4895
             DHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +D+EKL VF+WER+   L 
Sbjct  478   DHSSELTDAEKLEENQACEMLLVVISKLLERNSLYSQFFSFQDLEKLCVFDWERTTTALP  537

Query  4896  HV*LH  4910
              V  H
Sbjct  538   EVHQH  542



>ref|XP_009767851.1| PREDICTED: uncharacterized protein LOC104218932 isoform X4 [Nicotiana 
sylvestris]
Length=548

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/536 (61%), Positives = 416/536 (78%), Gaps = 6/536 (1%)
 Frame = +3

Query  3285  MRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLK  3464
             MRL+LL+SYLQN IE+ WQ+I S+TA+F+AEASFVLLDPSHDHY+ I+ +LM+SPS N+K
Sbjct  1     MRLRLLMSYLQNGIEKPWQRISSITAVFVAEASFVLLDPSHDHYSAISAYLMRSPSANMK  60

Query  3465  SIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADN  3644
              IPLFQN  WS S +F  ERLWILR+LYSGLN +DD  IYIRN+IFETLLSFYVSP++ +
Sbjct  61    GIPLFQNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIRNAIFETLLSFYVSPISSH  120

Query  3645  ESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVL  3824
             ESKELI+Q VKKS  + +MAR+L+E CGLISW S VV+S   + +   +   F +  V+L
Sbjct  121   ESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVVSS---LSWSPCRSDSFVELTVIL  177

Query  3825  EVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTW  4004
             E +NE+I  RHT+EW+QKYALEQL ELSC+L ++LVE  ++ K  +   KLILQI+T  +
Sbjct  178   EALNEVILSRHTIEWMQKYALEQLVELSCNLYKMLVERVEIFKGKTQLVKLILQIVTSAF  237

Query  4005  KVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDC  4184
             K+SQKRKVYQPHFT+S+E L  LCE +D CC+G  SP+A+ GLEA+LMSTPPV ILQMD 
Sbjct  238   KISQKRKVYQPHFTISIESLLQLCEVVDECCDGRQSPVAQIGLEAVLMSTPPVNILQMDK  297

Query  4185  KKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGK  4364
             +KVSKF+ WA  IALQ + + +  +E     + + +EEET++SLIS L+RWL ASVI+GK
Sbjct  298   EKVSKFVRWATLIALQPKIENIHGLENFACIVRLQAEEETDDSLISMLVRWLAASVIVGK  357

Query  4365  ISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTS  4544
             +S + S  D  HS DRSKL NL  L+EWNE+   E  + FAC+  LA+SIF+LQQL  T+
Sbjct  358   LSPRFSNSDLCHSFDRSKLNNLLSLMEWNEQRCEETNRAFACEGTLASSIFFLQQLQCTN  417

Query  4545  FKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIRCPAEANSAWRWSFYQPWK  4715
             + +LPS VSALCLLLL + +S+ S++L G+A   A LCSKI CPAEAN AWRWSFYQPWK
Sbjct  418   YIVLPSVVSALCLLLLSSLSSAESDILAGDAVQWATLCSKINCPAEANPAWRWSFYQPWK  477

Query  4716  DHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSI  4883
             DHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +D+EKL VF+WER++
Sbjct  478   DHSSELTDAEKLEENQACEMLLVVISKLLERNSLYSQFFSFQDLEKLCVFDWERTL  533



>ref|XP_009767847.1| PREDICTED: uncharacterized protein LOC104218932 isoform X1 [Nicotiana 
sylvestris]
Length=553

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/534 (61%), Positives = 414/534 (78%), Gaps = 6/534 (1%)
 Frame = +3

Query  3285  MRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLK  3464
             MRL+LL+SYLQN IE+ WQ+I S+TA+F+AEASFVLLDPSHDHY+ I+ +LM+SPS N+K
Sbjct  1     MRLRLLMSYLQNGIEKPWQRISSITAVFVAEASFVLLDPSHDHYSAISAYLMRSPSANMK  60

Query  3465  SIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADN  3644
              IPLFQN  WS S +F  ERLWILR+LYSGLN +DD  IYIRN+IFETLLSFYVSP++ +
Sbjct  61    GIPLFQNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIRNAIFETLLSFYVSPISSH  120

Query  3645  ESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVL  3824
             ESKELI+Q VKKS  + +MAR+L+E CGLISW S VV+S   + +   +   F +  V+L
Sbjct  121   ESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVVSS---LSWSPCRSDSFVELTVIL  177

Query  3825  EVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTW  4004
             E +NE+I  RHT+EW+QKYALEQL ELSC+L ++LVE  ++ K  +   KLILQI+T  +
Sbjct  178   EALNEVILSRHTIEWMQKYALEQLVELSCNLYKMLVERVEIFKGKTQLVKLILQIVTSAF  237

Query  4005  KVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDC  4184
             K+SQKRKVYQPHFT+S+E L  LCE +D CC+G  SP+A+ GLEA+LMSTPPV ILQMD 
Sbjct  238   KISQKRKVYQPHFTISIESLLQLCEVVDECCDGRQSPVAQIGLEAVLMSTPPVNILQMDK  297

Query  4185  KKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGK  4364
             +KVSKF+ WA  IALQ + + +  +E     + + +EEET++SLIS L+RWL ASVI+GK
Sbjct  298   EKVSKFVRWATLIALQPKIENIHGLENFACIVRLQAEEETDDSLISMLVRWLAASVIVGK  357

Query  4365  ISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTS  4544
             +S + S  D  HS DRSKL NL  L+EWNE+   E  + FAC+  LA+SIF+LQQL  T+
Sbjct  358   LSPRFSNSDLCHSFDRSKLNNLLSLMEWNEQRCEETNRAFACEGTLASSIFFLQQLQCTN  417

Query  4545  FKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIRCPAEANSAWRWSFYQPWK  4715
             + +LPS VSALCLLLL + +S+ S++L G+A   A LCSKI CPAEAN AWRWSFYQPWK
Sbjct  418   YIVLPSVVSALCLLLLSSLSSAESDILAGDAVQWATLCSKINCPAEANPAWRWSFYQPWK  477

Query  4716  DHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWER  4877
             DHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +D+EKL VF+WER
Sbjct  478   DHSSELTDAEKLEENQACEMLLVVISKLLERNSLYSQFFSFQDLEKLCVFDWER  531



>ref|XP_009767849.1| PREDICTED: uncharacterized protein LOC104218932 isoform X3 [Nicotiana 
sylvestris]
Length=551

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/534 (61%), Positives = 412/534 (77%), Gaps = 8/534 (1%)
 Frame = +3

Query  3285  MRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLK  3464
             MRL+LL+SYLQN IE+ WQ+I S+TA+F+AEASFVLLDPSHDHY+ I+ +LM+SPS N+K
Sbjct  1     MRLRLLMSYLQNGIEKPWQRISSITAVFVAEASFVLLDPSHDHYSAISAYLMRSPSANMK  60

Query  3465  SIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADN  3644
              IPLFQN  WS S +F  ERLWILR+LYSGLN +DD  IYIRN+IFETLLSFYVSP++ +
Sbjct  61    GIPLFQNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIRNAIFETLLSFYVSPISSH  120

Query  3645  ESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVL  3824
             ESKELI+Q VKKS  + +MAR+L+E CGLISW S VV+S   + +   +   F +  V+L
Sbjct  121   ESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVVSS---LSWSPCRSDSFVELTVIL  177

Query  3825  EVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTW  4004
             E +NE+I  RHT+EW+QKYALEQL ELSC+L ++LVE  ++ K  +   KLILQI+T  +
Sbjct  178   EALNEVILSRHTIEWMQKYALEQLVELSCNLYKMLVERVEIFKGKTQLVKLILQIVTSAF  237

Query  4005  KVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDC  4184
             K+SQKRKVYQPHFT+S+E L  LCE +D CC+G  SP+A+ GLEA+LMSTPPV ILQMD 
Sbjct  238   KISQKRKVYQPHFTISIESLLQLCEVVDECCDGRQSPVAQIGLEAVLMSTPPVNILQMDK  297

Query  4185  KKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGK  4364
             +KVSKF+ WA  IALQ + + +  +E     + + +EEET++SLIS L+RWL ASVI+GK
Sbjct  298   EKVSKFVRWATLIALQPKIENIHGLENFACIVRLQAEEETDDSLISMLVRWLAASVIVGK  357

Query  4365  ISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTS  4544
             +S + S  D  HS DRSKL NL  L+EWNE+   E  + FAC+  LA+SIF+LQQL  T+
Sbjct  358   LSPRFSNSDLCHSFDRSKLNNLLSLMEWNEQRCEETNRAFACEGTLASSIFFLQQLQCTN  417

Query  4545  FKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIRCPAEANSAWRWSFYQPWK  4715
             + +LPS VSALCLLLL   + S +++L G+A   A LCSKI CPAEAN AWRWSFYQPWK
Sbjct  418   YIVLPSVVSALCLLLLS--SLSSADILAGDAVQWATLCSKINCPAEANPAWRWSFYQPWK  475

Query  4716  DHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWER  4877
             DHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +D+EKL VF+WER
Sbjct  476   DHSSELTDAEKLEENQACEMLLVVISKLLERNSLYSQFFSFQDLEKLCVFDWER  529



>ref|XP_006858190.1| hypothetical protein AMTR_s00062p00165700 [Amborella trichopoda]
 gb|ERN19657.1| hypothetical protein AMTR_s00062p00165700 [Amborella trichopoda]
Length=2407

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/1352 (34%), Positives = 728/1352 (54%), Gaps = 94/1352 (7%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLE---------  155
             D+L +FP ++ +++ + GV  S+L SI   E  LL  V+  WP++F + L+         
Sbjct  1042  DMLADFPSLIIIAEHIYGVDTSVLSSILCQERVLLSQVAHLWPDLFMSSLDVVSCACKEA  1101

Query  156   SAISGLQEGRTEEFG------DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQ  317
             + +SG     +   G      D DS E A A   +FL+     +LF    S   +DL   
Sbjct  1102  APVSGYNASHSPVSGLPGLGIDFDSKELAIATFGIFLQHIPFNVLFSAITSFNDTDLLGS  1161

Query  318   QGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRML  497
               +  +L A L E   D +++S   +LFW  +         +         CF +V+ +L
Sbjct  1162  TKMRGVLQAKLLESPADSLIASVHLILFWMYRISRKEVDSSIRSWGEQLTTCFALVEHIL  1221

Query  498   RQFLNTKG--DASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPL-----PCNADFTD  656
              + L++    D+S +   +      +QE++E IF HP VA  L  PL     P N  F  
Sbjct  1222  IRILSSASVLDSSQEIKSTTAAVVLIQEVVEAIFCHPAVALLLLHPLINHGEPENGGF--  1279

Query  657   TFSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELL---YFCDGQTSSFEACHARQVTK  827
                 ++++ FL S+    +H +D HV++LL    + L       G        H   V K
Sbjct  1280  ----NNLEAFLCSSS-NYVHPVDHHVLHLLNVVADYLSTQMTVQGLNLKLRDVHG-SVLK  1333

Query  828   AFKNVVQKLFLTFKDRTDKCIES-KDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRI  1004
             A + ++++    F+D     + + K+L P LP+ Y + +LK F+ PFELLELV+W+F  I
Sbjct  1334  ACQPLLRRPLSVFRDEVLAGMTTHKELFPCLPSFYVLWSLKHFLSPFELLELVYWLFCNI  1393

Query  1005  DLEDNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLL  1184
             D E          S + +GLHIA   F  LS+ + +  ++  L ++F G +   FD+ + 
Sbjct  1394  DEEKIKDSAPSMPSAIYLGLHIAEEAFSMLSSFVLRGKTKVALWNIF-GEVAGTFDLDVF  1452

Query  1185  EKILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNP--TLVMAISRFIVNIPVNL  1358
             EKI  ++   +   +L++AD+CLL+   +V      Q S     L M + + I   P++L
Sbjct  1453  EKIYDKILNFSLMCNLEIADLCLLRVM-LVSVWNCTQSSAVLLPLSMTVQKMISCCPMDL  1511

Query  1359  LSYCMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQT---------NAI-R  1508
             L +C+++ N+ K+ +LFL T++SPLHLSIFG +   ++      +          N I  
Sbjct  1512  LIHCIYKTNRIKSRILFLITQISPLHLSIFGEMFLSVLGNDSSREVPKLDGAYPVNVITE  1571

Query  1509  ETSNP--SDPELLMLLPTVFLYLDSVLIKAGSQ-VKYFEKIVSFYWRILLHIFSDWKCYV  1679
             ET+N   +  E ++LLP    Y  S   ++  Q   Y E I   Y + LL  FS+W+ +V
Sbjct  1572  ETTNHCFTSEEYILLLPVALKYFFSEFAESSKQKFVYAECIPVHYSKTLLQGFSNWQDFV  1631

Query  1680  TRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVC  1859
             +  +F  E  D +  S EEF + FS  +LSR++ M++L   + G  ++ + R++LFDS+ 
Sbjct  1632  SSKIFWEEGDDVVLTSPEEFHNFFSSTILSRTIGMLELWLIMKGKTLRKKKRIKLFDSID  1691

Query  1860  PQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHN-------KFSSG  2018
                      +D    ++ + S EQSLN VNR  A+I   R LLFP+++       + + G
Sbjct  1692  RTLHCRGVLVDSALDELCSSSFEQSLNTVNRITARIYFLRMLLFPQNSILVQKFVEINDG  1751

Query  2019  LKEDKMETCAELHSTLDVSR---IRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFR  2189
               E   E        L + +     ++ +L  +  K+V+KFP+   N     V++  + R
Sbjct  1752  TGEMSTERKQNGSDNLKLGQDAYFEVMSILSITLDKLVQKFPLNLYNLESTMVDSSQLVR  1811

Query  2190  FLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSE  2369
             FLE+ IL N+VEL++E+      +  +PF+    +++  HRF+DP TL+ LR I+ SL E
Sbjct  1812  FLEMTILTNLVELAREIGRTSADMHPVPFLGPFLRSSLLHRFEDPSTLKALRSILLSLPE  1871

Query  2370  GKFSCVKIIQLMVAHSQFETAI----CSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHN  2537
             G  +     + +VAHSQF  AI      S+ ++ +S  G+ F P  S++     P    +
Sbjct  1872  GNLAFGDAFEYLVAHSQFVPAILWSEAGSDRASVLSHSGMLFRPFSSILHLLSYPNSVQS  1931

Query  2538  SICRKDNLQMSK--------QHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVF  2693
                 K NL+ S          + ++LEL+KLLRVL+ +K RQ  I   +    N ++L+ 
Sbjct  1932  VSEMKSNLKTSSGKREISFLSYQRKLELVKLLRVLYHLKVRQGQINTTENSSTNAKELLS  1991

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSIS-DSNISIAEWDYLWGNAVVKARKERELVQTVS  2870
             LLL+ Y ATL  ID E+ +L++EI+S+    +  ++E DYLWG + +  R+ER L  +++
Sbjct  1992  LLLAGYGATLSVIDVEMLSLMHEIESLELTCHGCLSEMDYLWGTSALTIRRERALEGSLA  2051

Query  2871  CNLSD-AEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHE  3047
               ++D  E AE+ RK +FRENLP+D ++CA TVL+F Y R          Q +  + + E
Sbjct  2052  STITDDCETAEEKRKREFRENLPVDSRVCAWTVLHFSYDREIW------TQSEPLEKLKE  2105

Query  3048  DCSAE----VANRHI-----YDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSP  3200
             D   +    + +RH      YDP F+LR + H LSMG+IEP+EF+ LGLLAV+  S+SS 
Sbjct  2106  DNLMDLPIVIPSRHGEMVAQYDPAFVLRFAIHSLSMGFIEPMEFSGLGLLAVAFISMSSS  2165

Query  3201  DDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEA  3380
             D+  RKL Y  L +FK ALE C   ++  +L+LLL+Y+QN I+E WQ+IPSV AIF AEA
Sbjct  2166  DEGIRKLAYDALGRFKTALENCWNCRNGPQLRLLLTYIQNGIKEPWQQIPSVIAIFAAEA  2225

Query  3381  SFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLN  3560
             SF+L+DP++  Y  + + LM+SP V+L+++PLF +L  S S+ F ++R WIL +L++GLN
Sbjct  2226  SFILMDPANGLYVNVNQFLMRSPRVDLEAVPLFHSLFGSCSIHFLSDRKWILHLLFAGLN  2285

Query  3561  TDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISW  3740
               DD  I+ R  +FE LLSFY S LAD+ ++ LI+Q V+K+ KL  M R+L+E  GLISW
Sbjct  2286  LVDDAQIFKRKFLFELLLSFYNSSLADHNTRVLILQIVRKAVKLHMMGRYLVEQSGLISW  2345

Query  3741  LSSVVTSFCGIKYDHW--KGFPFAQFAVVLEV  3830
             LSS++    GI+  H   +     Q  + LE+
Sbjct  2346  LSSII--LFGIERLHGEIRELVLTQMVIALEL  2375



>ref|XP_009767853.1| PREDICTED: uncharacterized protein LOC104218932 isoform X6 [Nicotiana 
sylvestris]
Length=537

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/534 (59%), Positives = 401/534 (75%), Gaps = 22/534 (4%)
 Frame = +3

Query  3285  MRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLK  3464
             MRL+LL+SYLQN IE+ WQ+I S+TA+F+AEASFVLLDPSHDHY+ I+ +LM+SPS N+K
Sbjct  1     MRLRLLMSYLQNGIEKPWQRISSITAVFVAEASFVLLDPSHDHYSAISAYLMRSPSANMK  60

Query  3465  SIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADN  3644
              IPLFQN  WS S +F  ERLWILR+LYSGLN +DD  IYIRN+IFETLLSFYVSP++ +
Sbjct  61    GIPLFQNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIRNAIFETLLSFYVSPISSH  120

Query  3645  ESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVL  3824
             ESKELI+Q VKKS  + +MAR+L+E CGLISW S VV+S   + +   +   F +  V+L
Sbjct  121   ESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVVSS---LSWSPCRSDSFVELTVIL  177

Query  3825  EVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTW  4004
             E                KYALEQL ELSC+L ++LVE  ++ K  +   KLILQI+T  +
Sbjct  178   E----------------KYALEQLVELSCNLYKMLVERVEIFKGKTQLVKLILQIVTSAF  221

Query  4005  KVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDC  4184
             K+SQKRKVYQPHFT+S+E L  LCE +D CC+G  SP+A+ GLEA+LMSTPPV ILQMD 
Sbjct  222   KISQKRKVYQPHFTISIESLLQLCEVVDECCDGRQSPVAQIGLEAVLMSTPPVNILQMDK  281

Query  4185  KKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGK  4364
             +KVSKF+ WA  IALQ + + +  +E     + + +EEET++SLIS L+RWL ASVI+GK
Sbjct  282   EKVSKFVRWATLIALQPKIENIHGLENFACIVRLQAEEETDDSLISMLVRWLAASVIVGK  341

Query  4365  ISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTS  4544
             +S + S  D  HS DRSKL NL  L+EWNE+   E  + FAC+  LA+SIF+LQQL  T+
Sbjct  342   LSPRFSNSDLCHSFDRSKLNNLLSLMEWNEQRCEETNRAFACEGTLASSIFFLQQLQCTN  401

Query  4545  FKLLPSAVSALCLLLLKNPASSGSEVLIGNA---AALCSKIRCPAEANSAWRWSFYQPWK  4715
             + +LPS VSALCLLLL + +S+ S++L G+A   A LCSKI CPAEAN AWRWSFYQPWK
Sbjct  402   YIVLPSVVSALCLLLLSSLSSAESDILAGDAVQWATLCSKINCPAEANPAWRWSFYQPWK  461

Query  4716  DHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWER  4877
             DHSS LTD+EK+EE  AC+MLL+V SK+L RNSLYS+  S +D+EKL VF+WER
Sbjct  462   DHSSELTDAEKLEENQACEMLLVVISKLLERNSLYSQFFSFQDLEKLCVFDWER  515



>ref|XP_010436368.1| PREDICTED: uncharacterized protein LOC104720098 [Camelina sativa]
Length=2243

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/785 (45%), Positives = 501/785 (64%), Gaps = 44/785 (6%)
 Frame = +3

Query  2577  HLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLV  2756
             + +QLE++KLLRVL          +  ++ GINL++L FLLL SY ATL +ID EI+ L+
Sbjct  1486  YARQLEIVKLLRVLLS--------KCGKDSGINLKELHFLLLCSYGATLSEIDLEIYKLM  1537

Query  2757  NEIKSIS-DSNISIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENL  2933
             ++IK +  +  ++++E D LWG A +K R+   L Q  S ++ +A++ ED R+  F+ENL
Sbjct  1538  HDIKLVDVEHTLNVSETDCLWGKAALKIREALRLSQDAS-DVGEADLLEDVRQSLFKENL  1596

Query  2934  PIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMH-------EDCSAEVANRHIYDPI  3092
              +DPK+CA TVL+FPY R            +  D++H       E CS  + +   YDP+
Sbjct  1597  CVDPKICARTVLFFPYQRTT----------EVSDNLHLYDYPVNEKCSPGMEDIERYDPV  1646

Query  3093  FILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQK  3272
             FILR S   LS+GYIEPVEFA+LGLLAV+  S+SS D   RKLGY  LE + +ALE C+K
Sbjct  1647  FILRFSIDTLSIGYIEPVEFASLGLLAVAFVSMSSADLGIRKLGYESLEIYLDALESCRK  1706

Query  3273  KKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPS  3452
              K V  L+LLL Y+QN +EE WQ+IP+V+AIF AEAS +LLDPSH+HY  I K L  S +
Sbjct  1707  NKHVTGLRLLLMYVQNGVEEPWQRIPTVSAIFAAEASLILLDPSHEHYVPINKLLKSSST  1766

Query  3453  VNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSP  3632
             + L+ IPLF +  WS +V+FR++R W LR++ +GL +D+D  IYIRNSI ET++SF  SP
Sbjct  1767  LKLRGIPLFHDFFWSSTVNFRSQRFWELRLVCAGLKSDEDAQIYIRNSILETVMSFSSSP  1826

Query  3633  LADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQF  3812
             LAD+E+K LI+Q V+KSAK  +MARHL+ENCGL SW S+ +++F         G    + 
Sbjct  1827  LADDETKGLILQVVRKSAKFHKMARHLVENCGLFSWCSAFISTFA----TKPTGDEDLRL  1882

Query  3813  AVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQIL  3992
              V+LEV+ +++  R+  EWLQ+  LE L E+S  L ++L  G   ++E++T    ILQIL
Sbjct  1883  VVILEVITDVLASRNVTEWLQRCGLEGLMEISSRLYRLLGGGLVSVQENATSVDFILQIL  1942

Query  3993  TLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAIL  4172
             + T K+SQKRK+YQPHFT+++EG+F L E +    +      ++ GL  ILMS+PPV I+
Sbjct  1943  SATLKISQKRKMYQPHFTITIEGIFQLFEGVANSGSPQVEDSSEHGLITILMSSPPVDII  2002

Query  4173  QMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASV  4352
              MD  K+ +F+ WA S AL+ + K V    +        +EE  E ++I+K LRWL ASV
Sbjct  2003  DMDVDKLRRFLLWATSTALKCDHKRV--PSESHHDTKKITEEPEEETMIAKFLRWLLASV  2060

Query  4353  ILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQ-  4529
             IL K+  K +  DS+    ++K   L  LLE+ ++ + E+  + + + I+   I YLQ+ 
Sbjct  2061  ILRKLYSKANHSDST-VLSKTKPKTLLNLLEYFKKRNLEDSMKIS-EHIIEEVIVYLQKH  2118

Query  4530  LLGTSFK-LLPSAVSALCLLLLKNPASSGSEVLIGN---AAALCSKIRCPAEANSAWRWS  4697
             LL T+++ LLPS V AL L+LL N    G+E    +     +LCSKI  P EAN  WRWS
Sbjct  2119  LLCTNYRVLLPSVVFALSLMLLHNDL--GTEDPNDDYKLIKSLCSKISSPPEANPGWRWS  2176

Query  4698  FYQPWKDHSS-NLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISL-KDVEKLGVFEW  4871
             ++Q W D SS   TD +KI+E+HACQ LLL+ S ML      S+ + L KD +   V EW
Sbjct  2177  YFQAWWDLSSEQATDLDKIDELHACQHLLLIFSDMLGETPGESQQVLLRKDFDISHVLEW  2236

Query  4872  ERSIL  4886
             ERS++
Sbjct  2237  ERSLV  2241


 Score =   246 bits (627),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 213/678 (31%), Positives = 338/678 (50%), Gaps = 49/678 (7%)
 Frame = +3

Query  78    SIFFLEPSLLIDVSKTWPEMF-----FTGL----------ESAISGLQEGRTEEFGDIDS  212
             SI FLE + L ++SK   ++F     FTG           E   SG      E    +  
Sbjct  800   SILFLEANFLGNLSKLSLDLFARGSEFTGSRDLCEETVDSEIGFSGHSSITEEIRSKMGI  859

Query  213   MEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLLANLSERTPDHIVSSFLY  392
              +  S+A S+FL++A   +L    +S+  S L     +  LLL  +S+ T   I S+   
Sbjct  860   RDIGSSAFSVFLEQAPFPVLLTAIMSMDISCLLEFPRISELLLLKVSQPTSGSIDSNIQV  919

Query  393   VLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTK---GDASSKCTRSLLPTK  563
             +LFW  Q   SY+V+P   L  LSE+C  ++  +  Q   T+   G +S+K     L TK
Sbjct  920   ILFWLFQIRSSYKVQPAPVLRQLSEICVRLMKNVFSQISETELVSGPSSNKLFA--LVTK  977

Query  564   CVQELIETIFYHPVVAASLECPLPC----NADFTDTFSGDSMDKFLESNKWRVIHKMDLH  731
                ++ +TI  HPVV A LE PL C         + FS  S+     +    V  ++D H
Sbjct  978   QKHQVAQTILGHPVVIALLESPLDCCTSPGVQNVEIFSEISL-----TTGRLVFSEIDQH  1032

Query  732   VINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRTDKCIESKDLTP  911
             +++LL +T E L+        ++    + +  AFK++V+KL L F+   +  + S+    
Sbjct  1033  ILDLLVSTCEFLFDEKHNVWKWDFRKNKSII-AFKDLVEKLLLEFRVTFELSVGSQSYAS  1091

Query  912   LLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAGSVFDS  1091
             +L     IH L RFI PF+LL + H M S+ID ++++   S +  +L +GL IAG  F+ 
Sbjct  1092  VLQLSQVIHALLRFISPFKLLYVAHSMLSKIDEKESASPDSSK--ILSLGLGIAGGAFEM  1149

Query  1092  LSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLD-VADMCLLKAFK  1268
             L     QP ++R + DL W + E  +D  L+EK+     + +T   LD  AD+CLLK   
Sbjct  1150  LVLYSHQPTAKRGVYDLLWELEENNYDSNLIEKVYSMACKFSTSFGLDSAADICLLKVCG  1209

Query  1269  VVKTHKVMQQ-SNPTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLHLSI  1445
              +   K  Q  S   LV+ IS  +   P +L+ +C+ + +  +A++LF   E SPLH  +
Sbjct  1210  GIFRGKHYQNCSVHRLVLVISLIVGRTPEDLIIHCVKRASITRAKILFYLVESSPLHRLV  1269

Query  1446  FGHLLSGMIDKQVHLQTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQVKYFEKIV  1625
             FG     M+ K+        +E +  +D + +MLLP V  YL SV  K          I 
Sbjct  1270  FGRFFFSMLSKK--------QEDTALTDDQFIMLLPAVLSYLTSVSEKLEKPCNRCLDIT  1321

Query  1626  SFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSIEEFMD-IFSCNLLSRSVLMVQLCSA  1802
             S Y  IL++ F  W  +++R +F+ E +D++ LS  + +D +F+ +LL ++VLM Q   +
Sbjct  1322  SVYSNILINGFLQWPRFLSRCIFE-EKYDDILLSTTDDIDTMFNASLLGKAVLMFQYHFS  1380

Query  1803  LTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINLCRT  1982
             LT    K +   ++F+S+ P  S   + LD++  +V   S++Q  N   R VAK+ L R 
Sbjct  1381  LTESPTKEDDLFKVFNSIFPHTSARKEMLDYEMKEVDVQSVDQMFNVAIRVVAKVTLSRI  1440

Query  1983  LLFPE-----HNKFSSGL  2021
              LFPE     H K  +GL
Sbjct  1441  CLFPEDSSMCHLKREAGL  1458



>ref|XP_010438668.1| PREDICTED: uncharacterized protein LOC104722226 [Camelina sativa]
Length=709

 Score =   568 bits (1465),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 322/717 (45%), Positives = 453/717 (63%), Gaps = 33/717 (5%)
 Frame = +3

Query  2778  DSNISIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCA  2957
             +  ++++E D LWG A +K R+   L Q  S ++ +AE+ ED R+  F+ENL +DPK+CA
Sbjct  10    EHTLNVSETDCLWGKAALKIREALRLSQDAS-DVGEAELLEDVRQSLFKENLCVDPKICA  68

Query  2958  STVLYFPYGRPNGPGVVNKVQKDTFDSMH-------EDCSAEVANRHIYDPIFILRLSFH  3116
              TVL+FPY R            +  D++H       E CS  + +   YDP+FILR S  
Sbjct  69    RTVLFFPYQRTT----------EVSDNLHLYDYPINEKCSPGMEDIERYDPVFILRFSID  118

Query  3117  CLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQ  3296
              LS+GYIEPVEFA+LGLLAV+  S+SS D   RKLGY  LE + +ALE C+K K V  L+
Sbjct  119   TLSIGYIEPVEFASLGLLAVAFVSMSSADLGMRKLGYETLEIYLDALESCRKNKHVTGLR  178

Query  3297  LLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPL  3476
             LLL Y+QN +EE WQ+IP+V+AIF AEAS +LLDPSH+HY  I K L  S ++ L+ IPL
Sbjct  179   LLLMYVQNGVEEPWQRIPTVSAIFAAEASLILLDPSHEHYVPINKLLKSSSTLKLRGIPL  238

Query  3477  FQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKE  3656
             F +  WS +V+FR++R W LR++ +GL +D+D  IYIRNSI ET++SF  SPLAD+E+K 
Sbjct  239   FHDFFWSSTVNFRSQRFWELRLVCAGLKSDEDAQIYIRNSILETVMSFSSSPLADDETKG  298

Query  3657  LIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVN  3836
             LI+Q V+KS K  +MARHL+ENCGL SW S+ +++F         G    +  V+LEV+ 
Sbjct  299   LILQVVRKSVKFHKMARHLVENCGLFSWCSAFISTFTTKP----TGDEDLRLVVILEVIT  354

Query  3837  EIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQ  4016
             +++  R+  EWLQ+  LE L E+S  L ++L  G   ++E+ T   LILQIL+ T K+SQ
Sbjct  355   DVLASRNVTEWLQRCGLEGLMEISSRLYRLLGGGLVSVQENGTSVDLILQILSATLKISQ  414

Query  4017  KRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVS  4196
             KRK+YQPHFT+++EG+F L E +    +      ++ GL  ILMS+PPV I+ MD  K+ 
Sbjct  415   KRKMYQPHFTITIEGIFQLFEGVANSGSPQVEASSEHGLITILMSSPPVDIIDMDVDKLR  474

Query  4197  KFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYK  4376
             +F+ WA S AL+S+ K V +  +        +EE  E ++++K LRWL ASVILGK+  K
Sbjct  475   RFLLWATSTALKSDHKRVSKPSETHQDSKKLTEEPQEETMVAKFLRWLLASVILGKLYSK  534

Query  4377  LSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQ-LLGTSFK-  4550
              +  D +    ++K   L   LE+ ++ + E+  +   + I+   I YLQ+ LL T++  
Sbjct  535   SNHSDPT-VLSKTKSETLLNSLEYFKKRNLEDSMK-NSEHIIGEVIVYLQKHLLCTNYGV  592

Query  4551  LLPSAVSALCLLLLKNPASSGSEVLIGN---AAALCSKIRCPAEANSAWRWSFYQPWKDH  4721
             LLPS V AL L+LL N    G+E    +     +LCSKI  P EAN  WRWS++Q W D 
Sbjct  593   LLPSVVFALSLMLLHNDL--GTEDPNDDYKLIKSLCSKISSPLEANPGWRWSYFQAWWDL  650

Query  4722  SS-NLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISL-KDVEKLGVFEWERSIL  4886
             SS   TD E I+E+HACQ LLL+ S ML      S+ + L KD +   V EWERS++
Sbjct  651   SSEQATDLENIDELHACQHLLLIFSDMLGETPGESQQVLLRKDFDISHVLEWERSLV  707



>ref|XP_010438666.1| PREDICTED: uncharacterized protein LOC104722225 isoform X1 [Camelina 
sativa]
Length=707

 Score =   565 bits (1457),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 322/717 (45%), Positives = 455/717 (63%), Gaps = 35/717 (5%)
 Frame = +3

Query  2778  DSNISIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCA  2957
             +  ++++E D LWG A +K R+   L Q  S ++ +A++ ED R+  F+ENL +DPK+CA
Sbjct  10    EHTLNVSETDCLWGKAALKIREALRLSQDAS-DVGEADLLEDVRQSLFKENLCVDPKICA  68

Query  2958  STVLYFPYGRPNGPGVVNKVQKDTFDSMH-------EDCSAEVANRHIYDPIFILRLSFH  3116
              TVL+FPY R            +  D++H       E CS  + +   YDP+FILR S  
Sbjct  69    RTVLFFPYQRTT----------EVSDNLHLYDYPVNEKCSPGMEDIERYDPVFILRFSID  118

Query  3117  CLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQ  3296
              LS+GYIEPVEFA+LGLLAV+  S+SS D   RKLGY  LE + +ALE C+K K V  L+
Sbjct  119   TLSIGYIEPVEFASLGLLAVAFVSMSSADLGIRKLGYESLEIYLDALESCRKNKHVTGLR  178

Query  3297  LLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPL  3476
             LLL Y+QN +EE WQ+IP+V+AIF AEAS +LLDPSH+HY  I K L  S ++ L+ IPL
Sbjct  179   LLLMYVQNGVEEPWQRIPTVSAIFAAEASLILLDPSHEHYVPINKLLKSSSTLKLRGIPL  238

Query  3477  FQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKE  3656
             F +  WS +V+FR++R W LR++ +GL +D+D  IYIRNSI ET++SF  SPLAD+E+K 
Sbjct  239   FHDFFWSSTVNFRSQRFWELRLVCAGLKSDEDAQIYIRNSILETVMSFSSSPLADDETKG  298

Query  3657  LIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVN  3836
             LI+Q V+KS K  +MARHL+ENCGL SW S+ +++F         G    +  V+LEV+ 
Sbjct  299   LILQVVRKSVKFHKMARHLVENCGLFSWCSAFISTFTTKP----TGDEDLRLVVILEVIT  354

Query  3837  EIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQ  4016
             +++  R+  EWLQ+  LE L E+S  L ++L  G   ++E+ T   LILQIL+ T K+SQ
Sbjct  355   DVLASRNVTEWLQRCGLEGLMEISSRLYRLLGGGLVSVQENGTSVDLILQILSATLKISQ  414

Query  4017  KRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVS  4196
             KRK+YQPHFT+++EG+F L E +    +      ++ GL  ILMS+PPV I+ MD  K+ 
Sbjct  415   KRKMYQPHFTITIEGIFQLFEGVANSGSPQVEDSSEHGLITILMSSPPVDIIDMDVDKLR  474

Query  4197  KFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYK  4376
             +F+ WA S AL+ + K V    +        +EE  E ++I+K LRWL ASVIL K+  K
Sbjct  475   RFLLWATSTALKCDHKRV--PSESHHDTKKITEEPEEETMIAKFLRWLLASVILRKLYSK  532

Query  4377  LSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQ-LLGTSFK-  4550
              +  DS+    ++K   L  LLE+ ++ + E+  + + + I+   I YLQ+ LL T+++ 
Sbjct  533   ANHSDST-VLSKTKPKTLLNLLEYFKKRNLEDSMKIS-EHIIEEVIVYLQKHLLCTNYRV  590

Query  4551  LLPSAVSALCLLLLKNPASSGSEVLIGN---AAALCSKIRCPAEANSAWRWSFYQPWKDH  4721
             LLPS V AL L+LL N    G+E    +     +LCSKI  P EAN  WRWS++Q W D 
Sbjct  591   LLPSVVFALSLMLLHNDL--GTEDPNDDYKLIKSLCSKISSPPEANPGWRWSYFQAWWDL  648

Query  4722  SS-NLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISL-KDVEKLGVFEWERSIL  4886
             SS   TD +KI+E+HACQ LLL+ S ML      S+ + L KD +   V EWERS++
Sbjct  649   SSEQATDLDKIDELHACQHLLLIFSDMLGETPGESQQVLLRKDFDISHVLEWERSLV  705



>gb|EMT15404.1| hypothetical protein F775_01717 [Aegilops tauschii]
Length=2299

 Score =   574 bits (1480),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 420/1241 (34%), Positives = 658/1241 (53%), Gaps = 97/1241 (8%)
 Frame = +3

Query  231   ALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLL--------ANLSERTPDHIVSSF  386
             ALS FL     C L P  LS+  S  +     H LLL        A L E T   +  + 
Sbjct  1120  ALSTFLNVTPFCALLPSVLSLVFSGPAKTGEAHALLLDALVRLIRAKLYESTISELTFNL  1179

Query  387   LYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTKGDASSKCTRSLLPTKC  566
               +LFW ++  +SY  +    LE L  +C  +VD +         D +          +C
Sbjct  1180  RVILFWSHRLLLSYTRKGSNVLEELCHVCSTLVDSIFEHIRVLAADTADLNA----SVEC  1235

Query  567   VQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKMDLHVINLL  746
              Q+++E++ +HP +   L C L    D TD  S + +++   S     +H +D  V+NLL
Sbjct  1236  FQDIVESVLHHPTI--DLPCSLSNCPDLTDG-SVEHVEEAFTSFSKENLHLVDGFVVNLL  1292

Query  747   RTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRTDKCIESKDLTPLLPAI  926
                ++LL   +    S E+  A     + K +++K+ L FKD+   C+++ +   LLP  
Sbjct  1293  SKLYDLLLLAENDGQSLESLFA-----SPKAMLEKILLLFKDKFQVCMDNGNFGLLLPNF  1347

Query  927   YAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAGSVFDSLSACM  1106
             Y +  LK+F+ P  LLELV+WMFS ++   +S   +   +   V L +A    + L   +
Sbjct  1348  YMVRALKKFMSPVRLLELVNWMFSELESRGSSCSAAFAPAAF-VCLSVADIAMELLYDYL  1406

Query  1107  WQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLLKAFKVVKTHK  1286
              Q   +R  S   WG+     DI  ++++   +      L+L+ AD+CLLK   +++ H 
Sbjct  1407  QQT-DQRSESCQLWGLEIRSSDIATIQRVYHFILHFTAKLNLESADVCLLKM--LIRIHN  1463

Query  1287  VMQQSN-----PTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLHLSIFG  1451
               + +          M +S    N P+++L +CMF  +K KA++L+L  E+SP+H++ FG
Sbjct  1464  AERSAGQNTEYTAFHMMLSTMATNTPLSILHHCMFPTSKVKAKVLWLLLEVSPIHMNFFG  1523

Query  1452  HLLSGMIDKQVHL--QTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQVKYFEKIV  1625
              +L  ++++   +    +   ++S       ++LLP    Y+           ++ E + 
Sbjct  1524  QMLMKVLEEDTSILQGMDYNSDSSWAHADSSILLLPAALSYMRHHSDGHMQCAEFLEPLA  1583

Query  1626  SFYWRILL--HIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQLCS  1799
              FY  +LL  + F  WK ++TR +F+    D    S+ + MD FS  LL +SV M+  C 
Sbjct  1584  KFYCEMLLGDNGFPCWKSFITRTIFEENFGDFQHESVPDMMDYFSDTLLGKSVTMLHYCL  1643

Query  1800  ALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSLEQSLNFVNRTVAKINLCR  1979
             +L     K   R+E+  S+CPQ S     LDFD S +   S +  L   N  +AKI+L R
Sbjct  1644  SLKEMPRK--QRLEIVASLCPQSS---GLLDFDVSDINPDSHKGHLKLTNELLAKISLIR  1698

Query  1980  TLLFPEHNKFSSGLKEDKMETCAELHST-LDVSRIRLLKMLVSSWRKIVEKFPMTADNSC  2156
              LL P   + SS       ET ++  S  +  +++  + +LV +  +I+  FP    +  
Sbjct  1699  LLLSPP-RRLSSN------ETASDRESKRVSNAKLNFISILVRTLDQILRNFPRC--DGL  1749

Query  2157  QMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPFIVKLAKTTFWHRFDDPMTLQ  2336
                 +   V R LE  +L+NI+ELS E+   L +L S+PF+ +  +++  HR  DP    
Sbjct  1750  SHSDKQQRVVRSLEYTVLKNIIELSSEIQTHLNQLKSIPFLNQFIRSSLLHR-RDPAD--  1806

Query  2337  KLRDIISSLSEGKFSCVKIIQLMVAHSQFETAI-CS--SNLSTGISQLGLTFTPLPSLMR  2507
                              +I++L++ HS F ++I CS  S  S+  +  G    P P +++
Sbjct  1807  -----------------EILELILGHSHFLSSITCSEVSEYSSAFNATGSLLQPAPGILK  1849

Query  2508  SFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGI--NLR  2681
             S V  LF      +++   +     +++E+I+LLR+L+ +K+RQ      Q  G+    +
Sbjct  1850  S-VDSLFT-----KENEFHIGIAETRKIEIIRLLRILYDIKSRQ------QSNGLLNESK  1897

Query  2682  DLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQ  2861
             +L FLLLS Y ATL + D EI NL+NEI+S      +IAE D+LWG+A VK R+E +L  
Sbjct  1898  ELSFLLLSVYGATLSETDLEIFNLMNEIES--HECKTIAEMDHLWGSAAVKYREELKLDS  1955

Query  2862  TVS-CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGV--VNKVQKDTF  3032
             ++S  + ++   +   R+  FREN+PID K+C  TVL F Y R     V  + ++++D F
Sbjct  1956  SISEIHKTENTESNSRRRALFRENIPIDSKLCVMTVLQFCYKRSTRTSVFSLEQLRQDKF  2015

Query  3033  DSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDT  3212
               + +  S       IYDP+FILR S H L MGYIEP EF+ +GLLA++L  ISSPD++ 
Sbjct  2016  GDILKTTSQSTDMVRIYDPMFILRFSIHTLLMGYIEPAEFSRVGLLAITLVCISSPDEEL  2075

Query  3213  RKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVL  3392
             RKLGY  L  FK +LE  QK K+  +LQLLL+YLQN I + WQ+IPS+ AIF AEAS  L
Sbjct  2076  RKLGYESLNTFKKSLEASQKSKEKWQLQLLLTYLQNGISKPWQRIPSIIAIFAAEASLTL  2135

Query  3393  LDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDD  3572
             LD SH  + TI+K+LM S SV+++SIPLF  LL S SV F+ +RLW+LR+LY+G N  DD
Sbjct  2136  LDSSHTQFNTISKYLMNSASVDMQSIPLFPTLLKSSSVHFKADRLWMLRLLYAGSNLADD  2195

Query  3573  VHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSV  3752
               I    S+ E  L+F  S ++D+ESK LI+Q +KK  KL  +A+HL++NCGL+SW+SSV
Sbjct  2196  ATICKNKSVLELALAFCSSAISDSESKHLILQVLKKCVKLPVLAQHLVKNCGLLSWISSV  2255

Query  3753  VTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQ  3875
             +++       H KG      + ++ +  E   FR  +  LQ
Sbjct  2256  IST-------HGKGLDNNSSSRIVGLALEKQQFRPPLFGLQ  2289


 Score = 70.5 bits (171),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 66/256 (26%), Positives = 110/256 (43%), Gaps = 21/256 (8%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGL--Q  176
             D++ +FP ++ V K         L S+ +L+   L +++  WP++FF  L      L   
Sbjct  857   DIICSFPELLDVVKTHCPSHMQFLSSVLYLQHDYLAEIATCWPDIFFCSLRQIEGNLDVD  916

Query  177   EGRTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLL-----  341
             EG+ +      S+     ALS FL     C L P  LS+  S  +     H LLL     
Sbjct  917   EGKCQNH----SISAELTALSTFLNVTPFCALLPSVLSLVFSGPAKTGEAHALLLDALVR  972

Query  342   ---ANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLN  512
                A L E T   +  +   +LFW ++  +SY  +    LE L  +C  +VD +      
Sbjct  973   LIRAKLYESTISELTFNLRVILFWSHRLLLSYTRKGSNVLEELCHVCSTLVDSIFEHIRV  1032

Query  513   TKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLE  692
                D +          +C Q+++E++ +HP +   L C L    D TD  S + +++   
Sbjct  1033  LAADTADLNA----SVECFQDIVESVLHHPTI--DLPCSLSNCPDLTDG-SVEHVEEAFT  1085

Query  693   SNKWRVIHKMDLHVIN  740
             S     +H +D  V+N
Sbjct  1086  SFSKENLHLVDGFVVN  1101



>ref|XP_004980119.1| PREDICTED: uncharacterized protein LOC101758221 [Setaria italica]
Length=2175

 Score =   566 bits (1458),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 408/1227 (33%), Positives = 647/1227 (53%), Gaps = 72/1227 (6%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             D++ +FP ++ V K       + L S+ FL+   L  V+  WP++FF+ +      L   
Sbjct  983   DIISDFPDLLDVVKTYFPYHLAFLSSVLFLQHDYLAKVASCWPDIFFSSIRLFKDDLNAD  1042

Query  183   RTEEFGDI---DSMEFASAALSLFLKEASLCMLFPITLSIYKS-----DLSTQQGLHNLL  338
                   D     S+   SA LS FL  +  C L P  LS+  S       + +  L  LL
Sbjct  1043  HVNTVEDKWKNLSVSTESAPLSTFLSVSPFCALLPSVLSLAFSVSDEIREAHKDALLRLL  1102

Query  339   LANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNTK  518
                LSE T   +      +LFW +    SY ++    LE L  LCF +VDR+        
Sbjct  1103  QVKLSECTFSEVTLYLRVILFWSHHLLSSYTIKSSNVLEQLCNLCFALVDRVFEHIQVLA  1162

Query  519   GDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESN  698
              D  S+      P + +Q++++ + +HP++A SL   L    + +D  S + +++ L   
Sbjct  1163  ADRQSQSADLPYPVQHIQDIVDFVIHHPIIALSLSRSLSNCQNLSDG-SLEHLEEALVVF  1221

Query  699   KWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLT-----  863
                 +H +D  V+ LL  +++LL        SFEA ++R    +     + LF T     
Sbjct  1222  SKENLHLLDRFVLKLLGKSYDLLLM----VGSFEANYSRDDGPSH----ESLFATPNLLL  1273

Query  864   ------FKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSF  1025
                   FK++ + C+   +   LLP  Y +  L +F+ P +LL+L +WMF+++    +S 
Sbjct  1274  ENILLLFKEKFELCMGKVNFGLLLPNFYMVRALSKFLSPVKLLDLANWMFTKLADCSSSC  1333

Query  1026  QQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQV  1205
               +   + L + L+I     + L  C+ Q   +R  S L W +   +  +  +++    V
Sbjct  1334  SPAFVPAAL-MCLYITDVAMEMLCRCL-QKTGQRSESYLLWDL---EIHVTTIQQAYHIV  1388

Query  1206  YEIATHLHLDVADMCLLKAF-KVVKTHKVMQQSNPTLV--MAISRFIVNIPVNLLSYCMF  1376
                AT  +L+ AD CLLK   ++  T +    S   +   M +S  ++N P+++L +C+F
Sbjct  1389  LHFATKWNLEFADHCLLKMLGRIHHTERYAGWSTDYIAFHMILSTLVINTPIDVLHHCIF  1448

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHL--QTNAIRETSNPSDPELLMLL  1550
               +K KA+ L L  E SP+H+++FG +LS    K   L    ++    S P +   ++LL
Sbjct  1449  PASKVKAKALLLLLEASPMHMNLFGKILSETFKKDNSLLQVKDSDSNASWPQEDGAILLL  1508

Query  1551  PTVFLYLDSVLIKAGSQVKYFEKIVSFYWRILL--HIFSDWKCYVTRDMFDIESFDNLPL  1724
             P     L       G   K+ E +  FY  +LL    FS WK +VTR +F+ +  D +P 
Sbjct  1509  PAALSCLKCHSDDNGRWAKFLEPVSIFYSELLLCDKGFSSWKSFVTRSIFEEDFSDFIPT  1568

Query  1725  SIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPS  1904
             S+++ M  FS  LL +SV+M  L    +   +  + R+++  S+ P+ S   + LD D +
Sbjct  1569  SVKDIMIYFSGTLLGKSVMM--LHHYFSSKEMSRKQRLDIVGSIFPESS---ELLDSDVN  1623

Query  1905  QVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIR  2084
              +   S +  +   N   AKI+L R LL P     SS +  ++      LH     +++ 
Sbjct  1624  DINPTSCKGIVKVTNELFAKISLIRLLLSPPRKLLSSEVASER--ESKRLHK----AKLN  1677

Query  2085  LLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLD  2264
              + +LV +  KI    P ++DN      +   V  FLE +IL+NI+ELS E+   L +L 
Sbjct  1678  FISILVRTMDKIFMNLP-SSDNILAHSAKEQKVIHFLEYVILKNIIELSSEIQSHLNQLK  1736

Query  2265  SLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFETAICSS  2444
             S+PF+ +  +++  HRF+DP+ ++ +R I+  LS+ KFS  +II+L++ HS F + I  +
Sbjct  1737  SIPFLSQFIRSSLLHRFNDPVAIKAIRSILVVLSQAKFSADEIIELILGHSNFMSTITCN  1796

Query  2445  NLS---TGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRV  2615
              +S   +  +  G    P PS+++         +S   ++  Q+  +   ++E+I+LLRV
Sbjct  1797  GVSEYPSACNPSGGMLQPAPSILK------LVDSSFMEENKPQLCTKEKGRVEIIRLLRV  1850

Query  2616  LFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISI  2795
             L+ +K+RQ +    +E     R+LVFLLLS Y+ATL + D EI +L+NEI+S     I+ 
Sbjct  1851  LYGIKSRQQNNSQLRES----RELVFLLLSIYDATLSETDLEILHLMNEIESTECRTIT-  1905

Query  2796  AEWDYLWGNAVVKARKEREL--VQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVL  2969
              E D+LWG+A +K R+E +L   ++ + N+ +AE+ E  R+  FREN+P+D K+CA T L
Sbjct  1906  -EVDHLWGSAALKFREELKLDFSKSDTQNIENAEITER-RRALFRENIPVDSKLCAKTAL  1963

Query  2970  YFPYGRPNGPGV--VNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEP  3143
              + Y R +      + ++Q++ F    E+ S  +    IYDPIFILR S H L MGYIEP
Sbjct  1964  LYCYKRSSRASAFSLEQLQRENFTDSFEETSQRMDAVQIYDPIFILRFSIHTLLMGYIEP  2023

Query  3144  VEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNC  3323
              EFA LGLLA++L SI+SPD + R LGY  L  FK +LE  Q+ K+  +LQLLL+YLQN 
Sbjct  2024  AEFARLGLLAITLVSIASPDQELRMLGYECLGAFKKSLETSQRSKETWQLQLLLTYLQNG  2083

Query  3324  IEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDS  3503
             I E WQKIPS+  +F AEAS  LLD SH  +  I+  LM S S +L+SIPLF  LL S S
Sbjct  2084  ISEQWQKIPSIITVFAAEASLTLLDSSHAQFTAISNFLMHSTSASLQSIPLFPTLLQSSS  2143

Query  3504  VSFRTERLWILRILYSGLNTDDDVHIY  3584
             V F+ ERLW+LR+L +G N  DD  IY
Sbjct  2144  VHFKAERLWMLRLLSAGSNLADDAKIY  2170



>ref|XP_009767854.1| PREDICTED: uncharacterized protein LOC104218932 isoform X7 [Nicotiana 
sylvestris]
Length=443

 Score =   520 bits (1338),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 253/428 (59%), Positives = 327/428 (76%), Gaps = 3/428 (1%)
 Frame = +3

Query  3285  MRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLK  3464
             MRL+LL+SYLQN IE+ WQ+I S+TA+F+AEASFVLLDPSHDHY+ I+ +LM+SPS N+K
Sbjct  1     MRLRLLMSYLQNGIEKPWQRISSITAVFVAEASFVLLDPSHDHYSAISAYLMRSPSANMK  60

Query  3465  SIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADN  3644
              IPLFQN  WS S +F  ERLWILR+LYSGLN +DD  IYIRN+IFETLLSFYVSP++ +
Sbjct  61    GIPLFQNFFWSSSTNFIAERLWILRLLYSGLNANDDTQIYIRNAIFETLLSFYVSPISSH  120

Query  3645  ESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVL  3824
             ESKELI+Q VKKS  + +MAR+L+E CGLISW S VV+S   + +   +   F +  V+L
Sbjct  121   ESKELIVQIVKKSVGIPKMARYLVEQCGLISWSSCVVSS---LSWSPCRSDSFVELTVIL  177

Query  3825  EVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTW  4004
             E +NE+I  RHT+EW+QKYALEQL ELSC+L ++LVE  ++ K  +   KLILQI+T  +
Sbjct  178   EALNEVILSRHTIEWMQKYALEQLVELSCNLYKMLVERVEIFKGKTQLVKLILQIVTSAF  237

Query  4005  KVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDC  4184
             K+SQKRKVYQPHFT+S+E L  LCE +D CC+G  SP+A+ GLEA+LMSTPPV ILQMD 
Sbjct  238   KISQKRKVYQPHFTISIESLLQLCEVVDECCDGRQSPVAQIGLEAVLMSTPPVNILQMDK  297

Query  4185  KKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGK  4364
             +KVSKF+ WA  IALQ + + +  +E     + + +EEET++SLIS L+RWL ASVI+GK
Sbjct  298   EKVSKFVRWATLIALQPKIENIHGLENFACIVRLQAEEETDDSLISMLVRWLAASVIVGK  357

Query  4365  ISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTS  4544
             +S + S  D  HS DRSKL NL  L+EWNE+   E  + FAC+  LA+SIF+LQQL  T+
Sbjct  358   LSPRFSNSDLCHSFDRSKLNNLLSLMEWNEQRCEETNRAFACEGTLASSIFFLQQLQCTN  417

Query  4545  FKLLPSAV  4568
             + +LPS V
Sbjct  418   YIVLPSVV  425



>ref|XP_008345051.1| PREDICTED: uncharacterized protein LOC103407956 [Malus domestica]
Length=564

 Score =   500 bits (1287),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 274/570 (48%), Positives = 377/570 (66%), Gaps = 17/570 (3%)
 Frame = +3

Query  3201  DDDTRK-LGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAE  3377
             DD  RK LG      F    ++CQK+K V ++QLLL+Y+QN IEE WQ+IPSV +IF AE
Sbjct  3     DDPFRKKLG------FYYPSQRCQKRKGVKQIQLLLTYVQNAIEEPWQRIPSVNSIFAAE  56

Query  3378  ASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGL  3557
              S +LLDPSH+HY  +T  LM+S  +N+K+I  F N  WS S++F+ ERLWILR++Y+GL
Sbjct  57    TSLILLDPSHEHYTALTTLLMRSSRLNVKNILFFSNFFWSSSINFKAERLWILRLVYAGL  116

Query  3558  NTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLIS  3737
             N D+D  IY+ NS+ E L+SFYVSP++D+ESKELI+Q VKK+ KL +MARHL+E CGL S
Sbjct  117   NFDEDAQIYMNNSVLEALMSFYVSPISDDESKELILQVVKKAVKLHKMARHLVEKCGLFS  176

Query  3738  WLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHL  3917
             WLSSV++      +   K     Q  VV EVVN++I      EWLQ+YALEQL EL+ HL
Sbjct  177   WLSSVLSVLGERHFRDGKSLFLLQLGVVSEVVNDVISLGKINEWLQQYALEQLMELASHL  236

Query  3918  CQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCC  4097
              + L+    ++K++      IL  + LT K+SQKR++YQPHF LSVEG +++ +A+ +C 
Sbjct  237   FKFLISDMTLIKDNVAAVNPILXAIILTLKISQKRRIYQPHFVLSVEGSYNIYKAVKICD  296

Query  4098  NGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFP  4277
             N       +  L+AILMS PPV I  +  +++S FI WA+S AL+++   + Q ++    
Sbjct  297   NARSCGTVELALKAILMSAPPVDIFCLSREQISSFIXWAVSAALEADFAKMXQPKESHLC  356

Query  4278  LNVSSEEET-ENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNE  4454
             L    EEE  ENSLISKLLRWLTASVILGK+ +K + LD   S  R  L  L  L+E  E
Sbjct  357   LTSIPEEELYENSLISKLLRWLTASVILGKLDWKSNDLDPEVS-KRLNLKTLQTLMELVE  415

Query  4455  E-SDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSG----SE  4619
               S+R++   + C+EILA++I +LQQL GT+ ++LPS  +AL LLL      +G    +E
Sbjct  416   SASERKSKSRYGCEEILASAILFLQQLAGTNHQMLPSVAAALSLLLYDGSVFTGFFCKNE  475

Query  4620  VLIGNAAALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKM  4799
              ++    +L SKI CPAEAN +WRW+FYQPWKD +   T S+K+EE+HAC  LL + S +
Sbjct  476   SVV---KSLWSKIGCPAEANLSWRWAFYQPWKDLTQEQTGSQKMEELHACHSLLDIVSNV  532

Query  4800  LARNSLYSKLISLKDVEKLGVFEWERSILN  4889
             L +      + S  DV++ G FEWERSI+ 
Sbjct  533   LGKRPSELLVSSTYDVDRFGAFEWERSIMQ  562



>ref|XP_006452312.1| hypothetical protein CICLE_v100072361mg, partial [Citrus clementina]
 gb|ESR65552.1| hypothetical protein CICLE_v100072361mg, partial [Citrus clementina]
Length=1794

 Score =   511 bits (1317),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 318/855 (37%), Positives = 498/855 (58%), Gaps = 42/855 (5%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             +LL++FP+++++S  +LGVP SLL S+ FLE S L + SK WPEMFF+GLE A+S ++  
Sbjct  946   ELLKSFPLVMTISHNLLGVPASLLPSMIFLEQSFLANASKLWPEMFFSGLEIAVSTIRH-  1004

Query  183   RTEEFG------------------DIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDL  308
                EF                   D D+ E A+ ALS FLK+A   ++FP  +++    L
Sbjct  1005  EVREFDVCRIPTHSSFDEEVLCNIDFDANESAAGALSFFLKQAPFHVMFPAIMTVGAPYL  1064

Query  309   STQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVD  488
             S    + +LLL  LS+   D ++S    VLF F Q   SYR EP  EL  LSE+C  ++ 
Sbjct  1065  SEPSKVQDLLLDKLSDWRTDCLISYLRLVLFCFFQIQSSYRDEPTAELLQLSEICIVLMK  1124

Query  489   RMLRQFLNTKGDASSKCTRSL-LPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFS  665
              +  Q L  K +     T  L L  + V E+ ET+  HP V ASL  PL C+ +      
Sbjct  1125  NVFTQLLVLKPNPGHPKTVGLHLSAENVWEVAETVLRHPAVFASLSSPLSCDLELPVGNL  1184

Query  666   GDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYF-CDGQTSSFEACHA--RQVTKAFK  836
             G +++ FL   + + +HK+D HV+++L  T + L+  C    +  E  +   + + KAF 
Sbjct  1185  GHNLETFLSLTQ-QSVHKIDRHVLDMLTATLDHLFSSCTDHYTILEVDNGVCKSLVKAFN  1243

Query  837   NVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLED  1016
              +V++LFL  +D+ D CI ++D+ PLLPA YA+H L RFI P +LLELVHWMF ++D+ +
Sbjct  1244  TLVRRLFLELRDKFDLCIATEDVLPLLPAFYALHALIRFISPLKLLELVHWMFRKVDVNE  1303

Query  1017  NSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKIL  1196
              S  +S     L VG  IAG  F++LS  + QP  +R   +L W   E  F +  +E+I 
Sbjct  1304  MSICKSCNVYALSVGFCIAGGTFEALSNYLQQPVEKRASYNLLWETEENSFGVNHIEEIY  1363

Query  1197  LQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNLLSYCMF  1376
             ++V ++A +  L +AD CLLK    + +   MQ  +P L + +SR IV  P+ ++S+C++
Sbjct  1364  IEVCKLAINFDLGLADTCLLKIVNCIYSQNYMQSVHP-LNLIMSRVIVKTPIEMISHCVY  1422

Query  1377  QINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNP-SDPELLMLLP  1553
             +    KA++LFL T+MSP+HLS+FG+LL G ++K   L  + +       SD E +MLLP
Sbjct  1423  RTTMTKAKVLFLFTKMSPMHLSVFGNLLVGSLNKDSLLTGSQMWTCGYAFSDEEFMMLLP  1482

Query  1554  TVFLYLDSVLIKAGSQV-KYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNLPLSI  1730
                 YL+   +K   Q  K+   I+SFY R+LL  F +WK +V+  +F  E     P S 
Sbjct  1483  AALSYLNMNFLKFEKQYHKHLMDILSFYSRMLLSGFRNWKSFVSGYIFQEEYDGFFPSST  1542

Query  1731  EEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQV  1910
             EE +++ + +LL ++VL++    AL G  +K +  ++LF+S+ P      + LDFD ++V
Sbjct  1543  EELLNLVNGSLLGKTVLLLHYHFALNGDSLKTKKLIKLFNSIFPCSGAQNELLDFDINEV  1602

Query  1911  GTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFS-------SGLKEDKMETCAELHSTLD  2069
              + S +QSLN +NR VAK++LCR LLFPE ++          GLK   +++ ++  ++  
Sbjct  1603  KSNSFKQSLNHINRVVAKVSLCRMLLFPEDDQVQFLPKAAEGGLKGISLKSGSDDQNS--  1660

Query  2070  VSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENC-SVFRFLEVLILRNIVELSKEMHG  2246
              SR+R + +LV SW+ +V K P  + +  + +  N  S++++LEV ILR+I EL  +M  
Sbjct  1661  -SRMRFMNILVGSWQWMVMKLPSISKDFERNKSANVLSLYKYLEVFILRSIFELVSKMSK  1719

Query  2247  CLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFE  2426
              L++L S+PF+ +L ++  ++RF+D  TL+ LR I++ L EGKFSC   +QL++AHSQF 
Sbjct  1720  GLIELQSIPFLEQLIRSALFYRFEDSTTLKMLRSILTLLLEGKFSCGLYLQLLLAHSQFA  1779

Query  2427  TAI----CSSNLSTG  2459
              +I     +SN   G
Sbjct  1780  ASIQSVSAASNAGGG  1794



>ref|XP_010438667.1| PREDICTED: uncharacterized protein LOC104722225 isoform X2 [Camelina 
sativa]
Length=550

 Score =   429 bits (1103),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 246/547 (45%), Positives = 350/547 (64%), Gaps = 17/547 (3%)
 Frame = +3

Query  3267  QKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQS  3446
             +K K V  L+LLL Y+QN +EE WQ+IP+V+AIF AEAS +LLDPSH+HY  I K L  S
Sbjct  12    RKNKHVTGLRLLLMYVQNGVEEPWQRIPTVSAIFAAEASLILLDPSHEHYVPINKLLKSS  71

Query  3447  PSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYV  3626
              ++ L+ IPLF +  WS +V+FR++R W LR++ +GL +D+D  IYIRNSI ET++SF  
Sbjct  72    STLKLRGIPLFHDFFWSSTVNFRSQRFWELRLVCAGLKSDEDAQIYIRNSILETVMSFSS  131

Query  3627  SPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFA  3806
             SPLAD+E+K LI+Q V+KS K  +MARHL+ENCGL SW S+ +++F         G    
Sbjct  132   SPLADDETKGLILQVVRKSVKFHKMARHLVENCGLFSWCSAFISTFTTKP----TGDEDL  187

Query  3807  QFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQ  3986
             +  V+LEV+ +++  R+  EWLQ+  LE L E+S  L ++L  G   ++E+ T   LILQ
Sbjct  188   RLVVILEVITDVLASRNVTEWLQRCGLEGLMEISSRLYRLLGGGLVSVQENGTSVDLILQ  247

Query  3987  ILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEAILMSTPPVA  4166
             IL+ T K+SQKRK+YQPHFT+++EG+F L E +    +      ++ GL  ILMS+PPV 
Sbjct  248   ILSATLKISQKRKMYQPHFTITIEGIFQLFEGVANSGSPQVEDSSEHGLITILMSSPPVD  307

Query  4167  ILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTA  4346
             I+ MD  K+ +F+ WA S AL+ + K V    +        +EE  E ++I+K LRWL A
Sbjct  308   IIDMDVDKLRRFLLWATSTALKCDHKRV--PSESHHDTKKITEEPEEETMIAKFLRWLLA  365

Query  4347  SVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQ  4526
             SVIL K+  K +  DS+    ++K   L  LLE+ ++ + E+  + + + I+   I YLQ
Sbjct  366   SVILRKLYSKANHSDST-VLSKTKPKTLLNLLEYFKKRNLEDSMKIS-EHIIEEVIVYLQ  423

Query  4527  Q-LLGTSFK-LLPSAVSALCLLLLKNPASSGSEVLIGN---AAALCSKIRCPAEANSAWR  4691
             + LL T+++ LLPS V AL L+LL N    G+E    +     +LCSKI  P EAN  WR
Sbjct  424   KHLLCTNYRVLLPSVVFALSLMLLHNDL--GTEDPNDDYKLIKSLCSKISSPPEANPGWR  481

Query  4692  WSFYQPWKDHSS-NLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISL-KDVEKLGVF  4865
             WS++Q W D SS   TD +KI+E+HACQ LLL+ S ML      S+ + L KD +   V 
Sbjct  482   WSYFQAWWDLSSEQATDLDKIDELHACQHLLLIFSDMLGETPGESQQVLLRKDFDISHVL  541

Query  4866  EWERSIL  4886
             EWERS++
Sbjct  542   EWERSLV  548



>ref|XP_006452310.1| hypothetical protein CICLE_v10007711mg [Citrus clementina]
 gb|ESR65550.1| hypothetical protein CICLE_v10007711mg [Citrus clementina]
Length=644

 Score =   426 bits (1094),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 265/553 (48%), Positives = 357/553 (65%), Gaps = 39/553 (7%)
 Frame = +3

Query  3285  MRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLK  3464
             MRL+LLL+Y+QN IEE WQ+IPSV AIF AEAS +LLDPSHDHY +++K LM+S  VNLK
Sbjct  1     MRLRLLLTYVQNGIEEPWQRIPSVIAIFAAEASLLLLDPSHDHYTSVSKLLMRSSRVNLK  60

Query  3465  ---------------------------------SIPLFQNLLWSDSVSFRTERLWILRIL  3545
                                              SIPLF +   S SV+FR ERLW+LR+L
Sbjct  61    VYALQILFLSLLCILYLCTMINFVSYSLRFCWQSIPLFHDFFSSSSVNFRKERLWMLRLL  120

Query  3546  YSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENC  3725
             Y+GLN DDD  +YIRNS+ E L+SFY SPL+D+ESKELI+  +KKS KL +MA +L+E+C
Sbjct  121   YAGLNLDDDAQVYIRNSVLEILMSFYASPLSDSESKELILLILKKSIKLHKMACYLVEHC  180

Query  3726  GLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSEL  3905
             GL SWLSS+++SF G+     K F  AQ  VV+EVVN++I  R+  EWLQ++ALEQL + 
Sbjct  181   GLFSWLSSLLSSFSGMLLGGEKMFLMAQLIVVVEVVNDVISSRNINEWLQRHALEQLVDF  240

Query  3906  SCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAI  4085
             S HL ++LV G ++++E+      IL IL  T K+SQKRK+YQPHFTLS+E  F +C+A+
Sbjct  241   SSHLYKLLVGGMKLMRENVPLVNSILLILISTVKISQKRKMYQPHFTLSLESFFQICQAV  300

Query  4086  DVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEK  4265
             D+         A+  L+ ILMS+P + I +++  K+S F+ WA+S AL+S++  + ++ +
Sbjct  301   DMYNTARSGANAELALKVILMSSPSIDIFRVNQVKLSSFLTWAISAALKSDSGQMYELRE  360

Query  4266  CCFPL-NVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLL  4442
                 L N+  +   E SL SKLLRWL ASVILGK+  KL    S  S    + +N     
Sbjct  361   SHLHLRNMLEDAPFEESLTSKLLRWLVASVILGKLYGKLDIPGSKLSKSLYETLN-SLFQ  419

Query  4443  EWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAV-SALCLLLLKNPASSGSE  4619
             ++  +    N   F C+EILAA+IFYLQQLLG     LPS + +   LLL     S+GS 
Sbjct  420   DFGNKCVENNKSRFDCKEILAAAIFYLQQLLGLCCGGLPSVISALSLLLLSDVSESAGSA  479

Query  4620  VLIGNA---AALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVA  4790
               +G+    A+L S+I CPAEAN  WRWSFYQPWKD S  LTD +KI+E+HACQ LL++ 
Sbjct  480   FKLGHRTSLASLWSRIHCPAEANPCWRWSFYQPWKDLSLELTDLQKIDELHACQTLLVII  539

Query  4791  SKMLARNSLYSKL  4829
             S +L + SL S+ 
Sbjct  540   SNVLGKKSLDSQF  552



>ref|XP_008668866.1| PREDICTED: uncharacterized protein LOC103645921 [Zea mays]
Length=586

 Score =   394 bits (1013),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 252/594 (42%), Positives = 356/594 (60%), Gaps = 21/594 (4%)
 Frame = +3

Query  3126  MGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLL  3305
             MGYIEP EFA LGLLA++L SI+SPD++ R LGY  L  FK +LE  Q+ K+  +LQLLL
Sbjct  1     MGYIEPAEFARLGLLAITLVSIASPDNELRMLGYECLGTFKKSLEYAQRSKETWQLQLLL  60

Query  3306  SYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQN  3485
             +YLQN I E WQKIPS+ A+F AEAS  LLD SH  +  +   LM S SVNL+SIPLF  
Sbjct  61    TYLQNGISEQWQKIPSIIAVFAAEASLTLLDGSHAQFTVMRNFLMHSTSVNLQSIPLFPT  120

Query  3486  LLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELII  3665
             LL S SV F+ ERLW+LR+L +G N  DD  IY R  + E  L+F  SP++D ESK L++
Sbjct  121   LLQSSSVHFKAERLWMLRLLSAGSNLADDAKIYKRGRVLELALAFCSSPVSDFESKVLVL  180

Query  3666  QTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVVLEVVNEII  3845
             + +KK  KL  +A HL++  G++ WL SV++    +  D  +        + LEVVN +I
Sbjct  181   KVLKKCVKLPVLAHHLVKESGILLWLLSVISVRSEVS-DGSESSCSRVTELALEVVNGLI  239

Query  3846  FFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRK  4025
               R   +WLQ+ ALEQLS +S +L  +L+  A++LK +       L ++T T ++S KRK
Sbjct  240   SSRLITDWLQETALEQLSTISSYL-SVLINNAKLLKGNVHLLTSALSVITSTMRLSMKRK  298

Query  4026  VYQPHFTLSVEGLFHLCEAIDVCCNGC-YSPIAKTGLEAILMSTPPVAILQMDCKKVSKF  4202
             +YQPHFTLS+ G+F+LC+ I        +  + + G++AILM+ P   + +MD  ++S  
Sbjct  299   IYQPHFTLSLHGVFNLCQTIGGSSRSTEHKLVMELGIDAILMNGPIPILSEMDKSRISMV  358

Query  4203  INWAMS--IALQSETKGVLQVEKCCFPLNVSSEEETEN-SLISKLLRWLTASVILGKISY  4373
             ++WA S    L S  + +L+         +S +E   N SL+SK+LR L ASVILGKIS 
Sbjct  359   VSWATSSIFWLYSNQRSLLE---------ISCKEPPRNESLLSKILRLLAASVILGKISS  409

Query  4374  KLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKL  4553
                      + + S+ +   C    N     E  K  +  + LA  I +LQ  +  +   
Sbjct  410   IFHGKSVDLAGNTSETL---CSFLDNAYERAETAKSCSVNDTLAVIILHLQDHMPKNSDS  466

Query  4554  LPSAVSALCLLLLKNPASSGSEVLIGNAAA---LCSKIRCPAEANSAWRWSFYQPWKDHS  4724
             LPS ++ALCLLLL   +   ++ L  N      LCSKI CPAE+N AWRW +YQPWKD +
Sbjct  467   LPSVIAALCLLLLDRSSKQVNKHLANNRGKIEMLCSKIGCPAESNPAWRWHYYQPWKDSA  526

Query  4725  SNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
                T  E++EE  AC+ LL++ S   +       ++SL DVEK G+F+WER ++
Sbjct  527   LQRTGMERLEEEQACRSLLVLFSSAFSACLSEFPVLSLDDVEKSGLFQWERDLM  580



>ref|XP_006653786.1| PREDICTED: uncharacterized protein LOC102722013 [Oryza brachyantha]
Length=584

 Score =   363 bits (931),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 252/599 (42%), Positives = 359/599 (60%), Gaps = 29/599 (5%)
 Frame = +3

Query  3126  MGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLL  3305
             MGYIEP EF+ LGLLA++L SISSPD+D RKLGY  L  FK +LE  QK K+  +LQLLL
Sbjct  1     MGYIEPAEFSRLGLLAITLVSISSPDEDLRKLGYESLGTFKKSLEASQKSKETWQLQLLL  60

Query  3306  SYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQN  3485
             +YLQN I E WQ+IPSV AIF AEAS  LLD SH  +ATI+K LM S SVNL+S+PLF  
Sbjct  61    TYLQNGISEPWQRIPSVIAIFAAEASLTLLDSSHTQFATISKFLMHSASVNLQSVPLFPA  120

Query  3486  LLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELII  3665
             LL S++V F+++ LW+L++LY+G N  DD  IY R S+ E  LS   S ++D+ +K L +
Sbjct  121   LLRSNAVHFKSDHLWMLQLLYAGSNLPDDAKIYKRGSVLELALSLGSSAVSDSTTKLLTL  180

Query  3666  QTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKG-FPFAQFAVVLEVVNEI  3842
             Q +KK  KL  +A HL ++ GL+ WLSS+++S  G   D  K  +        LEVV+++
Sbjct  181   QVLKKCVKLPVLAHHLTKHSGLLLWLSSLISSH-GDGLDSVKDTYSSTVIGTALEVVSDL  239

Query  3843  IFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKR  4022
                R   EWLQ+ ALEQLS +S +L  ++V+  ++LK ++    L+L ++  T ++S KR
Sbjct  240   TSSRLIAEWLQETALEQLSGISKYL-YVIVKDMKLLKGNAPLLTLVLTVIASTMRLSMKR  298

Query  4023  KVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIA-KTGLEAILMSTPPVAILQMDCKKVSK  4199
             K+YQPHF+LS+ G+  LC+ I          +A +  ++ ILM+ P   + +MD    + 
Sbjct  299   KIYQPHFSLSLHGIHKLCQTISGNSRSIELKLAMEICIDVILMNGPLPVVSEMDKSMTAT  358

Query  4200  FINWAMS--IALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGK---  4364
              ++WA S  + L  + + VL++ +         E      L+SK+LRWL AS+ILG+   
Sbjct  359   VVSWATSNILWLCGQQRSVLKMSQ--------GEALKNECLLSKMLRWLVASIILGRTSC  410

Query  4365  ISYKLSKL--DSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLG  4538
             IS++ + L  D+         +N  C          EN    +  E LA  I YLQ+ L 
Sbjct  411   ISHESAGLTRDADSFGSLQSFLNRMC-------GKVENVGSHSANEALAIIILYLQKHLK  463

Query  4539  TSFKLLPSAVSALCLLLLKNPASSGSEVLIGNAA---ALCSKIRCPAEANSAWRWSFYQP  4709
              +   LPSAV+AL LLLL           + N     +LCSKI+CPAE + AWRW +YQP
Sbjct  464   MNQDFLPSAVAALGLLLLDRSTKQAFRNFVDNRGQIESLCSKIQCPAEVDPAWRWHYYQP  523

Query  4710  WKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             W+D S + T++E++EE  ACQ LL++ S           + SL DVE  G+F+WER+ +
Sbjct  524   WRDPSMHRTETERLEEEQACQSLLIIFSNSFNAGLSGFPVFSLGDVENSGLFQWERNYM  582



>tpg|DAA35931.1| TPA: hypothetical protein ZEAMMB73_902980 [Zea mays]
Length=556

 Score =   349 bits (895),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 231/563 (41%), Positives = 330/563 (59%), Gaps = 21/563 (4%)
 Frame = +3

Query  3219  LGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLD  3398
             LGY  L  FK +LE  Q+ K+  +LQLLL+YLQN I E WQKIPS+ A+F AEAS  LLD
Sbjct  2     LGYECLGTFKKSLEYAQRSKETWQLQLLLTYLQNGISEQWQKIPSIIAVFAAEASLTLLD  61

Query  3399  PSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVH  3578
              SH  +  +   LM S SVNL+SIPLF  LL S SV F+ ERLW+LR+L +G N  DD  
Sbjct  62    GSHAQFTVMRNFLMHSTSVNLQSIPLFPTLLQSSSVHFKAERLWMLRLLSAGSNLADDAK  121

Query  3579  IYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVT  3758
             IY R  + E  L+F  SP++D ESK L+++ +KK  KL  +A HL++  G++ WL SV++
Sbjct  122   IYKRGRVLELALAFCSSPVSDFESKVLVLKVLKKCVKLPVLAHHLVKESGILLWLLSVIS  181

Query  3759  SFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEG  3938
                 +  D  +        + LEVVN +I  R   +WLQ+ ALEQLS +S +L  +L+  
Sbjct  182   VRSEVS-DGSESSCSRVTELALEVVNGLISSRLITDWLQETALEQLSTISSYL-SVLINN  239

Query  3939  AQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGC-YSP  4115
             A++LK +       L ++T T ++S KRK+YQPHFTLS+ G+F+LC+ I        +  
Sbjct  240   AKLLKGNVHLLTSALSVITSTMRLSMKRKIYQPHFTLSLHGVFNLCQTIGGSSRSTEHKL  299

Query  4116  IAKTGLEAILMSTPPVAILQMDCKKVSKFINWAMS--IALQSETKGVLQVEKCCFPLNVS  4289
             + + G++AILM+ P   + +MD  ++S  ++WA S    L S  + +L+         +S
Sbjct  300   VMELGIDAILMNGPIPILSEMDKSRISMVVSWATSSIFWLYSNQRSLLE---------IS  350

Query  4290  SEEETEN-SLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDR  4466
              +E   N SL+SK+LR L ASVILGKIS          + + S+ +   C    N     
Sbjct  351   CKEPPRNESLLSKILRLLAASVILGKISSIFHGKSVDLAGNTSETL---CSFLDNAYERA  407

Query  4467  ENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNAAA-  4643
             E  K  +  + LA  I +LQ  +  +   LPS ++ALCLLLL   +   ++ L  N    
Sbjct  408   ETAKSCSVNDTLAVIILHLQDHMPKNSDSLPSVIAALCLLLLDRSSKQVNKHLANNRGKI  467

Query  4644  --LCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSL  4817
               LCSKI CPAE+N AWRW +YQPWKD +   T  E++EE  AC+ LL++ S   +    
Sbjct  468   EMLCSKIGCPAESNPAWRWHYYQPWKDSALQRTGMERLEEEQACRSLLVLFSSAFSACLS  527

Query  4818  YSKLISLKDVEKLGVFEWERSIL  4886
                ++SL DVEK G+F+WER ++
Sbjct  528   EFPVLSLDDVEKSGLFQWERDLM  550



>gb|EEC78054.1| hypothetical protein OsI_17497 [Oryza sativa Indica Group]
Length=2415

 Score =   350 bits (899),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 280/981 (29%), Positives = 469/981 (48%), Gaps = 73/981 (7%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             D++ +FP ++ V K         L S+ FL+   L  V+   P+MFF+ L      L   
Sbjct  943   DVISSFPKLLHVLKTHFPSNLPFLSSVLFLQHDYLAKVASYCPDMFFSSLRQIKGNL---  999

Query  183   RTEEFGDIDSMEFA------------SAALSLFLKEASLCMLFPITLS--------IYKS  302
                   D+DS+               SA +S FL     C L P  LS        I K+
Sbjct  1000  ------DVDSVNIVEDKWGKHSTCSESAVISTFLNVTPFCALLPSVLSLAFSAPDEITKA  1053

Query  303   DLSTQQGLHNLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNI  482
                 Q  L +LL A +SE     +      VLFW +    SY V+  + L  L  +CF++
Sbjct  1054  HPLLQDELVHLLQAKISESPLSELTIFLRVVLFWSHHLLSSYTVKCSDILAQLCGVCFSL  1113

Query  483   VDRMLRQFLNTKGD-ASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDT  659
             +D +  +      D A+SK + +  P +C+  ++E++  HP++  SL C L    D  D 
Sbjct  1114  IDSIFERIRVLTADTANSKSSVAFYPVECLNGIVESVVQHPIIGLSLSCSLSNFQDLADG  1173

Query  660   FSGDSMDKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAF--  833
                   + F   +K + +H  D  V+NLL   + L+       +++     + +   F  
Sbjct  1174  SVEYVKEDFASFSKEK-LHLADSFVLNLLSNLYGLVLLAGSFGANYSNNDDQSLESLFGP  1232

Query  834   -KNVVQKLFLTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDL  1010
              K +++++ L FK++ + C+E ++    LP  Y   TL +F+ P  LLEL +WMFS    
Sbjct  1233  PKLLLERILLLFKEKFELCMEKRNFGLFLPNFYMFRTLAKFVSPVRLLELANWMFST--F  1290

Query  1011  EDNSFQQSLRDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEK  1190
             E  S             L+ A   F+ L   + Q   +R      WG+     DI  +++
Sbjct  1291  EGFSSSSPAYAPAAFCCLYTADIAFEMLYDYLQQI-DQRSGPCRLWGLEIHNCDIATIQQ  1349

Query  1191  ILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLV---MAISRFIVNIPVNLL  1361
             +   +   AT L+L+ AD+CLLK    +   ++    N   +   M +S  + N P+++L
Sbjct  1350  VYNIILHFATKLNLEFADLCLLKMLIRIHHTEISAVRNTDYIALHMMLSTMVANTPIDIL  1409

Query  1362  SYCMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPS---DP  1532
              +CMF  +K KA+ + L    +P+H+ +FG LL+ ++ K   +    +   SN S   + 
Sbjct  1410  HHCMFPTSKVKAKAIQLLLGANPMHMRLFGKLLTDILKKDTSVM-QVVGSDSNASWTHED  1468

Query  1533  ELLMLLPTVFLYLDSVLIKAGSQVKYFEKIVSFYWRILL--HIFSDWKCYVTRDMFDIES  1706
               ++LLP    Y++         V + E +  FY  ILL  + F  WK +VTR +F+ + 
Sbjct  1469  SFILLLPAALSYIEHHSGGNRQCVDFLEPVPVFYREILLSDNGFPCWKSFVTRSIFEEDF  1528

Query  1707  FDNLPLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDF  1886
              D    S+E+ M+ F   LL +S+ M++         +  + R+++  S+CPQ S   + 
Sbjct  1529  SDFRHTSVEDIMNYFGDTLLGKSITMLRY--YFYSKEIPRKQRLKIIASICPQSS---EL  1583

Query  1887  LDFDPSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTL  2066
             LD D S V   S    +   N   AKI+L R LL P     ++ +  +K          +
Sbjct  1584  LDSDISFVTPVSCNGIMKLTNELFAKISLIRMLLSPPRGSLNNEIAPEKES------KRV  1637

Query  2067  DVSRIRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHG  2246
             + +++  + +LV +  KI   FP + D       E  +V   LE  IL+NIVELS E+  
Sbjct  1638  NNAKLSFISILVRTLDKIFRNFPHS-DGILLSSPEEQNVVSCLEYAILKNIVELSSEVQS  1696

Query  2247  CLVKLDSLPFIVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQFE  2426
              L +L  +PF+ +L +++  HRF DP+ ++ +R II  LSEGKF   +I++L++ HS F 
Sbjct  1697  HLNQLKPIPFLNQLIRSSLLHRFSDPVVIKAIRCIIVVLSEGKFPADEILELILGHSHFV  1756

Query  2427  TAICSSNLS---TGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLEL  2597
             + I  S +S   +  +  G    P PS+++S        ++  +++  Q      K++E+
Sbjct  1757  STITCSGVSECPSACNPTGGLLQPAPSILKSV------DSAFAKENKFQDCIPERKKVEI  1810

Query  2598  IKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSIS  2777
             I+LLR+L+ +K+RQ +     E     R+L FLLLS Y ATL + D EI +L+NEI+  S
Sbjct  1811  IRLLRILYDIKSRQHNSSLLDES----RELGFLLLSVYGATLSETDLEILHLMNEIE--S  1864

Query  2778  DSNISIAEWDYLWGNAVVKAR  2840
                 +I + D+LWG A   ++
Sbjct  1865  SECKAITDVDHLWGKAAATSQ  1885


 Score =   348 bits (894),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 239/607 (39%), Positives = 322/607 (53%), Gaps = 95/607 (16%)
 Frame = +3

Query  3078  IYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNAL  3257
             IYDP+FIL  S H L MGYIEPVEF+ LGLLA++L SISSPD+D RKLGY  L  FK +L
Sbjct  1892  IYDPVFILHFSIHTLLMGYIEPVEFSRLGLLAITLVSISSPDEDLRKLGYESLGTFKKSL  1951

Query  3258  EKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHL  3437
             E  QK K+  +LQLLL+YLQN I E WQ+IPSV AIF AEAS  LLD SH  +ATI+K L
Sbjct  1952  EASQKSKETWQLQLLLTYLQNGISEQWQRIPSVIAIFAAEASLTLLDSSHTQFATISKFL  2011

Query  3438  MQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLS  3617
             M S SVNL+                         +LY+G N  DD  IY R  + E  LS
Sbjct  2012  MHSASVNLQ-------------------------LLYAGSNLADDAKIYKRGGVLELALS  2046

Query  3618  FYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGF  3797
             +  S ++D+E+K L                                              
Sbjct  2047  YGSSAVSDSETKLL----------------------------------------------  2060

Query  3798  PFAQFAVVLEVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKL  3977
                     L+VVN++   R   EWLQ+ ALEQLS +S +L  +LVE  ++LK +      
Sbjct  2061  -------TLQVVNDLTSSRLIAEWLQETALEQLSRISKYL-YVLVEDMKLLKGNVPLLTS  2112

Query  3978  ILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIA-KTGLEAILMST  4154
             +L ++  T ++S KRK+YQPHF+LS+ G+  LC  I          +A + G++ ILM+ 
Sbjct  2113  VLNVIASTMRLSMKRKIYQPHFSLSLHGIHKLCRTIGGISRSIEVKLAMQLGIDVILMNG  2172

Query  4155  PPVAILQMDCKKVSKFINWAMS--IALQSETKGVLQVEKCCFPLNVSSEEETENS-LISK  4325
             P   + +MD    +  ++WA S    L  E + VL++           EE  +N  L+SK
Sbjct  2173  PLPVLSEMDKSMTATVVSWATSNIFWLCDEQRSVLKMPH---------EEPLKNECLLSK  2223

Query  4326  LLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILA  4505
             +LRWL AS+ILGKIS    +     + D +   +L   L +  +   E     +  E LA
Sbjct  2224  MLRWLVASIILGKISCISHEKCGDLTRDPNNFGSLESFLNYTYDEKVETVGSHSADEALA  2283

Query  4506  ASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPASSGSEVLIGNAAA---LCSKIRCPAEA  4676
               I YLQ+ L  +   LPS V+ALCLLLL           IG+      LCS+I+CPAEA
Sbjct  2284  IIILYLQKHLKMNRDFLPSVVAALCLLLLDRSNKQVIRNFIGDYGQIEMLCSQIQCPAEA  2343

Query  4677  NSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKL  4856
             N AWRW +YQPWKD + +  ++E +EE  ACQ LL++ S   +       ++SL DVEK 
Sbjct  2344  NPAWRWHYYQPWKDPAMHRNEAEHLEEEQACQSLLVMFSNSFSAGLSGFPVLSLGDVEKS  2403

Query  4857  GVFEWER  4877
             G+F+WER
Sbjct  2404  GLFQWER  2410



>gb|KGN44665.1| hypothetical protein Csa_7G368170 [Cucumis sativus]
Length=417

 Score =   321 bits (822),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 191/412 (46%), Positives = 269/412 (65%), Gaps = 16/412 (4%)
 Frame = +3

Query  3672  VKKSAKLSRMARHLIENCGLISWLSSVV-TSFCGIKYDHWKGFPFAQFAVVLEVVNEIIF  3848
             +KKS KL RMA +L+EN GL SWL S++ TS   +  D    FP  Q A+VLEVVN +I 
Sbjct  1     MKKSVKLQRMAFYLVEN-GLFSWLCSIISTSSRRLTEDQKSIFP-KQLALVLEVVNNVIS  58

Query  3849  FRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKV  4028
             FR+  EWLQK ALEQL E S ++ +ILV G Q+L         ILQI+T   ++SQKRK+
Sbjct  59    FRNICEWLQKDALEQLMEFSSNIFKILVGGEQLLLIEGALVNQILQIITSVLRISQKRKI  118

Query  4029  YQPHFTLSVEGLFHLCEAI-DVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFI  4205
             +QPHFT S+EGLFH+ +A+  + C    S  A +GL+ ILM+ P +++L+MD K+ S F+
Sbjct  119   FQPHFTFSIEGLFHIYQAVHKLDCTRLGSNSA-SGLKMILMNMPQISLLRMDPKRCSGFL  177

Query  4206  NWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILGKISYKLSK  4385
             +WA+S AL+ +++ + + E     ++ S EE  + SL SKLLRWL+AS ILGK+S    K
Sbjct  178   SWAVSTALEFDSRMIAK-ESHLGLISESDEEHFDESLTSKLLRWLSASAILGKVSL---K  233

Query  4386  LDSSHSCDRSKLIN-LHCLLEWNEESDRENG-KEFACQEILAASIFYLQQLLGTSFKLLP  4559
              D  H     +L   L+ LLE  + +  +N  +EF C+ +LAA+IFYLQQ L +SF +LP
Sbjct  234   FDCMHLRTSERLSGTLYSLLEHVKNTRDDNSLQEFGCEGLLAANIFYLQQHLQSSFMVLP  293

Query  4560  SAVSALCLLLLKNPASSGSEVLIGNAAALC---SKIRCPAEANSAWRWSFYQPWKDHSSN  4730
               +SALCLLL    A   +++     A L    SKIRCP E N AWRW+FYQPWKD+S  
Sbjct  294   VVISALCLLLFD--ALISADLFHSEGADLAQHLSKIRCPEEVNPAWRWTFYQPWKDYSLE  351

Query  4731  LTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWERSIL  4886
             LT+ +K++E+HACQ L LV S +L++  L  +++  +D+E   VFEWER+++
Sbjct  352   LTNLQKMDEVHACQTLQLVISNILSKKPLDLQVLLPQDIEISRVFEWERNLI  403



>ref|XP_010092142.1| hypothetical protein L484_017831 [Morus notabilis]
 gb|EXB50293.1| hypothetical protein L484_017831 [Morus notabilis]
Length=310

 Score =   312 bits (800),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 195/256 (76%), Gaps = 1/256 (0%)
 Frame = +3

Query  3060  EVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLE  3239
             +V N   YDP+FILR S + L++GYIEP+EFA LGLLA++  S+SSPD+  RKL Y  L 
Sbjct  11    DVENLERYDPVFILRFSLYSLTVGYIEPMEFAGLGLLAIAFVSMSSPDEGIRKLAYSTLG  70

Query  3240  KFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYA  3419
             KFK+ LE+C+K+K+V R++LLLS LQN IEE WQ+IPSV +IF AEASF+LLDPSHD Y+
Sbjct  71    KFKDTLEQCKKRKEVTRIRLLLSSLQNGIEEPWQRIPSVVSIFAAEASFILLDPSHDQYS  130

Query  3420  TITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSI  3599
             T+++ LM S  +NLK++P+F +  WS SV++R +RLWILR++Y+GLN+ DD  IYIRNSI
Sbjct  131   TLSRLLMNSSKLNLKNVPVFSDFFWSTSVNYRADRLWILRLVYAGLNSSDDAQIYIRNSI  190

Query  3600  FETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKY  3779
              ET +SFY SPL+D ESK+LI+Q VK+S K  ++ RHL+E+CGL+ WLSSV+T+      
Sbjct  191   PETFMSFYFSPLSDTESKDLILQVVKRSVKSYKLTRHLVESCGLLLWLSSVLTANTRNSR  250

Query  3780  DHWKGFPFAQFAVVLE  3827
             +    F   Q  VVLE
Sbjct  251   EETNIF-IMQLTVVLE  265



>gb|EMS50591.1| hypothetical protein TRIUR3_05504 [Triticum urartu]
Length=2516

 Score =   333 bits (854),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 199/438 (45%), Positives = 283/438 (65%), Gaps = 29/438 (7%)
 Frame = +3

Query  2463  SQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQV  2642
             S  G    P P +++S V  LF      +++   +     +++E+I+LLR+L+ +K+RQ 
Sbjct  1658  SHKGSLLQPAPGILKS-VDSLFT-----KENEFHICIAEKRKIEIIRLLRILYDIKSRQ-  1710

Query  2643  DIEPAQEIGI--NLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLW  2816
                  Q  G+    ++L FLLLS Y ATL + D EI NL+NEI+S      +IAE D+LW
Sbjct  1711  -----QSNGLLNESKELSFLLLSVYGATLSETDLEIFNLMNEIES--HECKTIAEMDHLW  1763

Query  2817  GNAVVKARKERELVQTVS-CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPN  2993
             G+A VK R+E +L  ++S  + ++   +   R+  FREN+PID K+C  TVL F Y R +
Sbjct  1764  GSAAVKYREELKLDSSISEIHKTENTESNSRRRALFRENIPIDSKLCVMTVLQFCYKRSS  1823

Query  2994  GPGV--VNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGL  3167
                V  + ++++D FD + +          IYDP+FILR S H L MGYIEP EF+ +GL
Sbjct  1824  RTSVFSLEQLRQDKFDDILK----------IYDPMFILRFSIHTLLMGYIEPAEFSRVGL  1873

Query  3168  LAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKI  3347
             LA++L  ISSPD++ RKLGY  L  FK +LE  QK K+  +LQLLL+YLQN I + WQ+I
Sbjct  1874  LAITLVCISSPDEELRKLGYESLNTFKKSLEASQKSKEKWQLQLLLTYLQNGISKPWQRI  1933

Query  3348  PSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERL  3527
             PS+ AIF AEAS  LLD SH  + TI+K LM S  V+++SIPLF  LL S SV F+ +RL
Sbjct  1934  PSIIAIFAAEASLTLLDSSHTQFNTISKFLMNSACVDMQSIPLFPTLLKSSSVHFKADRL  1993

Query  3528  WILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMAR  3707
             W+LR+LY+G N  DD  I    S+ E  L+F  S ++D+ESK LI+Q +KK  KL  +A+
Sbjct  1994  WMLRLLYAGSNLADDATICKNKSVLELALAFCSSAISDSESKYLILQVLKKCVKLPVLAQ  2053

Query  3708  HLIENCGLISWLSSVVTS  3761
             HL++NCGL+SW+SSV+++
Sbjct  2054  HLVKNCGLLSWISSVIST  2071


 Score =   211 bits (537),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 182/664 (27%), Positives = 312/664 (47%), Gaps = 44/664 (7%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQ--  176
             D++ +FP ++ V K         L S+ +L+   L +++  WP++FF  L      L   
Sbjct  1025  DIICSFPELLDVVKTHCPSHMQFLSSVLYLQHDYLAEIATCWPDIFFCSLRQIEGNLDVD  1084

Query  177   EGRTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLL-----  341
             EG+ +      S+     ALS FL     C L P  LS+  S  +     H LLL     
Sbjct  1085  EGKCQNH----SISAELTALSTFLNVTPFCALLPSVLSLVFSGPAKTGEAHALLLDALVR  1140

Query  342   ---ANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLN  512
                A L E     +  +   +LFW ++  +SY  +    LE L  +C  +VD +  +   
Sbjct  1141  LIRAKLYESIISELTFNLRVILFWSHRLLLSYTRKGSNVLEELCHVCSTLVDSIFERIRV  1200

Query  513   TKGDASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLE  692
                D +     +    +C Q+++E++ +HP +   L C L    D TD  S + +++   
Sbjct  1201  LAADTADLNASA----ECFQDIVESVLHHPTI--DLPCSLSNCPDLTDG-SAEHVEEAFT  1253

Query  693   SNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKD  872
             S     +H +D  V+NLL   ++LL   +    S E+  A     + K ++ K+ L FKD
Sbjct  1254  SFSKENLHLVDGFVVNLLSKLYDLLLLAENDGQSLESLFA-----SPKAMLGKILLLFKD  1308

Query  873   RTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVL  1052
             +   C+++ +   LLP  Y +  LK+F+ P  LLELV+WMFS ++   +S   +   +  
Sbjct  1309  KFQVCMDNGNFGLLLPNFYMVRALKKFMSPVRLLELVNWMFSELESRGSSCSAAFAPAAF  1368

Query  1053  RVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHL  1232
              V L IA    + L   + Q   +R  S   WG+     DI  ++++   +      L+L
Sbjct  1369  -VCLSIADIAMELLYDYLQQT-DQRSESCQLWGLEIRSSDIATIQRVYHFILHFTAKLNL  1426

Query  1233  DVADMCLLKAFKVVKTHKVMQQSN-----PTLVMAISRFIVNIPVNLLSYCMFQINKRKA  1397
             + AD+CLLK   +++ H   + +          M +S   +N P+++L +CMF  +K KA
Sbjct  1427  ESADVCLLKM--LIRIHNAERSAGQNTEYTAFHMMLSTMAINTPLSILHHCMFPTSKVKA  1484

Query  1398  ELLFLATEMSPLHLSIFGHLLSGMIDKQVHL--QTNAIRETSNPSDPELLMLLPTVFLYL  1571
             ++L L  E+SP+H++ FG +L  ++++   +    +   ++S       ++LLP    Y+
Sbjct  1485  KVLRLLLEVSPIHMNFFGQMLMKVLEEDTSILQGMDYNSDSSWAHADSSILLLPAALSYM  1544

Query  1572  DSVLIKAGSQVKYFEKIVSFYWRILL--HIFSDWKCYVTRDMFDIESFDNLPLSIEEFMD  1745
                        ++ E +  FY  +LL  + F  WK ++TR +F+    D    S+ + MD
Sbjct  1545  RHHSDGHMQCAEFLEPLAKFYCEMLLGDNGFPCWKSFITRTIFEENFGDFQHESVPDMMD  1604

Query  1746  IFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGTCSL  1925
              FS  LL +SV M+  C +L     K   R+E+  S+CPQ S     LDFD + +   S 
Sbjct  1605  YFSDTLLGKSVTMLHYCLSLKEMPRK--QRLEIVASLCPQSS---GLLDFDVNDINPDSH  1659

Query  1926  EQSL  1937
             + SL
Sbjct  1660  KGSL  1663


 Score =   202 bits (514),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 134/357 (38%), Positives = 197/357 (55%), Gaps = 20/357 (6%)
 Frame = +3

Query  3828  VVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWK  4007
             V++ +I  R   EWLQ+ ALEQLSE+S +L  +LVE  ++LK   T    +L I+  T +
Sbjct  2164  VLDVLILSRFITEWLQETALEQLSEISQYL-YLLVEDGKILKGDFTMLSSVLNIIASTMR  2222

Query  4008  VSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIA-KTGLEAILMSTPPVAILQMDC  4184
             +S KRK+YQPHFTLS+ G+F LC+AID         ++ + G + +LM+ P   + + D 
Sbjct  2223  LSMKRKIYQPHFTLSLHGIFKLCQAIDGNSRSIELKLSMELGTDVVLMNGPLPILSETDK  2282

Query  4185  KKVSKFINWAMS-IALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVILG  4361
              +    ++W  S I    + K  +++  C  PLN          L+SK+LRWL ASVILG
Sbjct  2283  SRAVMVVSWVTSNIFWLCKQKSAVEM-SCEEPLN-------NECLLSKILRWLVASVILG  2334

Query  4362  KISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGT  4541
             +IS    +     +   +    L   L  + E+  E        E LAA I YLQ  +  
Sbjct  2335  RISRISPEKRGGLATSTNSPGTLQSFLNHSSET-VEMVDSHVADEALAAIILYLQGHVKK  2393

Query  4542  SFKLLPSAVSALCLLLLKNPASSGSEVLI---GNAAALCSKIRCPAEANSAWRWSFYQPW  4712
                 LPS V+AL LLLL        +VL+   G    LCSKI CPAE+N AWRW +YQPW
Sbjct  2394  KSDTLPSVVTALSLLLLDR---CREQVLVDGRGQIETLCSKIHCPAESNPAWRWHYYQPW  2450

Query  4713  KDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYS--KLISLKDVEKLGVFEWER  4877
             +D +   T +E++E   +C+ LL++ S  L+   L +   ++S+ D+EK G+F+WER
Sbjct  2451  RDPALQHTATERMEVEQSCRSLLIMFSNALSAAGLPAGVSVLSVGDIEKSGLFQWER  2507



>ref|XP_001756292.1| predicted protein [Physcomitrella patens]
 gb|EDQ78688.1| predicted protein [Physcomitrella patens]
Length=2778

 Score =   296 bits (758),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 187/620 (30%), Positives = 332/620 (54%), Gaps = 19/620 (3%)
 Frame = +3

Query  2586  QLELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEI  2765
             QL L++L+R LFQVK    D   + E    + +L+ LLL++Y AT   +D EI+ L+ ++
Sbjct  1928  QLALLQLVRSLFQVKMHPGDEILSSEDRATVEELLSLLLAAYGATTGRLDTEIYALMKQL  1987

Query  2766  KSISDSNIS-IAEWDYLWGNAVVKARKER--ELVQTVSCNLSDAEVAEDCRKIQFRENLP  2936
             +S      S +A  DYLWG A ++ RK +  E  Q +   L   E   + RK  ++E+L 
Sbjct  1988  ESYGGPGFSGLASMDYLWGEAALQRRKAKVEEKSQLMDEGLEIDENVLESRKRTYKEDLT  2047

Query  2937  IDPKMCASTVLYFP----YGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRHI-YDPIFIL  3101
             +DP+ C  +VL FP    +    G   V    K  F S   D   E+  +   YDP +IL
Sbjct  2048  LDPRRCGLSVLCFPTLAHHSITLGNREVGAKSKKVFLSDTYDADLELQLKGTAYDPRYIL  2107

Query  3102  RLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKD  3281
             +   H +++  I+  EF  LGLLAV++AS+SS D+D R+LGY +L K+ + LE+    K 
Sbjct  2108  QFGLHGIAVKCIDAEEFVCLGLLAVAIASLSSSDEDMRRLGYKLLAKYMSILEEGSTFKG  2167

Query  3282  VMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNL  3461
               ++++LL+Y++N + E+WQ++P V  +F AE S +L+ P + H+  IT++L++ P+++L
Sbjct  2168  QPQIRMLLNYVKNAVTEEWQQLPFVLMLFAAECSCILMHPENPHFMVITRYLLKGPALDL  2227

Query  3462  KSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLAD  3641
             + +PLF ++  S S   R+ERLW+LR+L  GL+T  D  ++ R  + E L+SFY SPLAD
Sbjct  2228  EYVPLFHSMFGSGSPRHRSERLWMLRLLACGLSTSRDARVFRRQFVLEILMSFYNSPLAD  2287

Query  3642  NESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQFAVV  3821
             + +++ ++Q + KS ++    + L+E  G + WL+S V ++  I      G       ++
Sbjct  2288  SFARKWVLQVLLKSTRVRGCVQALVERSGFLPWLASAVVNYRDISISEQDGKEADDLPIM  2347

Query  3822  L--EVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILT  3995
             +  +++  ++ ++   +      + +L+  +  L   L  G +  K+ + F +  ++I+T
Sbjct  2348  ILEQIMERLLRWKFFEQRCLGEGMAELTTAALTLRYFLTHGTRTPKQRAIFRRPAIRIMT  2407

Query  3996  LTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTG------LEAILMSTP  4157
                + SQ+RK ++ HF LS+  +      ++         I  T       L  +L S+P
Sbjct  2408  YALRSSQRRKKHETHFNLSLRDILEAIRWVESEGPDSGYGIETTAETRALVLHMLLQSSP  2467

Query  4158  PVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRW  4337
             P      D + + +  +WA+ +A ++      +        +     E    L  KL RW
Sbjct  2468  PAVSTPEDKELLCEVSSWAVPVASRTLVNAAYKQSTGSGHADFKKLPE---GLPEKLARW  2524

Query  4338  LTASVILGKISYKLSKLDSS  4397
             +TAS+++GK++   S+  S+
Sbjct  2525  VTASLVIGKLALVRSQQGSA  2544



>ref|XP_006653787.1| PREDICTED: uncharacterized protein LOC102722296 [Oryza brachyantha]
Length=1835

 Score =   288 bits (736),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 242/858 (28%), Positives = 411/858 (48%), Gaps = 45/858 (5%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAISGLQEG  182
             D+++NFP ++ V K         L SI FL+   L  V+   P++FF+ L      L   
Sbjct  959   DVIRNFPELLHVVKTHFPSNLPFLSSILFLQHDYLAKVATCCPDIFFSSLGQIKGNLDAD  1018

Query  183   RTEEFGD---IDSMEFASAALSLFLKEASLCMLFP--ITLSIYKSDLST------QQGLH  329
                   D     S+   SAA+S FL  +  C L P  ++L++   D +T      Q  L 
Sbjct  1019  NVNTVADRRGKHSISAESAAISTFLNVSPFCALLPSVLSLTLSAPDENTKAHALLQNELV  1078

Query  330   NLLLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFL  509
             +LL A +SE     +      VLFW +    SY V+  + LE L  +C +++D +  +  
Sbjct  1079  HLLQAKVSESPLSELTVFLRAVLFWSHHLVSSYIVKHSDILEQLCGVCLSLIDSIFERIR  1138

Query  510   NTKGD-ASSKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKF  686
                 D A+SK + +  P +C+  +I+++  HP+V+ SL C L    D          + F
Sbjct  1139  VLTADTANSKSSLAFYPVECINGIIDSVVQHPIVSLSLSCSLSNIQDLAHGSVECVKENF  1198

Query  687   LESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAF---KNVVQKLF  857
                +K + +H  D  V+NLL   + +L   D   +++     + +   F   K +++++ 
Sbjct  1199  ASFSKEK-LHLADSFVLNLLSNLYGVLLLADSFGANYSNKDDQSLESLFGRPKQLLERIL  1257

Query  858   LTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSL  1037
             L FK++ + C++ ++    LP  Y + +L +F+ P  LLEL  WMFS    E +S     
Sbjct  1258  LLFKEKFELCMDKRNFGLFLPTFYMVCSLAKFMSPVRLLELADWMFST--FESSSSSSLA  1315

Query  1038  RDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIA  1217
                     L+ A    + L   + Q   +R      WG+     D V ++++   +   A
Sbjct  1316  YTPAAFFCLYTADLALEMLYDYLQQI-DQRSQPCRLWGLEIHNSDFVTIQRVYNIILHFA  1374

Query  1218  THLHLDVADMCLLKAFKVVKTHKVMQQSNP---TLVMAISRFIVNIPVNLLSYCMFQINK  1388
             T L+L+ AD+ LLK    +   +     N     L M +S  + N P+N++ +CMF  +K
Sbjct  1375  TKLNLEFADIFLLKMLTRIHYSERSAGRNTDDIALHMMLSTMVANTPINIIRHCMFPTSK  1434

Query  1389  RKAELLFLATEMSPLHLSIFGHLLSGMI--DKQVHLQTNAIRETSNPSDPELLMLLPTVF  1562
              KA+ + L    +P+H+ +FG +   ++  D  V   T +    S   +   ++LLP   
Sbjct  1435  VKAKAIQLLLGANPMHMRLFGKIFMDILKNDTSVLQVTGSNSNASWAHEDSFILLLPAAL  1494

Query  1563  LYLDSVLIKAGSQVKYFEKIVSFYWRILL--HIFSDWKCYVTRDMFDIESFDNLPLSIEE  1736
              Y++         V++ E +  FY  ILL  + F  WK +VTR +F+ +  D    S+E+
Sbjct  1495  SYMEHHGGINRQCVEFLEPVPVFYGEILLSDNGFPCWKSFVTRSVFEEDYSDFRHTSVED  1554

Query  1737  FMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFDPSQVGT  1916
              M+ F   LL +S+ M+     L    +  + R+E+  S+CPQ S   + LD D S +  
Sbjct  1555  IMNYFCDTLLGKSITMLHYYFCLKD--ISRKKRLEIISSICPQSS---ELLDSDISLITP  1609

Query  1917  CSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSRIRLLKM  2096
              S    + F N   AKI+L R LL P  +  +    E   +        ++ +++  + +
Sbjct  1610  VSCNGIMKFTNELFAKISLIRMLLSPRISLTNDVAPEKDSKR-------VNNAKLNFISI  1662

Query  2097  LVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVKLDSLPF  2276
             LV ++  I+  FP + D       +  +V  FLE +IL+NIVELS E+   L +L  +PF
Sbjct  1663  LVRTFDNILRNFPQS-DGILVSSPKEQNVVSFLEYVILKNIVELSSEIQSHLNRLKPIPF  1721

Query  2277  IVKLAKTTFWHRFDDPMTLQKLRDIISSLSEGKFSCVKIIQLMVAHSQF-ETAICSSNLS  2453
             + +L +++  HRF DP+ ++ +R I+  LSEGKF   +II+L++ HS F  T ICS    
Sbjct  1722  LNQLIRSSLLHRFSDPVVIKAIRCILVVLSEGKFPADEIIELILGHSHFVSTIICS----  1777

Query  2454  TGISQLGLTFTPLPSLMR  2507
              G+SQ     TP  +L++
Sbjct  1778  -GVSQRPSACTPTGNLLQ  1794



>gb|EMT14380.1| hypothetical protein F775_01479 [Aegilops tauschii]
Length=2081

 Score =   269 bits (687),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 155/318 (49%), Positives = 210/318 (66%), Gaps = 5/318 (2%)
 Frame = +3

Query  2907  RKIQFRENLPIDPKMCASTVLYFPYGRPNGPGV--VNKVQKDTFDSMHEDCSAEVANRHI  3080
             R   FREN+PID K+C  TVL F Y R +   V  + ++++D FD + +  S  +    I
Sbjct  1417  RAALFRENIPIDSKLCVMTVLQFCYKRSSRTSVFSLEQLRQDKFDDILKTTSRSIDMVRI  1476

Query  3081  YDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALE  3260
             YDP+FIL    H L MGYIEP EF+ +GLLA++L SISSPD++ RKLGY  L  FK +LE
Sbjct  1477  YDPMFILCFLIHTLLMGYIEPAEFSRVGLLAITLVSISSPDEELRKLGYESLNTFKKSLE  1536

Query  3261  KCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLM  3440
               QK K+  +LQLLL+YLQN I + WQ+IPS+ AIF AEAS  LLD +H  + TI+  LM
Sbjct  1537  ASQKSKEKWQLQLLLTYLQNGISKPWQRIPSIIAIFTAEASLTLLDSTHTQFNTISNFLM  1596

Query  3441  QSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSF  3620
              S SV+++SIPLF  LL S SV F+ +RLW+LR+LY+G N  DD  I    S+ E  L+F
Sbjct  1597  NSASVDMQSIPLFPTLLKSSSVHFKADRLWMLRLLYAGSNLADDATICKNKSVLELALAF  1656

Query  3621  YVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFP  3800
               S ++D+ESK LI+Q +KK AKL  +A+HL++ CGL+SW+SSV+++      D+     
Sbjct  1657  CSSAISDSESKHLILQVLKKCAKLPVLAQHLVKTCGLLSWISSVIST-QDKGLDNNSSSR  1715

Query  3801  FAQFAVVLEVVNEIIFFR  3854
              A  A  LEV+N +I  R
Sbjct  1716  IAGLA--LEVLNALILSR  1731


 Score =   188 bits (477),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 158/571 (28%), Positives = 275/571 (48%), Gaps = 41/571 (7%)
 Frame = +3

Query  231   ALSLFLKEASLCMLFPITLSIYKSDLSTQQGLHNLLL--------ANLSERTPDHIVSSF  386
             ALS FL     C L P  LS+  S  +     H LLL        A L E T   +  + 
Sbjct  723   ALSTFLNVTPFCALLPSVLSLVFSGPAKTGEAHALLLDALVRLIRAKLYESTISELTFNL  782

Query  387   LYVLFWFNQAHISYRVepleelemlselCFNIVDRM---LRQFLNTKGDASSKCTRSLLP  557
               +LFW ++  +SY  +    LE L  +C  +VD +   +R       D ++        
Sbjct  783   RVILFWSHRLLLSYTRKGSNVLEELCHVCSTLVDSIFERIRVLAANTADLNAS-------  835

Query  558   TKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFLESNKWRVIHKMDLHVI  737
              +C Q+++E++ +HP +   L   L    D TD  S + +++   S     +H +D  V+
Sbjct  836   AECFQDIVESVLHHPTI--DLPRSLSNCPDLTDG-SAEHVEEAFTSFSKENLHLVDGFVV  892

Query  738   NLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQKLFLTFKDRTDKCIESKDLTPLL  917
             NLL   ++LL        S E+  A     + K +++K+ L FKD+ + C+++ +   LL
Sbjct  893   NLLSKLYDLLLLAGNDGQSLESLFA-----SPKVMLEKILLLFKDKFEVCMDNGNFGLLL  947

Query  918   PAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLRDSVLRVGLHIAGSVFDSLS  1097
             P  Y +  LK+F+ P  LLELV+WMFS ++   +S   +   +   V L +A    + L 
Sbjct  948   PNFYMVRALKKFMSPVRLLELVNWMFSELESRGSSCSAAFAPAAF-VCLSVADIAMELLY  1006

Query  1098  ACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIATHLHLDVADMCLLKAFKVVK  1277
               + Q   +R  S   WG+     DI  ++++   +      L+L+ AD+CLLK   +++
Sbjct  1007  DYLQQT-DQRSESCQLWGLEIRSSDIATIQRVYHFILHFTAKLNLESADVCLLKM--LIR  1063

Query  1278  THKVMQQSN-----PTLVMAISRFIVNIPVNLLSYCMFQINKRKAELLFLATEMSPLHLS  1442
              H   + +          M +S    N P+++L +CMF  +K KA++L+L  E+SP+H++
Sbjct  1064  IHNAERSAGQNTEYTAFHMMLSTMATNTPLSILHHCMFPTSKVKAKVLWLLLEVSPIHMN  1123

Query  1443  IFGHLLSGMIDKQVHL--QTNAIRETSNPSDPELLMLLPTVFLYLDSVLIKAGSQVKYFE  1616
              FG +L  ++++   +    +   ++S   +   ++LLP    Y+           ++ E
Sbjct  1124  FFGQMLMKVLEEDTSILQGMDYNSDSSRAHEDSSILLLPAALSYMRHHSDGHMQCAEFLE  1183

Query  1617  KIVSFYWRILL--HIFSDWKCYVTRDMFDIESFDNLPLSIEEFMDIFSCNLLSRSVLMVQ  1790
              + +FY  +LL  + F  WK ++TR +F+    D    S+++ MD FS  LL +SV M+ 
Sbjct  1184  PLANFYCEMLLGDNGFPCWKSFITRSIFEENFGDFQHESVQDMMDYFSDTLLGKSVTMLH  1243

Query  1791  LCSALTGYLVKFEARMELFDSVCPQKSTCVD  1883
              C +L     K   R+E+  S+CPQ S  +D
Sbjct  1244  YCLSLKEMPRK--QRLEIVASLCPQSSGLLD  1272



>ref|XP_002976606.1| hypothetical protein SELMODRAFT_443287 [Selaginella moellendorffii]
 gb|EFJ22275.1| hypothetical protein SELMODRAFT_443287 [Selaginella moellendorffii]
Length=2382

 Score =   264 bits (675),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 278/1047 (27%), Positives = 461/1047 (44%), Gaps = 185/1047 (18%)
 Frame = +3

Query  1179  LLEKILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNL  1358
             LL +I     E+A    L++A  CLL A KV+   K        L+ AI      +PV +
Sbjct  1319  LLAQIFNATLELAMVSSLEIASSCLLMAMKVLLPTK--------LLAAI------VPVEV  1364

Query  1359  LSYCMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPEL  1538
             L   M   ++ KAE++      +P+ +  FG  ++G       L      + SN S+ +L
Sbjct  1365  LHCSMRNASRVKAEIVTHLVRENPVMMVEFGRRVAG-------LSLETAEQGSNVSESDL  1417

Query  1539  LMLLPTVFLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNL  1718
             L LLP  + +L++     G       +    Y  +L   F DW    T  ++D       
Sbjct  1418  LQLLPAAWHFLENSRSFKGCSEDIGIQFSKVYGDLLAKRFIDWD--TTSGVWD-------  1468

Query  1719  PLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFD  1898
                  +  + +  + L+ SV ++ L + +     K             QKS  +  L  D
Sbjct  1469  -----QGEEHYEKSFLATSVSVLDLAADIRPLQAK-------------QKSRILRSLLHD  1510

Query  1899  PSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSR  2078
              + + T S   SL   NR VAK +L R LL  +H +              +  ST +V  
Sbjct  1511  TTVLDTASSFPSLT--NRLVAKASLVRILLL-QHEQ-------------GDESSTSEV--  1552

Query  2079  IRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVK  2258
             +  + + +S+   + ++F    D       E+     FLE  +L      S  +   L  
Sbjct  1553  LTFISVSLSTMAAVYKQFDGKQD-------EDSRSLVFLEERLLGAC---SDAVERLLAA  1602

Query  2259  LDSLPF--IVKLAKTTFWHRFDDPMTLQKLRDIISSL---------SEGKFSCVKIIQLM  2405
                L +  I K+AKT    RF     ++ L+ +   L         ++ +     ++  +
Sbjct  1603  SSGLVYKSIKKMAKTLLRFRFGKIEAMRALQRVFVKLLEMFKAEDGAQIRKLVTDVMDFV  1662

Query  2406  VAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLK  2585
               HSQF  A+ + + + G +      T +PS     ++ LFN      +  + +S++  +
Sbjct  1663  TGHSQFVQALLAKSKARGTA-----LTEIPS-----ILSLFNDRGSEGEVPIAVSEEEAR  1712

Query  2586  QLELIKLLRVLFQVKARQVD----IEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNL  2753
                +++LLRVL+  + R  +     E +++  + L  L   LL +Y ATL  +D EI  L
Sbjct  1713  -FHIVRLLRVLYAFRVRHREHFSVGEASRQTSMELESL---LLVAYGATLSTLDQEIFCL  1768

Query  2754  VNEIK-SISDSNISIAEWDYLWGNAVVKARKER------ELVQTVSCNLSDAEVAEDCRK  2912
             ++EI+ S  D    ++E DYLWG+A ++ R+++      +LVQ         E  E+ RK
Sbjct  1769  MHEIETSEGDGFSGMSEMDYLWGDAALERRRDKTESGGEDLVQ---------ESLEEMRK  1819

Query  2913  IQFRENLPIDPKMCASTVLYFPYGRPN-GPGVVNKVQKDTFDSMHEDCSAEVANRHIYDP  3089
              +F+E+L ++ +MC  T L+FP  R    P  V       FD   ++ +AEV     YDP
Sbjct  1820  RRFKEDLALNLRMCGLTALHFPMKRDMWTPETVQ-----VFDDSRQEENAEV-----YDP  1869

Query  3090  IFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQ  3269
              FIL  + H LS+G I+  EF   G LA++ AS+SS  +  RK GY +L  F   LE  Q
Sbjct  1870  AFILPFAMHALSVGCIDAEEFVRSGFLAIAFASMSSSLEAMRKYGYELLVAFSTHLE-VQ  1928

Query  3270  KKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSP  3449
               K   ++  LL +++N I + WQ+IPSV ++F AEAS +LL P   +Y  + + +++SP
Sbjct  1929  SFKGKSQINTLLVFMKNAISQPWQRIPSVISLFAAEASCILLHPESPNYVVVNRFILRSP  1988

Query  3450  SVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVS  3629
             S++L++IPLFQ +  S S + R ER WI+++L +GL +  D  IY R  + E L+SF  S
Sbjct  1989  SIDLQAIPLFQTMFTSGSTNSRGERNWIVKLLIAGLVSSADALIYRRQFVAEILMSFCTS  2048

Query  3630  PLADNESKELIIQTVKKSAKLSRMARHLIENCGLISW-LSSVVTSFCGIKYDHWKGFPFA  3806
              +AD  +++                           W L + +TS      +   G   +
Sbjct  2049  AMADISAQQ---------------------------WTLKATITSLSAPSINSEDGDAKS  2081

Query  3807  QFAVVLEVVNEIIFFRHTVE-WLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFT----  3971
              F V+     E++     +E  L     E+LS+++  L   +          ST T    
Sbjct  2082  SFQVI-----ELLLSSRGIETLLLAEGTEELSKVASMLLHFV----------STVTPTSW  2126

Query  3972  ----KLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEA  4139
                 K + +I+    ++SQ+R  YQ  F LS   L  + +++               LE 
Sbjct  2127  DVCGKPLFRIVNTALRLSQRRNKYQSAFNLSWRCLHDIAQSVQAEPFLSDRETRLGALEC  2186

Query  4140  ILMSTPPVAILQMDCKKVSKFINWAMS  4220
             +L   PP A    D +       WA S
Sbjct  2187  LLRCPPPEARETQDHESFCSITRWATS  2213



>ref|XP_002973298.1| hypothetical protein SELMODRAFT_442019 [Selaginella moellendorffii]
 gb|EFJ25672.1| hypothetical protein SELMODRAFT_442019 [Selaginella moellendorffii]
Length=2274

 Score =   260 bits (664),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 275/1047 (26%), Positives = 454/1047 (43%), Gaps = 185/1047 (18%)
 Frame = +3

Query  1179  LLEKILLQVYEIATHLHLDVADMCLLKAFKVVKTHKVMQQSNPTLVMAISRFIVNIPVNL  1358
             LL +I     E+A    L++A  CLL A KV+   K        L+ AI      +PV +
Sbjct  1208  LLAQIFNATLELAMVSSLEIASSCLLMAMKVLLPTK--------LLAAI------VPVEV  1253

Query  1359  LSYCMFQINKRKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSNPSDPEL  1538
             L   M   ++ KAE++      +P+ +  FG  ++G       L      + SN S+ +L
Sbjct  1254  LHCSMRNASRVKAEIVTHLVRENPVMMVEFGRRVAG-------LSLETAEQGSNVSESDL  1306

Query  1539  LMLLPTVFLYLDSVLIKAGSQVKYFEKIVSFYWRILLHIFSDWKCYVTRDMFDIESFDNL  1718
             L LLP    +L++     G       +    Y  +L   F DW    T  ++D       
Sbjct  1307  LQLLPAARHFLENSRSFKGCSEDIGIQFSKVYGDLLAKRFIDWD--TTSGVWD-------  1357

Query  1719  PLSIEEFMDIFSCNLLSRSVLMVQLCSALTGYLVKFEARMELFDSVCPQKSTCVDFLDFD  1898
                  +  + +  + L+ SV ++ L + +     K             QKS  +  L  D
Sbjct  1358  -----QGEEHYEKSFLATSVSVLDLAADIRPLQAK-------------QKSRILRSLLHD  1399

Query  1899  PSQVGTCSLEQSLNFVNRTVAKINLCRTLLFPEHNKFSSGLKEDKMETCAELHSTLDVSR  2078
              + + T S   SL   NR VAK +L R LL        S   E                 
Sbjct  1400  TTVLDTASSFPSLT--NRLVAKASLVRILLLQHEQGDESSTSE----------------A  1441

Query  2079  IRLLKMLVSSWRKIVEKFPMTADNSCQMEVENCSVFRFLEVLILRNIVELSKEMHGCLVK  2258
             +  + + +S+   + ++F          + E+     FLE  +L      S  +   L  
Sbjct  1442  LTFISVSLSTMAMVYKQFD-------GKQGEDSRSLVFLEERLLGAC---SDAVERLLAA  1491

Query  2259  LDSLPF--IVKLAKTTFWHRFDDPMTLQKLRDIISSL---------SEGKFSCVKIIQLM  2405
                L +  I K+AKT    RF     ++ L+ +   L         ++ +     ++  +
Sbjct  1492  SPGLVYKSIKKMAKTLLRFRFGKIEAMRALQRVFVKLLEMFKAEDGAQIRKLVTDVMDFV  1551

Query  2406  VAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMSKQHLK  2585
               HSQF  A+ + + + G +      T +PS     ++ LFN      +  + +S++  +
Sbjct  1552  TGHSQFVQALLAKSKARGTA-----LTEIPS-----ILSLFNDRGSEGEVPIAVSEEEAR  1601

Query  2586  QLELIKLLRVLFQVKARQVD----IEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNL  2753
                +++LLRVL+  + R  +     E +++  + L  L   LL +Y ATL  +D EI  L
Sbjct  1602  -FHIVRLLRVLYAFRVRHREHFSVGEASRQTSMELESL---LLVAYGATLSTLDQEIFCL  1657

Query  2754  VNEIK-SISDSNISIAEWDYLWGNAVVKARKER------ELVQTVSCNLSDAEVAEDCRK  2912
             ++EI+ S  D    ++E DYLWG+A ++ R+++      +LVQ         E  E+ RK
Sbjct  1658  MHEIETSEGDGFSGMSEMDYLWGDAALERRRDKTESGGEDLVQ---------ESLEEMRK  1708

Query  2913  IQFRENLPIDPKMCASTVLYFPYGRPN-GPGVVNKVQKDTFDSMHEDCSAEVANRHIYDP  3089
              +F+E+L ++ +MC  T L+FP  R    P  V       FD   ++ +AEV     YDP
Sbjct  1709  RRFKEDLALNLRMCGLTALHFPMKRDMWTPETVQ-----VFDDSRQEENAEV-----YDP  1758

Query  3090  IFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQ  3269
              FIL  + H LS+G I+  EF   G LA++ AS+SS  +  RK GY +L  F   LE  Q
Sbjct  1759  AFILPFAMHALSVGCIDAEEFVRSGFLAIAFASMSSSLEAMRKYGYELLVAFSTHLE-VQ  1817

Query  3270  KKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSP  3449
               K   ++  LL +++N I + WQ+IPSV ++F AEAS +LL P   +Y  + + +++SP
Sbjct  1818  SFKGKSQINTLLVFMKNAISQPWQRIPSVISLFAAEASCILLHPESPNYVVVNRFILRSP  1877

Query  3450  SVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVS  3629
             S++L++IPLFQ +  S S + R ER WI+++L +GL +  D  IY R  + E L+SF  S
Sbjct  1878  SIDLQAIPLFQTMFTSGSTNSRGERNWIVKLLIAGLVSSADALIYRRQFVAEILMSFCTS  1937

Query  3630  PLADNESKELIIQTVKKSAKLSRMARHLIENCGLISW-LSSVVTSFCGIKYDHWKGFPFA  3806
              +AD  +++                           W L + +TS      +   G   +
Sbjct  1938  AMADISAQQ---------------------------WTLKATITSLSAPSINSEDGDAKS  1970

Query  3807  QFAVVLEVVNEIIFFRHTVE-WLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFT----  3971
              F V+     E++     +E  L     E+LS+++  L   +          ST T    
Sbjct  1971  SFQVI-----ELLLSSRGIETLLLAEGTEELSKVASMLLHFV----------STVTPTSW  2015

Query  3972  ----KLILQILTLTWKVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGCYSPIAKTGLEA  4139
                 K + +I+    ++SQ+R  YQ  F LS   L  + +++               LE 
Sbjct  2016  DVCGKPLFRIVNTALRLSQRRNKYQSAFNLSWRCLHDIAQSVQAEPFLSDRETRLGALEC  2075

Query  4140  ILMSTPPVAILQMDCKKVSKFINWAMS  4220
             +L   PP A    D +       WA S
Sbjct  2076  LLRCPPPEAREAQDHESFCSITRWATS  2102



>ref|XP_006575207.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1-like 
[Glycine max]
Length=182

 Score =   231 bits (590),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 142/183 (78%), Gaps = 4/183 (2%)
 Frame = +3

Query  3093  FILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQK  3272
             ++LR+S  CLS  Y+ PVEFA  GLLA++  S+SSPD   R+L YG L+KFKNA+EKCQK
Sbjct  4     YLLRIS--CLSKAYVAPVEFAGSGLLAIAFVSLSSPDQGIRRLAYGTLDKFKNAVEKCQK  61

Query  3273  KKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPS  3452
             +KDVM L+LLL+ +QN IEE WQ+IPSV A+F AEAS VLLDP+HDHYA I+   + S  
Sbjct  62    RKDVMGLRLLLNSVQNSIEEPWQRIPSVIALFAAEASCVLLDPAHDHYAAISTFFIHSSK  121

Query  3453  VNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSP  3632
             +N++   +F N  WS SV+F+ ER W+L ++Y+G+N+DDDV IYIRNSI E L+SFYVSP
Sbjct  122   LNMRV--MFDNFFWSTSVNFKAERSWMLCLVYAGMNSDDDVAIYIRNSILEKLMSFYVSP  179

Query  3633  LAD  3641
             L+D
Sbjct  180   LSD  182



>ref|NP_001053939.1| Os04g0625300 [Oryza sativa Japonica Group]
 dbj|BAF15853.1| Os04g0625300, partial [Oryza sativa Japonica Group]
Length=342

 Score =   196 bits (498),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 191/345 (55%), Gaps = 17/345 (5%)
 Frame = +3

Query  3864  EWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTWKVSQKRKVYQPHF  4043
             EWLQ+ ALEQLS +S +L  +LVE  ++LK +      +L ++  T ++S KRK+YQPHF
Sbjct  3     EWLQETALEQLSRISKYL-YVLVEDMKLLKGNVPLLTSVLNVIASTMRLSMKRKIYQPHF  61

Query  4044  TLSVEGLFHLCEAIDVCCNGCYSPIA-KTGLEAILMSTPPVAILQMDCKKVSKFINWAMS  4220
             +LS+ G+  LC  I          +A + G++ ILM+ P   + +MD    +  ++WA S
Sbjct  62    SLSLHGIHKLCRTIGGISRSIEVKLAMQLGIDVILMNGPLPVLSEMDKSMTATVVSWATS  121

Query  4221  --IALQSETKGVLQVEKCCFPLNVSSEEETENS-LISKLLRWLTASVILGKISYKLSKLD  4391
                 L  E + VL++           EE  +N  L+SK+LRWL AS+ILGKIS    +  
Sbjct  122   NIFWLCDEQRSVLKM---------PHEEPLKNECLLSKMLRWLVASIILGKISCISHEKC  172

Query  4392  SSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVS  4571
                + D +   +L   L +  +   E     +  E LA  I YLQ+ L  +   LPS V+
Sbjct  173   GDLTRDANNFGSLESFLNYTYDEKVETVGSHSADEALAIIILYLQKHLKMNRDFLPSVVA  232

Query  4572  ALCLLLLKNPASSGSEVLIGNAAA---LCSKIRCPAEANSAWRWSFYQPWKDHSSNLTDS  4742
             ALCLLLL           IG+      LCS+I+CPAEAN AWRW +YQPWKD + +  ++
Sbjct  233   ALCLLLLDRSNKQVIRNFIGDYGQIEMLCSQIQCPAEANPAWRWHYYQPWKDPAMHRNEA  292

Query  4743  EKIEEIHACQMLLLVASKMLARNSLYSKLISLKDVEKLGVFEWER  4877
             E +EE  ACQ LL++ S   +       ++SL DVEK G+F+WER
Sbjct  293   EHLEEEQACQSLLVMFSNSFSAGLSGFPVLSLGDVEKSGLFQWER  337



>gb|EMT15403.1| hypothetical protein F775_27504 [Aegilops tauschii]
Length=511

 Score =   201 bits (510),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 136/367 (37%), Positives = 199/367 (54%), Gaps = 21/367 (6%)
 Frame = +3

Query  3825  EVVNEIIFFRHTVEWLQKYALEQLSELSCHLCQILVEGAQMLKEHSTFTKLILQILTLTW  4004
             +V++ +I  R   EWLQ+ ALEQLSE+S +L  +LVE  ++LK   T    IL I+  T 
Sbjct  158   KVLDVLILSRFITEWLQETALEQLSEISQYL-YLLVEDGKLLKGDITMLSSILNIIASTM  216

Query  4005  KVSQKRKVYQPHFTLSVEGLFHLCEAIDVCCNGC-YSPIAKTGLEAILMSTPPVAILQMD  4181
             ++S KRK+YQPHFTLS+ G+F LC+AID         P  + G + +LM+ P     + D
Sbjct  217   RLSMKRKIYQPHFTLSLHGIFKLCQAIDGNSRSIELKPSMELGTDVVLMNGPLPISSETD  276

Query  4182  CKKVSKFINWAMS-IALQSETKGVLQVEKCCFPLNVSSEEETENSLISKLLRWLTASVIL  4358
               +    ++W  S I    + K  +++  C  PLN           +SK+LRWL ASVIL
Sbjct  277   KSRTVMVVSWVTSNIFWLCKQKSAVEM-LCEEPLN-------NECRLSKILRWLVASVIL  328

Query  4359  GKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQQLLG  4538
             G+IS    +     +   +    L   L  + E+  E        E LAA I YLQ  + 
Sbjct  329   GRISRISPEKRGGLATSTNSPGTLQSFLNHSSET-VEMVDSHVANEALAAIILYLQGHVK  387

Query  4539  TSFKLLPSAVSALCLLLLKNPASSGSEVLI---GNAAALCSKIRCPAEANSAWRWSFYQP  4709
                  LPS ++AL LLLL        +VL+   G    LCSKI CPAE+N AWRW +YQP
Sbjct  388   KKSDTLPSVMTALSLLLLDR---CSEQVLVDGRGQIETLCSKIHCPAESNPAWRWHYYQP  444

Query  4710  WKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKL--ISLKDVEKLGVFEWER-S  4880
             W+D +   T +E++E   +C+ LL++ S  L+   L + +  +S+ D+EK G+F+WER S
Sbjct  445   WRDPALQHTATERMEVEQSCRSLLIIFSNALSAAGLPAGIPVLSVGDIEKSGLFQWERDS  504

Query  4881  ILNLNHV  4901
             ++   H 
Sbjct  505   VVEQPHA  511



>ref|XP_010278715.1| PREDICTED: uncharacterized protein LOC104612823 [Nelumbo nucifera]
Length=257

 Score =   191 bits (484),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 117/244 (48%), Positives = 160/244 (66%), Gaps = 15/244 (6%)
 Frame = +3

Query  4170  LQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPLNVSSEEET-ENSLISKLLRWLTA  4346
             +  D +KVSK I W +S ALQS +     ++K  F   + SEEE  E SL+SK+LRW+TA
Sbjct  21    IAFDREKVSKLIMWMVSTALQSYSMQPSLLKKTDFHFTILSEEEQYEESLVSKILRWITA  80

Query  4347  SVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAASIFYLQ  4526
             SVI+GKIS K+ K+++S S     L +L   ++      REN   +  ++ L A+I YLQ
Sbjct  81    SVIVGKISLKVYKINTSTSPGIKTLQSLLECIKNGYGERRENN--YGNKKALVATILYLQ  138

Query  4527  QLLGTSFKLLPSAVSALCLLLLKNPA-SSGSEVLIGN----AAALCSKIRCPAEANSAWR  4691
             QLLG + ++LPS VSA+CLLLL N + S+GSE+L+ N     A+LCSKIRCPAEAN AWR
Sbjct  139   QLLGLNGEVLPSVVSAICLLLLSNASNSTGSELLLCNHGSLVASLCSKIRCPAEANPAWR  198

Query  4692  WSFYQPWKDHSSNLTDSEKIEEIHACQMLLLVASKMLARNSLYSKLISLKD--VEKLGVF  4865
             WSFYQPW+D S +LTD +K++E  ACQ LL++ +     N+L  K + L D  +E  G+F
Sbjct  199   WSFYQPWRDLSLDLTDLQKMDERVACQKLLVIFA-----NALEGKRLELPDLNIENSGLF  253

Query  4866  EWER  4877
              W R
Sbjct  254   TWGR  257



>ref|XP_002862159.1| hypothetical protein ARALYDRAFT_359794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38417.1| hypothetical protein ARALYDRAFT_359794 [Arabidopsis lyrata subsp. 
lyrata]
Length=658

 Score =   195 bits (496),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 160/500 (32%), Positives = 251/500 (50%), Gaps = 37/500 (7%)
 Frame = +3

Query  30    VSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGLESAIS-GLQEGRTE---EF  197
             +++S  + G  FS L SI FLE + L ++SK  P++F  GLE   S  L+EG  +   +F
Sbjct  1     MAISWDLYGTSFSFLQSIVFLEENFLGNLSKLSPDLFVRGLELTRSRNLREGIVDSEIDF  60

Query  198   GDIDSMEFA-----------SAALSLFLKEASLCMLFPITLS-IYKSDLSTQQGLHNL--  335
              D  S+  A           S+ALS+F ++A     FP+ L+ I   D+S       L  
Sbjct  61    ADYSSVTEAIKSKMEIRDIYSSALSMFFEQAP----FPVLLNEIMSMDISCVPEFPRLAE  116

Query  336   LLANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlselCFNIVDRMLRQFLNT  515
             LL  + +   D I S    +LFW  Q   SY+++P   L  LSE+C  ++  +  Q ++ 
Sbjct  117   LLLQVWQPKSDSIESDIRLILFWLFQIRSSYKIQPASVLCRLSEICLRLLKHLFSQ-ISE  175

Query  516   KGDASSKCTRSLLP--TKCVQELIETIFYHPVVAASLECPLPCNA----DFTDTFSGDSM  677
             +G  S   +  L+    K   ++ +T+  HPVV A LE PL C           FS  S+
Sbjct  176   RGFVSGPSSDKLVAPFAKWKHQVAQTVLCHPVVMALLESPLDCGTLPPVHNVKIFSETSL  235

Query  678   DKFLESNKWRVIHKMDLHVINLLRTTFELLYFCDGQTSSFEACHARQVTKAFKNVVQKLF  857
                  +    VI ++D H+++LL +  E   F +            + +  FK++VQ+L 
Sbjct  236   -----TTSRLVICEIDQHILDLLVSICEHFLFDERHIVQEGDLRENKSSTVFKDLVQRLL  290

Query  858   LTFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSL  1037
             L F+D+ + C+ S+   PLL     IH L RFI PF++LEL   M S+ID E+ +   S 
Sbjct  291   LLFRDKFELCVGSQSYAPLLQPSQLIHALLRFISPFKILELARSMLSKIDEEELASPNS-  349

Query  1038  RDSVLRVGLHIAGSVFDSLSACMWQPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIA  1217
                ++ +GL IAG  F+ L +    P ++R L DL W + EE +D +L+E++       +
Sbjct  350   -SMIISLGLDIAGGAFEMLISYSHLPAAKRGLYDLLWELKEENYDSILIEEVYSMACRFS  408

Query  1218  THLHLDVADMCLLKAFKVVKTHKVMQQSN-PTLVMAISRFIVNIPVNLLSYCMFQINKRK  1394
             T   L  AD CLLK    +   K  +  N   L + IS+ +   P +L+ + + Q +  +
Sbjct  409   TSFGLVSADTCLLKVGSSIFRGKHNRHCNVHPLTVIISQIVGRTPKDLIIHYINQPSMTR  468

Query  1395  AELLFLATEMSPLHLSIFGH  1454
             A++LF   E SPLHLS+FGH
Sbjct  469   AKILFYLVESSPLHLSVFGH  488


 Score =   124 bits (311),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 93/293 (32%), Positives = 149/293 (51%), Gaps = 35/293 (12%)
 Frame = +3

Query  2445  NLSTGISQLGLTFTPLPSLMRSFVIPLF-----NHNSICRKDNLQMSKQHLKQLELIKLL  2609
             +++ G  ++ ++++ LP+  R     L+     N++SI  ++   M+ +      L+   
Sbjct  358   DIAGGAFEMLISYSHLPAAKRGLYDLLWELKEENYDSILIEEVYSMACRFSTSFGLVSAD  417

Query  2610  RVLFQVKA--------RQVDIEP-----AQEIGINLRDLVFLLLSSYNATLCDIDFEIHN  2750
               L +V +        R  ++ P     +Q +G   +DL+   ++  + T   I F    
Sbjct  418   TCLLKVGSSIFRGKHNRHCNVHPLTVIISQIVGRTPKDLIIHYINQPSMTRAKILF----  473

Query  2751  LVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFREN  2930
              + E   +  S    + ++YLWG A +K R+     Q       +A + E+ ++I F+EN
Sbjct  474   YLVESSPLHLSVFGHSFFNYLWGKAALKIREGLRFSQDAYYG-GEAGLVENLQQILFKEN  532

Query  2931  LPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTF---DSMHEDCSAEVANRHIYDPIFIL  3101
             L IDPK+CA T+LYFPY R        +V  +++   D + E CS  +     YDP +IL
Sbjct  533   LWIDPKICAQTLLYFPYQR------TAEVSDNSYISDDPVSEKCSPVIER---YDPAYIL  583

Query  3102  RLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALE  3260
               S H LSMG IEPV+FA+ GLLAV+LAS SS D   RKLGY  L  F +AL+
Sbjct  584   PFSIHSLSMGCIEPVKFASSGLLAVALASTSSADLGMRKLGYETLGIFVHALK  636



>ref|XP_002448560.1| hypothetical protein SORBIDRAFT_06g029102 [Sorghum bicolor]
 gb|EES12888.1| hypothetical protein SORBIDRAFT_06g029102 [Sorghum bicolor]
Length=175

 Score =   145 bits (367),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 113/178 (63%), Gaps = 7/178 (4%)
 Frame = +3

Query  2739  EIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKEREL--VQTVSCNLSDAEVAEDCRK  2912
             EI +L+NEI+S      +I E D+LWG + +K R+E +L   ++ + +  +AE+ E  R+
Sbjct  1     EILHLMNEIES--PECRTITEVDHLWGTSALKFREELKLDFSKSDTHSTENAEITER-RR  57

Query  2913  IQFRENLPIDPKMCASTVLYFPYGRPNGPGV--VNKVQKDTFDSMHEDCSAEVANRHIYD  3086
               FREN+P+D K+CA T L + Y R +   V  + ++Q+D F    E  S  +    IYD
Sbjct  58    TLFRENIPVDSKLCAKTSLLYCYKRSSRASVFSLEQLQRDNFADSFEVTSQRMDIVQIYD  117

Query  3087  PIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALE  3260
             PIFILR S H L MGYIEP EFA LGLLA++L SI+SPD + R LGY  L  FKN+LE
Sbjct  118   PIFILRFSIHTLHMGYIEPAEFARLGLLAITLVSIASPDHELRMLGYECLGTFKNSLE  175



>ref|XP_006452303.1| hypothetical protein CICLE_v10007833mg [Citrus clementina]
 gb|ESR65543.1| hypothetical protein CICLE_v10007833mg [Citrus clementina]
Length=584

 Score =   144 bits (362),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 104/248 (42%), Positives = 149/248 (60%), Gaps = 9/248 (4%)
 Frame = +3

Query  4041  FTLSVEGLFHLC-EAIDVCCNGCYSPIAKTGLEAILMSTPPVAILQMDCKKVSKFINWAM  4217
             F L + G + +  +++D+         A+  L+ ILMS+P + I +++  K+S F+ WA+
Sbjct  314   FYLIMSGTYAISFKSVDMYNTARSGANAELALKVILMSSPSIDIFRVNQVKLSSFLTWAI  373

Query  4218  SIALQSETKGVLQVEKCCFPL-NVSSEEETENSLISKLLRWLTASVILGKISYKLSKLDS  4394
             S AL+S++  + ++ +    L N+  +   E SL SKLLRW  ASVILGK+  KL    S
Sbjct  374   STALKSDSGQMYKLRESHLHLRNMLEDAPFEESLTSKLLRWPFASVILGKLFGKLDIPGS  433

Query  4395  SHSCDRSKLINLHCLL-EWNEESDRENGKEFACQEILAASIFYLQQLLGTSFKLLPSAVS  4571
               S  +S    L+ L  ++  +    N   F C+EILAA+IFYLQQLLG     LPS +S
Sbjct  434   KLS--KSSYETLNSLFQDFGNKCVENNKSRFDCKEILAAAIFYLQQLLGLCCGGLPSVIS  491

Query  4572  ALCLLLLKNPAS-SGSEVLIGNA---AALCSKIRCPAEANSAWRWSFYQPWKDHSSNLTD  4739
             AL LLLL + +  +GS   +G+    A+L S+I CPAEAN  WRWSFYQPWKD S  LTD
Sbjct  492   ALSLLLLSDVSESAGSAFKLGHRTSLASLWSRIHCPAEANPCWRWSFYQPWKDLSLELTD  551

Query  4740  SEKIEEIH  4763
              +KI+E+ 
Sbjct  552   LQKIDELR  559



>tpg|DAA35930.1| TPA: hypothetical protein ZEAMMB73_692446, partial [Zea mays]
Length=1533

 Score =   144 bits (362),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 135/540 (25%), Positives = 250/540 (46%), Gaps = 25/540 (5%)
 Frame = +3

Query  3     DLLQNFPVIVSVSKKMLGVPFSLLMSIFFLEPSLLIDVSKTWPEMFFTGL---ESAISGL  173
             D++  FP ++ + K       + L S+ FL+   L  V+  WP++FF+ +   +  I+  
Sbjct  986   DVISAFPDLLDLVKAHFPSHVAFLSSVLFLQHDYLAKVASCWPDIFFSSIRLFKDDINAD  1045

Query  174   QEGRTEEFGDIDSMEFASAALSLFLKEASLCMLFPITLSIYKSDL-----STQQGLHNLL  338
                  E+     S+   SA LS FL  +  C L P  LS+  S       + +  L  LL
Sbjct  1046  HANTVEDECQNLSVSTESAPLSTFLSVSPFCALLPSVLSLACSSPDEIMEAHKDALLRLL  1105

Query  339   LANLSERTPDHIVSSFLYVLFWFNQAHISYRVepleelemlse--lCFNIVDRMLRQFLN  512
                LS+ T   +      +LFW +    SY ++     ++     LCF ++DR+  +   
Sbjct  1106  EVKLSDCTFSELTLYLRVILFWTHHLLSSYTIKDSNSDDLEQVCHLCFGLLDRVFERIQV  1165

Query  513   TKGDAS-SKCTRSLLPTKCVQELIETIFYHPVVAASLECPLPCNADFTDTFSGDSMDKFL  689
                D S S       P + +Q++++++  HPV+  SL C L    +  D  S + +++ L
Sbjct  1166  LTADPSQSNSEYPYYPAQHIQDIVDSVLRHPVITLSLSCSLSNCQNLADG-SLEHLEEAL  1224

Query  690   ESNKWRVIHKMDLHVINLLRTTFE---LLYFCDGQTSSFEACHARQVTKAFKNVVQKLFL  860
                    +H +D  V+NLL   ++   +     G  S+        +  A   +++ + L
Sbjct  1225  AIFATENLHLIDRFVLNLLGKLYDLLLMFGSYGGNYSTDNGPSHESLFAAPNLLLENIIL  1284

Query  861   TFKDRTDKCIESKDLTPLLPAIYAIHTLKRFIFPFELLELVHWMFSRIDLEDNSFQQSLR  1040
              FK++ + C++  +   LLP  Y + TL +F  PF+LLEL +WMFS++D   ++F     
Sbjct  1285  LFKEKFELCVDKLNFELLLPNFYMVRTLSKFFSPFKLLELANWMFSKLD--GHNFSSPAF  1342

Query  1041  DSVLRVGLHIAGSVFDSLSACMW-QPHSERPLSDLFWGMLEEQFDIVLLEKILLQVYEIA  1217
              S + + L+I     + L  C + Q   +R  S LF  +     DI  +++    +   A
Sbjct  1343  VSAVLMCLYIIDVTMEML--CFYLQKTDQRSQSYLFRHLEIHNSDINAIQQAYHIILHFA  1400

Query  1218  THLHLDVADMCLLKAFKVVKTHKVMQQSNPTLV---MAISRFIVNIPVNLLSYCMFQINK  1388
             T  +++ AD CLLK    +   +     N   +   M +S   +N P+++L +C+F  +K
Sbjct  1401  TKWNVEFADHCLLKMLCHIHYTERCAGWNTDYIAFHMVLSTMAINTPIDILHHCIFPTSK  1460

Query  1389  RKAELLFLATEMSPLHLSIFGHLLSGMIDKQVHLQTNAIRETSN--PSDPELLMLLPTVF  1562
              KA+ + L  E SP+HL++F  +   +++K  ++      +++N    +   ++LLP   
Sbjct  1461  VKAKAILLLLEASPMHLNLFSQIFLEILNKDTYVLQVKDSDSNNLWAQEDGAILLLPAAL  1520



>ref|XP_006858194.1| hypothetical protein AMTR_s00062p00168210 [Amborella trichopoda]
 gb|ERN19661.1| hypothetical protein AMTR_s00062p00168210 [Amborella trichopoda]
Length=277

 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 116/214 (54%), Gaps = 18/214 (8%)
 Frame = +3

Query  4170  LQMDCKKVSKFINWAMSIALQSETKGVL------QVEKCCFPLNVSSEEETENSLISKLL  4331
             L+ +  K+  FI WA+SIAL S+   V       QV        V  E ++E  LI+KLL
Sbjct  29    LEKEKGKLVNFIIWAISIALVSDCPPVYLLGHFNQVGAI-----VPEENQSEIPLIAKLL  83

Query  4332  RWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENGKEFACQEILAAS  4511
             RW+TASVILG +S   +  D     + S+   L  LLE  E   +  G E +    LA  
Sbjct  84    RWVTASVILGWVSKARNSQDGFFPMEVSRPQTLLSLLE--EVPHKGAGSENSTDNALARL  141

Query  4512  IFYLQQLLGTSFKLLPSAVSALCLLLLKN-----PASSGSEVLIGNAAALCSKIRCPAEA  4676
             I YLQQLLG ++K  PS VSAL +LL  +       +SG+ +       L SKI CP EA
Sbjct  142   ILYLQQLLGVNYKFFPSVVSALSILLSADLHRSCDPNSGNVMFTRVFKMLASKISCPVEA  201

Query  4677  NSAWRWSFYQPWKDHSSNLTDSEKIEEIHACQML  4778
             N AWRWS+YQ W+D SS   +SE I E HACQ L
Sbjct  202   NPAWRWSYYQSWRDLSSVSAESEMISENHACQAL  235



>emb|CDH60529.1| hypothetical protein RO3G_06036 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=1698

 Score =   141 bits (356),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 108/394 (27%), Positives = 189/394 (48%), Gaps = 48/394 (12%)
 Frame = +3

Query  2604  LLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDS  2783
             ++R++  + A Q DI   Q        L+  LL+SY AT    D  I +++   ++    
Sbjct  1320  IIRLVHVLHALQPDILATQH------GLLDPLLTSYGATTSRPDRTILDILRSCEARGHG  1373

Query  2784  NISIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCAST  2963
               +I     LWG    K R+      T+         A+    + F     IDP +   T
Sbjct  1374  --TILPKMLLWGTGSDKTRQAHAQAGTLL-------QADTISMVTFGL---IDPDLMEYT  1421

Query  2964  VLYFP----YGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMG  3131
               +FP     G P  P      Q D               + +YDP F L L  + +  G
Sbjct  1422  WTHFPENTTLGAPEPPS-----QND---------------KPVYDPAFFLPLFGNLIGNG  1461

Query  3132  YIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSY  3311
              ++   F     L + L S+S  D   R LG+ ++++F  AL +  K  +V +L  LL  
Sbjct  1462  AVDCKRFLECKALGMVLVSLSCQDVQVRMLGFQMMDQFY-ALLQHSKITEVAQLIYLLDA  1520

Query  3312  LQNCIE-----EDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPL  3476
             L+N IE     ++  +IP+   + +A A F+LLDP+H  Y  I++ ++Q P+ +L  +P+
Sbjct  1521  LRNSIEGRHNQDEPPRIPAAVTVTVAHAVFILLDPTHYMYPHISRLILQYPNFDLNYVPM  1580

Query  3477  FQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKE  3656
             F  +  S + + R ERLW+L++L S + T +D  I+ R  +++ ++SFY S +AD  +K+
Sbjct  1581  FNWVFSSATPTHRKERLWLLQVLASSMRTYEDYKIFTRRRVWDLIMSFYSSVMADQPTKK  1640

Query  3657  LIIQTVKKSAKLSRMARHLIENCGLISWLSSVVT  3758
              I++ ++ + K+ R+   L+ N GL +W+  ++ 
Sbjct  1641  TIVEIMQHALKIPRVGSSLVRNQGLQAWIYQILA  1674



>tpg|DAA43440.1| TPA: hypothetical protein ZEAMMB73_622457 [Zea mays]
Length=157

 Score =   129 bits (324),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 94/144 (65%), Gaps = 0/144 (0%)
 Frame = +3

Query  3219  LGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLD  3398
             LGY  L KFK +LE  Q+ K+  +LQLLL+YLQN I E WQKIPS+ A+F AEAS  L D
Sbjct  2     LGYECLGKFKKSLEYAQRSKETWQLQLLLTYLQNGISEQWQKIPSIIAVFAAEASLTLPD  61

Query  3399  PSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVH  3578
              SH  +  +   LM S  V+L+SIPLF  LL S  V F+ ERLW+LR+L +G N  DD  
Sbjct  62    GSHAQFTVMRNFLMHSTPVSLQSIPLFPTLLQSSFVHFKAERLWMLRLLSAGSNLADDAK  121

Query  3579  IYIRNSIFETLLSFYVSPLADNES  3650
             IY R  + E  L+F  SP++D ES
Sbjct  122   IYKRGRVLELALAFCSSPISDFES  145



>emb|CDS07405.1| hypothetical protein LRAMOSA01354 [Absidia idahoensis var. thermophila]
Length=1705

 Score =   140 bits (352),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 102/363 (28%), Positives = 176/363 (48%), Gaps = 42/363 (12%)
 Frame = +3

Query  2697  LLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSCN  2876
             LL+SY AT    D  I  ++    S +  + ++     LWG    K R+      T+   
Sbjct  1352  LLTSYGATTSRPDRTILGILR--SSEARGHGTVLPKMLLWGPGSDKTRQAHAQAGTLLQ-  1408

Query  2877  LSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFP----YGRPNGPGVVNKVQKDTFDSMH  3044
                   A+    + F     IDP +   T  +FP     G P  P      Q D      
Sbjct  1409  ------ADTISMVTFGL---IDPDLMEYTWTHFPENITLGVPEPP-----TQSD------  1448

Query  3045  EDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLG  3224
                      + +YDP F L L  + ++ G ++   F +   L + L S+S  D   R LG
Sbjct  1449  ---------KPVYDPAFFLPLFGNLIANGAVDCKRFLDCKALGMVLVSLSCQDVQVRMLG  1499

Query  3225  YGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIE-----EDWQKIPSVTAIFIAEASFV  3389
             + ++++F   L+   K  +V +L  LL  L+N IE     ++  +IP+   + +A A FV
Sbjct  1500  FQMMDQFYTLLQHS-KITEVAQLIYLLDALRNSIEGRHKQDEPPRIPAAVTVTVAHAVFV  1558

Query  3390  LLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDD  3569
             LLDP+H  Y  I++ ++Q P+ +L  +P+F  +  S + + R ERLW+L++L S + T +
Sbjct  1559  LLDPAHYMYPHISRLILQYPNFDLNYVPMFNWVFSSATQTHRKERLWLLQVLASSIRTYE  1618

Query  3570  DVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSS  3749
             D  I+ R  +++ ++SFY S +AD  +K+ II+ ++ +  + R+   L+ N GL +W+  
Sbjct  1619  DYKIFTRRRVWDLIMSFYSSVMADQPTKKTIIEIMQHAIDIPRVGSSLVRNQGLQAWIYQ  1678

Query  3750  VVT  3758
             +V 
Sbjct  1679  IVA  1681



>emb|CEF96522.1| Nucleolar pre-ribosomal-associated protein 1, N-terminal [Ostreococcus 
tauri]
Length=2222

 Score =   138 bits (347),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 127/511 (25%), Positives = 234/511 (46%), Gaps = 46/511 (9%)
 Frame = +3

Query  2391  IIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMS  2570
             I+  +++H  FE  + ++ +  G S+L +    +   M+S V  +    S   ++  + +
Sbjct  1431  ILSQIISHPMFERTL-TAVIGGGDSELPVNLREMSVTMKSIVEAV--RESSAHEERSEPN  1487

Query  2571  KQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLR----DLVFLLLSSYNATLCDIDF  2738
                  +LEL++++R+L++++    D +  +   +  R     ++  L S Y ATL + D 
Sbjct  1488  NASALKLELLRVMRLLWKLQ--DADGKNGKNKCMKWRASNARVIVSLASGYGATLSEADC  1545

Query  2739  EIHNLVNEIKSISDSNISIAEWDYLWGNAV-------VKARKERELVQTVS----CNLSD  2885
                 L+ +I + +   + +    YLWG +V       +  R+  +    V      + S 
Sbjct  1546  LTQELMLDIDASTGGGV-LRSIGYLWGESVTHFVKTTISVRRNEDTGYDVDDLLYSHPSP  1604

Query  2886  AEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDCSAEV  3065
             A VA        RE  P D +  A+T   FP  R   P  V      + D+ H D     
Sbjct  1605  ALVAS-----AIREGSPPDARRAAATAARFPMSRTTPPSNV------SVDASHVDEIVPF  1653

Query  3066  ANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVL---  3236
                  YDP ++L  + H L  G ++P E    GL  ++ A+++S D+ TR++ Y +    
Sbjct  1654  G----YDPSWMLPFTMHALMSGAMDPREAVAWGLAPLAAAALASHDESTRRIAYAIFSVM  1709

Query  3237  -EKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDH  3413
              ++  + L   +++  V+     LS ++N       + PS  A   AE     L P  D 
Sbjct  1710  NDRISDPLYSFRERTQVL---ACLSAMRNATTSSLMRWPSPGATLAAECMLSSLYPETDT  1766

Query  3414  YATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRN  3593
             +  + K L +  +++L  +P+F  +L S  V  R  RLWILR+L + L  + D  I+ + 
Sbjct  1767  FLPLQKQLNRRAALDLSGLPMFLPMLNSGDVDARQHRLWILRLLRASLKDETDATIFRKT  1826

Query  3594  SIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFC-G  3770
                E ++S Y + LA++ ++ L++  V ++  +   AR L+E  GLI+W++S+  + C  
Sbjct  1827  FALEVVMSHYSATLAESYARFLMLDLVARACAVLPAARPLVEGGGLIAWMASITRAACVN  1886

Query  3771  IKYDHWKGFPFAQFAVVLEVVNE--IIFFRH  3857
              KY+   G   A  A   +V  E  +   RH
Sbjct  1887  DKYNIRSGETPALRASTAKVATEALVTLIRH  1917



>ref|XP_008604996.1| hypothetical protein SDRG_01257 [Saprolegnia diclina VS20]
 gb|EQC41282.1| hypothetical protein SDRG_01257 [Saprolegnia diclina VS20]
Length=1847

 Score =   137 bits (345),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 91/362 (25%), Positives = 163/362 (45%), Gaps = 41/362 (11%)
 Frame = +3

Query  2673  NLRDLVFL--LLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKE  2846
             +L DL  L  LLS Y A+L  +D  + ++++ +++  D  +  A + +   N V  +   
Sbjct  1334  DLVDLALLKALLSRYGASLSPVDVALQSVLSLLETKFDVRLETAHYCFGRANHVASSSLS  1393

Query  2847  RELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKD  3026
                   +                   E   I+P     ++ YFP  R    G V+  Q+ 
Sbjct  1394  SIKSHWL-----------------LEE---IEPARMRKSIEYFPLQRSFSGGAVDDDQEA  1433

Query  3027  TFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDD  3206
             +                +YDP F L L  H LS  +I   +    G+L  ++ ++S+ DD
Sbjct  1434  S----------------VYDPAFFLPLVAHTLSTSHIPDKQLLQSGILGYAICALSAEDD  1477

Query  3207  DTRKLGYGVLEKFKNALEKCQKKKDV---MRLQLLLSYLQNCIEEDWQKIPSVTAIFIAE  3377
               R   YG++     A+    +  D     ++ LLL  L+N +    +++PS+  +F  +
Sbjct  1478  TIRAYAYGIVASAHEAMSVTARSHDFHERRQIHLLLETLKNGVRSTHERLPSLLTVFAND  1537

Query  3378  ASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGL  3557
             A  VLL P H  Y  I   L+   +++   +P+F  L  S + ++R ER W+L I+  G+
Sbjct  1538  AISVLLRPGHAMYPLINAFLLARSALDTTDVPMFYTLFNSSATTYRQERSWLLHIIKRGV  1597

Query  3558  NTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLIS  3737
               + DV +  R  +F  LL+F+ SPLAD  +++ ++  + +S         L+   GL++
Sbjct  1598  RLNIDVDLLQRRHVFAILLTFFDSPLADAYTQDFVLHILSRSVATPHGVFTLVHKFGLLA  1657

Query  3738  WL  3743
             WL
Sbjct  1658  WL  1659



>ref|XP_003074141.1| unnamed protein product [Ostreococcus tauri]
Length=2122

 Score =   137 bits (346),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 127/511 (25%), Positives = 234/511 (46%), Gaps = 46/511 (9%)
 Frame = +3

Query  2391  IIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFNHNSICRKDNLQMS  2570
             I+  +++H  FE  + ++ +  G S+L +    +   M+S V  +    S   ++  + +
Sbjct  1331  ILSQIISHPMFERTL-TAVIGGGDSELPVNLREMSVTMKSIVEAV--RESSAHEERSEPN  1387

Query  2571  KQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLR----DLVFLLLSSYNATLCDIDF  2738
                  +LEL++++R+L++++    D +  +   +  R     ++  L S Y ATL + D 
Sbjct  1388  NASALKLELLRVMRLLWKLQ--DADGKNGKNKCMKWRASNARVIVSLASGYGATLSEADC  1445

Query  2739  EIHNLVNEIKSISDSNISIAEWDYLWGNAV-------VKARKERELVQTVS----CNLSD  2885
                 L+ +I + +   + +    YLWG +V       +  R+  +    V      + S 
Sbjct  1446  LTQELMLDIDASTGGGV-LRSIGYLWGESVTHFVKTTISVRRNEDTGYDVDDLLYSHPSP  1504

Query  2886  AEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDCSAEV  3065
             A VA        RE  P D +  A+T   FP  R   P  V      + D+ H D     
Sbjct  1505  ALVAS-----AIREGSPPDARRAAATAARFPMSRTTPPSNV------SVDASHVDEIVPF  1553

Query  3066  ANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVL---  3236
                  YDP ++L  + H L  G ++P E    GL  ++ A+++S D+ TR++ Y +    
Sbjct  1554  G----YDPSWMLPFTMHALMSGAMDPREAVAWGLAPLAAAALASHDESTRRIAYAIFSVM  1609

Query  3237  -EKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDH  3413
              ++  + L   +++  V+     LS ++N       + PS  A   AE     L P  D 
Sbjct  1610  NDRISDPLYSFRERTQVL---ACLSAMRNATTSSLMRWPSPGATLAAECMLSSLYPETDT  1666

Query  3414  YATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRN  3593
             +  + K L +  +++L  +P+F  +L S  V  R  RLWILR+L + L  + D  I+ + 
Sbjct  1667  FLPLQKQLNRRAALDLSGLPMFLPMLNSGDVDARQHRLWILRLLRASLKDETDATIFRKT  1726

Query  3594  SIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFC-G  3770
                E ++S Y + LA++ ++ L++  V ++  +   AR L+E  GLI+W++S+  + C  
Sbjct  1727  FALEVVMSHYSATLAESYARFLMLDLVARACAVLPAARPLVEGGGLIAWMASITRAACVN  1786

Query  3771  IKYDHWKGFPFAQFAVVLEVVNE--IIFFRH  3857
              KY+   G   A  A   +V  E  +   RH
Sbjct  1787  DKYNIRSGETPALRASTAKVATEALVTLIRH  1817



>gb|KDR11374.1| Nucleolar pre-ribosomal-associated protein 1 [Zootermopsis nevadensis]
Length=1946

 Score =   137 bits (345),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 117/395 (30%), Positives = 184/395 (47%), Gaps = 51/395 (13%)
 Frame = +3

Query  2601  KLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISD  2780
             KL+ +LF +  +   +  +  I I         L SYNATL   D  +  L   ++S   
Sbjct  1425  KLVELLFLLVKKDSSVMSSSHIPI--------FLGSYNATLDPTDQLVLGL---LQSYEA  1473

Query  2781  SNISIAE-WDYLWGNAVVKARKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCA  2957
               IS+ E   YLWG A V     +     V  +L         R+ Q  + L +    C 
Sbjct  1474  GGISLHECRPYLWGEAAVSHYSVKS---KVGMSL--------WRQPQANQVLELLDMNCV  1522

Query  2958  -STVLYFPYGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLS-MG  3131
               T+  FP  R                 +    S E   R +YDP F+L L  H L+   
Sbjct  1523  LETIKNFPLNR----------------GLKASESLECG-RKVYDPAFLLPLFSHLLAPES  1565

Query  3132  YIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQK-KKDVMRLQLL--  3302
              +   +F + G LAV+LA++ S  +DTR   Y V+ +     E C+  K  ++ LQ L  
Sbjct  1566  VVHTYKFISSGGLAVTLAALCSACEDTRAAAYHVVARLYFHEEVCRNVKGRLLSLQFLDA  1625

Query  3303  ----LSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSI  3470
                 ++ L+N  E    ++P +   F+A  S +L    H+ Y  +   ++   SVNL +I
Sbjct  1626  VRNGVASLKN--ESLNPQLPCIVTTFLARTSLILSQTHHEFYVPLQNFIIAKSSVNLNTI  1683

Query  3471  PLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNES  3650
             P F   L S  V FRT RLWILR++  G+ ++ D  +  R  +F+ LL FY S LAD+++
Sbjct  1684  PEFFTFLHSSEVEFRTYRLWILRVIRDGMKSNLDFRLSQRCVVFKLLLGFYSSVLADDDT  1743

Query  3651  KELIIQTVKKSAKLSRMARHLIENCGLISWLSSVV  3755
             K+LI++ ++ + K+   A+ L+   GL+SWL   +
Sbjct  1744  KKLILEVIQSTVKIPTAAKVLVSTNGLVSWLHQTI  1778



>gb|ERZ99138.1| hypothetical protein GLOINDRAFT_9831 [Rhizophagus irregularis 
DAOM 181602]
Length=692

 Score =   135 bits (339),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 86/283 (30%), Positives = 159/283 (56%), Gaps = 12/283 (4%)
 Frame = +3

Query  2937  IDPKMCASTVLYFPYGRPNGPGV-VNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSF  3113
             IDP     +  +FP  +     +  N ++K  FD+       E     +YD  + L L  
Sbjct  202   IDPMFMMRSFTHFPIDKELELEIDYNYIEKLLFDNNFSIIIME-KKISVYDLSYFLPLFA  260

Query  3114  HCLSMGYI----EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKC---QK  3272
               LS G +    + +E   LG + V+ +S+     + R++ Y +L++F   LE     +K
Sbjct  261   SLLSYGNLLDCRKFIEINALGFIVVATSSLVI---NVRRIAYYLLDEFYVLLETTNFREK  317

Query  3273  KKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPS  3452
             K+ ++ L LL + + N   +D Q+IP++  IFIA + ++ ++P H  Y  I + L+Q P 
Sbjct  318   KQILLLLNLLKNSITNRDNDDIQRIPTIITIFIAHSLYIFMNPGHFMYPLINRFLLQRPF  377

Query  3453  VNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSP  3632
             ++LK IP+F +L  S + +++ E++WILR+L +GL T DD  I+ R  I+  +  +Y SP
Sbjct  378   LDLKDIPMFYSLFQSSTNNYQKEKVWILRLLSAGLKTYDDYKIFNRRHIWNIISCYYTSP  437

Query  3633  LADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTS  3761
             LADN +++LII+ + ++A + ++  ++++N GL++W+  +  S
Sbjct  438   LADNITRKLIIEILFQAASIPKVITNMMKNQGLLTWIYHICIS  480



>gb|KDO34983.1| hypothetical protein SPRG_01045 [Saprolegnia parasitica CBS 223.65]
Length=1834

 Score =   136 bits (342),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 112/474 (24%), Positives = 205/474 (43%), Gaps = 67/474 (14%)
 Frame = +3

Query  2589  LELIKLLRVLFQVKARQVDIEPAQEIGI-------------NLRDLVFL--LLSSYNATL  2723
             ++ + L RV+     +Q ++EP     +             +L DL  L  LLS Y+A+L
Sbjct  1281  VDFVPLARVIVAALPQQAELEPTLVDALAAILATARDGSTDDLVDLALLKALLSRYSASL  1340

Query  2724  CDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSCNLSDAEVAED  2903
               +D  + ++++ +++  D  +  A   Y +G A                N   +     
Sbjct  1341  SHVDVALQSVLSLLETKFDVRLETAH--YCFGKA----------------NHVSSSSLSS  1382

Query  2904  CRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRHIY  3083
              +     E   I+P     ++ YFP  R    G  +  Q+ +                +Y
Sbjct  1383  VKSHWLLEE--IEPARMRKSIEYFPLHRSFTGGACDADQEQS----------------VY  1424

Query  3084  DPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEK  3263
             DP F L L  H LS  +I   +    G+L  ++ ++S+ DD  R   YG++     A+  
Sbjct  1425  DPAFFLPLVAHTLSTSHIPDKQLLQSGILGYAICALSAEDDTIRAYAYGIVASAHEAMSV  1484

Query  3264  CQKKKDV---MRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKH  3434
               +  D     ++ LLL  L+N +    +++PS+  +F  +A  VLL P H  Y  I   
Sbjct  1485  TARSHDFHERRQIHLLLETLKNGVRSTHERLPSLLTVFANDAISVLLRPGHAMYPLINAF  1544

Query  3435  LMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLL  3614
             L+   +++   +P+F  L  S + ++R ER W+L I+  G+  + DV +  R  ++  LL
Sbjct  1545  LLARSALDTTDVPMFYTLFNSSATTYRQERSWLLHIIKRGVRLNIDVDLLQRRHVYAILL  1604

Query  3615  SFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLS-SVVTSFCGIKYDHWK  3791
             +F+ SPLAD  +++ ++  + +S         L+   GL++WL  +++  F      HW 
Sbjct  1605  TFFDSPLADAYTQDFVLHILSRSVATPHGVFTLVHKFGLLAWLECALLRHFQSDVIAHW-  1663

Query  3792  GFPFAQFAVVLEVVNEIIFFRHTVEWLQ-KYALEQLSELSCHLCQILVEGAQML  3950
                      +L +    I    + E    KY L  +++L   LC+ +V+ A  L
Sbjct  1664  ---------LLSIATTAIEAYESAEKNDAKYRLNVVTQLQ-QLCKTMVQHASSL  1707



>gb|EXX68709.1| Urb1p [Rhizophagus irregularis DAOM 197198w]
Length=2146

 Score =   135 bits (339),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 87/285 (31%), Positives = 162/285 (57%), Gaps = 16/285 (6%)
 Frame = +3

Query  2937  IDPKMCASTVLYFPYGRPNGPGV-VNKVQKDTFDSMHEDCSAEVANRHI--YDPIFILRL  3107
             IDP     +  +FP  +     +  N ++K  FD+   + S  +  + I  YD  + L L
Sbjct  1656  IDPMFMMRSFTHFPIDKELELEIDYNYIEKLLFDN---NFSIIIMEKKISVYDLSYFLPL  1712

Query  3108  SFHCLSMGYI----EPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKC---  3266
                 LS G +    + +E   LG + V+ +S+     + R++ Y +L++F   LE     
Sbjct  1713  FASLLSYGNLLDCRKFIEINALGFIVVATSSLVI---NVRRIAYYLLDEFYVLLETTNFR  1769

Query  3267  QKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQS  3446
             +KK+ ++ L LL + + N   +D Q+IP++  IFIA + ++ ++P H  Y  I + L+Q 
Sbjct  1770  EKKQILLLLNLLKNSITNRDNDDIQRIPTIITIFIAHSLYIFMNPGHFMYPLINRFLLQR  1829

Query  3447  PSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYV  3626
             P ++LK IP+F +L  S + +++ E++WILR+L +GL T DD  I+ R  I+  +  +Y 
Sbjct  1830  PFLDLKDIPMFYSLFQSSTNNYQKEKVWILRLLSAGLKTYDDYKIFNRRHIWNIISCYYT  1889

Query  3627  SPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTS  3761
             SPLADN +++LII+ + ++A + ++  ++++N GL++W+  +  S
Sbjct  1890  SPLADNITRKLIIEILFQAASIPKVITNMMKNQGLLTWIYHICIS  1934



>gb|ETO62692.1| hypothetical protein F444_19426 [Phytophthora parasitica P1976]
Length=2060

 Score =   132 bits (333),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 93/374 (25%), Positives = 172/374 (46%), Gaps = 22/374 (6%)
 Frame = +3

Query  2667  GINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSIS--DSNISIAEWDYLWGNAVVKAR  2840
             G   R L+  LLS Y+ +L   D  +  L  E ++    D  +++    + +G +     
Sbjct  1483  GTYTRSLLQTLLSCYSMSLSPFDRSLRVLFEEFETQGSKDEELTLVSMGFRFGASSTVPS  1542

Query  2841  KERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR---PNGPGVVN  3011
                    T +   S  ++ +D   +       +D     +T+ +FP  R   P+    + 
Sbjct  1543  S------TATSKRSHNDLVDDSAWVL---GGGLDQNRIRATIEHFPLDREVSPDSDASLL  1593

Query  3012  KVQKD---TFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSL  3182
             ++ ++    FD M +   ++      YDP F+L +  H +S   +        GLL V++
Sbjct  1594  ELDEEIPADFDGMEKSLESDEKQARAYDPAFLLPMLSHFISSSDLPDSGIVQQGLLGVAI  1653

Query  3183  ASISSPDDDTRKLGYGVL----EKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIP  3350
              + SS  D  R   +G+L    E  +   E     K   ++ LLL   +  +EE  ++IP
Sbjct  1654  RATSSDVDKIRGYAFGILAHLHESLQATTETTSDFKAGRQVHLLLDVFRRGVEEPLEQIP  1713

Query  3351  SVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDS-VSFRTERL  3527
             SV  +F+ +A  VL+ P+H  Y  +   L+  P+++L  +P+F +L  S + ++FR ER 
Sbjct  1714  SVVTVFLNDALAVLIRPTHVLYPQVNHFLLARPAMDLADVPMFYSLFNSRAPLTFRQERS  1773

Query  3528  WILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMAR  3707
             W+L  L  G+ ++DDV +  R  +   L SF+ S LAD  ++ LI   +  + +      
Sbjct  1774  WLLHTLRRGVRSEDDVALLERRHVLPMLFSFFTSELADTHTQPLITSILLSALRTPSGGV  1833

Query  3708  HLIENCGLISWLSS  3749
             +L+    L+ WL++
Sbjct  1834  YLVTKAALLEWLAT  1847



>gb|ETP31921.1| hypothetical protein F442_19245 [Phytophthora parasitica P10297]
Length=2060

 Score =   132 bits (333),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 93/374 (25%), Positives = 172/374 (46%), Gaps = 22/374 (6%)
 Frame = +3

Query  2667  GINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSIS--DSNISIAEWDYLWGNAVVKAR  2840
             G   R L+  LLS Y+ +L   D  +  L  E ++    D  +++    + +G +     
Sbjct  1483  GTYTRSLLQTLLSCYSMSLSPFDRSLRVLFEEFETQGSKDEELTLVSMGFRFGASSTVPS  1542

Query  2841  KERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR---PNGPGVVN  3011
                    T +   S  ++ +D   +       +D     +T+ +FP  R   P+    + 
Sbjct  1543  S------TATSKRSHNDLVDDSAWVL---GGGLDQNRIRATIEHFPLDREVSPDSDASLL  1593

Query  3012  KVQKD---TFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSL  3182
             ++ ++    FD M +   ++      YDP F+L +  H +S   +        GLL V++
Sbjct  1594  ELDEEIPADFDGMEKSLESDEKQARAYDPAFLLPMLSHFISSSDLPDSGIVQQGLLGVAI  1653

Query  3183  ASISSPDDDTRKLGYGVL----EKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIP  3350
              + SS  D  R   +G+L    E  +   E     K   ++ LLL   +  +EE  ++IP
Sbjct  1654  RATSSDVDKIRGYAFGILAHLHESLQATTETTSDFKAGRQVHLLLDVFRRGVEEPLEQIP  1713

Query  3351  SVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDS-VSFRTERL  3527
             SV  +F+ +A  VL+ P+H  Y  +   L+  P+++L  +P+F +L  S + ++FR ER 
Sbjct  1714  SVVTVFLNDALAVLIRPTHVLYPQVNHFLLARPAMDLADVPMFYSLFNSRAPLTFRQERS  1773

Query  3528  WILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMAR  3707
             W+L  L  G+ ++DDV +  R  +   L SF+ S LAD  ++ LI   +  + +      
Sbjct  1774  WLLHTLRRGVRSEDDVALLERRHVLPMLFSFFTSELADTHTQPLITSILLSALRTPSGGV  1833

Query  3708  HLIENCGLISWLSS  3749
             +L+    L+ WL++
Sbjct  1834  YLVTKAALLEWLAT  1847



>ref|XP_008879480.1| hypothetical protein H310_13669 [Aphanomyces invadans]
 gb|ETV91843.1| hypothetical protein H310_13669 [Aphanomyces invadans]
Length=1927

 Score =   132 bits (333),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 94/362 (26%), Positives = 165/362 (46%), Gaps = 40/362 (11%)
 Frame = +3

Query  2697  LLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSCN  2876
             +LSSY AT   +D  + ++V+ + +   +++++    Y +G A                +
Sbjct  1426  VLSSYGATTSPVDLLLKSIVDALVA-DGTHLTLHRVGYCFGKA---------------NH  1469

Query  2877  LSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDCS  3056
             LS    A D  +    +   ID     S++ +FP+ RP     V               +
Sbjct  1470  LS----AGDLEQHWLLDE--IDADTMKSSIEHFPHDRPFAGQYV--------------VA  1509

Query  3057  AEVANRH-IYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGV  3233
                +NR  +YDP F L L  H LS   I        G+L  ++  +S+ DD  R   YG+
Sbjct  1510  PSSSNRAAVYDPAFFLPLVAHTLSTSSIPDRHLLQSGILGYAICGLSAEDDMIRSFAYGI  1569

Query  3234  LEKFKNALEKCQKK---KDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPS  3404
             +     ++    +     +  ++ LLL  L+N I     ++P + ++F+ +A   LL P 
Sbjct  1570  VASAHESMSSTARTFEFNERRQVHLLLETLKNGIAHPHTRLPFLISVFVNDAISALLKPG  1629

Query  3405  HDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIY  3584
             H  Y  +   L+   ++++  +P+F  L  S S  FR ER W+L ++  GL  D DV + 
Sbjct  1630  HFMYPLVNAFLLSRSALDVNDVPMFYALFNSSSTMFRAERSWLLHLIKRGLKVDLDVDLL  1689

Query  3585  IRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSF  3764
              R  +F   L F+ SPLAD  ++ L+++ + K+A  +     L+   GL+ WL +V+T  
Sbjct  1690  QRRHVFSIFLGFFDSPLADAHTQALVLEILTKAAATAAGNVALVHKMGLLGWLQAVMTKH  1749

Query  3765  CG  3770
              G
Sbjct  1750  EG  1751



>ref|XP_008897378.1| hypothetical protein PPTG_05546 [Phytophthora parasitica INRA-310]
 gb|ETN17871.1| hypothetical protein PPTG_05546 [Phytophthora parasitica INRA-310]
Length=2061

 Score =   132 bits (331),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 95/374 (25%), Positives = 173/374 (46%), Gaps = 22/374 (6%)
 Frame = +3

Query  2667  GINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSIS--DSNISIAEWDYLWGNAVVKAR  2840
             G   R L+  LLS Y+ +L   D  +  L  E ++    D  +++    + +G +     
Sbjct  1484  GTYTRSLLQTLLSCYSMSLSPFDRSLRVLFEEFETQGSKDEELTLVSMGFRFGASSTVPS  1543

Query  2841  KERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR---PNGPGVVN  3011
                    T +   S  ++ +D   + F   L  D     +T+ +FP  R   P+    + 
Sbjct  1544  S------TATSKRSHNDLVDDSAWV-FGGGL--DQNRIRATIEHFPLDREVSPDSDASLL  1594

Query  3012  KVQKDT---FDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSL  3182
             ++ ++    FD M +   ++      YDP F+L +  H +S   +        GLL V++
Sbjct  1595  ELDEEIPAYFDGMEKSLESDEKQARAYDPAFLLPMLSHFISSSDLPDSGIVQQGLLGVAI  1654

Query  3183  ASISSPDDDTRKLGYGVLEKFKNAL----EKCQKKKDVMRLQLLLSYLQNCIEEDWQKIP  3350
              + SS  D  R   +G+L     +L    E     K   ++ LLL   +  +EE  ++IP
Sbjct  1655  RATSSDVDKIRGYAFGILAHLHESLQVTTETTSDFKAGRQVHLLLDVFRRGVEEPLEQIP  1714

Query  3351  SVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDS-VSFRTERL  3527
             SV  +F+ +A  VL+ P+H  Y  +   L+  P+++L  +P+F +L  S + ++FR ER 
Sbjct  1715  SVVTVFLNDALAVLIRPTHVLYPQVNHFLLVRPAMDLADVPMFYSLFNSRAPLTFRQERS  1774

Query  3528  WILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMAR  3707
             W+L  L  G+ ++DDV +  R  +   L SF+ S LAD  ++ LI   +  + +      
Sbjct  1775  WLLHTLRRGVRSEDDVALLERRHVLPMLFSFFTSELADTHTQPLITSILLSALRTPSGGV  1834

Query  3708  HLIENCGLISWLSS  3749
             +L+    L+ WL++
Sbjct  1835  YLVTKAALLEWLAT  1848



>gb|ETI33903.1| hypothetical protein F443_19474 [Phytophthora parasitica P1569]
Length=2060

 Score =   130 bits (328),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 93/374 (25%), Positives = 173/374 (46%), Gaps = 22/374 (6%)
 Frame = +3

Query  2667  GINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSIS--DSNISIAEWDYLWGNAVVKAR  2840
             G   R L+  LLS Y+ +L   D  +  L  E ++    D  +++    + +G +     
Sbjct  1483  GTYTRSLLQTLLSCYSMSLSPFDRSLRVLFEEFETQGSKDEELTLVSMGFRFGASSTVPS  1542

Query  2841  KERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR---PNGPGVVN  3011
                    T +   S  ++ +D   +       +D     +T+ +FP  R   P+    + 
Sbjct  1543  S------TATSKRSHNDLVDDSAWVL---GGGLDQNRIRATIEHFPLDREVSPDSDASLL  1593

Query  3012  KVQKD---TFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSL  3182
             ++ ++    FD M +   ++      YDP F+L +  H +S   +        GLL V++
Sbjct  1594  ELDEEIPADFDGMEKSLESDEKLVRAYDPAFLLPMLSHFISSSDLPDSGIVQQGLLGVAI  1653

Query  3183  ASISSPDDDTRKLGYGVL----EKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIP  3350
              + SS  D  R   +G+L    E  +   E     K   ++ LLL+  +  +EE  ++IP
Sbjct  1654  RATSSDVDKIRGYAFGILAHLHESLQATTETTSDFKAGRQVHLLLNVFRRGVEEPLEQIP  1713

Query  3351  SVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDS-VSFRTERL  3527
             SV  +F+ +A  VL+ P+H  Y  +   L+  P+++L  +P+F +L  S + ++FR ER 
Sbjct  1714  SVVTVFLNDALAVLIRPTHVLYPQVNHFLLARPAMDLADVPMFYSLFNSRAPLTFRQERS  1773

Query  3528  WILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMAR  3707
             W+L  L  G+ ++DDV +  R  +   L SF+ S LAD  ++ LI   +  + +      
Sbjct  1774  WLLHTLRRGVRSEDDVALLERRHVLPMLFSFFTSELADTHTQPLITSILLSALRTPSGGV  1833

Query  3708  HLIENCGLISWLSS  3749
             +L+    L+ WL++
Sbjct  1834  YLVTKAALLEWLAT  1847



>gb|ETK74261.1| hypothetical protein L915_18892 [Phytophthora parasitica]
 gb|ETL27691.1| hypothetical protein L916_18789 [Phytophthora parasitica]
 gb|ETP03784.1| hypothetical protein F441_19296 [Phytophthora parasitica CJ01A1]
Length=2060

 Score =   130 bits (328),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 93/374 (25%), Positives = 173/374 (46%), Gaps = 22/374 (6%)
 Frame = +3

Query  2667  GINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSIS--DSNISIAEWDYLWGNAVVKAR  2840
             G   R L+  LLS Y+ +L   D  +  L  E ++    D  +++    + +G +     
Sbjct  1483  GTYTRSLLQTLLSCYSMSLSPFDRSLRVLFEEFETQGSKDEELTLVSMGFRFGASSTVPS  1542

Query  2841  KERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR---PNGPGVVN  3011
                    T +   S  ++ +D   +       +D     +T+ +FP  R   P+    + 
Sbjct  1543  S------TATSKRSHNDLVDDSAWVL---GGGLDQNRIRATIEHFPLDREVSPDSDASLL  1593

Query  3012  KVQKD---TFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSL  3182
             ++ ++    FD M +   ++      YDP F+L +  H +S   +        GLL V++
Sbjct  1594  ELDEEIPADFDGMEKSLESDEKLVRAYDPAFLLPMLSHFISSSDLPDSGIVQQGLLGVAI  1653

Query  3183  ASISSPDDDTRKLGYGVL----EKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIP  3350
              + SS  D  R   +G+L    E  +   E     K   ++ LLL+  +  +EE  ++IP
Sbjct  1654  RATSSDVDKIRGYAFGILAHLHESLQATTETTSDFKAGRQVHLLLNVFRRGVEEPLEQIP  1713

Query  3351  SVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDS-VSFRTERL  3527
             SV  +F+ +A  VL+ P+H  Y  +   L+  P+++L  +P+F +L  S + ++FR ER 
Sbjct  1714  SVVTVFLNDALAVLIRPTHVLYPQVNHFLLARPAMDLADVPMFYSLFNSRAPLTFRQERS  1773

Query  3528  WILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMAR  3707
             W+L  L  G+ ++DDV +  R  +   L SF+ S LAD  ++ LI   +  + +      
Sbjct  1774  WLLHTLRRGVRSEDDVALLERRHVLPMLFSFFTSELADTHTQPLITSILLSALRTPSGGV  1833

Query  3708  HLIENCGLISWLSS  3749
             +L+    L+ WL++
Sbjct  1834  YLVTKAALLEWLAT  1847



>ref|XP_009517123.1| hypothetical protein PHYSODRAFT_309991 [Phytophthora sojae]
 gb|EGZ29848.1| hypothetical protein PHYSODRAFT_309991 [Phytophthora sojae]
Length=2046

 Score =   130 bits (328),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 98/382 (26%), Positives = 176/382 (46%), Gaps = 35/382 (9%)
 Frame = +3

Query  2667  GINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGN-AVVKARK  2843
             G   R L+  LL++Y+ +L   D  +  L  + ++   S +++    + +G  + V    
Sbjct  1448  GNYTRSLLQTLLNAYSMSLSPFDRSLRVLFEDFEA-QGSGLTLVSMGFRFGAFSTVSPSA  1506

Query  2844  ERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQK  3023
             E  L    S N    ++ +D   +       I+     +T+ YFP  R          + 
Sbjct  1507  EASLSSKRSHN----DLVDDSAWLL---GGGIEQNRVRATIEYFPLDREV------STEG  1553

Query  3024  DTFD-SMHEDCSAEVANRHI--------------YDPIFILRLSFHCLSMGYIEPVEFAN  3158
             D F  ++ ++   E  N ++              YDP F+L +  H +S   +       
Sbjct  1554  DAFLLNLDDELPVENGNDNVELTLADNGEKEAEAYDPAFLLPMLSHFVSSSDLPDGGIVQ  1613

Query  3159  LGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKK----KDVMRLQLLLSYLQNCI  3326
              GLL +++ +ISS  +  R+  YG+L     AL+   +     K   ++ LLL   +  +
Sbjct  1614  QGLLGITIRAISSDVEKIREYAYGILAHLHEALQATTETSSDFKAGRQVHLLLDVFRRGV  1673

Query  3327  EEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDS-  3503
             EE  +++PSV  +F+ +A  VL  P+H  Y  +   L+  P+++L  +P+F +L  S + 
Sbjct  1674  EEQLEQVPSVVTVFLNDALAVLTRPTHVLYPQVNHFLLARPAMDLADVPMFYSLFNSRAP  1733

Query  3504  VSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKS  3683
             ++FR ER W+L  L  G+  DDDV + +R  +   LLSFY S LAD  ++ LI   +  +
Sbjct  1734  LTFRQERSWLLHALRRGVRNDDDVALLVRRHVLPMLLSFYSSELADTHTQPLITSILLAA  1793

Query  3684  AKLSRMARHLIENCGLISWLSS  3749
              +      +LI    L+ WL++
Sbjct  1794  LRTPSGGAYLITKAALVEWLAA  1815



>gb|ETL80934.1| hypothetical protein L917_18613 [Phytophthora parasitica]
Length=2060

 Score =   130 bits (328),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 93/374 (25%), Positives = 172/374 (46%), Gaps = 22/374 (6%)
 Frame = +3

Query  2667  GINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSIS--DSNISIAEWDYLWGNAVVKAR  2840
             G   R L+  LLS Y+ +L   D  +  L  E ++    D  +++    + +G +     
Sbjct  1483  GTYTRSLLQTLLSCYSMSLSPFDRSLRVLFEEFETQGSKDEELTLVSMGFRFGASSTVPS  1542

Query  2841  KERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR---PNGPGVVN  3011
                    T +   S  ++ +D   +       +D     +T+ +FP  R   P+    + 
Sbjct  1543  S------TATSKRSHNDLVDDSAWVL---GGGLDQNRIRATIEHFPLDREVSPDSDASLL  1593

Query  3012  KVQKD---TFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSL  3182
             ++ ++    FD M +   ++      YDP F+L +  H +S   +        GLL V++
Sbjct  1594  ELDEEIPADFDGMEKSLESDEKLVRAYDPAFLLPMLSHFISSSDLPDSGIVQQGLLGVAI  1653

Query  3183  ASISSPDDDTRKLGYGVL----EKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIP  3350
              + SS  D  R   +G+L    E  +   E     K   ++ LLL   +  +EE  ++IP
Sbjct  1654  RATSSDVDKIRGYAFGILAHLHESLQATTETTSDFKAGRQVHLLLDVFRRGVEEPLEQIP  1713

Query  3351  SVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDS-VSFRTERL  3527
             SV  +F+ +A  VL+ P+H  Y  +   L+  P+++L  +P+F +L  S + ++FR ER 
Sbjct  1714  SVVTVFLNDALAVLIRPTHVLYPQVNHFLLARPAMDLADVPMFYSLFNSRAPLTFRQERS  1773

Query  3528  WILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMAR  3707
             W+L  L  G+ ++DDV +  R  +   L SF+ S LAD  ++ LI   +  + +      
Sbjct  1774  WLLHTLRRGVRSEDDVALLERRHVLPMLFSFFTSELADTHTQPLITSILLSALRTPSGGV  1833

Query  3708  HLIENCGLISWLSS  3749
             +L+    L+ WL++
Sbjct  1834  YLVTKAALLEWLAT  1847



>gb|ETM34126.1| hypothetical protein L914_18711 [Phytophthora parasitica]
Length=2060

 Score =   130 bits (327),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 93/374 (25%), Positives = 173/374 (46%), Gaps = 22/374 (6%)
 Frame = +3

Query  2667  GINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKSIS--DSNISIAEWDYLWGNAVVKAR  2840
             G   R L+  LLS Y+ +L   D  +  L  E ++    D  +++    + +G +     
Sbjct  1483  GTYTRSLLQTLLSCYSMSLSPFDRSLRVLFEEFETQGSKDEELTLVSMGFRFGASSTVPS  1542

Query  2841  KERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR---PNGPGVVN  3011
                    T +   S  ++ +D   +       +D     +T+ +FP  R   P+    + 
Sbjct  1543  S------TATSKRSHNDLVDDSAWVL---GGGLDQNRIRATIEHFPLDREVSPDSDASLL  1593

Query  3012  KVQKD---TFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSL  3182
             ++ ++    FD M +   ++      YDP F+L +  H +S   +        GLL V++
Sbjct  1594  ELDEEIPADFDGMEKSLESDEKLVRAYDPAFLLPMLSHFISSSDLPDSGIVQQGLLGVAI  1653

Query  3183  ASISSPDDDTRKLGYGVL----EKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIP  3350
              + SS  D  R   +G+L    E  +   E     K   ++ LLL+  +  +EE  ++IP
Sbjct  1654  RATSSDVDKIRGYAFGILAHLHESLQATTETTSDFKAGRQVHLLLNVFRRGVEEPLEQIP  1713

Query  3351  SVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDS-VSFRTERL  3527
             SV  +F+ +A  VL+ P+H  Y  +   L+  P+++L  +P+F +L  S + ++FR ER 
Sbjct  1714  SVVTVFLNDALAVLIRPTHVLYPQVNHFLLARPAMDLADVPMFYSLFNSRAPLTFRQERS  1773

Query  3528  WILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMAR  3707
             W+L  L  G+ ++DDV +  R  +   L SF+ S LAD  ++ LI   +  + +      
Sbjct  1774  WLLHTLRRGVRSEDDVALLERRHVLPMLFSFFTSELADTHTQPLITSILLSALRTPSGGI  1833

Query  3708  HLIENCGLISWLSS  3749
             +L+    L+ WL++
Sbjct  1834  YLVTKAALLEWLAT  1847



>ref|XP_003723889.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1-like 
[Strongylocentrotus purpuratus]
Length=1919

 Score =   127 bits (319),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 96/356 (27%), Positives = 161/356 (45%), Gaps = 30/356 (8%)
 Frame = +3

Query  2694  LLLSSYNA--TLCDIDFEIHNLVNEIKSISDSNISIAEW-DYLWGNAVVKARKERELVQT  2864
             +LL +Y+A  T+CD       L++ +     +N  + E+  Y+WG   V     R   + 
Sbjct  1546  ILLGAYSAMRTVCD-----RGLLSLMHIYEKNNAHMWEYRPYIWGKEAVTQHSAR---KA  1597

Query  2865  VSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMH  3044
             +   L      ED  K+       +D K    ++L FP  +P  P V     ++  +   
Sbjct  1598  LGRTLWKQPSVEDVLKL-------LDAKALYDSMLKFPLDQPLHPDVTEVSSREDIEIQA  1650

Query  3045  EDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVE-FANLGLLAVSLASISSPDDDTRKL  3221
             E          +YDP F+L L  H L    + P + F     L   LAS+SS  DD R+ 
Sbjct  1651  E----------LYDPRFLLPLFSHLLQPENLVPCQTFVESNALGFVLASLSSHHDDVRRA  1700

Query  3222  GYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDP  3401
             GY VL  F   LE   + +    +  +L  L+N +    Q IP +  +F+A +   +L P
Sbjct  1701  GYHVLSCFIQHLEGA-RFRGRREIAFILEILRNSVSSPTQYIPPLLTVFLARSIQQMLQP  1759

Query  3402  SHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHI  3581
                 Y  +  +LM  P +NL  +PLF  L     +  + E+ W L +L  GL    D  +
Sbjct  1760  ESSLYPILISYLMFKPQLNLNKVPLFPRLFVGAEMQHKIEKTWFLSLLTDGLRGPADFKL  1819

Query  3582  YIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSS  3749
               ++++F+TLL+FY SPL +    + II  + K+ ++   A  L++   ++ W+ +
Sbjct  1820  CAKSNVFQTLLAFYASPLCEKAIGDPIIGVLVKACEIPEGAVQLVKRRNILIWIQA  1875



>ref|XP_005345403.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar pre-ribosomal-associated 
protein 1 [Microtus ochrogaster]
Length=2266

 Score =   127 bits (318),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 99/362 (27%), Positives = 181/362 (50%), Gaps = 29/362 (8%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD-YLWGNAVVKARKERELVQTVS  2870
             +LL +Y+ATL  +D +I  L   +++   +N+S+  +   LWG A V+  K     +++ 
Sbjct  1518  VLLGTYSATLSVVDQKILLL---LRTYEQNNLSLISFRVLLWGPAAVEHHKT---CRSLG  1571

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSM-HE  3047
              +L       D  ++       +DP     T+L+FP  R   P       +DT + +  +
Sbjct  1572  KSLWQQPSVGDILRL-------LDPDQMMQTILHFPQYRRLLP------TEDTGEPLVFK  1618

Query  3048  DCSAEVANRHIYDPIFILRLSFHCLSMGYI-EPVEFANLGLLAVSLASISSPDDDTRKLG  3224
             D +A V    +YDP F+L L        ++ +  +F +   L +++A++SS D   R   
Sbjct  1619  DNTARVDLDRLYDPCFLLHLFGELTRPEFVVDCRKFLDSNALGLTVAALSSYDPKMRAAA  1678

Query  3225  YGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPS  3404
             Y VL  + + LE  + ++    L  LL  ++N I+    ++P   A+FIA+A+  +L P 
Sbjct  1679  YSVLAAYYSHLEGARFREQSQVL-YLLDVVRNGIKAPNLRLPFTVALFIAKAALQILKPE  1737

Query  3405  HDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIY  3584
                Y  I+K L+   ++N+  +P F    +S     +TE+ W+L IL  G+    D H Y
Sbjct  1738  EHMYWKISKFLLSHENLNMDKLPGFYQFFYSSDFQQKTEQEWVLGILRQGIR---DKHCY  1794

Query  3585  ---IRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVV  3755
                 R  +F  +LSF+ SPL D  +K  I++ ++  A+++R A  +I +  L++W+  ++
Sbjct  1795  ELCSRRGVFHIILSFFSSPLCDEVAKNWILEILQNVARITRSAYEVIRDYSLLTWILHIL  1854

Query  3756  TS  3761
              S
Sbjct  1855  ES  1856



>ref|XP_006035756.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Alligator 
sinensis]
Length=2312

 Score =   126 bits (316),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 103/361 (29%), Positives = 174/361 (48%), Gaps = 33/361 (9%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVN--EIKSISDSNISIAEWDYLWGNAVVKARKE-RELVQT  2864
             +LL +Y ATL  ID +I  L+   E   +S  N  I     LWG A V+  +  + L ++
Sbjct  1557  VLLGAYGATLSVIDQKILLLLQLYEKNDLSLINFRI----LLWGPAAVEHHRTCKSLGKS  1612

Query  2865  VSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR---PNGPGVVNKVQKDTFD  3035
             +    S  E+   C          +D +M   TVL+FP  R   P   G V   + ++  
Sbjct  1613  LWQQPSMEEIL--CL---------LDREMMMKTVLHFPQHRRLLPPQEGQVLLYRDESVK  1661

Query  3036  SMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPV-EFANLGLLAVSLASISSPDDDT  3212
              ++E          IYDP F+L+L        Y+    +F  +  L +++A++SS D + 
Sbjct  1662  DLNE----------IYDPCFLLQLFSELTRPEYVVACHKFVEVNALGLTVAALSSYDANM  1711

Query  3213  RKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVL  3392
             R   Y VL  F++ LE   + ++  +L  L+  +QN I +   ++    AI++A  +  +
Sbjct  1712  RAAAYYVLGSFRSHLEGA-RFREQRQLLYLMDVVQNGIRQPNLRLTFSLAIYVARVAKQM  1770

Query  3393  LDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDD  3572
             L P    Y  I K L+    ++LK +P F    +S     +TER WILR+L  GL     
Sbjct  1771  LKPEQHMYTKINKFLLSHQYLDLKKVPGFYQFFYSFDFEHKTEREWILRLLGEGLRDKHC  1830

Query  3573  VHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSV  3752
               +Y    IF  +LSF+ SPL D  S+  I++ ++ +A +++ A  LI +  L++W+  +
Sbjct  1831  YQLYDYQRIFHVILSFFNSPLCDETSENHILEILQNAAYITKAAYELIRDHSLLTWILGI  1890

Query  3753  V  3755
             +
Sbjct  1891  L  1891



>ref|XP_005849166.1| hypothetical protein CHLNCDRAFT_57419 [Chlorella variabilis]
 gb|EFN57064.1| hypothetical protein CHLNCDRAFT_57419 [Chlorella variabilis]
Length=2371

 Score =   125 bits (313),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 86/287 (30%), Positives = 141/287 (49%), Gaps = 10/287 (3%)
 Frame = +3

Query  2919  FRENLPIDPKMCASTVLYFPYG----RPNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYD  3086
              ++ LP+DP   A TV ++P G     P   G  +    D   +  +  +A  A    YD
Sbjct  1800  LQQRLPLDPARAALTVCHWPEGCSLAVPGSSGDGDGTGSDAGGAPEQLPAAAAA----YD  1855

Query  3087  PIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKC  3266
             P F+L     CL    + P  FA  GLL+V L  +++ D   R   Y  L  F+  L   
Sbjct  1856  PGFLLPFCCACLRQQLLPPRAFAEAGLLSVCLRGLAAADPGCRAASYQALALFEAQLTGA  1915

Query  3267  QKK--KDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLM  3440
                  +++ +L +LL  L+  +   +Q++P+V A+F+AEA+ + L P    Y  + KHL 
Sbjct  1916  AAPDFREMQQLSVLLGALRAAVTRPFQRLPAVHAVFLAEAALLALHPGAAMYPAVNKHLT  1975

Query  3441  QSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSF  3620
             +   +++  +P+   LL S       +R W+L++L +GL T DD  +Y R   FE  +S 
Sbjct  1976  RRALLSITDVPMLGQLLLSGGQQHAADRRWMLQLLVAGLRTADDAGLYRRQHAFELAMSL  2035

Query  3621  YVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTS  3761
             + S +AD  +  L ++ V  +  + R AR L +  GLI WL++   S
Sbjct  2036  HDSCVADPAASTLALRLVCTATFIPRAARQLAQESGLIPWLAAAAGS  2082



>ref|XP_003731583.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1-like 
[Strongylocentrotus purpuratus]
Length=560

 Score =   122 bits (305),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 96/356 (27%), Positives = 163/356 (46%), Gaps = 32/356 (9%)
 Frame = +3

Query  2694  LLLSSYNA--TLCDIDFEIHNLVNEIKSISDSNISIAEW-DYLWGNAVVKARKERELVQT  2864
             +LL +Y+A  T+CD       L++ +     +N  + E+  Y+W    V     R   + 
Sbjct  189   ILLGAYSAMRTVCD-----RGLLSLMHIYEKNNAHMWEYRPYIWVKQAVTQHSAR---KA  240

Query  2865  VSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMH  3044
             +   L      ED  K+       +D K+   ++L FP  +P  P V       T DS  
Sbjct  241   LGRTLWKQPSVEDVLKL-------LDAKVLYDSMLKFPLDQPLHPNV-------TEDSSK  286

Query  3045  EDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVE-FANLGLLAVSLASISSPDDDTRKL  3221
             +D   +     +YDP F+L L  H L   ++ P + F     L   LAS+SS  +D R+ 
Sbjct  287   KDIEKQA---ELYDPRFLLPLFSHLLQPEHLVPCQTFVESNALGFVLASLSSHHEDVRRA  343

Query  3222  GYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDP  3401
             GY VL  F   LE   + +    +  +L  L N +    Q IP +  +F+A +   +L P
Sbjct  344   GYHVLSCFIQHLEGA-RFRGRREIAFILEILLNSVSSPTQYIPPLLTVFLARSIQQMLQP  402

Query  3402  SHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHI  3581
                 Y  +  +LM  P +NL  +PLF  L        + E+ W L +L  GL +  D  +
Sbjct  403   ESALYPILISYLMFKPQLNLNKVPLFPRLFVG--AEMQIEKTWFLSLLTDGLRSPADFKL  460

Query  3582  YIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSS  3749
               ++++F+T+L+FY SPL +    + II  + K+ ++   A  L++   ++ W+ +
Sbjct  461   CAKSNVFQTILAFYASPLCEKAIGDPIIGVLVKACEIPEGAVQLVKRRNILIWIQA  516



>ref|XP_003704945.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar pre-ribosomal-associated 
protein 1-like [Megachile rotundata]
Length=1966

 Score =   124 bits (312),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 106/362 (29%), Positives = 168/362 (46%), Gaps = 36/362 (10%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAE-WDYLWGNAVVKARKERELVQTVS  2870
             L L++YNATL + D  I  L+ +   IS  NI+I E W Y+WGNA   A     +   V 
Sbjct  1498  LYLAAYNATLSEADQYIL-LILQYYEIS--NINICEYWPYVWGNA---AAVHYSVKGEVH  1551

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              NL           + F E+         +T+  +P  R    G+ N    D  D     
Sbjct  1552  MNLWRQPSVTQVLNL-FEED------KVNNTIKNYPINR----GLKNTELYDVND-----  1595

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYIEPV-EFANLGLLAVSLASISSPDDDTRKLGY  3227
                      IYDP F L L  + LS   +    + A  G LA++ A+ SS   D R L Y
Sbjct  1596  ---------IYDPAFYLPLLHYLLSENNVVSCHKVAQSGALALTFAACSSVHADVRMLAY  1646

Query  3228  GVLEKFKNALEKCQKKKDV-MRLQLLLSYLQNCIEEDWQ--KIPSVTAIFIAEASFVLLD  3398
              V+ ++   LE    K  + MRL   L Y    ++ +    ++  + +IF+A  S V   
Sbjct  1647  TVIARYYTHLEASSSKAKLWMRLVDALRYGIASLQSELNNVRLNCLVSIFLARTSLVATK  1706

Query  3399  PSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVH  3578
             P H  Y  +   L+  P++N+ +IP    L  S  V  +  R WIL  +  G+ T+ D+ 
Sbjct  1707  PLHSLYPALQTFLLAKPALNINTIPELLQLFHSSDVKHKVHRCWILENIRDGMKTETDLD  1766

Query  3579  IYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVT  3758
             +  + ++F+ LL FY   L+D+++K LI++ +  + K+++ +  LIE  GL+ WL  + T
Sbjct  1767  VAFKCTLFKMLLDFYTCNLSDSDAKILILEVINVTLKIAKASTLLIEGHGLLPWLLGITT  1826

Query  3759  SF  3764
               
Sbjct  1827  DL  1828



>ref|XP_001415404.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93696.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=2142

 Score =   124 bits (311),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 127/492 (26%), Positives = 224/492 (46%), Gaps = 51/492 (10%)
 Frame = +3

Query  2352  ISSLSEGKFSCVKIIQLMVAHSQFETAICSSNLSTGISQLGLTFTPLPSLMRSFVIPLFN  2531
             + +L+EG      ++  +VAH  F T + ++  S   + L      +P  ++S +I +  
Sbjct  1344  MQTLAEG------VVSQIVAHPLF-TRVLTTGSSDDDATLPANVRDMPITVKS-IIEVVE  1395

Query  2532  HNSICRKDNLQMSKQHLKQLELIKLLRVLFQVKARQVDIEPAQEIGINLR-------DLV  2690
               S      +  +   LK LEL+++L   ++++    D   A E  I  R       + +
Sbjct  1396  DTSAFETGAVASNSSELK-LELLRVLNSFWKLQ----DANGANET-IACRKWRAERANTL  1449

Query  2691  FLLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAV---VKARKERELVQ  2861
               L S Y AT+ + D    +L+  I + S    ++    YLWG +V   VKA       +
Sbjct  1450  ITLASGYGATMSETDRVAQDLMLAIDA-STGGGALRSLGYLWGESVTHFVKATIAIRRNE  1508

Query  2862  TVSCNLSDAEVAEDCRKI---QFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTF  3032
               S ++ D   +E    +     RE  P D +  A+T   +P  R   P     V  +T 
Sbjct  1509  NESYDVEDLLYSEPSPALVASAIREGSPPDARRAAATANRYPVTRSTPPSTA-MVSDETL  1567

Query  3033  DSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDT  3212
             D    +C +       YDP ++L  +   L    ++P E    GL  ++ A++SS D+ T
Sbjct  1568  D----ECVS-----FGYDPSWVLPFALRSLMTDAMDPREAIAWGLAPLAAAALSSHDEAT  1618

Query  3213  RKLGYGVLEKFKNALEKCQKKKDVM-----RLQLL--LSYLQNCIEEDWQKIPSVTAIFI  3371
             R++ Y +L   ++      +  D M     R Q+L  LS ++N   E   + PS +A+  
Sbjct  1619  RRVAYAILSTLEH------RVSDPMMSFRERTQVLACLSAIRNATSEALIRWPSPSAVLT  1672

Query  3372  AEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYS  3551
             AE     L P  D +  + + L +  +++L  +P+F  +L S  V  R  R WILR+L +
Sbjct  1673  AECMISCLYPELDTFLPLQRQLNKRAALDLDGLPMFLPMLNSGDVDARQHRFWILRLLRA  1732

Query  3552  GLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGL  3731
              L  D D  ++ +    E ++S Y + LA+   + L++  + ++  +   AR L+E  GL
Sbjct  1733  SLKDDVDATMFRKTFALEVVMSHYSTTLAEPFVRFLMLDLISRACAVQFAARPLVEGGGL  1792

Query  3732  ISWLSSVVTSFC  3767
             I+WL+SV  + C
Sbjct  1793  IAWLASVARAAC  1804



>ref|XP_009841762.1| hypothetical protein H257_15368 [Aphanomyces astaci]
 gb|ETV68808.1| hypothetical protein H257_15368 [Aphanomyces astaci]
Length=1940

 Score =   124 bits (310),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 89/337 (26%), Positives = 160/337 (47%), Gaps = 35/337 (10%)
 Frame = +3

Query  2937  IDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFH  3116
             ID  M  +++ +FP  RP                 H    A  ++R +YDP ++L L  H
Sbjct  1498  IDADMMNTSIAHFPIDRP----------------FHGSAYAS-SSRDMYDPAYMLPLIAH  1540

Query  3117  CLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKKDV---M  3287
              +S   I      + G+L  ++  +S+ D   R   YG++     ++    +  D     
Sbjct  1541  TISSSAIPDRHLLSSGILGYAICGLSAHDATLRAHAYGIVATAHESMSATARTFDFSERR  1600

Query  3288  RLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKS  3467
             ++ LLL  L+N I E   ++P + ++F+ +A   LL P H  +  +   L+   ++++  
Sbjct  1601  QVFLLLETLKNGIAEPHARLPCLLSVFVNDAIAALLKPGHFMFPLVNAFLLSRSALDVND  1660

Query  3468  IPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNE  3647
             +P+F  L  S S  FR ER W+L ++  G+  D DV +  R  +F  LL F+ SPLAD  
Sbjct  1661  VPMFYALFNSSSTMFRAERSWLLHLVKRGVKLDVDVELLQRRHVFSILLGFFDSPLADAH  1720

Query  3648  SKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFCGIKYDHWKGFPFAQF-AVVL  3824
             ++ L+++ +  +   +     L+   GL++WL +V      IK++        +F A++L
Sbjct  1721  TQGLVLEILATAVATAAGNVILVHKMGLLAWLQAV-----AIKHE-------GKFTALLL  1768

Query  3825  EVVNEIIFFRHTVE-WLQKYALEQLSELSCHLCQILV  3932
              +V+  I   +  E    +YA   +S+L   LC+ LV
Sbjct  1769  SLVHTSIQSYYLSEKPTDRYAANTMSQLH-QLCRTLV  1804



>ref|XP_006983601.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Peromyscus 
maniculatus bairdii]
Length=2295

 Score =   123 bits (309),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 96/359 (27%), Positives = 176/359 (49%), Gaps = 23/359 (6%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD-YLWGNAVVKARKERELVQTVS  2870
             +LL +Y+ATL  +D +I  L   +++   +N+S+  +   LWG A V+  K     +++ 
Sbjct  1526  VLLGTYSATLSVLDQKILLL---LRAYEQNNLSLISFRVLLWGPAAVEHHKT---CRSLG  1579

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSM-HE  3047
              +L       D  ++       +DP+    T+L+FP  R   P       +DT + +   
Sbjct  1580  KSLWQQPSVGDILRL-------LDPERMMQTILHFPQDRRLLPA------EDTGEPLVFT  1626

Query  3048  DCSAEVANRHIYDPIFILRLSFHCLSMGYI-EPVEFANLGLLAVSLASISSPDDDTRKLG  3224
             D +  V    +YDP F+L L        ++ +  +F +   L +++A++SS D   R   
Sbjct  1627  DKTVRVDLDSLYDPCFLLHLFGELTRPEFVVDCRKFLDSNALGLTVAALSSYDPQMRAAA  1686

Query  3225  YGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPS  3404
             Y VL  + + LE  + ++    L  LL  ++N I+    ++P   A+FIA+A+  +L P 
Sbjct  1687  YSVLAAYYSHLEGARFREQSQVL-YLLDVVRNGIKAPNLRLPFTVALFIAKAALQILKPE  1745

Query  3405  HDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIY  3584
                Y  I+K L+   SVN+  +P F    +S     RTE+ W+L IL  G+       + 
Sbjct  1746  EHMYWKISKFLLSHDSVNMDKLPGFYQFFYSSDFQQRTEQEWVLGILRQGIRDKQCYELC  1805

Query  3585  IRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTS  3761
              R  +   +LSF+ SPL D  ++  I++ ++  A ++R A  +I +  L++W+  ++ S
Sbjct  1806  SRRGVLHIILSFFSSPLCDQVAQNWILEILQNIAHVTRPAYEVIRDYSLLTWILHILES  1864



>ref|XP_006475169.1| PREDICTED: uncharacterized protein LOC102615491 isoform X3 [Citrus 
sinensis]
Length=243

 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 121/200 (61%), Gaps = 6/200 (3%)
 Frame = +3

Query  4119  AKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPL-NVSSE  4295
             A+  L+ ILMS+P + I +++  K+S F+ WA+S AL+S++  + ++ +    L N+  +
Sbjct  26    AELALKVILMSSPSIDIFRVNQVKLSSFLTWAISTALKSDSGQMYKLRESHLHLRNMLED  85

Query  4296  EETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENG  4475
                E SL SKLLRW  ASVILGK+  KL    S  S    + +N     ++  +    N 
Sbjct  86    APFEESLTSKLLRWPFASVILGKLFGKLDIPGSKLSKSSYETLN-SLFQDFGNKCVENNK  144

Query  4476  KEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPAS-SGSEVLIGNA---AA  4643
               F C+EILAA+IFYLQQLLG     LPS +SAL LLLL + +  +GS   +G+    A+
Sbjct  145   SRFDCKEILAAAIFYLQQLLGLCCGGLPSVISALSLLLLSDVSEYAGSAFKLGHRTSLAS  204

Query  4644  LCSKIRCPAEANSAWRWSFY  4703
             L S+I CPAEAN  WRWSFY
Sbjct  205   LWSRIHCPAEANPCWRWSFY  224



>ref|XP_002907672.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY64236.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=2004

 Score =   122 bits (305),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 92/372 (25%), Positives = 168/372 (45%), Gaps = 25/372 (7%)
 Frame = +3

Query  2679  RDLVFLLLSSYNATLCDIDFEIHNLVNEIKS--ISDSNISIAEWDYLWGNAVVKA-----  2837
             R L+  LLS Y+ +L   D  +  L  E ++    +  +++    + +G +   A     
Sbjct  1431  RSLLQTLLSCYSMSLSSFDRSLRVLFEEFETQGFREEELTLVSMGFRFGASSTVAPSTEA  1490

Query  2838  --RKERELVQTVSCNLSDAEVAEDCRKIQFRENLPIDPKM-CASTVLYFPYGRPNGPGVV  3008
               R   +LV   +  L      E  R     E+ P+D ++  AS  L             
Sbjct  1491  SKRSHNDLVDDSAWVLGGG--LEQNRIRSTIEHFPLDRQVSTASDALLLELD--------  1540

Query  3009  NKVQKDTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLAS  3188
               +  +  D + +    +      YDP F+L +  H +S   +        GLL V++ +
Sbjct  1541  EDIPTERGDDLEQSLETDEKRAEAYDPAFLLPMLSHFISSSDLPDGGIVQQGLLGVAIRA  1600

Query  3189  ISSPDDDTRKLGYGVL----EKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSV  3356
              SS  +  R+  YG+L    E  +   E   + K   ++ LLL   +  ++E   ++PSV
Sbjct  1601  TSSDVEKIREYAYGILAHLHESLQATTETTSEFKAGRQVHLLLDVFRRGVQEPLLQVPSV  1660

Query  3357  TAIFIAEASFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDS-VSFRTERLWI  3533
               +F+ +A  VL  P+H  Y  +   L+  P+++L  +P+F +L  S + +++R ER W+
Sbjct  1661  VTVFLNDALAVLTRPTHVLYPQVNHFLLARPAMDLADVPMFYSLFNSRAPLTYRQERSWL  1720

Query  3534  LRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHL  3713
             L  L  G+ +DDDV +  R  +   LLSF+ S LAD  ++ LI   +  + +    + +L
Sbjct  1721  LHTLRRGVRSDDDVALLERRHVLPMLLSFFTSELADTHTQPLITSILLSALRTPSGSVYL  1780

Query  3714  IENCGLISWLSS  3749
             +    L+ WL++
Sbjct  1781  VTKAALLEWLAT  1792



>gb|EZA54632.1| Nucleolar pre-ribosomal-associated protein [Cerapachys biroi]
Length=1835

 Score =   122 bits (305),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 113/408 (28%), Positives = 183/408 (45%), Gaps = 69/408 (17%)
 Frame = +3

Query  2592  ELIKLLRVLFQVKARQVDIEPAQEIGINLRDLVFLLLSSYNATLCDIDFEIHNLVNEIKS  2771
             +LI+LLR+L  ++     I  +          V L L++YNATL  ID  I  ++   +S
Sbjct  1423  DLIELLRIL--IRKNHSVISASH---------VALYLAAYNATLSHIDQRILQILQHYES  1471

Query  2772  ISDSNISIAE-WDYLWGNAV-----VKARKERELVQTVSC----NLSDAEVAEDCRKIQF  2921
                  + + + W YLWG+A      VK   E  L +  S     NL D ++ ++      
Sbjct  1472  ---HGVKLQQYWPYLWGSAAASHYAVKGETETALWRQPSTTEIFNLFDKDIVKN------  1522

Query  2922  RENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRHIYDPIFIL  3101
                          T+  +P         + +  KD  D +HE       N ++YDP F L
Sbjct  1523  -------------TIKDYP---------IRRTLKD--DELHE-------NSNVYDPAFYL  1551

Query  3102  RLSFHCLSMGYIEPVEFANL-GLLAVSLASISSPDDDTRKLGYGVLEKFKNALEKCQKKK  3278
              L    L+   I      N  G+LA+ L +  S   D R   Y  L ++   LE   K K
Sbjct  1552  PLLCSLLAENNIVACYKINQNGVLALVLIACCSSSSDVRLAAYTALSRYYFHLE-ASKSK  1610

Query  3279  DVMRLQLLLSYLQNCIEEDWQ------KIPSVTAIFIAEASFVLLDPSHDHYATITKHLM  3440
             D +    LL  L+N ++          ++  +TA F+A AS +   P H  Y+ +   LM
Sbjct  1611  DKLLWMRLLDALRNGVKLSLNCPLKDIRLSCLTATFLARASLIASQPLHPLYSPLHTFLM  1670

Query  3441  QSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSF  3620
               P+++L +IP    LL S  V  +  R WIL+ +  G+  + DV + ++  +F  LL F
Sbjct  1671  AKPALDLTTIPELLQLLHSPHVEHKAHRHWILKNIRDGMKEEGDVDVALKCMLFRMLLDF  1730

Query  3621  YVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSF  3764
             +   L+D +SK+LI++ +  + K+S+ +  LI   G++ WL  VV   
Sbjct  1731  HTCILSDAKSKQLILEVIASTTKISKASVLLIRGYGVLPWLHKVVNQL  1778



>ref|XP_005375723.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Chinchilla 
lanigera]
Length=2271

 Score =   122 bits (305),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 95/359 (26%), Positives = 175/359 (49%), Gaps = 24/359 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD-YLWGNAVVKARKE-RELVQTV  2867
             +LL +Y ATL  +D +I  L   +++   + +S+  +   LWG A V+  K  R L +++
Sbjct  1530  VLLGAYGATLSTLDQKILLL---LRAYEQNKLSLISFRVLLWGPAAVEHHKTCRSLGKSL  1586

Query  2868  SCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHE  3047
                 S A++   C          +D      T+L+FP  R   P       +D  + + +
Sbjct  1587  WQQPSVADIL--CL---------LDRDRMLQTILHFPQRRRLLP------PEDAQEVIFK  1629

Query  3048  DCSAEVANRHIYDPIFILRLSFHCLSMGYI-EPVEFANLGLLAVSLASISSPDDDTRKLG  3224
             D S  V    +YDP F+L L        ++ +  +F +   L ++LA++SS D   R   
Sbjct  1630  DQSMRVDPNGLYDPCFLLHLFGELTRPEFVVDCRKFLDSNALGLTLAALSSYDPQLRAAA  1689

Query  3225  YGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPS  3404
             Y VL  F + LE   + ++  +L  LL  ++N +     ++P   A+FIA+ +  +L P 
Sbjct  1690  YSVLAAFYSHLEGA-RFRERPQLLYLLDVVRNGVRTPNLRLPFTLALFIAKVALQILKPE  1748

Query  3405  HDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIY  3584
                Y  I+K L+   S+N+  +P F    +S     +TE+ W+L +L  G+       + 
Sbjct  1749  EHMYWKISKFLLSHESLNMDKVPGFYQFFYSSDFEHKTEQEWVLGLLRQGIRDKQCYELC  1808

Query  3585  IRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTS  3761
              R  +F  LL+F+ SPL D  ++  I++ ++  A+++R A  ++ +  L++W+  +V S
Sbjct  1809  ARRGVFHILLAFFSSPLCDEVAQNWILEILQNIARVARSAYEILRDYSLLTWILHIVES  1867



>gb|KFH73852.1| hypothetical protein MVEG_01066 [Mortierella verticillata NRRL 
6337]
Length=2029

 Score =   122 bits (305),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 85/285 (30%), Positives = 150/285 (53%), Gaps = 27/285 (9%)
 Frame = +3

Query  2937  IDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDCSAEVANRH---IYDPIFILRL  3107
             ID  +  +++++FP  R     + N V   T     +D S EV  +    +YDP F+L L
Sbjct  1547  IDAGVMMASLIHFPLDR----ALENPVPSVTL----KDYSEEVLKKRQAPMYDPCFMLPL  1598

Query  3108  SFHCLSMGY----IEPVEFANLGLLAVSLASISSPDDDTRKLGYGVLEKFKN--ALEKCQ  3269
                 ++ G      + +E   LGL+ V+L   SS DD  R   + +L+ F    +L   +
Sbjct  1599  FGTYMAFGTQLDSRKLIEANGLGLIIVAL---SSHDDTMRLAAFSLLDDFYGIVSLATMR  1655

Query  3270  KKKDVMRLQLLLSYLQNCIEEDWQ----KIPSVTAIFIAEASFVLLDPSHDHYATITKHL  3437
             +K  VM   LLL  L+N I E       +IP+V   F+A A   LL P H  Y  + K  
Sbjct  1656  EKNQVM---LLLDTLKNSIVEREDNVAPRIPTVITTFVAHALSTLLRPDHFMYPHVNKFC  1712

Query  3438  MQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLS  3617
             +Q P+++++ IP+F +L  S S   R ER+W+LR+L + L T +D  ++ R  + + L++
Sbjct  1713  LQRPTIDMEDIPMFYSLFNSSSEQHRKERVWMLRLLAASLKTSEDYKLFKRRHVVDLLVA  1772

Query  3618  FYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSV  3752
             F+ S L++  SK+++I+ +  ++ + +++  +I     +SWL ++
Sbjct  1773  FFNSQLSEPLSKKIVIEILFNASSIPKVSLQMITQSAFLSWLHTL  1817



>ref|XP_006268321.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Alligator 
mississippiensis]
Length=2311

 Score =   121 bits (304),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 102/361 (28%), Positives = 170/361 (47%), Gaps = 33/361 (9%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVN--EIKSISDSNISIAEWDYLWGNAVVKARKE-RELVQT  2864
             +LL +Y ATL  ID +I  L+   E   +S  N  I     LWG A V+  K  + L ++
Sbjct  1556  VLLGAYGATLSVIDQKILLLLQLYEKNDLSLINFRI----LLWGPAAVEHHKTCKSLGKS  1611

Query  2865  VSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR---PNGPGVVNKVQKDTFD  3035
             +    S  E+   C          +D +M   T+L+FP  R   P   G V   + ++  
Sbjct  1612  LWQQPSMEEIL--CL---------LDREMMMKTILHFPQHRRLLPPQEGQVLLYRDESVK  1660

Query  3036  SMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPV-EFANLGLLAVSLASISSPDDDT  3212
              ++E          IYDP F+L+L        Y+    +F  +  L +++A++SS D + 
Sbjct  1661  DLNE----------IYDPCFLLQLFSELTRPEYVVACHKFVEVNALGLTVAALSSYDANM  1710

Query  3213  RKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVL  3392
             R   Y VL  F++ LE    ++   +L  L+  +QN I +   +      I+IA  +  +
Sbjct  1711  RAAAYYVLGSFRSHLEGAHFREQ-RQLLYLMDVVQNGIRQPNLRFTFSLTIYIARVAQQM  1769

Query  3393  LDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDD  3572
             L P    Y  I   L+    ++LK +P F    +S     +TER WILR+L  GL     
Sbjct  1770  LKPEQHMYPKINTFLLSHQYLDLKKVPGFYQFFYSFDFEHKTEREWILRLLGEGLRDKHC  1829

Query  3573  VHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSV  3752
               +Y    IF  +LSF+ SPL D  S+  I++ ++ +A +++ A  LI +  L++W+  +
Sbjct  1830  YQLYDYQRIFHVILSFFNSPLCDETSENHILEILQNAAYITKAAYELIRDHSLLTWILGI  1889

Query  3753  V  3755
             +
Sbjct  1890  L  1890



>ref|XP_005993684.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Latimeria 
chalumnae]
Length=2138

 Score =   121 bits (304),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 97/379 (26%), Positives = 186/379 (49%), Gaps = 25/379 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD-YLWGNAVVKARKERELVQTVS  2870
             +LL +Y ATL   D     L+  +++   +N+S+AE+  ++WG A V+  K R   +++ 
Sbjct  1447  VLLGAYGATLGITD---QKLLLLLQTYEKNNVSLAEFRLWMWGPAAVEHHKTR---KSLG  1500

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              +L      E+   +  RE +         T+L++P  R   P    + QK+    + +D
Sbjct  1501  QSLWQQPNMEEILSLLDREKM-------LQTILHYPQHRRLLP----EEQKEL---LFKD  1546

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYI-EPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
                E  +  +YDP F+L L    +   Y+ +  +F +   L +++ ++SS D   R   Y
Sbjct  1547  DLIEYPDS-LYDPCFLLPLFSALIVPEYVVDCRKFVDANALGLTVTALSSYDPKMRAAAY  1605

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F + LE   + ++  +LQ L+  ++N I ++  ++    A+++A+    LL P  
Sbjct  1606  HVLGSFSSHLEAA-RFREKRQLQYLMDIVKNGIRQENLRLTFSLAVYVAKVVQQLLKPEE  1664

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  I++ L+    +++K +P F NL +S     + ER W+L +L  GL       +Y 
Sbjct  1665  HMYVKISRFLLAHQYLDVKKVPGFYNLFYSFDFEHKVEREWVLGLLVDGLKDRHCYELYE  1724

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTSFC  3767
                IF  +L F+ SPL D  ++  I++ ++++A +++ A  LI +  L++W+  +     
Sbjct  1725  HQRIFHIILIFFNSPLCDETTQTQILEVLQRAAHVTKAAYELIRDHSLLTWILQITEKRA  1784

Query  3768  GIKYDHWKGFPFAQFAVVL  3824
              +  D    F  + F+ VL
Sbjct  1785  NLGLDKMSQF-LSMFSSVL  1802



>ref|XP_003467321.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar pre-ribosomal-associated 
protein 1 [Cavia porcellus]
Length=2268

 Score =   121 bits (303),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 99/355 (28%), Positives = 174/355 (49%), Gaps = 31/355 (9%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVN--EIKSISDSNISIAEWDYLWGNAVVKARKE-RELVQT  2864
             +LL +Y ATL  +D +I  L+   E   +S  N  +     LWG A V+  K  R L ++
Sbjct  1530  VLLGAYGATLSTLDQKILLLLQAYEQNKLSLINFRV----LLWGPAAVEHHKTCRSLGKS  1585

Query  2865  VSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMH  3044
             +    S A++   C          +D      T+L+FP  R   P         + ++M 
Sbjct  1586  LWQQPSVADIL--CL---------LDRDRMLQTILHFPQNRRLLP---------SEEAMF  1625

Query  3045  EDCSAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRK  3218
             +D S  V  R +YDP F+L L F  L+     ++  +F +   L +++A++SS D   R 
Sbjct  1626  KDKSMRVDPRGLYDPCFLLPL-FVELTRPECVVDCRKFLDSNALGLTVAALSSYDPQMRA  1684

Query  3219  LGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLD  3398
               Y VL  F + LE   + ++  +L  LL  ++N I+    ++P   A+FIA+A+  +L 
Sbjct  1685  AAYSVLAAFYSHLEGA-RFREQSQLLYLLDVVRNGIQTPNLRLPFTLALFIAKAALQILK  1743

Query  3399  PSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVH  3578
             P    Y  I+K L+    +N+  +P F    +S     +TE+ W+L IL  G+       
Sbjct  1744  PEEHMYWKISKFLLSHDYLNMDKVPGFYQFFYSSDFEHKTEQEWVLGILRQGIRDKQCYE  1803

Query  3579  IYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
             +  R  +F  +LSF+ SPL D  ++  I++ ++  A+++R A  ++ +  L++W+
Sbjct  1804  LCARRGVFHIILSFFSSPLCDEVAQIWILEILQNIAQVARSAYEILRDYSLLTWI  1858



>ref|XP_010606933.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 isoform 
X1 [Fukomys damarensis]
 gb|KFO21600.1| Nucleolar pre-ribosomal-associated protein 1 [Fukomys damarensis]
Length=2274

 Score =   120 bits (302),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 94/353 (27%), Positives = 174/353 (49%), Gaps = 24/353 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD-YLWGNAVVKARKE-RELVQTV  2867
             +LL +Y ATL  +D +I  L   +++   + +S+ ++   LWG A V+  K  R L +++
Sbjct  1533  VLLGAYGATLSTLDQKILLL---LRAYEQNKLSLIDFRVLLWGPAAVEHHKTCRSLGKSL  1589

Query  2868  SCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHE  3047
                 S A++   C          +D      T+L+FP  R   P       +D  +++ +
Sbjct  1590  WQQPSVADIL--CL---------LDRDRMLHTILHFPQNRRLLP------PEDAQEAIFK  1632

Query  3048  DCSAEVANRHIYDPIFILRLSFHCLSMGYI-EPVEFANLGLLAVSLASISSPDDDTRKLG  3224
             D S  V    +YDP F+L L        ++ +  +F +   L +++A++SS D   R   
Sbjct  1633  DKSMTVDPSGLYDPCFLLHLFGELTRPEFVVDCRKFLDSNALGLTVAALSSYDPQMRAAA  1692

Query  3225  YGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPS  3404
             Y VL  F + LE   + ++  +L  LL  ++N I     ++P   A+FIA+A+  +L P 
Sbjct  1693  YSVLAAFYSHLEGA-RFREQSQLLYLLDVVRNGIRTLNLRLPFTLALFIAKAAVQILKPE  1751

Query  3405  HDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIY  3584
                Y  I+K L+    +N+  +P F    +S     +TE+ W+L IL  G+       + 
Sbjct  1752  EHMYWKISKFLLSHEYLNMDKLPGFYQFFYSSDFEHKTEQEWVLGILRQGIRDKQCYELC  1811

Query  3585  IRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
              R  +F  +LSF+ SPL D  ++  I++ ++  A+++R A  ++ +  L++W+
Sbjct  1812  ARRGVFHIILSFFSSPLCDEVAQNWILEILQNIARVARSAYEILRDYSLLTWI  1864



>ref|XP_010606934.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 isoform 
X2 [Fukomys damarensis]
Length=2273

 Score =   120 bits (302),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 94/353 (27%), Positives = 174/353 (49%), Gaps = 24/353 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD-YLWGNAVVKARKE-RELVQTV  2867
             +LL +Y ATL  +D +I  L   +++   + +S+ ++   LWG A V+  K  R L +++
Sbjct  1532  VLLGAYGATLSTLDQKILLL---LRAYEQNKLSLIDFRVLLWGPAAVEHHKTCRSLGKSL  1588

Query  2868  SCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHE  3047
                 S A++   C          +D      T+L+FP  R   P       +D  +++ +
Sbjct  1589  WQQPSVADIL--CL---------LDRDRMLHTILHFPQNRRLLP------PEDAQEAIFK  1631

Query  3048  DCSAEVANRHIYDPIFILRLSFHCLSMGYI-EPVEFANLGLLAVSLASISSPDDDTRKLG  3224
             D S  V    +YDP F+L L        ++ +  +F +   L +++A++SS D   R   
Sbjct  1632  DKSMTVDPSGLYDPCFLLHLFGELTRPEFVVDCRKFLDSNALGLTVAALSSYDPQMRAAA  1691

Query  3225  YGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPS  3404
             Y VL  F + LE   + ++  +L  LL  ++N I     ++P   A+FIA+A+  +L P 
Sbjct  1692  YSVLAAFYSHLEGA-RFREQSQLLYLLDVVRNGIRTLNLRLPFTLALFIAKAAVQILKPE  1750

Query  3405  HDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIY  3584
                Y  I+K L+    +N+  +P F    +S     +TE+ W+L IL  G+       + 
Sbjct  1751  EHMYWKISKFLLSHEYLNMDKLPGFYQFFYSSDFEHKTEQEWVLGILRQGIRDKQCYELC  1810

Query  3585  IRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
              R  +F  +LSF+ SPL D  ++  I++ ++  A+++R A  ++ +  L++W+
Sbjct  1811  ARRGVFHIILSFFSSPLCDEVAQNWILEILQNIARVARSAYEILRDYSLLTWI  1863



>ref|XP_010606935.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 isoform 
X3 [Fukomys damarensis]
Length=2255

 Score =   120 bits (301),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 94/353 (27%), Positives = 174/353 (49%), Gaps = 24/353 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD-YLWGNAVVKARKE-RELVQTV  2867
             +LL +Y ATL  +D +I  L   +++   + +S+ ++   LWG A V+  K  R L +++
Sbjct  1514  VLLGAYGATLSTLDQKILLL---LRAYEQNKLSLIDFRVLLWGPAAVEHHKTCRSLGKSL  1570

Query  2868  SCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHE  3047
                 S A++   C          +D      T+L+FP  R   P       +D  +++ +
Sbjct  1571  WQQPSVADIL--CL---------LDRDRMLHTILHFPQNRRLLP------PEDAQEAIFK  1613

Query  3048  DCSAEVANRHIYDPIFILRLSFHCLSMGYI-EPVEFANLGLLAVSLASISSPDDDTRKLG  3224
             D S  V    +YDP F+L L        ++ +  +F +   L +++A++SS D   R   
Sbjct  1614  DKSMTVDPSGLYDPCFLLHLFGELTRPEFVVDCRKFLDSNALGLTVAALSSYDPQMRAAA  1673

Query  3225  YGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPS  3404
             Y VL  F + LE   + ++  +L  LL  ++N I     ++P   A+FIA+A+  +L P 
Sbjct  1674  YSVLAAFYSHLEGA-RFREQSQLLYLLDVVRNGIRTLNLRLPFTLALFIAKAAVQILKPE  1732

Query  3405  HDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIY  3584
                Y  I+K L+    +N+  +P F    +S     +TE+ W+L IL  G+       + 
Sbjct  1733  EHMYWKISKFLLSHEYLNMDKLPGFYQFFYSSDFEHKTEQEWVLGILRQGIRDKQCYELC  1792

Query  3585  IRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
              R  +F  +LSF+ SPL D  ++  I++ ++  A+++R A  ++ +  L++W+
Sbjct  1793  ARRGVFHIILSFFSSPLCDEVAQNWILEILQNIARVARSAYEILRDYSLLTWI  1845



>ref|XP_010872252.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Esox 
lucius]
Length=2325

 Score =   120 bits (301),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 92/352 (26%), Positives = 174/352 (49%), Gaps = 24/352 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD-YLWGNAVVKARKERELVQTVS  2870
             +L+ +Y ATL   D ++  L+ E +    +NIS+ ++   LWG A V+  K R   +++ 
Sbjct  1576  VLMGAYGATLSATDQKLLLLLQEYER---NNISLVDFQCLLWGPAAVEHHKTR---RSLG  1629

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              +L     +ED   +       + P+  A+TV +FP  R         + +++ + + +D
Sbjct  1630  VSLWQQPSSEDLLAL-------LQPETMANTVRHFPLQR-------RIIIQESKEQIFKD  1675

Query  3051  CSAEVANRHIYDPIFILRL-SFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             C  +     +YDP F+L L S        ++ ++F +   L V++ S+SS D   R   Y
Sbjct  1676  CEVKDLGS-VYDPCFLLPLFSAMLQPESVVDCLKFVSSHGLGVTVVSLSSYDPKLRAAAY  1734

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  + + LE   + ++  +L  LL  ++N I     ++P +   +IA+ +  +L P  
Sbjct  1735  QVLASYYHHLEAA-RFRERRQLLYLLDMVKNGIGLQNLRMPFILTTYIAKVAQQMLRPEE  1793

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  + + L+   S+N + +P F  L +S  +  + ER WIL +L  GL       +  
Sbjct  1794  HMYVVVNRFLLSQQSLNFRRVPEFFKLFFSCDMEHKLEREWILSVLEEGLTDRHCYELLD  1853

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
             +  IF+TLL F  SPL D+ ++  I++ + ++  +++ A  L +  GL+ W+
Sbjct  1854  QQGIFQTLLGFCCSPLCDDHTQTRIVRVLHRAGHVTKAAYLLTQYHGLLVWI  1905



>ref|XP_005323593.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Ictidomys 
tridecemlineatus]
Length=2267

 Score =   120 bits (301),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 91/353 (26%), Positives = 176/353 (50%), Gaps = 24/353 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD-YLWGNAVVKARKERELVQTVS  2870
             +LL +Y ATL  +D +I  L   +++   + +S+  +   LWG A V+  K     +++ 
Sbjct  1530  VLLGAYRATLSILDQKILLL---LRAYEQNKLSLISFRVLLWGPAAVEHHKT---CRSLG  1583

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              +L       D  ++  R+ +         T+L+FP  R   P       +D+ +S+ +D
Sbjct  1584  KSLWQQPSVGDILRLLDRDQM-------MQTILHFPLNRRLLP------PEDSQESVFKD  1630

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLG  3224
              S +V    +YDP F+L L F  L+     ++  +F +   L +++A++SS D   R   
Sbjct  1631  KSVKVDLNGLYDPCFLLHL-FSELTRPEFVVDCRKFLDSNALGLTVAALSSYDPQMRAAA  1689

Query  3225  YGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPS  3404
             Y VL  + + LE   + ++  +L  LL  ++N I     ++    A+FIA+A+  +L P 
Sbjct  1690  YSVLAAYYSHLEGA-RFREQSQLLYLLDVVRNGIRTPNMRLTFTLALFIAKAALQILKPE  1748

Query  3405  HDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIY  3584
                Y  I+K L+    +N+  +P F    +S     +TE+ W+  IL  G+   +   + 
Sbjct  1749  EHMYWKISKFLLSHEYLNMDKVPGFYQFFYSSDFEQKTEQEWVFGILRQGIRDKNSYELC  1808

Query  3585  IRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
              R  +F  +L+F+ SPL D  ++  I++ ++ +A+++R A  +I +  L++W+
Sbjct  1809  ARRGVFHIILTFFSSPLCDEVAQNWILEILQNAAQVARSAYEIIRDYSLLTWI  1861



>gb|KFO54919.1| Nucleolar pre-ribosomal-associated protein 1, partial [Corvus 
brachyrhynchos]
Length=2220

 Score =   120 bits (300),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 113/400 (28%), Positives = 190/400 (48%), Gaps = 50/400 (13%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKE-RELVQTVS  2870
             +LL +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K  + L +++ 
Sbjct  1470  VLLGAYGATLSAVDQKILLLLQLYEKNNQSLIN--SRILLWGPAAVEHHKTCKSLGKSLW  1527

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGP--GVVNKVQKD-TFDSM  3041
                S  E+   C          +D +M   T+L FP  R   P  G+   + KD T  S+
Sbjct  1528  QQPSMEEIL--CL---------LDREMMMKTILSFPQHRRLLPSQGIQESLYKDETVKSL  1576

Query  3042  HEDCSAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTR  3215
              +           YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R
Sbjct  1577  DD----------FYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMR  1625

Query  3216  KLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLL  3395
                Y VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L
Sbjct  1626  AAAYFVLASFRSHLEGA-RFREKSQLLYLLDAVQNGIGQPNLRFTFSLTLYIARVAQQIL  1684

Query  3396  DPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDV  3575
              P    Y  + + L+    ++L+ +P F  L +S    ++TER WILR L  GL      
Sbjct  1685  KPEEHMYIKVNRFLLSHQYLDLRKVPGFFQLFYSFDFEYKTEREWILRFLGEGLRDKHCY  1744

Query  3576  HIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISW-LSSV  3752
              +Y    IF+ +LSF+ SPL D  S+  I++ ++ +A+++R A  LI++  L++W L S+
Sbjct  1745  ELYDYQRIFQIILSFFNSPLCDEGSQSRILEILQSAARVTRAAYELIQDHSLLTWVLHSL  1804

Query  3753  VTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWL  3872
                F   K                 V+N+II   HT+ WL
Sbjct  1805  EKRFLENK-----------------VINKIISLLHTL-WL  1826



>ref|XP_008642871.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Corvus 
brachyrhynchos]
Length=2269

 Score =   119 bits (299),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 113/400 (28%), Positives = 190/400 (48%), Gaps = 50/400 (13%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKE-RELVQTVS  2870
             +LL +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K  + L +++ 
Sbjct  1524  VLLGAYGATLSAVDQKILLLLQLYEKNNQSLIN--SRILLWGPAAVEHHKTCKSLGKSLW  1581

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGP--GVVNKVQKD-TFDSM  3041
                S  E+   C          +D +M   T+L FP  R   P  G+   + KD T  S+
Sbjct  1582  QQPSMEEIL--CL---------LDREMMMKTILSFPQHRRLLPSQGIQESLYKDETVKSL  1630

Query  3042  HEDCSAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTR  3215
              +           YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R
Sbjct  1631  DD----------FYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMR  1679

Query  3216  KLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLL  3395
                Y VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L
Sbjct  1680  AAAYFVLASFRSHLEGA-RFREKSQLLYLLDAVQNGIGQPNLRFTFSLTLYIARVAQQIL  1738

Query  3396  DPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDV  3575
              P    Y  + + L+    ++L+ +P F  L +S    ++TER WILR L  GL      
Sbjct  1739  KPEEHMYIKVNRFLLSHQYLDLRKVPGFFQLFYSFDFEYKTEREWILRFLGEGLRDKHCY  1798

Query  3576  HIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISW-LSSV  3752
              +Y    IF+ +LSF+ SPL D  S+  I++ ++ +A+++R A  LI++  L++W L S+
Sbjct  1799  ELYDYQRIFQIILSFFNSPLCDEGSQSRILEILQSAARVTRAAYELIQDHSLLTWVLHSL  1858

Query  3753  VTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWL  3872
                F   K                 V+N+II   HT+ WL
Sbjct  1859  EKRFLENK-----------------VINKIISLLHTL-WL  1880



>ref|XP_010389699.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 isoform 
X2 [Corvus cornix cornix]
Length=2243

 Score =   119 bits (299),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 113/400 (28%), Positives = 190/400 (48%), Gaps = 50/400 (13%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKE-RELVQTVS  2870
             +LL +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K  + L +++ 
Sbjct  1538  VLLGAYGATLSAVDQKILLLLQLYEKNNQSLIN--SRILLWGPAAVEHHKTCKSLGKSLW  1595

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGP--GVVNKVQKD-TFDSM  3041
                S  E+   C          +D +M   T+L FP  R   P  G+   + KD T  S+
Sbjct  1596  QQPSMEEIL--CL---------LDREMMMKTILSFPQHRRLLPSQGIQESLYKDETVKSL  1644

Query  3042  HEDCSAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTR  3215
              +           YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R
Sbjct  1645  DD----------FYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMR  1693

Query  3216  KLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLL  3395
                Y VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L
Sbjct  1694  AAAYFVLASFRSHLEGA-RFREKSQLLYLLDAVQNGIGQPNLRFTFSLTLYIARVAQQIL  1752

Query  3396  DPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDV  3575
              P    Y  + + L+    ++L+ +P F  L +S    ++TER WILR L  GL      
Sbjct  1753  KPEEHMYIKVNRFLLSHQYLDLRKVPGFFQLFYSFDFEYKTEREWILRFLGEGLRDKHCY  1812

Query  3576  HIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISW-LSSV  3752
              +Y    IF+ +LSF+ SPL D  S+  I++ ++ +A+++R A  LI++  L++W L S+
Sbjct  1813  ELYDYQRIFQIILSFFNSPLCDEGSQSRILEILQSAARVTRAAYELIQDHSLLTWVLHSL  1872

Query  3753  VTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWL  3872
                F   K                 V+N+II   HT+ WL
Sbjct  1873  EKRFLENK-----------------VINKIISLLHTL-WL  1894



>ref|XP_006126117.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 isoform 
X1 [Pelodiscus sinensis]
Length=2305

 Score =   119 bits (299),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 99/361 (27%), Positives = 169/361 (47%), Gaps = 41/361 (11%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVN--EIKSISDSNISIAEWDYLWGNAVVKARKE-RELVQT  2864
             +LL SY ATL D+D +I  L+   E   +S  N  I     LWG A V+  K  + L ++
Sbjct  1553  VLLGSYGATLSDVDQKILLLLQLYEKNDLSLINFRI----LLWGPAAVEHHKTCKSLGKS  1608

Query  2865  VSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR-------PNGPGVVNKVQK  3023
             +    S  E+   C          +D +   +T+L+FP  R          P   +K  K
Sbjct  1609  LWQQPSMEEIL--CL---------LDKEKMMNTILHFPQHRRLLPPEEGQAPLYRDKSMK  1657

Query  3024  DTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPV-EFANLGLLAVSLASISSP  3200
             D  D              +YDP F+L+L        ++    +F  +  L +++A++SS 
Sbjct  1658  DLDD--------------LYDPCFLLQLFSELTRPEFVVACHKFVEVNALGLTVAALSSY  1703

Query  3201  DDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEA  3380
             D   R + Y VL  F++ LE   + ++  +L  L+  +QN I +   +      +F+A  
Sbjct  1704  DSSVRAVAYYVLGSFRSHLEGA-RFREQRQLLYLMDVVQNGIRQPNLRFTFSMTLFVARV  1762

Query  3381  SFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLN  3560
             +  +L P    Y  I K L+    ++LK +P F  L +S  +  +TER W+L +L  GL 
Sbjct  1763  AQQMLKPEEHMYTKINKFLLSHQYLDLKKVPGFYQLFYSFDLEHKTERDWVLGLLGEGLR  1822

Query  3561  TDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISW  3740
                   +Y    IF  +L F+ SPL D  S+  I++ ++ +A++++ A  LI +  L++W
Sbjct  1823  DKHCYELYEYQRIFHIILCFFNSPLCDETSQGHILEILQNAARITKAAYELIRDHSLLTW  1882

Query  3741  L  3743
             +
Sbjct  1883  I  1883



>ref|XP_006126118.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 isoform 
X2 [Pelodiscus sinensis]
Length=2299

 Score =   119 bits (299),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 99/361 (27%), Positives = 169/361 (47%), Gaps = 41/361 (11%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVN--EIKSISDSNISIAEWDYLWGNAVVKARKE-RELVQT  2864
             +LL SY ATL D+D +I  L+   E   +S  N  I     LWG A V+  K  + L ++
Sbjct  1547  VLLGSYGATLSDVDQKILLLLQLYEKNDLSLINFRI----LLWGPAAVEHHKTCKSLGKS  1602

Query  2865  VSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR-------PNGPGVVNKVQK  3023
             +    S  E+   C          +D +   +T+L+FP  R          P   +K  K
Sbjct  1603  LWQQPSMEEIL--CL---------LDKEKMMNTILHFPQHRRLLPPEEGQAPLYRDKSMK  1651

Query  3024  DTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPV-EFANLGLLAVSLASISSP  3200
             D  D              +YDP F+L+L        ++    +F  +  L +++A++SS 
Sbjct  1652  DLDD--------------LYDPCFLLQLFSELTRPEFVVACHKFVEVNALGLTVAALSSY  1697

Query  3201  DDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEA  3380
             D   R + Y VL  F++ LE   + ++  +L  L+  +QN I +   +      +F+A  
Sbjct  1698  DSSVRAVAYYVLGSFRSHLEGA-RFREQRQLLYLMDVVQNGIRQPNLRFTFSMTLFVARV  1756

Query  3381  SFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLN  3560
             +  +L P    Y  I K L+    ++LK +P F  L +S  +  +TER W+L +L  GL 
Sbjct  1757  AQQMLKPEEHMYTKINKFLLSHQYLDLKKVPGFYQLFYSFDLEHKTERDWVLGLLGEGLR  1816

Query  3561  TDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISW  3740
                   +Y    IF  +L F+ SPL D  S+  I++ ++ +A++++ A  LI +  L++W
Sbjct  1817  DKHCYELYEYQRIFHIILCFFNSPLCDETSQGHILEILQNAARITKAAYELIRDHSLLTW  1876

Query  3741  L  3743
             +
Sbjct  1877  I  1877



>ref|XP_004842340.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Heterocephalus 
glaber]
Length=2274

 Score =   119 bits (298),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 96/360 (27%), Positives = 176/360 (49%), Gaps = 26/360 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD-YLWGNAVVKARKE-RELVQTV  2867
             +LL +Y ATL  +D +I  L   +++   + +S+ ++   LWG A V+  K  R L +++
Sbjct  1533  VLLGAYGATLSTLDQKILFL---LRAYEQNKLSLIDFRVLLWGPAAVEHHKTCRGLGKSL  1589

Query  2868  SCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHE  3047
                 S A++   C          +D      T+L+FP  R   P       +D  +++ +
Sbjct  1590  WQQPSVADIL--CL---------LDRDRMLHTILHFPQNRRLLP------PEDAQEALFK  1632

Query  3048  DCSAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKL  3221
             D    V    +YDP F+L L F  L+     ++  +F +   L +++A++SS D   R  
Sbjct  1633  DKIMRVDPSGLYDPCFLLHL-FRELTRPEFVVDCRKFLDSNALGLTVAALSSYDPQMRAA  1691

Query  3222  GYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDP  3401
              Y +L  F + LE   + ++  +L  LL  ++N I     ++P   A+FIA+ +  +L P
Sbjct  1692  AYSILAAFYSHLEGA-RFREQSQLLYLLDVVRNGIRTPNLRLPFTLALFIAKVALQILKP  1750

Query  3402  SHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHI  3581
                 Y  I+K L+    +N+  +P F    +S     +TE+ W+L IL  G+       +
Sbjct  1751  EEHMYWKISKFLLSHEYLNMDKVPGFYQFFYSSDFEHKTEQEWVLGILRQGIRDKQCYEL  1810

Query  3582  YIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTS  3761
               R  IF  +LSF+ SPL D  S+  I++ ++  A++ R A  ++ +  L++W+  ++ S
Sbjct  1811  CARRGIFHIILSFFSSPLCDEVSQNWILEILQNIAQVPRSAYEILRDYSLLTWILHILES  1870



>ref|XP_010389697.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 isoform 
X1 [Corvus cornix cornix]
Length=2283

 Score =   119 bits (298),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 113/400 (28%), Positives = 190/400 (48%), Gaps = 50/400 (13%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKE-RELVQTVS  2870
             +LL +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K  + L +++ 
Sbjct  1538  VLLGAYGATLSAVDQKILLLLQLYEKNNQSLIN--SRILLWGPAAVEHHKTCKSLGKSLW  1595

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGP--GVVNKVQKD-TFDSM  3041
                S  E+   C          +D +M   T+L FP  R   P  G+   + KD T  S+
Sbjct  1596  QQPSMEEIL--CL---------LDREMMMKTILSFPQHRRLLPSQGIQESLYKDETVKSL  1644

Query  3042  HEDCSAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTR  3215
              +           YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R
Sbjct  1645  DD----------FYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMR  1693

Query  3216  KLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLL  3395
                Y VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L
Sbjct  1694  AAAYFVLASFRSHLEGA-RFREKSQLLYLLDAVQNGIGQPNLRFTFSLTLYIARVAQQIL  1752

Query  3396  DPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDV  3575
              P    Y  + + L+    ++L+ +P F  L +S    ++TER WILR L  GL      
Sbjct  1753  KPEEHMYIKVNRFLLSHQYLDLRKVPGFFQLFYSFDFEYKTEREWILRFLGEGLRDKHCY  1812

Query  3576  HIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISW-LSSV  3752
              +Y    IF+ +LSF+ SPL D  S+  I++ ++ +A+++R A  LI++  L++W L S+
Sbjct  1813  ELYDYQRIFQIILSFFNSPLCDEGSQSRILEILQSAARVTRAAYELIQDHSLLTWVLHSL  1872

Query  3753  VTSFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWL  3872
                F   K                 V+N+II   HT+ WL
Sbjct  1873  EKRFLENK-----------------VINKIISLLHTL-WL  1894



>ref|XP_006126119.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 isoform 
X3 [Pelodiscus sinensis]
Length=2297

 Score =   119 bits (298),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 99/361 (27%), Positives = 169/361 (47%), Gaps = 41/361 (11%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVN--EIKSISDSNISIAEWDYLWGNAVVKARKE-RELVQT  2864
             +LL SY ATL D+D +I  L+   E   +S  N  I     LWG A V+  K  + L ++
Sbjct  1545  VLLGSYGATLSDVDQKILLLLQLYEKNDLSLINFRI----LLWGPAAVEHHKTCKSLGKS  1600

Query  2865  VSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR-------PNGPGVVNKVQK  3023
             +    S  E+   C          +D +   +T+L+FP  R          P   +K  K
Sbjct  1601  LWQQPSMEEIL--CL---------LDKEKMMNTILHFPQHRRLLPPEEGQAPLYRDKSMK  1649

Query  3024  DTFDSMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPV-EFANLGLLAVSLASISSP  3200
             D  D              +YDP F+L+L        ++    +F  +  L +++A++SS 
Sbjct  1650  DLDD--------------LYDPCFLLQLFSELTRPEFVVACHKFVEVNALGLTVAALSSY  1695

Query  3201  DDDTRKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEA  3380
             D   R + Y VL  F++ LE   + ++  +L  L+  +QN I +   +      +F+A  
Sbjct  1696  DSSVRAVAYYVLGSFRSHLEGA-RFREQRQLLYLMDVVQNGIRQPNLRFTFSMTLFVARV  1754

Query  3381  SFVLLDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLN  3560
             +  +L P    Y  I K L+    ++LK +P F  L +S  +  +TER W+L +L  GL 
Sbjct  1755  AQQMLKPEEHMYTKINKFLLSHQYLDLKKVPGFYQLFYSFDLEHKTERDWVLGLLGEGLR  1814

Query  3561  TDDDVHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISW  3740
                   +Y    IF  +L F+ SPL D  S+  I++ ++ +A++++ A  LI +  L++W
Sbjct  1815  DKHCYELYEYQRIFHIILCFFNSPLCDETSQGHILEILQNAARITKAAYELIRDHSLLTW  1874

Query  3741  L  3743
             +
Sbjct  1875  I  1875



>ref|NP_001131087.1| URB1 ribosome biogenesis 1 homolog [Xenopus (Silurana) tropicalis]
 gb|AAI68562.1| Unknown (protein for MGC:184940) [Xenopus (Silurana) tropicalis]
Length=2293

 Score =   119 bits (297),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 89/352 (25%), Positives = 177/352 (50%), Gaps = 24/352 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYL-WGNAVVKARKERELVQTVS  2870
             +LL +Y ATL   D +I  L   +++   +N S+ E+  L WG A V+  K R   +T+ 
Sbjct  1531  ILLGAYGATLSATDQKILQL---LQAYEKNNHSLTEFRLLLWGPAAVEHHKTR---KTLG  1584

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              +L      E+   +  RE +         T+ +FP  R         + +   + ++ED
Sbjct  1585  QSLWQQPSMEEILSLLDREKI-------MKTIFHFPQHR-------KLIAEGAKEILYED  1630

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMG-YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
                +  ++ +YDP F+L L    +     ++ V+F +   L +++A++SS D + R    
Sbjct  1631  SGIKDLDK-LYDPCFLLPLFSELVRPELMVDCVKFVDTNALGLAMAALSSYDYNMRAAAN  1689

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F + +E   + +D  +LQ L+  ++N I +  Q++  +  +++A+AS  +L P  
Sbjct  1690  YVLGSFLSHMEGA-RFRDKRQLQYLMDIVKNGIRQPNQRLTFLLPLYVAKASQQILKPEE  1748

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  ++K L+    +++K +P F  L +S     + ER WIL +L  G+       +  
Sbjct  1749  HIYIKMSKFLLSHQYLDMKKVPDFYKLFYSFDFEHKVEREWILELLRDGMRDKYCYELCD  1808

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
                IF  ++++Y SPL+D  S+ L+++ ++ ++ +++ A  LI +  L++W+
Sbjct  1809  NQRIFHVIMAYYNSPLSDETSQNLVLEILQNASHITKAAYQLIRDHSLLTWI  1860



>gb|AFW84162.1| hypothetical protein ZEAMMB73_733237 [Zea mays]
Length=388

 Score =   114 bits (286),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 83/131 (63%), Gaps = 4/131 (3%)
 Frame = +3

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGV--VNKVQKDTFDSMHE  3047
             N  +AE+ +  R++ FREN+P+D K+CA T L + Y R     V  + ++Q D F    E
Sbjct  186   NTENAEITKR-RRVLFRENIPVDSKLCAKTSLLYCYKRSTRASVFSLEQLQWDNFADSFE  244

Query  3048  DCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
               S ++ +  +YDP FILR S H L MGYIEP +FA LGLLA++L SI+SPD + R LGY
Sbjct  245   VTSQKM-DVQVYDPFFILRFSIHTLHMGYIEPAQFARLGLLAITLVSIASPDHELRMLGY  303

Query  3228  GVLEKFKNALE  3260
               L  FK +LE
Sbjct  304   ECLGTFKKSLE  314


 Score = 66.6 bits (161),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +3

Query  3456  NLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFYVSPL  3635
             +L+SIPLF  LL S  V F+ ERLW+LR+L +G N  DD  IY R  + E  L+F  SP+
Sbjct  312   SLESIPLFPTLLQSSFVHFKAERLWMLRLLSAGSNLADDAKIYKRGRVLELALAFCSSPI  371

Query  3636  ADNES  3650
             +D ES
Sbjct  372   SDFES  376



>gb|KFQ32136.1| Nucleolar pre-ribosomal-associated protein 1, partial [Merops 
nubicus]
Length=2233

 Score =   119 bits (297),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 100/356 (28%), Positives = 174/356 (49%), Gaps = 23/356 (6%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             + L +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K     +++  
Sbjct  1489  VFLGAYGATLSAVDQKILLLLQLYEKNNHSLIN--SRILLWGPAAVEHHKT---CKSLGK  1543

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         T+L FP  R           K+  DS++ D 
Sbjct  1544  SLWQQPSMEEILCLLDREKM-------MKTILSFPQHRRLLSS------KEAQDSLYRDE  1590

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             S +  +   YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R   Y
Sbjct  1591  SVKSLD-DFYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMRAAAY  1648

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  LL  +QN I +   ++     ++IA  +  +L P  
Sbjct  1649  FVLASFRSHLEGA-RFREKSQLLYLLDTVQNGIRQPNLRLTFSLTLYIARVAQQILKPEE  1707

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  I K L+    ++L+ +P F  L +S    ++TER WILR L  GL       +Y 
Sbjct  1708  HMYIKINKFLLSHQYLDLRKVPGFFQLFYSFDFEYKTERDWILRFLGDGLRDKHCYELYD  1767

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVV  3755
                IF  +LSF+ SPL D  S+  I+Q ++ +A+++R A  LI++  L++W+  ++
Sbjct  1768  YQRIFHVVLSFFNSPLCDEGSQSRILQILQNAARVTRAAYELIQDHSLLTWIVHIL  1823



>ref|XP_010139241.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1, partial 
[Buceros rhinoceros silvestris]
Length=1950

 Score =   118 bits (296),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 98/356 (28%), Positives = 174/356 (49%), Gaps = 23/356 (6%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K     +++  
Sbjct  1202  VLLGAYGATLSAVDQKILLLLQLYEKNNQSLIN--SRILLWGPAAVEHHKT---CKSLGK  1256

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         T+L FP  R   P       ++  +S++ D 
Sbjct  1257  SLWQQPSMEEILCLLDREKM-------MKTILSFPQHRRLLPS------QEAQESLYRDE  1303

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             S E  +   YDP F+L+L F  L+     +   +F  +  L +++A++SS D   R   Y
Sbjct  1304  SVESLD-DFYDPCFLLQL-FSELTRPECVVACQKFVEVNALGLTVAALSSYDSSMRAAAY  1361

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L P  
Sbjct  1362  FVLASFRSHLEGA-RFREKSQLLYLLDTVQNGITQPNLRFTFSLTLYIARVAQQILKPEE  1420

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  + + L+    ++L+ +P F  L +S    ++TER WILR L  GL       +Y 
Sbjct  1421  HMYIKVNRFLLSHQYLDLRKVPGFFQLFYSFDFEYKTEREWILRFLGEGLRDKHCYELYD  1480

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVV  3755
                IF+ +LSF+ SPL D  S+  I++ ++ +A ++R A  LI++  L++W+  ++
Sbjct  1481  YQRIFQVILSFFNSPLCDEGSQSRILEILQNAAHVTRAAYELIQDHSLLTWIVHIL  1536



>ref|XP_008941141.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1, partial 
[Merops nubicus]
Length=2239

 Score =   119 bits (297),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 100/356 (28%), Positives = 174/356 (49%), Gaps = 23/356 (6%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             + L +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K     +++  
Sbjct  1495  VFLGAYGATLSAVDQKILLLLQLYEKNNHSLIN--SRILLWGPAAVEHHKT---CKSLGK  1549

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         T+L FP  R           K+  DS++ D 
Sbjct  1550  SLWQQPSMEEILCLLDREKM-------MKTILSFPQHRRLLSS------KEAQDSLYRDE  1596

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             S +  +   YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R   Y
Sbjct  1597  SVKSLD-DFYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMRAAAY  1654

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  LL  +QN I +   ++     ++IA  +  +L P  
Sbjct  1655  FVLASFRSHLEGA-RFREKSQLLYLLDTVQNGIRQPNLRLTFSLTLYIARVAQQILKPEE  1713

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  I K L+    ++L+ +P F  L +S    ++TER WILR L  GL       +Y 
Sbjct  1714  HMYIKINKFLLSHQYLDLRKVPGFFQLFYSFDFEYKTERDWILRFLGDGLRDKHCYELYD  1773

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVV  3755
                IF  +LSF+ SPL D  S+  I+Q ++ +A+++R A  LI++  L++W+  ++
Sbjct  1774  YQRIFHVVLSFFNSPLCDEGSQSRILQILQNAARVTRAAYELIQDHSLLTWIVHIL  1829



>ref|XP_004645415.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Octodon 
degus]
Length=2271

 Score =   118 bits (296),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 94/363 (26%), Positives = 176/363 (48%), Gaps = 32/363 (9%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD-YLWGNAVVKARKE-RELVQTV  2867
             +LL +Y ATL  +D +I  L   +++  ++ +S+  +   LWG A V+  K  R L +++
Sbjct  1529  VLLGAYGATLSTLDQKILLL---LRAYEENKLSLINFRVLLWGPAAVEHHKTCRSLGKSL  1585

Query  2868  SCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR----PNGPGVVNKVQKDTFD  3035
                 S A++   C          +D      T+L+FP  R    P G   V         
Sbjct  1586  WQQPSVADIL--CL---------LDRDRMLQTILHFPQRRRLLPPEGAQEV---------  1625

Query  3036  SMHEDCSAEVANRHIYDPIFILRLSFHCLSMGYI-EPVEFANLGLLAVSLASISSPDDDT  3212
              + +D S  V    +YDP F+L L        ++ +  +F +   L++++A++SS D   
Sbjct  1626  -IFKDKSLRVDPSGLYDPCFLLHLFGELTRPEFVVDCRKFLDSNALSLTIAALSSYDPQM  1684

Query  3213  RKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVL  3392
             R   Y +L  F + LE   + ++  +L  LL  ++N I     ++P   A+FIA+A+  +
Sbjct  1685  RAAAYSILAAFYSHLEGA-RFREQSQLLYLLDVVRNGIRTPNLRLPFTLALFIAKAALQI  1743

Query  3393  LDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDD  3572
             L P    Y  I+K L+    +N+  +P F    +S     +TE+ W+L +L  G+     
Sbjct  1744  LRPEEHMYWKISKFLLSHEYLNMDKVPGFYQFFYSSDFEHKTEQEWVLGLLRQGIRDKQC  1803

Query  3573  VHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSV  3752
               +  R  +F  +LSF+ SPL D  ++  I++ ++  A+++R A  ++ +  L++W+  +
Sbjct  1804  YELCARRGVFHIILSFFSSPLCDEVTQNWILEILQNIARVARSAYEILRDYSLLTWILHI  1863

Query  3753  VTS  3761
             + S
Sbjct  1864  LES  1866



>tpg|DAA43439.1| TPA: hypothetical protein ZEAMMB73_622457 [Zea mays]
Length=476

 Score =   114 bits (286),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = +3

Query  3264  CQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSHDHYATITKHLMQ  3443
              Q+ K+  +LQLLL+YLQN I E WQKIPS+ A+F AEAS  L D SH  +  +   LM 
Sbjct  336   AQRSKETWQLQLLLTYLQNGISEQWQKIPSIIAVFAAEASLTLPDGSHAQFTVMRNFLMH  395

Query  3444  SPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYIRNSIFETLLSFY  3623
             S  V+L+SIPLF  LL S  V F+ ERLW+LR+L +G N  DD  IY R  + E  L+F 
Sbjct  396   STPVSLQSIPLFPTLLQSSFVHFKAERLWMLRLLSAGSNLADDAKIYKRGRVLELALAFC  455

Query  3624  VSPLADNES  3650
              SP++D ES
Sbjct  456   SSPISDFES  464



>gb|ELW62043.1| Nucleolar pre-ribosomal-associated protein 1 [Tupaia chinensis]
Length=2288

 Score =   117 bits (293),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 92/363 (25%), Positives = 180/363 (50%), Gaps = 33/363 (9%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD-YLWGNAVVKARKERELVQTVS  2870
             +LL +Y A+L  +D +I  L   +++   + +S+  +   LWG A V+  K     +++ 
Sbjct  1535  VLLGAYGASLSVLDQKILLL---LRAYEQNKLSLVTFRVLLWGPAAVEHHKT---CRSLG  1588

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR----PNGPGVVNKVQKDTFDS  3038
              +L     A D  ++  R+ +         T+L+FP  R    P          +D  + 
Sbjct  1589  KSLWQQPSAGDILRLLDRDQM-------MHTILHFPQNRRLLSP----------EDAQEP  1631

Query  3039  MHEDCSAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDT  3212
             + +D S E  +  +YDP F+L+L F  L+     ++  +F +   L +++A++SS D   
Sbjct  1632  IFKDKSTEDLD-GLYDPCFLLQL-FSELTRPEFVVDCRKFLDSNALGLTVAALSSHDPQM  1689

Query  3213  RKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVL  3392
             R   Y +L  + + LE   + ++  +L  LL  ++N I     ++     +FIA+A+  +
Sbjct  1690  RAAAYHILAAYYSHLEGA-RFREQPQLLYLLDVVRNGIRTQNMRLTFTLTLFIAKAALQI  1748

Query  3393  LDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDD  3572
             L P    Y  I+K L+    +N+  +P F    +S ++  +TE+ W+  +L  GL     
Sbjct  1749  LKPEEHMYLRISKFLLSHECLNMDKVPGFYQFFYSSNLEHKTEQEWVFGLLRQGLRDKRC  1808

Query  3573  VHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSV  3752
               +Y R  +F  +LSF+ SPL D  ++  I++ ++ +AK++R A  +I +  L++W+  +
Sbjct  1809  YELYTRRGVFHIILSFFNSPLCDTVAQNWILEILQNAAKVARSAYEIIRDYSLLTWIVHI  1868

Query  3753  VTS  3761
             + S
Sbjct  1869  LES  1871



>ref|XP_006153927.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Tupaia 
chinensis]
Length=2289

 Score =   117 bits (293),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 92/363 (25%), Positives = 180/363 (50%), Gaps = 33/363 (9%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWD-YLWGNAVVKARKERELVQTVS  2870
             +LL +Y A+L  +D +I  L   +++   + +S+  +   LWG A V+  K     +++ 
Sbjct  1536  VLLGAYGASLSVLDQKILLL---LRAYEQNKLSLVTFRVLLWGPAAVEHHKT---CRSLG  1589

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGR----PNGPGVVNKVQKDTFDS  3038
              +L     A D  ++  R+ +         T+L+FP  R    P          +D  + 
Sbjct  1590  KSLWQQPSAGDILRLLDRDQM-------MHTILHFPQNRRLLSP----------EDAQEP  1632

Query  3039  MHEDCSAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDT  3212
             + +D S E  +  +YDP F+L+L F  L+     ++  +F +   L +++A++SS D   
Sbjct  1633  IFKDKSTEDLD-GLYDPCFLLQL-FSELTRPEFVVDCRKFLDSNALGLTVAALSSHDPQM  1690

Query  3213  RKLGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVL  3392
             R   Y +L  + + LE   + ++  +L  LL  ++N I     ++     +FIA+A+  +
Sbjct  1691  RAAAYHILAAYYSHLEGA-RFREQPQLLYLLDVVRNGIRTQNMRLTFTLTLFIAKAALQI  1749

Query  3393  LDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDD  3572
             L P    Y  I+K L+    +N+  +P F    +S ++  +TE+ W+  +L  GL     
Sbjct  1750  LKPEEHMYLRISKFLLSHECLNMDKVPGFYQFFYSSNLEHKTEQEWVFGLLRQGLRDKRC  1809

Query  3573  VHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSV  3752
               +Y R  +F  +LSF+ SPL D  ++  I++ ++ +AK++R A  +I +  L++W+  +
Sbjct  1810  YELYTRRGVFHIILSFFNSPLCDTVAQNWILEILQNAAKVARSAYEIIRDYSLLTWIVHI  1869

Query  3753  VTS  3761
             + S
Sbjct  1870  LES  1872



>gb|KFP42806.1| Nucleolar pre-ribosomal-associated protein 1, partial [Chlamydotis 
macqueenii]
Length=1764

 Score =   117 bits (293),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 98/352 (28%), Positives = 174/352 (49%), Gaps = 23/352 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K     +++  
Sbjct  1288  VLLGAYGATLSTVDQKILLLLQLYEKNNQSLIN--SRILLWGPAAVEHHKT---CKSLGK  1342

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         T+L FP  R         + ++  DS++ D 
Sbjct  1343  SLWQQPSMEEILCLLDREKM-------MKTILSFPQHRRL------LLSQEVQDSLYRDE  1389

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             S +  +   YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R   Y
Sbjct  1390  SVKNLD-DFYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMRAAAY  1447

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  LL  +QN I +   +     +++IA  +  +L P  
Sbjct  1448  FVLASFRSHLEGA-RFREKSQLLYLLDAVQNGIGQPNLRFTFSLSLYIARVAQQILKPEE  1506

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  + + L+    ++L+ +P F  L +S    ++TER WILR L  GL       +Y 
Sbjct  1507  HMYIKVNRFLLSHQYLDLRKVPGFFQLFYSFDFEYKTEREWILRFLGEGLRDKHCYELYD  1566

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
                IF+ +LSF+ SPL D  S+  I++ ++ +A ++R A  LI++  L++WL
Sbjct  1567  YQRIFQVILSFFNSPLCDESSQSRILEILQNAAHVTRAAYELIQDHSLLTWL  1618



>ref|XP_008925593.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Manacus 
vitellinus]
Length=2244

 Score =   117 bits (293),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 96/352 (27%), Positives = 175/352 (50%), Gaps = 23/352 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  +D +I  L+   +  + S I+      LWG A V+  +     +++  
Sbjct  1506  VLLGAYGATLSAVDQKILLLLQLYEKNNQSLIN--SRILLWGPAAVEHHRT---CKSLGK  1560

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         T+L FP  R   P       ++  +S+++D 
Sbjct  1561  SLWQQPSMEEILCLLDREKM-------MKTILSFPQHRRLLPS------QEIQESLYKDE  1607

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             + +  +   YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R   Y
Sbjct  1608  TVKSLD-DFYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMRAAAY  1665

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L P  
Sbjct  1666  FVLASFRSHLEGA-RFREKSQLLYLLDTVQNGIRQPNLRFTFSLTLYIARVAQQILKPEE  1724

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  + + L+    ++LK +P F  L +S    ++TER WILR L  GL       +Y 
Sbjct  1725  HMYIKVNRFLLSHQYLDLKKVPGFFQLFYSFDFEYKTEREWILRFLGEGLRDKHCYELYD  1784

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
                IF+ +LSF+ SPL D  S+  I++ ++ +A+++R A  LI++  L++W+
Sbjct  1785  YQRIFQVILSFFNSPLCDEGSQSRILEILQSAARVTRAAYELIQDHSLLTWV  1836



>gb|KFO80793.1| Nucleolar pre-ribosomal-associated protein 1, partial [Cuculus 
canorus]
Length=2233

 Score =   117 bits (293),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 97/352 (28%), Positives = 174/352 (49%), Gaps = 23/352 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  ID +I  L+   +  + S I+      LWG A V+  K     +++  
Sbjct  1488  MLLGAYGATLSTIDQKILLLLQLYEKNNQSLIN--SRILLWGPAAVEHHKT---CKSLGK  1542

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         T+L +P  R           +D  +S++ D 
Sbjct  1543  SLWQQPSMEEILCLLDREKM-------MKTILSYPQHRRLLSS------QDIQESLYRDE  1589

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             S +  +   YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R   Y
Sbjct  1590  SIKSLD-DFYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMRAAAY  1647

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L P  
Sbjct  1648  FVLASFRSHLEGA-RFREKNQLLYLLDAVQNGIGQPNLRFTFSLTLYIARVAQQILKPEE  1706

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  + + L+    ++L+ +P F  L +S    ++TER WILR L  GL       +Y 
Sbjct  1707  HMYIKVNRFLLSHQYLDLRKVPGFFQLFYSSDFEYKTEREWILRFLGEGLRDKHCYELYD  1766

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
               +IF+ +LSF+ SPL D  S+  I++ ++ +A+++R A  LI++  L++W+
Sbjct  1767  YQNIFQVILSFFNSPLCDEGSQNRILEILQNAARVTRAAYELIQDHSLLTWI  1818



>ref|XP_009870096.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Apaloderma 
vittatum]
Length=1621

 Score =   117 bits (292),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 97/356 (27%), Positives = 180/356 (51%), Gaps = 26/356 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  +D +I  L+   +  + S IS      LWG A V+  K     +++  
Sbjct  879   VLLGAYGATLSAVDQKILLLLQLYEKNNQSLIS--SRILLWGPAAVEHHKT---CKSLGK  933

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         T+L FP  R     ++++      +S++ D 
Sbjct  934   SLWQQPSMEEILCLLDREKM-------MKTILSFPQHRR---LLLSQ------ESLYRDE  977

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             S +  +  +YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R + Y
Sbjct  978   SVKSLD-DLYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMRAVAY  1035

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L P  
Sbjct  1036  FVLASFRSHLEGA-RFREKTQLLYLLDAVQNGIRQPNLRFTFSLTLYIARVAQQILKPEE  1094

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  + + L+    ++L+ +P F  L +S    ++TER WILR+L  GL       +Y 
Sbjct  1095  HMYIKVNRFLLSHQYLDLRKVPGFFQLFYSFDFEYKTEREWILRLLGEGLRDKHCYELYD  1154

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVV  3755
                IF+ +LSF+ SPL D  S+  I++ ++ +A+++R A  LI++  L++W+  ++
Sbjct  1155  YQRIFQVILSFFNSPLCDEGSQSRILEILQNAARVTRAAYELIQDHSLLTWIVHIL  1210



>ref|XP_005073951.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Mesocricetus 
auratus]
Length=2212

 Score =   117 bits (293),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 92/359 (26%), Positives = 175/359 (49%), Gaps = 23/359 (6%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYL-WGNAVVKARKERELVQTVS  2870
             +LL +Y+ATL  +D +I  L   +++   +N+S+  +  L WG A V+  K     +++ 
Sbjct  1470  VLLGTYSATLSVLDQKILLL---LRAYEQNNLSLISFRVLLWGPAAVEHHKT---CRSLG  1523

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSM-HE  3047
              +L       D  ++       +DP     T+L+FP  R   P       +DT + +  +
Sbjct  1524  KSLWQQPSVGDILRL-------LDPDRMMQTILHFPQCRRLLP------TEDTGEPLVFK  1570

Query  3048  DCSAEVANRHIYDPIFILRLSFHCLSMGYI-EPVEFANLGLLAVSLASISSPDDDTRKLG  3224
             D +  V    IYDP F+L L        ++ +  +F +   L +++A++SS D   R   
Sbjct  1571  DDTVRVDLDSIYDPCFLLHLFGELTRPEFVVDCRKFLDSNALGLTVAALSSYDPQMRAAA  1630

Query  3225  YGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPS  3404
             Y VL  + + +E  + ++    L  LL  ++N I+    ++P   A+FIA+A+  +L P 
Sbjct  1631  YSVLAAYYSHVEGARFREQAQVL-YLLDVVRNGIKAPNMRLPFTLALFIAKAALQILKPE  1689

Query  3405  HDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIY  3584
                Y  I+K L+   ++++  +P F    +S     + E+ W+L IL  G+       + 
Sbjct  1690  EHMYWKISKFLLSHETLHMDKLPGFYQFFYSSDFQQKAEQEWVLGILRQGIRDKQCYELC  1749

Query  3585  IRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVVTS  3761
              R  +   LLSF+ SPL D  ++  I++ ++  A ++R A  +I +  L++W+  ++ S
Sbjct  1750  SRRGVLHVLLSFFSSPLCDQVAQNWILEILQNVALITRSAYEIIRDYSLLTWILHILES  1808



>ref|XP_009565429.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1, partial 
[Cuculus canorus]
Length=2236

 Score =   117 bits (293),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 97/352 (28%), Positives = 174/352 (49%), Gaps = 23/352 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  ID +I  L+   +  + S I+      LWG A V+  K     +++  
Sbjct  1491  MLLGAYGATLSTIDQKILLLLQLYEKNNQSLIN--SRILLWGPAAVEHHKT---CKSLGK  1545

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         T+L +P  R           +D  +S++ D 
Sbjct  1546  SLWQQPSMEEILCLLDREKM-------MKTILSYPQHRRLLSS------QDIQESLYRDE  1592

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             S +  +   YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R   Y
Sbjct  1593  SIKSLD-DFYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMRAAAY  1650

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L P  
Sbjct  1651  FVLASFRSHLEGA-RFREKNQLLYLLDAVQNGIGQPNLRFTFSLTLYIARVAQQILKPEE  1709

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  + + L+    ++L+ +P F  L +S    ++TER WILR L  GL       +Y 
Sbjct  1710  HMYIKVNRFLLSHQYLDLRKVPGFFQLFYSSDFEYKTEREWILRFLGEGLRDKHCYELYD  1769

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
               +IF+ +LSF+ SPL D  S+  I++ ++ +A+++R A  LI++  L++W+
Sbjct  1770  YQNIFQVILSFFNSPLCDEGSQNRILEILQNAARVTRAAYELIQDHSLLTWI  1821



>gb|EPB91763.1| hypothetical protein HMPREF1544_01477 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=1789

 Score =   117 bits (292),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 89/357 (25%), Positives = 166/357 (46%), Gaps = 38/357 (11%)
 Frame = +3

Query  2697  LLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERE----LVQT  2864
             LL+SY+AT    D  I  ++   +S      +I     +WG    + R+       L+QT
Sbjct  1411  LLTSYSATTSATDRLILEILMSCES--QGRDTILPKMLMWGPGSDRTRQAHAQAGTLLQT  1468

Query  2865  VSCNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMH  3044
              + ++    +              IDP +   T  +FP        +     KDT     
Sbjct  1469  SAISIETLSL--------------IDPALMKYTFTHFPTD-CTLKHIPTTADKDT-----  1508

Query  3045  EDCSAEVANRHIYDPIFILRLSFHCLSMGYIEPVEFANLGLLAVSLASISSPDDDTRKLG  3224
                       H+YDP F + L  + +S G ++  +F     L   +  +SS D+  R + 
Sbjct  1509  --------QTHVYDPCFFMPLFANLISSGAVDCRKFIECNGLGFVIMGMSSTDEYVRHIA  1560

Query  3225  YGVLEKFKNALEKCQKKKD---VMRLQLLLSYLQNCIEEDWQ-KIPSVTAIFIAEASFVL  3392
             Y ++++F   +E  + ++    +  L+   + +Q   E D   ++P+   + ++ A  +L
Sbjct  1561  YQMMDQFYVMVEHARFREQPSIIFVLEQFKNSIQGRSEADAPPRVPAAITVCVSHAMSIL  1620

Query  3393  LDPSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDD  3572
             L P H     IT  ++Q+PS +   +P+F  L  S S + + ERLW+L +L S L T +D
Sbjct  1621  LHPEHFMLPHITTWILQNPSFDFNYVPMFTFLFTSSSPNHKKERLWLLYVLSSSLRTYED  1680

Query  3573  VHIYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
               I+ R SIF+ + +FY S  AD  SK+ +++ ++++  +  +  +LI+  GL++W+
Sbjct  1681  YKIFARQSIFDMIATFYNSAYADPSSKKAVLEIMEQATAIPSVTSNLIQYNGLLAWI  1737



>ref|XP_009481221.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Pelecanus 
crispus]
Length=2189

 Score =   117 bits (292),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 98/352 (28%), Positives = 173/352 (49%), Gaps = 23/352 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  +D +I  L+   +  + S IS      LWG A V+  K     +++  
Sbjct  1444  VLLGAYGATLSAVDQKILLLLQLYEKNNQSLIS--SRILLWGPAAVEHHKT---CKSLGK  1498

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         T+L FP  R   P       ++  +S+++D 
Sbjct  1499  SLWQQPSMEEILCLLDREKM-------MKTILSFPQHRRLLPS------QEVQESLYKDE  1545

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             S +  +   YDP F+L+L F  L+     +   +F  +  L +++A++SS D   R   Y
Sbjct  1546  SVKSLD-DFYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSTMRAAAY  1603

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L P  
Sbjct  1604  FVLASFRSHLEGA-RFREKSQLLYLLDAVQNGIGQPNLRFTFSLTLYIARVAQQILKPEE  1662

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  + + L+    ++L+ +P F  L +S    ++TER WILR L  GL       +Y 
Sbjct  1663  HMYIKVNRFLLSHQYLDLRKVPGFFQLFYSFDFEYKTEREWILRFLGEGLRDKHCYELYD  1722

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
                IF+ +LSF+ SPL D  S+  I++ ++ +A ++R A  LI++  L++W+
Sbjct  1723  YQRIFQVILSFFNSPLCDEGSQSRILEILQNAAHVTRAAYELIQDHSLLTWI  1774



>gb|AAH73005.1| LOC443605 protein, partial [Xenopus laevis]
Length=890

 Score =   116 bits (290),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 90/352 (26%), Positives = 181/352 (51%), Gaps = 24/352 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYL-WGNAVVKARKERELVQTVS  2870
             +LL +Y ATL + D +I  L   +++   +N S+ E+  L WG A V+  K R   +T+ 
Sbjct  135   ILLGAYGATLSNTDQKILRL---LQAYEMNNHSLTEFRLLLWGPAAVEHHKTR---KTLG  188

Query  2871  CNLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHED  3050
              +L      ++   +  RE +         T+L+FP  R     ++ + +K+    ++ED
Sbjct  189   KSLWQQPSMDEILSLLDREKM-------METILHFPQHR----KLIAEGEKE---HLYED  234

Query  3051  CSAEVANRHIYDPIFILRLSFHCLSMGYI-EPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
                +  ++ +YDP F+L L    +    + + V+F +   L +++ ++SS D + R    
Sbjct  235   SGIKELDK-LYDPCFLLPLFSELVRPELVVDCVKFVDANALGLTMVALSSYDYNMRAAAN  293

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F + +E   + +D  +LQ L+  ++N I +  Q++  +  +++A+AS  +L P  
Sbjct  294   YVLGCFLSHMEGA-RFRDKRQLQYLMDIVKNGIRQPNQRLTFLLPLYVAKASQQILKPEE  352

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  ++K L+    +++K +P F  L +S     + ER WIL +L  G+       +  
Sbjct  353   HIYIKMSKFLLSHQYLDMKKVPDFYKLFYSFDFEHKVEREWILELLRDGIRDKYCYELCD  412

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
                IF  ++++Y SPL+D  S+ L+++ +K ++ +++ A  LI +  L++W+
Sbjct  413   NQRIFHVIMAYYNSPLSDEISQNLVLEILKNASHVTKAAYQLIRDHSLLTWI  464



>ref|XP_005524223.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Pseudopodoces 
humilis]
Length=2592

 Score =   117 bits (293),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 109/398 (27%), Positives = 187/398 (47%), Gaps = 46/398 (12%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K     +++  
Sbjct  1538  VLLGAYGATLSTVDQKILLLLQLYEKNNQSLIN--SRILLWGPAAVEHHKT---CKSLGK  1592

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGP--GVVNKVQKDTFDSMHE  3047
             +L      E+   +  RE +         T+L FP  R   P  G+   + KD      +
Sbjct  1593  SLWQQPSMEEILCLLDREKM-------MKTILSFPQHRRLLPSEGIQESLYKDEAVKSLD  1645

Query  3048  DCSAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKL  3221
             D          YDP F+L+L F  L+     +   +F  +  L +++ ++SS D + R  
Sbjct  1646  D---------FYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVTALSSYDSNMRAA  1695

Query  3222  GYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDP  3401
              Y VL  F++ LE   + ++  +L  LL  +QN I +   +     +++IA  +  +L P
Sbjct  1696  AYFVLASFRSHLEGA-RFREKSQLLYLLDAVQNGIGQPNLRFTFSLSLYIARVAQQILKP  1754

Query  3402  SHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHI  3581
                 Y  + + L+    ++L+ +P F  L +S  + ++TER+WILR L  GL       +
Sbjct  1755  EEHMYIKVNRFLLSHQYLDLRKVPGFFQLFYSFDLEYKTERVWILRFLGQGLRDRHCYEL  1814

Query  3582  YIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISW-LSSVVT  3758
             Y    IF+ +LSF+ SPL D  S+  I++ ++ +A+++R A  LI++  L++W L S+  
Sbjct  1815  YDYQRIFQIILSFFNSPLCDEGSQSRILEILQSAARVTRAAYELIQDHSLLTWVLHSLEK  1874

Query  3759  SFCGIKYDHWKGFPFAQFAVVLEVVNEIIFFRHTVEWL  3872
              F   K                 V+N II   HT+ WL
Sbjct  1875  RFLESK-----------------VINRIISLLHTL-WL  1894



>ref|XP_010120490.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1, partial 
[Chlamydotis macqueenii]
Length=1813

 Score =   117 bits (292),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 98/352 (28%), Positives = 174/352 (49%), Gaps = 23/352 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K     +++  
Sbjct  1337  VLLGAYGATLSTVDQKILLLLQLYEKNNQSLIN--SRILLWGPAAVEHHKT---CKSLGK  1391

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         T+L FP  R         + ++  DS++ D 
Sbjct  1392  SLWQQPSMEEILCLLDREKM-------MKTILSFPQHRRL------LLSQEVQDSLYRDE  1438

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             S +  +   YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R   Y
Sbjct  1439  SVKNLD-DFYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMRAAAY  1496

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  LL  +QN I +   +     +++IA  +  +L P  
Sbjct  1497  FVLASFRSHLEGA-RFREKSQLLYLLDAVQNGIGQPNLRFTFSLSLYIARVAQQILKPEE  1555

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  + + L+    ++L+ +P F  L +S    ++TER WILR L  GL       +Y 
Sbjct  1556  HMYIKVNRFLLSHQYLDLRKVPGFFQLFYSFDFEYKTEREWILRFLGEGLRDKHCYELYD  1615

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
                IF+ +LSF+ SPL D  S+  I++ ++ +A ++R A  LI++  L++WL
Sbjct  1616  YQRIFQVILSFFNSPLCDESSQSRILEILQNAAHVTRAAYELIQDHSLLTWL  1667



>gb|KFP90100.1| Nucleolar pre-ribosomal-associated protein 1, partial [Apaloderma 
vittatum]
Length=1607

 Score =   116 bits (291),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 97/356 (27%), Positives = 180/356 (51%), Gaps = 26/356 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  +D +I  L+   +  + S IS      LWG A V+  K     +++  
Sbjct  865   VLLGAYGATLSAVDQKILLLLQLYEKNNQSLIS--SRILLWGPAAVEHHKT---CKSLGK  919

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         T+L FP  R     ++++      +S++ D 
Sbjct  920   SLWQQPSMEEILCLLDREKM-------MKTILSFPQHRR---LLLSQ------ESLYRDE  963

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             S +  +  +YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R + Y
Sbjct  964   SVKSLD-DLYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMRAVAY  1021

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L P  
Sbjct  1022  FVLASFRSHLEGA-RFREKTQLLYLLDAVQNGIRQPNLRFTFSLTLYIARVAQQILKPEE  1080

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  + + L+    ++L+ +P F  L +S    ++TER WILR+L  GL       +Y 
Sbjct  1081  HMYIKVNRFLLSHQYLDLRKVPGFFQLFYSFDFEYKTEREWILRLLGEGLRDKHCYELYD  1140

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWLSSVV  3755
                IF+ +LSF+ SPL D  S+  I++ ++ +A+++R A  LI++  L++W+  ++
Sbjct  1141  YQRIFQVILSFFNSPLCDEGSQSRILEILQNAARVTRAAYELIQDHSLLTWIVHIL  1196



>ref|XP_005234439.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Falco 
peregrinus]
Length=2250

 Score =   117 bits (292),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 96/352 (27%), Positives = 174/352 (49%), Gaps = 23/352 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K     +++  
Sbjct  1505  VLLGAYGATLSAVDQKILLLLRLYEKNNQSLIN--SRILLWGPAAVEHHKT---CKSLGK  1559

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         T+L FP  R           ++  +S++ D 
Sbjct  1560  SLWQQPSMEEILCLLDREKM-------MKTILSFPQHRRLLSS------QEVQESLYRDE  1606

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             S +  +   YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R + Y
Sbjct  1607  SVKSLD-DFYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMRAVAY  1664

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L P  
Sbjct  1665  FVLASFRSHLEGA-RFREKSQLLYLLDTVQNGIRQPNLRFTFSLTLYIARVAQQILKPEE  1723

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  + + L+    ++L+ +P F  L +S    ++TER WILR L  GL       +Y 
Sbjct  1724  HMYIKVNRFLLSHQYLDLRKVPGFFQLFYSFDFEYKTEREWILRFLGEGLRDKHCYELYD  1783

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
                IF+ +LSF+ SPL D  S+  I++ ++ +A+++R A  LI++  L++W+
Sbjct  1784  YQRIFQVILSFFNSPLCDESSQSRILEILQNAARVTRAAYELIQDHSLLTWI  1835



>ref|XP_009083738.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Serinus 
canaria]
Length=2263

 Score =   116 bits (291),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 103/370 (28%), Positives = 179/370 (48%), Gaps = 30/370 (8%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K     +++  
Sbjct  1513  VLLGAYGATLSTVDQKILLLLQLYEKNNQSLIN--SRILLWGPAAVEHHKT---CKSLGK  1567

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGP--GVVNKVQKD-TFDSMH  3044
             +L      E+   +  RE +         T+L FP  R   P  G+   + KD T  S+ 
Sbjct  1568  SLWQQPSMEEILCLLDREKM-------MKTILSFPQHRRLLPSQGIQESLYKDETVKSLD  1620

Query  3045  EDCSAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRK  3218
             +           YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R 
Sbjct  1621  D----------FYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDPNMRA  1669

Query  3219  LGYGVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLD  3398
               Y VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L 
Sbjct  1670  AAYFVLASFRSHLEGA-RFREKSQLLYLLDAVQNGIRQPNLRFTFSLTLYIARVAQQILK  1728

Query  3399  PSHDHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVH  3578
             P    Y  + + L+    ++L+ +P F  L +S    ++TER WILR L  GL       
Sbjct  1729  PEEHMYLKVNRFLLSHQYLDLRKVPGFFQLFYSFDFEYKTEREWILRFLGEGLRDKHCYE  1788

Query  3579  IYIRNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISW-LSSVV  3755
             +Y    IF+ +LSF+ SPL D  S+  I++ ++ +A+++R A  L+++  L++W L+S+ 
Sbjct  1789  LYDYQRIFQVILSFFNSPLCDEGSQRRILEILQSAARVTRAAYELVQDHSLLTWILNSLE  1848

Query  3756  TSFCGIKYDH  3785
               F   K  H
Sbjct  1849  KRFLENKVIH  1858



>ref|XP_005438671.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Falco 
cherrug]
Length=2260

 Score =   116 bits (291),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 96/352 (27%), Positives = 174/352 (49%), Gaps = 23/352 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K     +++  
Sbjct  1515  VLLGAYGATLSAVDQKILLLLRLYEKNNQSLIN--SRILLWGPAAVEHHKT---CKSLGK  1569

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         T+L FP  R           ++  +S++ D 
Sbjct  1570  SLWQQPSMEEILCLLDREKM-------MKTILSFPQHRRLLSS------QEVQESLYRDE  1616

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             S +  +   YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R + Y
Sbjct  1617  SVKSLD-DFYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMRAVAY  1674

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  LL  +QN I +   +      ++IA  +  +L P  
Sbjct  1675  FVLASFRSHLEGA-RFREKSQLLYLLDTVQNGIRQPNLRFTFSLTLYIARVAQQILKPEE  1733

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  + + L+    ++L+ +P F  L +S    ++TER WILR L  GL       +Y 
Sbjct  1734  HMYIKVNRFLLSHQYLDLRKVPGFFQLFYSFDFEYKTEREWILRFLGEGLRDKHCYELYD  1793

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
                IF+ +LSF+ SPL D  S+  I++ ++ +A+++R A  LI++  L++W+
Sbjct  1794  YQRIFQVILSFFNSPLCDESSQSRILEILQNAARVTRAAYELIQDHSLLTWI  1845



>ref|XP_009665948.1| PREDICTED: nucleolar pre-ribosomal-associated protein 1 [Struthio 
camelus australis]
Length=2226

 Score =   116 bits (290),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 97/352 (28%), Positives = 173/352 (49%), Gaps = 23/352 (7%)
 Frame = +3

Query  2694  LLLSSYNATLCDIDFEIHNLVNEIKSISDSNISIAEWDYLWGNAVVKARKERELVQTVSC  2873
             +LL +Y ATL  +D +I  L+   +  + S I+      LWG A V+  K     +++  
Sbjct  1481  VLLGAYGATLSVVDQKILLLLQLYEKNNQSLIN--SRILLWGPAAVEHHKT---CKSLGK  1535

Query  2874  NLSDAEVAEDCRKIQFRENLPIDPKMCASTVLYFPYGRPNGPGVVNKVQKDTFDSMHEDC  3053
             +L      E+   +  RE +         TVL FP  R   P       K+  +S++ D 
Sbjct  1536  SLWQQPTMEEILCLLDREKM-------MKTVLSFPQHRHLLPS------KEEQESLYRDE  1582

Query  3054  SAEVANRHIYDPIFILRLSFHCLSMG--YIEPVEFANLGLLAVSLASISSPDDDTRKLGY  3227
             S +  +   YDP F+L+L F  L+     +   +F  +  L +++A++SS D + R   Y
Sbjct  1583  SVKSLD-DFYDPCFLLQL-FSELTRPECVVACHKFVEVNALGLTVAALSSYDSNMRAAAY  1640

Query  3228  GVLEKFKNALEKCQKKKDVMRLQLLLSYLQNCIEEDWQKIPSVTAIFIAEASFVLLDPSH  3407
              VL  F++ LE   + ++  +L  L+  +QN I     +      ++IA  +  +L P  
Sbjct  1641  FVLGSFRSHLEGA-RFREQKQLLYLMDAVQNGIRRQNLRFTFSLTLYIARVAQQMLKPEE  1699

Query  3408  DHYATITKHLMQSPSVNLKSIPLFQNLLWSDSVSFRTERLWILRILYSGLNTDDDVHIYI  3587
               Y  I + L+    ++L+ +P F  L +S  +  +TER W+LR+L  GL       +Y 
Sbjct  1700  HMYTKINRFLLSHQFLDLRKVPGFFQLFYSFDLEHKTEREWVLRLLGEGLRDKYCYQLYD  1759

Query  3588  RNSIFETLLSFYVSPLADNESKELIIQTVKKSAKLSRMARHLIENCGLISWL  3743
                IF  +LSF+ SPL D  S+  I++ ++ +A++++ A  LI++  L++W+
Sbjct  1760  YQRIFHVILSFFNSPLCDEGSQNHILEILQNAARVTKAAYELIQDHSLLTWI  1811



>ref|XP_006475167.1| PREDICTED: uncharacterized protein LOC102615491 isoform X1 [Citrus 
sinensis]
 ref|XP_006475168.1| PREDICTED: uncharacterized protein LOC102615491 isoform X2 [Citrus 
sinensis]
Length=248

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 118/197 (60%), Gaps = 6/197 (3%)
 Frame = +3

Query  4119  AKTGLEAILMSTPPVAILQMDCKKVSKFINWAMSIALQSETKGVLQVEKCCFPL-NVSSE  4295
             A+  L+ ILMS+P + I +++  K+S F+ WA+S AL+S++  + ++ +    L N+  +
Sbjct  26    AELALKVILMSSPSIDIFRVNQVKLSSFLTWAISTALKSDSGQMYKLRESHLHLRNMLED  85

Query  4296  EETENSLISKLLRWLTASVILGKISYKLSKLDSSHSCDRSKLINLHCLLEWNEESDRENG  4475
                E SL SKLLRW  ASVILGK+  KL    S  S    + +N     ++  +    N 
Sbjct  86    APFEESLTSKLLRWPFASVILGKLFGKLDIPGSKLSKSSYETLN-SLFQDFGNKCVENNK  144

Query  4476  KEFACQEILAASIFYLQQLLGTSFKLLPSAVSALCLLLLKNPAS-SGSEVLIGNA---AA  4643
               F C+EILAA+IFYLQQLLG     LPS +SAL LLLL + +  +GS   +G+    A+
Sbjct  145   SRFDCKEILAAAIFYLQQLLGLCCGGLPSVISALSLLLLSDVSEYAGSAFKLGHRTSLAS  204

Query  4644  LCSKIRCPAEANSAWRW  469