BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19293_g1_i4 len=1596 path=[142:0-139 282:140-193 364:194-552
3487:553-556 727:557-1595]

Length=1596
                                                                      Score     E

ref|XP_009588499.1|  PREDICTED: probable sodium/metabolite cotran...    563   0.0      
ref|XP_009761030.1|  PREDICTED: probable sodium/metabolite cotran...    553   0.0      
ref|XP_006358370.1|  PREDICTED: probable sodium/metabolite cotran...    550   0.0      
ref|XP_009761032.1|  PREDICTED: probable sodium/metabolite cotran...    538   0.0      
ref|XP_004244587.1|  PREDICTED: probable sodium/metabolite cotran...    532   0.0      
emb|CDP09858.1|  unnamed protein product                                530   0.0      
ref|XP_009761031.1|  PREDICTED: probable sodium/metabolite cotran...    521   1e-178   
ref|XP_010661664.1|  PREDICTED: probable sodium/metabolite cotran...    508   2e-173   
ref|XP_011081086.1|  PREDICTED: probable sodium/metabolite cotran...    506   1e-172   
ref|XP_006385744.1|  hypothetical protein POPTR_0003s11720g             503   3e-171   
ref|XP_010277422.1|  PREDICTED: probable sodium/metabolite cotran...    501   1e-170   
ref|XP_010277423.1|  PREDICTED: probable sodium/metabolite cotran...    501   2e-170   
ref|XP_009373344.1|  PREDICTED: probable sodium/metabolite cotran...    501   2e-170   
ref|XP_009373342.1|  PREDICTED: probable sodium/metabolite cotran...    500   4e-170   
ref|XP_006477320.1|  PREDICTED: probable sodium/metabolite cotran...    498   2e-169   
ref|XP_008448926.1|  PREDICTED: probable sodium/metabolite cotran...    498   4e-169   
ref|XP_007040026.1|  Sodium Bile acid symporter family isoform 1        497   5e-169   
gb|KDO63707.1|  hypothetical protein CISIN_1g0148931mg                  494   2e-168   
gb|KGN55930.1|  hypothetical protein Csa_3G036560                       495   3e-168   
ref|XP_008448927.1|  PREDICTED: probable sodium/metabolite cotran...    495   5e-168   
ref|XP_006440451.1|  hypothetical protein CICLE_v10020346mg             494   7e-168   
gb|KDP25572.1|  hypothetical protein JCGZ_20728                         493   2e-167   
ref|XP_008356518.1|  PREDICTED: probable sodium/metabolite cotran...    493   3e-167   
ref|XP_008373870.1|  PREDICTED: probable sodium/metabolite cotran...    493   4e-167   
ref|XP_008356517.1|  PREDICTED: probable sodium/metabolite cotran...    493   5e-167   
ref|XP_008356519.1|  PREDICTED: probable sodium/metabolite cotran...    492   5e-167   
ref|XP_008373871.1|  PREDICTED: probable sodium/metabolite cotran...    492   6e-167   
ref|XP_008373869.1|  PREDICTED: probable sodium/metabolite cotran...    492   7e-167   
ref|XP_004300727.1|  PREDICTED: probable sodium/metabolite cotran...    491   1e-166   
ref|XP_008238677.1|  PREDICTED: probable sodium/metabolite cotran...    488   2e-165   
gb|EYU39046.1|  hypothetical protein MIMGU_mgv1a007118mg                488   2e-165   
ref|XP_010908919.1|  PREDICTED: probable sodium/metabolite cotran...    483   1e-163   
ref|XP_002509642.1|  sodium-bile acid cotransporter, putative           481   6e-163   Ricinus communis
ref|XP_004147983.1|  PREDICTED: probable sodium/metabolite cotran...    481   7e-163   
ref|XP_004159525.1|  PREDICTED: probable sodium/metabolite cotran...    481   1e-162   
ref|XP_008781310.1|  PREDICTED: probable sodium/metabolite cotran...    479   4e-162   
ref|XP_010055564.1|  PREDICTED: probable sodium/metabolite cotran...    479   5e-162   
ref|XP_009418728.1|  PREDICTED: probable sodium/metabolite cotran...    478   8e-162   
ref|XP_010055568.1|  PREDICTED: probable sodium/metabolite cotran...    478   1e-161   
emb|CAN76453.1|  hypothetical protein VITISV_011475                     475   2e-161   Vitis vinifera
ref|XP_010055566.1|  PREDICTED: probable sodium/metabolite cotran...    477   3e-161   
ref|XP_010055567.1|  PREDICTED: probable sodium/metabolite cotran...    477   5e-161   
ref|XP_010676632.1|  PREDICTED: probable sodium/metabolite cotran...    476   9e-161   
ref|XP_010108094.1|  putative sodium-dependent transporter yocS         474   5e-160   
ref|XP_010055565.1|  PREDICTED: probable sodium/metabolite cotran...    473   9e-160   
ref|XP_002304447.2|  bile acid:sodium symporter family protein          468   3e-159   Populus trichocarpa [western balsam poplar]
ref|XP_010277424.1|  PREDICTED: probable sodium/metabolite cotran...    470   1e-158   
gb|EPS60545.1|  hypothetical protein M569_14259                         466   1e-157   
ref|XP_010055570.1|  PREDICTED: probable sodium/metabolite cotran...    465   1e-156   
ref|XP_010055571.1|  PREDICTED: probable sodium/metabolite cotran...    462   1e-155   
ref|XP_002274965.3|  PREDICTED: probable sodium/metabolite cotran...    457   1e-154   Vitis vinifera
ref|XP_010540193.1|  PREDICTED: probable sodium/metabolite cotran...    456   2e-154   
ref|NP_001158917.1|  bile acid sodium symporter                         459   3e-154   Zea mays [maize]
ref|NP_001063701.1|  Os09g0520600                                       456   2e-153   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010540192.1|  PREDICTED: probable sodium/metabolite cotran...    456   4e-153   
ref|XP_010540185.1|  PREDICTED: probable sodium/metabolite cotran...    455   2e-152   
ref|XP_006440449.1|  hypothetical protein CICLE_v10020346mg             449   4e-152   
emb|CDX98774.1|  BnaA03g45590D                                          451   4e-151   
ref|XP_008651591.1|  PREDICTED: bile acid sodium symporter isofor...    451   5e-151   
ref|XP_002867746.1|  bile acid:sodium symporter family protein          450   7e-151   
ref|XP_010433982.1|  PREDICTED: probable sodium/metabolite cotran...    451   8e-151   
ref|XP_006660855.1|  PREDICTED: probable sodium/metabolite cotran...    448   1e-150   
ref|XP_009137288.1|  PREDICTED: probable sodium/metabolite cotran...    450   2e-150   
gb|KDO63708.1|  hypothetical protein CISIN_1g0148931mg                  446   4e-150   
ref|XP_006282633.1|  hypothetical protein CARUB_v10004948mg             448   4e-150   
ref|XP_006413612.1|  hypothetical protein EUTSA_v10025337mg             448   5e-150   
emb|CDX94131.1|  BnaC07g37650D                                          448   6e-150   
ref|NP_001150034.1|  bile acid sodium symporter                         448   6e-150   Zea mays [maize]
ref|XP_010448822.1|  PREDICTED: probable sodium/metabolite cotran...    448   8e-150   
ref|XP_003576744.2|  PREDICTED: probable sodium/metabolite cotran...    450   1e-149   
ref|NP_567671.1|  putative sodium/metabolite cotransporter BASS6        446   6e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003611207.1|  hypothetical protein MTR_5g011440                  445   2e-148   
gb|KEH27447.1|  Na+-bile acid cotransporter                             445   3e-148   
gb|KFK39256.1|  hypothetical protein AALP_AA3G220600                    438   4e-146   
ref|XP_010448821.1|  PREDICTED: probable sodium/metabolite cotran...    438   7e-146   
ref|NP_974538.1|  probable sodium/metabolite cotransporter BASS5        432   8e-144   Arabidopsis thaliana [mouse-ear cress]
gb|KHN34981.1|  Putative sodium-dependent transporter yocS              432   1e-143   
ref|XP_002872639.1|  bile acid:sodium symporter family protein          431   2e-143   
emb|CAA16569.1|  predicted protein                                      433   2e-143   Arabidopsis thaliana [mouse-ear cress]
gb|KHN42731.1|  Putative sodium-dependent transporter yocS              431   5e-143   
ref|XP_009114643.1|  PREDICTED: probable sodium/metabolite cotran...    430   6e-143   
ref|XP_003517442.1|  PREDICTED: probable sodium/metabolite cotran...    430   7e-143   
ref|XP_009761033.1|  PREDICTED: probable sodium/metabolite cotran...    425   7e-143   
ref|XP_004511635.1|  PREDICTED: probable sodium/metabolite cotran...    430   9e-143   
ref|XP_003538535.1|  PREDICTED: probable sodium/metabolite cotran...    429   2e-142   
gb|EMS66927.1|  putative sodium-dependent transporter yocS              437   4e-142   
ref|XP_004959610.1|  PREDICTED: probable sodium/metabolite cotran...    428   4e-142   
ref|XP_011033862.1|  PREDICTED: probable sodium/metabolite cotran...    426   9e-142   
ref|XP_010422171.1|  PREDICTED: probable sodium/metabolite cotran...    426   3e-141   
ref|XP_010422170.1|  PREDICTED: probable sodium/metabolite cotran...    426   3e-141   
ref|XP_010433855.1|  PREDICTED: probable sodium/metabolite cotran...    425   4e-141   
ref|XP_006290019.1|  hypothetical protein CARUB_v10003651mg             426   4e-141   
gb|AES94166.2|  Na+-bile acid cotransporter                             422   4e-141   
ref|XP_010433847.1|  PREDICTED: probable sodium/metabolite cotran...    425   4e-141   
ref|XP_008448928.1|  PREDICTED: probable sodium/metabolite cotran...    421   6e-141   
gb|KDO63709.1|  hypothetical protein CISIN_1g0148931mg                  421   2e-140   
ref|XP_006396806.1|  hypothetical protein EUTSA_v10028698mg             424   2e-140   
ref|XP_010455635.1|  PREDICTED: probable sodium/metabolite cotran...    423   3e-140   
ref|XP_006440450.1|  hypothetical protein CICLE_v10020346mg             422   3e-140   
gb|AFK35401.1|  unknown                                                 422   8e-140   
ref|XP_006396804.1|  hypothetical protein EUTSA_v10028698mg             418   2e-139   
gb|KEH27448.1|  Na+-bile acid cotransporter                             420   7e-139   
ref|XP_003611208.1|  Ileal sodium/bile acid cotransporter               419   4e-138   
ref|XP_007158423.1|  hypothetical protein PHAVU_002G151900g             416   4e-137   
ref|XP_007209464.1|  hypothetical protein PRUPE_ppa009895mg             406   2e-135   
gb|ACU23668.1|  unknown                                                 410   3e-135   Glycine max [soybeans]
gb|KFK31950.1|  hypothetical protein AALP_AA6G181000                    409   1e-134   
ref|XP_006440448.1|  hypothetical protein CICLE_v10020346mg             403   3e-134   
emb|CDY51554.1|  BnaC03g73000D                                          408   3e-134   
ref|XP_010676633.1|  PREDICTED: probable sodium/metabolite cotran...    402   4e-134   
ref|XP_009134253.1|  PREDICTED: probable sodium/metabolite cotran...    407   5e-134   
emb|CDX90815.1|  BnaA03g24950D                                          407   5e-134   
ref|XP_010055563.1|  PREDICTED: probable sodium/metabolite cotran...    399   3e-130   
ref|XP_006440452.1|  hypothetical protein CICLE_v10020346mg             377   3e-124   
ref|NP_567385.1|  probable sodium/metabolite cotransporter BASS5        361   6e-118   Arabidopsis thaliana [mouse-ear cress]
emb|CAB40944.1|  putative transport protein                             357   5e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001782711.1|  predicted protein                                  349   1e-112   
ref|XP_007040027.1|  Sodium Bile acid symporter family isoform 2        335   1e-107   
ref|XP_010058201.1|  PREDICTED: probable sodium/metabolite cotran...    322   2e-102   
gb|KCW72053.1|  hypothetical protein EUGRSUZ_E00495                     287   7e-89    
ref|XP_006858034.1|  hypothetical protein AMTR_s00069p00204810          279   1e-85    
ref|XP_006396805.1|  hypothetical protein EUTSA_v10028698mg             271   6e-83    
emb|CDX94129.1|  BnaC07g37630D                                          233   9e-70    
ref|XP_001772544.1|  predicted protein                                  238   4e-69    
ref|XP_001777483.1|  predicted protein                                  234   9e-68    
ref|XP_010055572.1|  PREDICTED: probable sodium/metabolite cotran...    226   7e-67    
ref|XP_004512195.1|  PREDICTED: probable sodium/metabolite cotran...    219   3e-64    
gb|ABK25200.1|  unknown                                                 226   6e-64    Picea sitchensis
ref|XP_006850283.1|  hypothetical protein AMTR_s00020p00147840          224   4e-63    
ref|XP_002973383.1|  hypothetical protein SELMODRAFT_54929              219   7e-63    
gb|KFK39838.1|  hypothetical protein AALP_AA3G294600                    221   4e-62    
ref|XP_004247027.1|  PREDICTED: probable sodium/metabolite cotran...    219   1e-61    
gb|EEC73156.1|  hypothetical protein OsI_07191                          218   7e-61    Oryza sativa Indica Group [Indian rice]
emb|CDY27896.1|  BnaA07g04860D                                          217   8e-61    
ref|NP_001046843.1|  Os02g0475400                                       217   1e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648635.1|  PREDICTED: probable sodium/metabolite cotran...    214   2e-60    
emb|CDY00836.1|  BnaCnng00360D                                          216   3e-60    
ref|XP_002885704.1|  bile acid:sodium symporter family protein          216   4e-60    
ref|XP_010488641.1|  PREDICTED: probable sodium/metabolite cotran...    216   4e-60    
ref|XP_006418632.1|  hypothetical protein EUTSA_v10002537mg             216   4e-60    
ref|XP_006345716.1|  PREDICTED: probable sodium/metabolite cotran...    216   7e-60    
ref|XP_010678956.1|  PREDICTED: probable sodium/metabolite cotran...    214   1e-59    
ref|XP_010466952.1|  PREDICTED: probable sodium/metabolite cotran...    214   1e-59    
ref|XP_009334244.1|  PREDICTED: probable sodium/metabolite cotran...    213   3e-59    
ref|XP_008363828.1|  PREDICTED: probable sodium/metabolite cotran...    213   3e-59    
ref|XP_010913121.1|  PREDICTED: probable sodium/metabolite cotran...    213   4e-59    
ref|XP_009358975.1|  PREDICTED: probable sodium/metabolite cotran...    212   8e-59    
ref|XP_010532927.1|  PREDICTED: probable sodium/metabolite cotran...    212   9e-59    
gb|AAM63721.1|  unknown                                                 212   9e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514113.1|  PREDICTED: probable sodium/metabolite cotran...    212   1e-58    
ref|XP_003622828.1|  Sodium-dependent transporter, putative             211   1e-58    
ref|NP_566764.1|  probable sodium/metabolite cotransporter BASS3        212   1e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008355641.1|  PREDICTED: probable sodium/metabolite cotran...    211   3e-58    
ref|XP_008358448.1|  PREDICTED: probable sodium/metabolite cotran...    210   7e-58    
ref|XP_008365930.1|  PREDICTED: probable sodium/metabolite cotran...    209   8e-58    
gb|ABS78850.1|  At4g12030-like protein                                  201   8e-58    Arabidopsis lyrata subsp. petraea
gb|ABS78812.1|  At4g12030-like protein                                  201   8e-58    Arabidopsis halleri subsp. halleri
ref|XP_009102742.1|  PREDICTED: probable sodium/metabolite cotran...    209   1e-57    
ref|XP_008777510.1|  PREDICTED: LOW QUALITY PROTEIN: probable sod...    208   2e-57    
gb|EEE56984.1|  hypothetical protein OsJ_06717                          207   2e-57    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952506.1|  PREDICTED: probable sodium/metabolite cotran...    208   3e-57    
ref|XP_002527259.1|  sodium-bile acid cotransporter, putative           206   3e-57    Ricinus communis
gb|KDO58570.1|  hypothetical protein CISIN_1g037575mg                   207   3e-57    
ref|XP_006492227.1|  PREDICTED: probable sodium/metabolite cotran...    207   3e-57    
ref|XP_006447990.1|  hypothetical protein CICLE_v10015435mg             207   4e-57    
gb|ABS78855.1|  At4g12030-like protein                                  199   5e-57    Arabidopsis lyrata subsp. petraea
ref|XP_004492253.1|  PREDICTED: probable sodium/metabolite cotran...    207   5e-57    
gb|ABS78828.1|  At4g12030-like protein                                  198   7e-57    Arabidopsis lyrata subsp. lyrata
gb|ABS78824.1|  At4g12030-like protein                                  198   7e-57    Arabidopsis lyrata subsp. lyrata
gb|ABS78847.1|  At4g12030-like protein                                  197   1e-56    Arabidopsis lyrata subsp. petraea
ref|XP_009780999.1|  PREDICTED: probable sodium/metabolite cotran...    206   1e-56    
ref|XP_010036742.1|  PREDICTED: probable sodium/metabolite cotran...    206   1e-56    
gb|ABS78844.1|  At4g12030-like protein                                  197   2e-56    Arabidopsis lyrata subsp. petraea
ref|XP_003574971.2|  PREDICTED: probable sodium/metabolite cotran...    207   2e-56    
gb|ABS78827.1|  At4g12030-like protein                                  197   3e-56    Arabidopsis lyrata subsp. lyrata
ref|XP_009393764.1|  PREDICTED: probable sodium/metabolite cotran...    205   3e-56    
gb|ABS78825.1|  At4g12030-like protein                                  196   3e-56    Arabidopsis lyrata subsp. lyrata
gb|ABS78845.1|  At4g12030-like protein                                  196   3e-56    Arabidopsis lyrata subsp. petraea
gb|ABS78814.1|  At4g12030-like protein                                  196   3e-56    Arabidopsis lyrata subsp. petraea
gb|ABS78843.1|  At4g12030-like protein                                  196   3e-56    Arabidopsis lyrata subsp. petraea
gb|ABS78838.1|  At4g12030-like protein                                  196   3e-56    Arabidopsis lyrata subsp. lyrata
gb|KCW48379.1|  hypothetical protein EUGRSUZ_K02087                     206   4e-56    
ref|XP_009589251.1|  PREDICTED: probable sodium/metabolite cotran...    204   5e-56    
ref|XP_002320573.1|  hypothetical protein POPTR_0014s17610g             204   1e-55    Populus trichocarpa [western balsam poplar]
gb|ABS78842.1|  At4g12030-like protein                                  195   1e-55    Arabidopsis lyrata subsp. petraea
ref|XP_003532243.1|  PREDICTED: probable sodium/metabolite cotran...    203   1e-55    
gb|EYU40662.1|  hypothetical protein MIMGU_mgv1a006964mg                203   2e-55    
emb|CDX86726.1|  BnaA09g21160D                                          194   3e-55    
ref|XP_002263684.2|  PREDICTED: probable sodium/metabolite cotran...    202   4e-55    Vitis vinifera
gb|ABS78841.1|  At4g12030-like protein                                  194   4e-55    Arabidopsis lyrata subsp. petraea
emb|CDX94482.1|  BnaC09g23540D                                          194   4e-55    
ref|XP_007200437.1|  hypothetical protein PRUPE_ppa008857mg             199   5e-55    
ref|XP_008235897.1|  PREDICTED: probable sodium/metabolite cotran...    202   7e-55    
ref|XP_011089619.1|  PREDICTED: probable sodium/metabolite cotran...    201   8e-55    
ref|XP_011009337.1|  PREDICTED: probable sodium/metabolite cotran...    201   1e-54    
gb|ABS78831.1|  At4g12030-like protein                                  192   2e-54    Arabidopsis lyrata subsp. lyrata
gb|KDP45244.1|  hypothetical protein JCGZ_15109                         200   3e-54    
ref|XP_004310253.1|  PREDICTED: probable sodium/metabolite cotran...    198   9e-54    
ref|XP_004150363.1|  PREDICTED: probable sodium/metabolite cotran...    198   1e-53    
ref|XP_007049591.1|  Sodium Bile acid symporter family                  198   1e-53    
ref|XP_004164201.1|  PREDICTED: probable sodium/metabolite cotran...    198   1e-53    
ref|XP_007140728.1|  hypothetical protein PHAVU_008G136700g             197   2e-53    
ref|XP_010244074.1|  PREDICTED: probable sodium/metabolite cotran...    197   3e-53    
dbj|BAB01312.1|  unnamed protein product                                197   5e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008447226.1|  PREDICTED: probable sodium/metabolite cotran...    197   5e-53    
gb|ABS78813.1|  At4g12030-like protein                                  187   6e-53    Arabidopsis halleri subsp. halleri
ref|XP_006297609.1|  hypothetical protein CARUB_v10013629mg             194   1e-51    
emb|CDP03966.1|  unnamed protein product                                193   2e-51    
ref|XP_005649158.1|  SBF-domain-containing protein                      187   5e-51    
gb|EMT02361.1|  Putative sodium-dependent transporter yocS              185   1e-49    
gb|KHG13148.1|  putative sodium-dependent transporter yocS              187   2e-49    
ref|XP_009589252.1|  PREDICTED: probable sodium/metabolite cotran...    185   2e-49    
gb|KFK39837.1|  hypothetical protein AALP_AA3G294600                    185   2e-49    
dbj|BAJ88093.1|  predicted protein                                      186   4e-49    
gb|KHN10925.1|  Putative sodium-dependent transporter yocS              178   7e-48    
ref|XP_010100822.1|  putative sodium-dependent transporter yocS         178   2e-46    
ref|XP_010913123.1|  PREDICTED: probable sodium/metabolite cotran...    176   3e-46    
ref|XP_010913122.1|  PREDICTED: probable sodium/metabolite cotran...    176   4e-46    
gb|EPS74376.1|  hypothetical protein M569_00378                         173   1e-44    
gb|KGN44688.1|  hypothetical protein Csa_7G372340                       167   9e-44    
ref|XP_010036747.1|  PREDICTED: probable sodium/metabolite cotran...    168   3e-43    
ref|XP_010036743.1|  PREDICTED: probable sodium/metabolite cotran...    168   3e-43    
ref|XP_010036746.1|  PREDICTED: probable sodium/metabolite cotran...    168   4e-43    
gb|KCW48383.1|  hypothetical protein EUGRSUZ_K02087                     168   7e-43    
gb|KCW48381.1|  hypothetical protein EUGRSUZ_K02087                     168   8e-43    
ref|WP_032810125.1|  MULTISPECIES: transporter                          165   1e-42    
ref|WP_026053809.1|  transporter                                        165   2e-42    
ref|WP_032927139.1|  transporter                                        164   3e-42    
ref|WP_032920941.1|  transporter                                        164   4e-42    
ref|WP_002732116.1|  sodium Bile acid symporter family protein          163   5e-42    
gb|EKQ93436.1|  sodium Bile acid symporter family protein               163   5e-42    
ref|WP_026053546.1|  transporter                                        163   6e-42    
ref|WP_032919300.1|  transporter                                        162   1e-41    
ref|WP_002765848.1|  MULTISPECIES: sodium Bile acid symporter fam...    162   1e-41    
gb|EMK13775.1|  sodium Bile acid symporter family protein               162   1e-41    
ref|WP_026131306.1|  transporter                                        162   1e-41    
gb|EKP11734.1|  sodium Bile acid symporter family protein               162   2e-41    
ref|WP_002749670.1|  sodium Bile acid symporter family protein          161   3e-41    
ref|WP_010579217.1|  transporter                                        161   4e-41    
ref|XP_010541879.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    163   4e-41    
ref|WP_004764442.1|  sodium Bile acid symporter family protein          160   5e-41    
ref|WP_004495214.1|  MULTISPECIES: transporter                          160   8e-41    
ref|WP_004780689.1|  sodium Bile acid symporter family protein          160   8e-41    
ref|WP_004506848.1|  sodium Bile acid symporter family protein          160   8e-41    
ref|WP_020766540.1|  sodium Bile acid symporter family protein          160   9e-41    
ref|XP_011012598.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    162   9e-41    
ref|WP_000448527.1|  Sodium-dependent transporter                       160   1e-40    
ref|WP_004448575.1|  sodium Bile acid symporter family protein          159   1e-40    
ref|WP_000448520.1|  transporter                                        159   2e-40    
gb|EPG56038.1|  sodium Bile acid symporter family protein               159   2e-40    
ref|XP_005650028.1|  SBF-domain-containing protein                      159   2e-40    
ref|WP_032850925.1|  transporter                                        159   2e-40    
ref|WP_004454588.1|  sodium Bile acid symporter family protein          159   2e-40    
ref|WP_000448517.1|  Sodium-dependent transporter                       159   2e-40    
emb|CEF98497.1|  Bile acid:sodium symporter                             162   2e-40    
gb|KHG10132.1|  putative sodium-dependent transporter yocS              161   3e-40    
ref|WP_004772068.1|  sodium Bile acid symporter family protein          159   3e-40    
ref|WP_020762608.1|  sodium Bile acid symporter family protein          158   3e-40    
ref|WP_000448519.1|  Sodium-dependent transporter                       158   3e-40    
ref|WP_004756245.1|  transporter                                        158   4e-40    
ref|WP_000448528.1|  Sodium-dependent transporter                       158   4e-40    
ref|WP_016751618.1|  transporter                                        158   4e-40    
gb|ABK96238.1|  unknown                                                 160   4e-40    Populus trichocarpa x Populus deltoides
ref|WP_004757679.1|  sodium Bile acid symporter family protein          158   5e-40    
ref|WP_016560727.1|  sodium Bile acid symporter family protein          157   7e-40    
ref|WP_020779210.1|  sodium Bile acid symporter family protein          157   7e-40    
ref|XP_010520782.1|  PREDICTED: probable sodium/metabolite cotran...    159   7e-40    
ref|XP_003080041.1|  Na+-bile acid cotransporter (ISS)                  159   9e-40    
ref|WP_002101302.1|  sodium Bile acid symporter family protein          157   1e-39    
ref|WP_004446543.1|  sodium Bile acid symporter family protein          157   1e-39    
ref|WP_000448529.1|  Sodium-dependent transporter                       157   1e-39    
ref|WP_002624984.1|  sodium Bile acid symporter family protein          157   1e-39    
ref|WP_004428403.1|  sodium Bile acid symporter family protein          157   1e-39    
ref|WP_000448523.1|  transporter                                        157   1e-39    
ref|WP_004435694.1|  sodium Bile acid symporter family protein          157   1e-39    
ref|WP_000448524.1|  transporter                                        157   1e-39    
ref|WP_000448522.1|  transporter                                        156   2e-39    
ref|WP_017853737.1|  transporter                                        156   2e-39    
ref|WP_001972505.1|  sodium Bile acid symporter family protein          156   3e-39    
ref|WP_004426040.1|  transporter                                        155   3e-39    
ref|XP_010541878.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    158   3e-39    
ref|WP_002998741.1|  sodium Bile acid symporter family protein          155   5e-39    
ref|WP_017850257.1|  transporter                                        155   5e-39    
dbj|BAJ16226.1|  sodium-dependent pyruvate transporter                  157   6e-39    
ref|WP_000448525.1|  transporter                                        154   7e-39    
ref|WP_036041348.1|  transporter                                        154   1e-38    
ref|WP_020772541.1|  sodium Bile acid symporter family protein          154   1e-38    
ref|XP_004508558.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    156   1e-38    
ref|XP_010249921.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    156   2e-38    
ref|XP_010249922.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    156   2e-38    
ref|XP_006389537.1|  hypothetical protein POPTR_0022s00710g             156   2e-38    
ref|XP_009143363.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    155   3e-38    
ref|XP_007202174.1|  hypothetical protein PRUPE_ppa006547mg             155   4e-38    
ref|XP_009371418.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    155   4e-38    
emb|CDX74891.1|  BnaA05g06370D                                          155   4e-38    
ref|WP_020985373.1|  sodium Bile acid symporter family protein          152   4e-38    
ref|XP_010541877.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    155   4e-38    
ref|XP_008242696.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    154   5e-38    
ref|XP_011047932.1|  PREDICTED: probable sodium/metabolite cotran...    154   5e-38    
ref|WP_016545504.1|  sodium Bile acid symporter family protein          152   5e-38    
ref|XP_008386071.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    154   5e-38    
emb|CDX91487.1|  BnaC04g06630D                                          154   6e-38    
ref|XP_008354390.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    154   7e-38    
ref|WP_017213483.1|  transporter                                        152   7e-38    
ref|XP_002531245.1|  sodium-bile acid cotransporter, putative           154   9e-38    
ref|WP_002179802.1|  sodium Bile acid symporter family protein          151   1e-37    
ref|WP_008105034.1|  transporter                                        151   1e-37    
ref|XP_001760363.1|  predicted protein                                  150   1e-37    
ref|WP_002134098.1|  sodium Bile acid symporter family protein          150   1e-37    
ref|XP_009141764.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    153   1e-37    
emb|CDX93303.1|  BnaC04g45930D                                          153   2e-37    
gb|KDP32335.1|  hypothetical protein JCGZ_13260                         152   2e-37    
ref|XP_006294304.1|  hypothetical protein CARUB_v10023312mg             153   2e-37    
ref|XP_007222073.1|  hypothetical protein PRUPE_ppa007523mg             151   3e-37    
ref|XP_002284920.3|  PREDICTED: sodium/pyruvate cotransporter BAS...    152   3e-37    
ref|XP_010656384.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    152   3e-37    
ref|XP_002880845.1|  hypothetical protein ARALYDRAFT_901497             152   3e-37    
ref|XP_006343176.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    152   3e-37    
ref|NP_001234028.1|  involved in inorganic sulfate assimilation         152   4e-37    
ref|XP_003609202.1|  Bile acid Na+ symporter family protein             152   4e-37    
ref|XP_010047772.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    152   4e-37    
gb|AAM18095.1|AF498303_1  putative sodium-dependent bile acid sym...    152   5e-37    
ref|XP_010510842.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    151   5e-37    
ref|XP_003569443.1|  PREDICTED: probable sodium/metabolite cotran...    152   5e-37    
ref|XP_010417834.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    151   5e-37    
ref|XP_010688119.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    152   5e-37    
ref|XP_006411101.1|  hypothetical protein EUTSA_v10016729mg             151   7e-37    
ref|NP_850089.1|  sodium/pyruvate cotransporter BASS2                   151   7e-37    
ref|XP_007041240.1|  Bile acid sodium symporter/ transporter            151   7e-37    
ref|XP_006411100.1|  hypothetical protein EUTSA_v10016729mg             151   8e-37    
ref|WP_016753439.1|  transporter                                        148   9e-37    
ref|XP_009788443.1|  PREDICTED: probable sodium/metabolite cotran...    150   1e-36    
ref|XP_011081192.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    151   1e-36    
ref|XP_006644431.1|  PREDICTED: probable sodium/metabolite cotran...    150   1e-36    
ref|XP_003062186.1|  bile Acid:Na+ symporter family                     147   1e-36    
ref|XP_010541876.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    151   1e-36    
gb|EWM27587.1|  bile acid:sodium symporter family protein               150   2e-36    
emb|CDY18367.1|  BnaA04g22200D                                          150   2e-36    
ref|WP_002975621.1|  sodium Bile acid symporter family protein          147   4e-36    
ref|XP_009627623.1|  PREDICTED: probable sodium/metabolite cotran...    148   5e-36    
dbj|GAK08034.1|  sodium-dependent transporter                           146   6e-36    
emb|CDP03385.1|  unnamed protein product                                149   6e-36    
gb|KDP24834.1|  hypothetical protein JCGZ_25168                         148   7e-36    
ref|NP_001043701.1|  Os01g0645200                                       148   9e-36    
ref|XP_002983351.1|  hypothetical protein SELMODRAFT_45175              145   9e-36    
ref|XP_010694752.1|  PREDICTED: probable sodium/metabolite cotran...    148   1e-35    
gb|EYU30455.1|  hypothetical protein MIMGU_mgv1a005885mg                148   1e-35    
ref|XP_004488981.1|  PREDICTED: probable sodium/metabolite cotran...    147   2e-35    
ref|XP_002975058.1|  hypothetical protein SELMODRAFT_174757             147   2e-35    
gb|EKO76377.1|  sodium Bile acid symporter family protein               143   3e-35    
ref|XP_006338900.1|  PREDICTED: probable sodium/metabolite cotran...    146   3e-35    
ref|XP_010537693.1|  PREDICTED: probable sodium/metabolite cotran...    146   4e-35    
ref|XP_009376713.1|  PREDICTED: probable sodium/metabolite cotran...    146   4e-35    
ref|XP_005707449.1|  bile acid:Na+ symporter, BASS family               146   4e-35    
ref|XP_003524523.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    145   5e-35    
ref|XP_001775120.1|  predicted protein                                  144   5e-35    
gb|EMO13400.1|  sodium Bile acid symporter family protein               142   6e-35    
gb|EMS48976.1|  putative sodium-dependent transporter yocS              144   6e-35    
ref|XP_010930820.1|  PREDICTED: probable sodium/metabolite cotran...    145   6e-35    
ref|XP_009376715.1|  PREDICTED: probable sodium/metabolite cotran...    145   7e-35    
ref|XP_009800401.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    145   7e-35    
gb|EMN22097.1|  sodium Bile acid symporter family protein               142   8e-35    
gb|ACN36368.1|  unknown                                                 145   8e-35    
ref|WP_000448526.1|  Sodium-dependent transporter                       142   8e-35    
ref|XP_007022021.1|  Sodium Bile acid symporter family isoform 1        145   9e-35    
dbj|BAJ88629.1|  predicted protein                                      145   9e-35    
ref|XP_001752354.1|  predicted protein                                  143   1e-34    
ref|XP_006851798.1|  hypothetical protein AMTR_s00041p00002450          136   1e-34    
gb|EKO32527.1|  sodium Bile acid symporter family protein               141   1e-34    
ref|XP_006294303.1|  hypothetical protein CARUB_v10023312mg             144   1e-34    
emb|CDM83534.1|  unnamed protein product                                144   1e-34    
ref|XP_009403016.1|  PREDICTED: probable sodium/metabolite cotran...    145   1e-34    
ref|XP_004287383.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    144   1e-34    
ref|XP_011006844.1|  PREDICTED: probable sodium/metabolite cotran...    144   2e-34    
ref|XP_005827510.1|  hypothetical protein GUITHDRAFT_75425              143   2e-34    
ref|WP_004483965.1|  sodium Bile acid symporter family protein          141   2e-34    
ref|XP_002526459.1|  sodium-bile acid cotransporter, putative           144   2e-34    
ref|XP_008368370.1|  PREDICTED: LOW QUALITY PROTEIN: probable sod...    144   2e-34    
ref|WP_004467607.1|  transporter                                        140   2e-34    
ref|XP_010242296.1|  PREDICTED: probable sodium/metabolite cotran...    144   2e-34    
ref|XP_006853461.1|  hypothetical protein AMTR_s00032p00193650          144   2e-34    
gb|KFK42231.1|  hypothetical protein AALP_AA2G228600                    143   2e-34    
ref|WP_002753764.1|  sodium Bile acid symporter family protein          140   2e-34    
ref|XP_004251493.1|  PREDICTED: probable sodium/metabolite cotran...    143   3e-34    
ref|XP_006600768.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    143   3e-34    
ref|XP_009344611.1|  PREDICTED: probable sodium/metabolite cotran...    143   3e-34    
ref|XP_006600767.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    144   3e-34    
ref|XP_004294172.1|  PREDICTED: probable sodium/metabolite cotran...    143   3e-34    
ref|NP_001152351.1|  bile acid sodium symporter/ transporter            143   4e-34    
ref|XP_003609203.1|  Bile acid Na+ symporter family protein             143   4e-34    
ref|XP_006442338.1|  hypothetical protein CICLE_v10020318mg             143   4e-34    
ref|XP_011092310.1|  PREDICTED: probable sodium/metabolite cotran...    142   6e-34    
ref|WP_015683030.1|  sodium Bile acid symporter family protein          140   7e-34    
ref|XP_003077930.1|  bile acid:sodium symporter family protein (ISS)    141   7e-34    
ref|XP_010557580.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    142   7e-34    
emb|CBJ30243.1|  putative anion:sodium symporter                        142   7e-34    
gb|EMM87120.1|  sodium Bile acid symporter family protein               139   7e-34    
ref|XP_008363646.1|  PREDICTED: probable sodium/metabolite cotran...    142   8e-34    
ref|XP_006451036.1|  hypothetical protein CICLE_v10008416mg             142   9e-34    
ref|XP_010030162.1|  PREDICTED: probable sodium/metabolite cotran...    142   9e-34    
ref|WP_004486981.1|  sodium Bile acid symporter family protein          138   1e-33    
ref|WP_012476637.1|  transporter                                        140   1e-33    
ref|XP_006431674.1|  hypothetical protein CICLE_v10001198mg             142   1e-33    
ref|XP_009420574.1|  PREDICTED: probable sodium/metabolite cotran...    141   1e-33    
gb|KDO43363.1|  hypothetical protein CISIN_1g015189mg                   142   1e-33    
ref|WP_024123849.1|  bile acid:Na+ symporter (BASS) family              140   1e-33    
gb|KDO41538.1|  hypothetical protein CISIN_1g014898mg                   142   1e-33    
ref|XP_004146013.1|  PREDICTED: probable sodium/metabolite cotran...    142   1e-33    
dbj|GAJ97656.1|  LOW QUALITY PROTEIN: sodium-dependent transporter      139   1e-33    
ref|XP_009602137.1|  PREDICTED: probable sodium/metabolite cotran...    142   1e-33    
ref|XP_006475764.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    142   1e-33    
ref|XP_008463794.1|  PREDICTED: LOW QUALITY PROTEIN: probable sod...    141   1e-33    
ref|XP_008463345.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    141   2e-33    
ref|WP_002980721.1|  sodium Bile acid symporter family protein          139   2e-33    
ref|XP_011082810.1|  PREDICTED: probable sodium/metabolite cotran...    141   2e-33    
ref|XP_004149855.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    141   2e-33    
ref|WP_004489283.1|  sodium Bile acid symporter family protein          138   2e-33    
gb|AAC32250.1|  putative Na+ dependent ileal bile acid transporter      140   2e-33    
ref|XP_003539630.2|  PREDICTED: probable sodium/metabolite cotran...    141   2e-33    
ref|XP_008226350.1|  PREDICTED: probable sodium/metabolite cotran...    141   2e-33    
gb|ACZ98535.1|  transmembrane domain protein                            141   2e-33    
ref|XP_006301266.1|  hypothetical protein CARUB_v10021666mg             140   2e-33    
ref|XP_010495237.1|  PREDICTED: probable sodium/metabolite cotran...    138   2e-33    
ref|XP_006829640.1|  hypothetical protein AMTR_s00122p00097060          141   2e-33    
emb|CBI29712.3|  unnamed protein product                                139   3e-33    
ref|WP_020158510.1|  transporter                                        139   3e-33    
ref|XP_007154938.1|  hypothetical protein PHAVU_003G159600g             140   3e-33    
ref|WP_014150060.1|  transporter                                        138   3e-33    
gb|ABK24409.1|  unknown                                                 140   3e-33    
ref|XP_006389975.1|  hypothetical protein EUTSA_v10018656mg             140   3e-33    
ref|XP_005648900.1|  BASS family transporter: sodium ion/bile acid      139   3e-33    
ref|XP_002263202.1|  PREDICTED: probable sodium/metabolite cotran...    140   3e-33    
gb|EMN14785.1|  sodium Bile acid symporter family protein               137   4e-33    
gb|EPS69603.1|  hypothetical protein M569_05164                         138   4e-33    
ref|XP_005716654.1|  sodium-dependent transporter                       140   5e-33    
ref|XP_004230458.1|  PREDICTED: probable sodium/metabolite cotran...    140   5e-33    
gb|EYU38235.1|  hypothetical protein MIMGU_mgv1a007506mg                139   6e-33    
ref|XP_006477810.1|  PREDICTED: probable sodium/metabolite cotran...    140   6e-33    
emb|CDO97606.1|  unnamed protein product                                139   6e-33    
emb|CEF96953.1|  Bile acid:sodium symporter                             137   7e-33    
ref|XP_010914977.1|  PREDICTED: probable sodium/metabolite cotran...    139   8e-33    
ref|XP_009106563.1|  PREDICTED: probable sodium/metabolite cotran...    139   8e-33    
ref|WP_036247339.1|  transporter                                        138   8e-33    
ref|XP_009629332.1|  PREDICTED: probable sodium/metabolite cotran...    139   8e-33    
ref|WP_012376899.1|  transporter                                        137   8e-33    
ref|WP_015679440.1|  sodium Bile acid symporter family protein          137   8e-33    
ref|WP_004787995.1|  transporter                                        137   9e-33    
ref|XP_010062765.1|  PREDICTED: probable sodium/metabolite cotran...    139   9e-33    
ref|XP_004166430.1|  PREDICTED: probable sodium/metabolite cotran...    139   1e-32    
gb|KHN19475.1|  Putative sodium-dependent transporter yocS              137   1e-32    
ref|WP_020770041.1|  sodium Bile acid symporter family protein          137   1e-32    
ref|XP_002889199.1|  bile acid:sodium symporter family protein          139   1e-32    
ref|XP_002442895.1|  hypothetical protein SORBIDRAFT_08g004520          139   1e-32    
emb|CDY52433.1|  BnaA07g39100D                                          138   1e-32    
ref|XP_004134255.1|  PREDICTED: probable sodium/metabolite cotran...    139   1e-32    
ref|WP_014804130.1|  Bile acid:sodium symporter                         137   1e-32    
ref|XP_009765749.1|  PREDICTED: probable sodium/metabolite cotran...    139   1e-32    
ref|NP_565182.1|  sodium Bile acid symporter family                     138   1e-32    
ref|WP_020987110.1|  sodium Bile acid symporter family protein          135   1e-32    
ref|XP_010098229.1|  putative sodium-dependent transporter yocS         138   2e-32    
ref|XP_004133714.1|  PREDICTED: probable sodium/metabolite cotran...    138   2e-32    
ref|XP_010254250.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    138   2e-32    
ref|XP_004166429.1|  PREDICTED: probable sodium/metabolite cotran...    138   2e-32    
ref|WP_008588953.1|  transporter                                        136   2e-32    
ref|XP_006349334.1|  PREDICTED: probable sodium/metabolite cotran...    138   2e-32    
ref|XP_010254248.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    138   2e-32    
ref|XP_010254249.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    138   2e-32    
emb|CDX86868.1|  BnaA09g22580D                                          137   3e-32    
ref|XP_010429683.1|  PREDICTED: probable sodium/metabolite cotran...    138   3e-32    
ref|WP_016551297.1|  sodium Bile acid symporter family protein          135   3e-32    
ref|XP_010417455.1|  PREDICTED: probable sodium/metabolite cotran...    137   3e-32    
ref|XP_010694742.1|  PREDICTED: LOW QUALITY PROTEIN: probable sod...    137   3e-32    
ref|WP_036296549.1|  transporter                                        136   3e-32    
ref|XP_009387169.1|  PREDICTED: probable sodium/metabolite cotran...    136   3e-32    
emb|CDX88454.1|  BnaC06g38980D                                          137   3e-32    
ref|XP_002456043.1|  hypothetical protein SORBIDRAFT_03g029420          137   4e-32    
ref|XP_009387167.1|  PREDICTED: probable sodium/metabolite cotran...    137   5e-32    
ref|WP_020777207.1|  sodium Bile acid symporter family protein          135   5e-32    
gb|KHG18566.1|  putative sodium-dependent transporter yocS              136   6e-32    
ref|XP_008804047.1|  PREDICTED: probable sodium/metabolite cotran...    136   7e-32    
ref|XP_006367653.1|  PREDICTED: probable sodium/metabolite cotran...    136   1e-31    
ref|WP_036243826.1|  transporter                                        134   1e-31    
ref|WP_028952635.1|  sodium dependent transporter                       134   1e-31    
emb|CDP06062.1|  unnamed protein product                                135   1e-31    
ref|XP_003543183.1|  PREDICTED: probable sodium/metabolite cotran...    135   1e-31    
ref|XP_006349335.1|  PREDICTED: probable sodium/metabolite cotran...    135   1e-31    
ref|WP_017841091.1|  transporter                                        134   1e-31    
ref|XP_008781515.1|  PREDICTED: probable sodium/metabolite cotran...    135   1e-31    
ref|XP_002946051.1|  hypothetical protein VOLCADRAFT_102664             139   1e-31    
ref|XP_001418553.1|  BASS family transporter: sodium ion/bile acid      133   2e-31    
gb|KDP42434.1|  hypothetical protein JCGZ_00231                         135   2e-31    
ref|XP_004969305.1|  PREDICTED: probable sodium/metabolite cotran...    135   2e-31    
ref|XP_002500634.1|  bile Acid:Na+ symporter family                     132   2e-31    
gb|KHG22637.1|  putative sodium-dependent transporter yocS              134   3e-31    
gb|KHN36938.1|  Putative sodium-dependent transporter yocS              134   3e-31    
gb|KEH38546.1|  sodium bile acid symporter family protein               137   3e-31    
ref|WP_036911527.1|  sodium transporter                                 132   3e-31    
ref|WP_035811030.1|  Bile acid:sodium symporter                         133   3e-31    
gb|EPS66417.1|  hypothetical protein M569_08357                         132   4e-31    
ref|XP_007013300.1|  Transmembrane domain protein isoform 1             134   4e-31    



>ref|XP_009588499.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Nicotiana tomentosiformis]
Length=405

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/399 (78%), Positives = 341/399 (85%), Gaps = 14/399 (4%)
 Frame = -1

Query  1344  NQGFKIHHPSLPKPLPCINLEFHYPFLSLPRK--SFNSSARSSRLPVSRCVSENLSDSIR  1171
             +QGFKI H    K LPC +    +PF+S P+K   F+S   +SRL +SRC+SE  SDS+ 
Sbjct  16    HQGFKILHQ---KSLPCFD---QHPFVSFPKKWKCFHSGG-NSRLLISRCISEKFSDSLG  68

Query  1170  PESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYA  991
             P       +ES E  K KEN+ LT+L+GAN+ LPHVVLGSTILAL+YPPSFTWFT+RYY+
Sbjct  69    PSD-----SESLENLKQKENTLLTILKGANSFLPHVVLGSTILALIYPPSFTWFTNRYYS  123

Query  990   PALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTS  811
             PALGFLMFAVGVNSSEKDFLEAF +P AI AGYIGQF VKPLLGYLFGT+A+  FGLPTS
Sbjct  124   PALGFLMFAVGVNSSEKDFLEAFKKPAAIFAGYIGQFAVKPLLGYLFGTLAMTVFGLPTS  183

Query  810   LAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLP  631
             LAAGIMLTSCVSGAQLSNYATFLTDP MAPLSIVMTSLSTATA  VTP LSLLLIGK+LP
Sbjct  184   LAAGIMLTSCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTATAVFVTPILSLLLIGKKLP  243

Query  630   VDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQ  451
             VDV GM+SNI+QIVV PVA GLLLNRFFPQ+CNAIRP LPPLSVFVT+LCVGAPLAINI+
Sbjct  244   VDVKGMVSNILQIVVAPVAGGLLLNRFFPQICNAIRPLLPPLSVFVTALCVGAPLAINIE  303

Query  450   svvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALA  271
             S+VSPSG+SVLLL+IAFHLSAFI GY L+G AF  APDVKPLQRTLSYETGMQSSLLALA
Sbjct  304   SLVSPSGMSVLLLMIAFHLSAFILGYLLSGIAFHKAPDVKPLQRTLSYETGMQSSLLALA  363

Query  270   LANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKST  154
             LANKFFQDPLVGVPPAISVVIMSLMGFSLVM W K K T
Sbjct  364   LANKFFQDPLVGVPPAISVVIMSLMGFSLVMLWAKKKET  402



>ref|XP_009761030.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X1 [Nicotiana sylvestris]
Length=421

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/421 (74%), Positives = 341/421 (81%), Gaps = 29/421 (7%)
 Frame = -1

Query  1362  LLQPQLNQGFKIHHPSLPKPLPCINLEFHYPFLSLPRK------------SFNSSARS--  1225
             L Q Q NQ FKI H    K LPC    + +  +S P+K             F+S+ +S  
Sbjct  9     LQQQQYNQDFKILHQ---KSLPCF---YQHTLVSFPKKWKCFHSSGVRLKGFSSTMQSTL  62

Query  1224  ----SRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVL  1057
                 SRL +SRC+S+   DS+ P       +ES E  K KEN+FLT+L+GAN+ LPHVVL
Sbjct  63    ASGNSRLLISRCISKKFPDSLGPSD-----SESLENLKQKENTFLTILKGANSFLPHVVL  117

Query  1056  GSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFV  877
             GSTILAL+YPPSFTWFT+RYYAPALGFLMFAVGVNSSEKDFLEAF +P AI AGYIGQF 
Sbjct  118   GSTILALIYPPSFTWFTNRYYAPALGFLMFAVGVNSSEKDFLEAFKKPAAIFAGYIGQFA  177

Query  876   VKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtsl  697
             VKPLLGYLFGT+A+  F LPTSLAAGIMLTSCVSGAQLSNYATFLTDP MAPLSIVMTSL
Sbjct  178   VKPLLGYLFGTLAMTVFDLPTSLAAGIMLTSCVSGAQLSNYATFLTDPQMAPLSIVMTSL  237

Query  696   stataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPF  517
             STATA  VTP LSLLLIGK+LPVDV GM+SNI+QIVV PVA GLL+NRFFPQ+CNAIRP 
Sbjct  238   STATAVFVTPILSLLLIGKKLPVDVKGMVSNILQIVVAPVAGGLLMNRFFPQICNAIRPL  297

Query  516   LPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPD  337
             LPPLSVFVT+LCVGAPLAINI+S+VSPSG+SVLLLVIAFHLSAFI GY L+G AF  APD
Sbjct  298   LPPLSVFVTALCVGAPLAINIESLVSPSGMSVLLLVIAFHLSAFILGYLLSGIAFHKAPD  357

Query  336   VKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             VK LQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM W K K 
Sbjct  358   VKALQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMLWAKKKE  417

Query  156   T  154
             T
Sbjct  418   T  418



>ref|XP_006358370.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic-like 
[Solanum tuberosum]
Length=420

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/420 (74%), Positives = 341/420 (81%), Gaps = 25/420 (6%)
 Frame = -1

Query  1362  LLQPQLNQGFKI-HHPSLPKPLPCINLEFHYPFLSLPRKSFNSS---------ARSSRLP  1213
             LL  Q +QGFKI   PSL K LPC +    +P +S P+K F+SS         A  S LP
Sbjct  6     LLFQQNHQGFKILDSPSLHKSLPCFH---QHPIVSFPKKCFHSSGVRLVGFPSAIQSTLP  62

Query  1212  -------VSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLG  1054
                    V+RC+SE+ SD + P        ES E  K KEN+FLT+L+GAN+ LPHVVL 
Sbjct  63    NGNSGLLVTRCISESFSDPLGPNDF-----ESLENLKQKENAFLTILKGANSFLPHVVLA  117

Query  1053  STILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVV  874
             STILAL+YPPSFTWFT+RYYAPALGFLMFAVGVNSSEKDFLEAF +P AI AGYIGQF +
Sbjct  118   STILALIYPPSFTWFTNRYYAPALGFLMFAVGVNSSEKDFLEAFKKPAAIFAGYIGQFAL  177

Query  873   KPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtsls  694
             KPLLGYLFGT+A+A FGLPTSLAAGIMLTSCVSGAQLSNYATFLTDP MAPLSIVMT+LS
Sbjct  178   KPLLGYLFGTVAMAVFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPQMAPLSIVMTALS  237

Query  693   tataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFL  514
             TATA  +TP L+LLLIGK+LPVDV GMISNI+QIVV PVA GL LNRFFPQ+CNAIRP L
Sbjct  238   TATAVFITPTLTLLLIGKKLPVDVKGMISNILQIVVAPVAGGLFLNRFFPQICNAIRPLL  297

Query  513   PPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDV  334
             PPLSVFVT+LCVGAPLAINI S+VSPSG+SVL LVIAFHLSAFI GY L+G AF  APDV
Sbjct  298   PPLSVFVTALCVGAPLAINIDSLVSPSGMSVLFLVIAFHLSAFILGYFLSGLAFHKAPDV  357

Query  333   KPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKST  154
             K LQRTLSYETGMQSSLLALALANKFFQDPLV VPPAISVVIMSLMGF+LVM W K K T
Sbjct  358   KALQRTLSYETGMQSSLLALALANKFFQDPLVSVPPAISVVIMSLMGFTLVMLWTKKKET  417



>ref|XP_009761032.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X3 [Nicotiana sylvestris]
Length=364

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/361 (81%), Positives = 318/361 (88%), Gaps = 5/361 (1%)
 Frame = -1

Query  1236  SARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVL  1057
             ++ +SRL +SRC+S+   DS+ P       +ES E  K KEN+FLT+L+GAN+ LPHVVL
Sbjct  6     ASGNSRLLISRCISKKFPDSLGPSD-----SESLENLKQKENTFLTILKGANSFLPHVVL  60

Query  1056  GSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFV  877
             GSTILAL+YPPSFTWFT+RYYAPALGFLMFAVGVNSSEKDFLEAF +P AI AGYIGQF 
Sbjct  61    GSTILALIYPPSFTWFTNRYYAPALGFLMFAVGVNSSEKDFLEAFKKPAAIFAGYIGQFA  120

Query  876   VKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtsl  697
             VKPLLGYLFGT+A+  F LPTSLAAGIMLTSCVSGAQLSNYATFLTDP MAPLSIVMTSL
Sbjct  121   VKPLLGYLFGTLAMTVFDLPTSLAAGIMLTSCVSGAQLSNYATFLTDPQMAPLSIVMTSL  180

Query  696   stataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPF  517
             STATA  VTP LSLLLIGK+LPVDV GM+SNI+QIVV PVA GLL+NRFFPQ+CNAIRP 
Sbjct  181   STATAVFVTPILSLLLIGKKLPVDVKGMVSNILQIVVAPVAGGLLMNRFFPQICNAIRPL  240

Query  516   LPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPD  337
             LPPLSVFVT+LCVGAPLAINI+S+VSPSG+SVLLLVIAFHLSAFI GY L+G AF  APD
Sbjct  241   LPPLSVFVTALCVGAPLAINIESLVSPSGMSVLLLVIAFHLSAFILGYLLSGIAFHKAPD  300

Query  336   VKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             VK LQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM W K K 
Sbjct  301   VKALQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMLWAKKKE  360

Query  156   T  154
             T
Sbjct  361   T  361



>ref|XP_004244587.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Solanum lycopersicum]
Length=416

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/416 (73%), Positives = 335/416 (81%), Gaps = 21/416 (5%)
 Frame = -1

Query  1362  LLQPQLNQGFKI-HHPSLPKPLPCINLEFHYPFLSLPRKSFNSS---------ARSSRLP  1213
             LL  Q +QGFKI   PSL K LPC +    +P +S  +K F+SS         A  S LP
Sbjct  6     LLFQQNHQGFKILDSPSLHKSLPCFH---QHPVVSFTKKCFHSSGVRLVGFPSAIQSTLP  62

Query  1212  ---VSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTIL  1042
                V+RC+SE+ SD + P        ES E  K KEN+FLT+L+GAN+ LPHVVL STIL
Sbjct  63    RLLVTRCISESFSDPLGPNDF-----ESLENLKQKENAFLTILKGANSFLPHVVLASTIL  117

Query  1041  ALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLL  862
             AL+YPPSFTWFT+RYYAPALGFLMFAVGVNSSEKDFLEAF +P AI AGYIGQF +KPLL
Sbjct  118   ALIYPPSFTWFTNRYYAPALGFLMFAVGVNSSEKDFLEAFKKPAAIFAGYIGQFALKPLL  177

Query  861   GYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstata  682
             GYLFGT+A++  GLPTSLAAGIMLTSCVSGAQLSNYATFLTDP MAPLSIVMT+LSTATA
Sbjct  178   GYLFGTVAMSVLGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPQMAPLSIVMTALSTATA  237

Query  681   aLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLS  502
             A +TP L+LLLIGK+LPVDV GMISNI+QIVV PVA GL LNR  PQ+ NAIRP LPPLS
Sbjct  238   AFITPTLTLLLIGKKLPVDVKGMISNILQIVVAPVAGGLFLNRCLPQISNAIRPLLPPLS  297

Query  501   VFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQ  322
             VFVT+L VGAPLAINI S++SPSG+SVL LVIAFHLSAFI  Y L+G AF  APDVK LQ
Sbjct  298   VFVTALAVGAPLAINIDSLMSPSGMSVLFLVIAFHLSAFILAYFLSGLAFHKAPDVKALQ  357

Query  321   RTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKST  154
             RTLSYETGMQSSLLALALANKFFQDPLV VPPAISVVIMSLMGF+LVM W K K T
Sbjct  358   RTLSYETGMQSSLLALALANKFFQDPLVSVPPAISVVIMSLMGFTLVMLWTKKKET  413



>emb|CDP09858.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/350 (81%), Positives = 312/350 (89%), Gaps = 0/350 (0%)
 Frame = -1

Query  1206  RCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYP  1027
             R   E LS S+ P+  SNY+ E++EI KPK+ SFLT+L+GAN++LPHVV+ ST+LALVYP
Sbjct  79    RSAGEKLSGSLEPDESSNYSKEAAEILKPKKASFLTILQGANSVLPHVVIASTVLALVYP  138

Query  1026  PSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFG  847
             PSFTWFT+RYYAPALGFLMFAVG+NSSEKDF+EAFNRP AI AGY+GQFVVKPLLGYLFG
Sbjct  139   PSFTWFTNRYYAPALGFLMFAVGLNSSEKDFIEAFNRPAAIFAGYVGQFVVKPLLGYLFG  198

Query  846   TIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTP  667
             TI++  FGLPT LAAGIMLTSCVSGAQLSNYATFLTDP MAPLSIVMTSLSTATA  VTP
Sbjct  199   TISMTIFGLPTPLAAGIMLTSCVSGAQLSNYATFLTDPAMAPLSIVMTSLSTATAVFVTP  258

Query  666   FLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTS  487
              LSLLLIGKRLPVDV GM+SNI+QIVV P+AAGLLLNR FP++ NAIRPFLPPLSVFVT+
Sbjct  259   LLSLLLIGKRLPVDVKGMVSNILQIVVAPIAAGLLLNRIFPRISNAIRPFLPPLSVFVTA  318

Query  486   LCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSY  307
             LCVGAPLAINI SV+SPSGLSVL LVIAFHL AFISGYTL G  F + PDVK LQRTLSY
Sbjct  319   LCVGAPLAINISSVLSPSGLSVLFLVIAFHLVAFISGYTLTGLLFHNTPDVKALQRTLSY  378

Query  306   ETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             ETGMQSSLLALALAN+FFQDPLVGVPPAISVVIMSLMGFSLVM W+K   
Sbjct  379   ETGMQSSLLALALANRFFQDPLVGVPPAISVVIMSLMGFSLVMLWSKKSE  428



>ref|XP_009761031.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X2 [Nicotiana sylvestris]
Length=398

 Score =   521 bits (1341),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 294/401 (73%), Positives = 325/401 (81%), Gaps = 29/401 (7%)
 Frame = -1

Query  1362  LLQPQLNQGFKIHHPSLPKPLPCINLEFHYPFLSLPRK------------SFNSSARS--  1225
             L Q Q NQ FKI H    K LPC    + +  +S P+K             F+S+ +S  
Sbjct  9     LQQQQYNQDFKILHQ---KSLPCF---YQHTLVSFPKKWKCFHSSGVRLKGFSSTMQSTL  62

Query  1224  ----SRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVL  1057
                 SRL +SRC+S+   DS+ P       +ES E  K KEN+FLT+L+GAN+ LPHVVL
Sbjct  63    ASGNSRLLISRCISKKFPDSLGPSD-----SESLENLKQKENTFLTILKGANSFLPHVVL  117

Query  1056  GSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFV  877
             GSTILAL+YPPSFTWFT+RYYAPALGFLMFAVGVNSSEKDFLEAF +P AI AGYIGQF 
Sbjct  118   GSTILALIYPPSFTWFTNRYYAPALGFLMFAVGVNSSEKDFLEAFKKPAAIFAGYIGQFA  177

Query  876   VKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtsl  697
             VKPLLGYLFGT+A+  F LPTSLAAGIMLTSCVSGAQLSNYATFLTDP MAPLSIVMTSL
Sbjct  178   VKPLLGYLFGTLAMTVFDLPTSLAAGIMLTSCVSGAQLSNYATFLTDPQMAPLSIVMTSL  237

Query  696   stataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPF  517
             STATA  VTP LSLLLIGK+LPVDV GM+SNI+QIVV PVA GLL+NRFFPQ+CNAIRP 
Sbjct  238   STATAVFVTPILSLLLIGKKLPVDVKGMVSNILQIVVAPVAGGLLMNRFFPQICNAIRPL  297

Query  516   LPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPD  337
             LPPLSVFVT+LCVGAPLAINI+S+VSPSG+SVLLLVIAFHLSAFI GY L+G AF  APD
Sbjct  298   LPPLSVFVTALCVGAPLAINIESLVSPSGMSVLLLVIAFHLSAFILGYLLSGIAFHKAPD  357

Query  336   VKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISV  214
             VK LQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISV
Sbjct  358   VKALQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISV  398



>ref|XP_010661664.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Vitis vinifera]
Length=423

 Score =   508 bits (1309),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 267/358 (75%), Positives = 311/358 (87%), Gaps = 1/358 (0%)
 Frame = -1

Query  1227  SSRLPVSRCVSENLSDSIRPESLSNYAAES-SEIFKPKENSFLTVLRGANAILPHVVLGS  1051
             S+R  ++RCVS+ LS+S+ P+   +Y  E  S++   K+ S   +L+GAN ILPHVVL S
Sbjct  63    STRFSLARCVSKKLSESLEPDQDPSYEPEEPSQMRGQKKASITDILKGANGILPHVVLAS  122

Query  1050  TILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVK  871
             T++AL+YPPSFTWFT+RYYAPALGFLMFAVGVNSSEKDFLEAFNRP AI AGY+GQFVVK
Sbjct  123   TLVALIYPPSFTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPMAIFAGYVGQFVVK  182

Query  870   PLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslst  691
             PLLGYLFGTIA+  FGLPT++ AGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMTSLST
Sbjct  183   PLLGYLFGTIAVTIFGLPTAIGAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMTSLST  242

Query  690   ataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLP  511
             ATA  VTP LSLLLIGKRLPVDV GM+S+I QIVV P+AAGLLLNRF P++CNAIRPFLP
Sbjct  243   ATAVFVTPILSLLLIGKRLPVDVKGMVSSISQIVVAPIAAGLLLNRFLPRICNAIRPFLP  302

Query  510   PLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVK  331
             PLSV VT+ CVG+PLAIN++SV+SP G++V +L+IAFH +AF++GY L+G  F +APDVK
Sbjct  303   PLSVLVTACCVGSPLAINVESVLSPFGVTVSMLIIAFHFTAFVAGYGLSGLVFHEAPDVK  362

Query  330   PLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
              +QRTLS+ETGMQSSLLALALAN+FFQD LVGVPPAISVVIMSLMGF+LVM W K K 
Sbjct  363   AIQRTLSFETGMQSSLLALALANRFFQDSLVGVPPAISVVIMSLMGFALVMVWAKRKE  420



>ref|XP_011081086.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Sesamum indicum]
Length=407

 Score =   506 bits (1303),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 284/378 (75%), Positives = 316/378 (84%), Gaps = 12/378 (3%)
 Frame = -1

Query  1278  HYPFLSLPRKSFNSSARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKE-NSFL  1102
             H+  L L    F   +R   L +S+C  +NLS    PE   N+A+E      PKE  S +
Sbjct  40    HFSGLRLRNSGFGGISR--LLLISKCGPDNLS----PEWHPNHASE-----PPKEGTSLM  88

Query  1101  TVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAF  922
             TVL+GAN+ LP VVL ST+LALVYPPSFTWFT+RYYAPALGFLMFAVGVNSSEKDFLEAF
Sbjct  89    TVLKGANSFLPQVVLASTVLALVYPPSFTWFTNRYYAPALGFLMFAVGVNSSEKDFLEAF  148

Query  921   NRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFL  742
              RP AI AGYIGQFVVKPLLGYLFGT+++  FGLPTSLAAGIMLTSCVSGAQLSNYATFL
Sbjct  149   RRPAAIFAGYIGQFVVKPLLGYLFGTVSMTIFGLPTSLAAGIMLTSCVSGAQLSNYATFL  208

Query  741   TDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLL  562
             TDP MAPLSIVMTSLSTATA  VTPFLSLLLIGK+LPVDV GM+SNI+QIVV P+A GLL
Sbjct  209   TDPQMAPLSIVMTSLSTATAVFVTPFLSLLLIGKKLPVDVKGMVSNILQIVVTPIATGLL  268

Query  561   LNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFI  382
             LNRFFP++CNAIRP LP LSVFVT+LCVGAPLAIN+++V+SPSG+SVLLLVIAFHLSAFI
Sbjct  269   LNRFFPKICNAIRPLLPLLSVFVTALCVGAPLAINVEAVMSPSGISVLLLVIAFHLSAFI  328

Query  381   SGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMS  202
             +G+TL G  F D PD K LQRTLSYETGMQSSLLALALAN+FFQDPLV +PPAIS VIMS
Sbjct  329   AGFTLTGLVFHDLPDAKALQRTLSYETGMQSSLLALALANRFFQDPLVSIPPAISTVIMS  388

Query  201   LMGFSLVMFWNKNKSTNV  148
             LMGFSLVM W + K T V
Sbjct  389   LMGFSLVMLWARRKETAV  406



>ref|XP_006385744.1| hypothetical protein POPTR_0003s11720g [Populus trichocarpa]
 gb|ERP63541.1| hypothetical protein POPTR_0003s11720g [Populus trichocarpa]
Length=423

 Score =   503 bits (1295),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 266/369 (72%), Positives = 306/369 (83%), Gaps = 1/369 (0%)
 Frame = -1

Query  1263  SLPRKSFNSSARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGA  1084
             S+P KS N    SSR  VSRC S+  SDS+ P+   NY  + S++ + KE S + +L  +
Sbjct  56    SMPLKS-NFHCGSSRFLVSRCESQKFSDSLEPDHDENYVTDLSQMVEQKEASIVDMLEQS  114

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             N++LPH+VL ST+LALV+PPSFTWFT+RYYAPALGFLMFAVGVNSSEKDFLEAFNRP AI
Sbjct  115   NSLLPHIVLASTLLALVHPPSFTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFNRPAAI  174

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
             LAGY+GQFVVKP LGYLFG I+++ FGLPT + AGIML SCVSGAQLSNYATFLTDPPMA
Sbjct  175   LAGYVGQFVVKPSLGYLFGIISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPMA  234

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
             PLSIVMTS+STATA  VTP LSLLLIGKRLPVDV GM+S+I+QIVV P+AAGLLLNR FP
Sbjct  235   PLSIVMTSMSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSIMQIVVAPIAAGLLLNRLFP  294

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
             Q+   IRPFLPPLSV VT+ CVGAPLAIN+ SV+SP G++++ L+IAFHLSAF+ GY   
Sbjct  295   QISGVIRPFLPPLSVLVTACCVGAPLAINVDSVMSPFGVTIVSLIIAFHLSAFVVGYYFT  354

Query  363   GAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSL  184
             G  F  A D+K LQRTLSYETGMQSSLLALALAN+FF+DPLV VPPAIS VIMSLMGFSL
Sbjct  355   GFVFHKASDLKALQRTLSYETGMQSSLLALALANRFFKDPLVAVPPAISTVIMSLMGFSL  414

Query  183   VMFWNKNKS  157
             VM W K K 
Sbjct  415   VMIWAKKKE  423



>ref|XP_010277422.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X1 [Nelumbo nucifera]
Length=419

 Score =   501 bits (1290),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 267/364 (73%), Positives = 312/364 (86%), Gaps = 3/364 (1%)
 Frame = -1

Query  1245  FNSSARSSRLPVSRCVSENLSDSIRPESL-SNYAAESSEIFKPKENSFLTVLRGANAILP  1069
             ++S  R S+    RCVSEN S S   + +  N +    +I    + + L +L+GAN+ILP
Sbjct  58    WSSKPRGSKASHRRCVSENFSSSFELDRVPENISGPIQKI--EGKGTVLDILKGANSILP  115

Query  1068  HVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYI  889
             HVVL ST+LAL++PPSFTWFT+RYYAPALGFLMFAVGVNSSEKDF+EAFNRP AI AGY+
Sbjct  116   HVVLASTVLALIFPPSFTWFTNRYYAPALGFLMFAVGVNSSEKDFIEAFNRPAAIFAGYV  175

Query  888   GQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIV  709
             GQF++KPLLGYLFGTI++ AF LPTSL AGIMLTSCVSGAQLSNYATFLTDPPMAPLSIV
Sbjct  176   GQFIMKPLLGYLFGTISVTAFHLPTSLGAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIV  235

Query  708   MtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNA  529
             MTSLSTATA  VTP LSLLLIGKRLPVDV GM+S+I+QIVV P+AAGLLLNRF P++C+A
Sbjct  236   MTSLSTATAVFVTPMLSLLLIGKRLPVDVRGMVSSIMQIVVAPIAAGLLLNRFLPRICDA  295

Query  528   IRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFR  349
             IRP LPPLSVFVT+LCVG+PLAINI +V+SP G+++L+L+I FHLS+F++GY L+G  F 
Sbjct  296   IRPILPPLSVFVTALCVGSPLAININAVLSPFGMTILMLIIGFHLSSFVAGYVLSGLFFH  355

Query  348   DAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWN  169
              APDVK LQRTLS+ETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM W 
Sbjct  356   RAPDVKALQRTLSFETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMLWA  415

Query  168   KNKS  157
             K ++
Sbjct  416   KKRN  419



>ref|XP_010277423.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X2 [Nelumbo nucifera]
Length=418

 Score =   501 bits (1290),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 266/363 (73%), Positives = 311/363 (86%), Gaps = 2/363 (1%)
 Frame = -1

Query  1245  FNSSARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPH  1066
             ++S  R S+    RCVSEN S S   + +    +   +I    + + L +L+GAN+ILPH
Sbjct  58    WSSKPRGSKASHRRCVSENFSSSFELDRVPENISGPIQI--EGKGTVLDILKGANSILPH  115

Query  1065  VVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIG  886
             VVL ST+LAL++PPSFTWFT+RYYAPALGFLMFAVGVNSSEKDF+EAFNRP AI AGY+G
Sbjct  116   VVLASTVLALIFPPSFTWFTNRYYAPALGFLMFAVGVNSSEKDFIEAFNRPAAIFAGYVG  175

Query  885   QFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVM  706
             QF++KPLLGYLFGTI++ AF LPTSL AGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVM
Sbjct  176   QFIMKPLLGYLFGTISVTAFHLPTSLGAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVM  235

Query  705   tslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAI  526
             TSLSTATA  VTP LSLLLIGKRLPVDV GM+S+I+QIVV P+AAGLLLNRF P++C+AI
Sbjct  236   TSLSTATAVFVTPMLSLLLIGKRLPVDVRGMVSSIMQIVVAPIAAGLLLNRFLPRICDAI  295

Query  525   RPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRD  346
             RP LPPLSVFVT+LCVG+PLAINI +V+SP G+++L+L+I FHLS+F++GY L+G  F  
Sbjct  296   RPILPPLSVFVTALCVGSPLAININAVLSPFGMTILMLIIGFHLSSFVAGYVLSGLFFHR  355

Query  345   APDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNK  166
             APDVK LQRTLS+ETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM W K
Sbjct  356   APDVKALQRTLSFETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMLWAK  415

Query  165   NKS  157
              ++
Sbjct  416   KRN  418



>ref|XP_009373344.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009373345.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=414

 Score =   501 bits (1289),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 283/403 (70%), Positives = 321/403 (80%), Gaps = 15/403 (4%)
 Frame = -1

Query  1350  QLNQGFKIHHP---SLPKPLPCINLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSD  1180
             Q+     IHHP    LPK      L F  P    P   F+ ++RS    +S   S+ LS 
Sbjct  24    QIQCRLNIHHPPQIQLPK------LSFSIPIS--PSLRFSLASRS----ISPLRSQKLSA  71

Query  1179  SIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSR  1000
             S+   S  NYA+E  +I +  + SFL VL+ +N+ LPH+ L ST+LALV+PPSFTWFT+R
Sbjct  72    SLDSGSGQNYASEPPQIPQRTKVSFLEVLKKSNSFLPHITLASTLLALVFPPSFTWFTNR  131

Query  999   YYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGL  820
             YYAPALGFLMFAVGVNSSEKDFLEAF RP AILAGY GQF+VKP+LGY+FGTIA+A FGL
Sbjct  132   YYAPALGFLMFAVGVNSSEKDFLEAFKRPAAILAGYTGQFLVKPILGYVFGTIAVAIFGL  191

Query  819   PTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGK  640
             PT + AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+A  +TP LSLLLIGK
Sbjct  192   PTPVGAGIMLVSCVSGAQLSNYATFLTDPTMAPLSIVMTSLSTASAVFITPLLSLLLIGK  251

Query  639   RLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAI  460
             RLPVDV GM+S+I+QIVV PVAAGLLLNRF P++C AIRPFLPPLSVFVT+ CVGAPLAI
Sbjct  252   RLPVDVRGMVSSIMQIVVTPVAAGLLLNRFLPRICGAIRPFLPPLSVFVTACCVGAPLAI  311

Query  459   NIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLL  280
             NI+SV+SP GL+VLLLVIAFHL+AF++GY L G  F  APDVK LQRTLSYETGMQSSLL
Sbjct  312   NIESVMSPFGLTVLLLVIAFHLTAFVAGYFLTGVVFHTAPDVKALQRTLSYETGMQSSLL  371

Query  279   ALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTN  151
             ALALAN+FFQDPLVGVPPAIS VIMSLMGFSLVM W K K   
Sbjct  372   ALALANRFFQDPLVGVPPAISTVIMSLMGFSLVMVWAKRKEEQ  414



>ref|XP_009373342.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=425

 Score =   500 bits (1288),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 283/403 (70%), Positives = 321/403 (80%), Gaps = 15/403 (4%)
 Frame = -1

Query  1350  QLNQGFKIHHP---SLPKPLPCINLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSD  1180
             Q+     IHHP    LPK      L F  P    P   F+ ++RS    +S   S+ LS 
Sbjct  35    QIQCRLNIHHPPQIQLPK------LSFSIPIS--PSLRFSLASRS----ISPLRSQKLSA  82

Query  1179  SIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSR  1000
             S+   S  NYA+E  +I +  + SFL VL+ +N+ LPH+ L ST+LALV+PPSFTWFT+R
Sbjct  83    SLDSGSGQNYASEPPQIPQRTKVSFLEVLKKSNSFLPHITLASTLLALVFPPSFTWFTNR  142

Query  999   YYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGL  820
             YYAPALGFLMFAVGVNSSEKDFLEAF RP AILAGY GQF+VKP+LGY+FGTIA+A FGL
Sbjct  143   YYAPALGFLMFAVGVNSSEKDFLEAFKRPAAILAGYTGQFLVKPILGYVFGTIAVAIFGL  202

Query  819   PTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGK  640
             PT + AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+A  +TP LSLLLIGK
Sbjct  203   PTPVGAGIMLVSCVSGAQLSNYATFLTDPTMAPLSIVMTSLSTASAVFITPLLSLLLIGK  262

Query  639   RLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAI  460
             RLPVDV GM+S+I+QIVV PVAAGLLLNRF P++C AIRPFLPPLSVFVT+ CVGAPLAI
Sbjct  263   RLPVDVRGMVSSIMQIVVTPVAAGLLLNRFLPRICGAIRPFLPPLSVFVTACCVGAPLAI  322

Query  459   NIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLL  280
             NI+SV+SP GL+VLLLVIAFHL+AF++GY L G  F  APDVK LQRTLSYETGMQSSLL
Sbjct  323   NIESVMSPFGLTVLLLVIAFHLTAFVAGYFLTGVVFHTAPDVKALQRTLSYETGMQSSLL  382

Query  279   ALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTN  151
             ALALAN+FFQDPLVGVPPAIS VIMSLMGFSLVM W K K   
Sbjct  383   ALALANRFFQDPLVGVPPAISTVIMSLMGFSLVMVWAKRKEEQ  425



>ref|XP_006477320.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic-like 
[Citrus sinensis]
Length=416

 Score =   498 bits (1282),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 266/357 (75%), Positives = 307/357 (86%), Gaps = 1/357 (0%)
 Frame = -1

Query  1227  SSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGST  1048
             SSR  V+ CVSEN+S     +   NY  ES+++   +E S + +L+ +N+ LPHVVLGST
Sbjct  61    SSRNFVTNCVSENISGPFDQDPDRNYVTESNQVLN-QEFSLVNILKQSNSFLPHVVLGST  119

Query  1047  ILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKP  868
             +LALV+PPSFTWFT+RYYAPALGFLMFAVGVNSSEKDF+EAF RP AI AGY+GQFVVKP
Sbjct  120   MLALVFPPSFTWFTARYYAPALGFLMFAVGVNSSEKDFIEAFKRPAAIFAGYVGQFVVKP  179

Query  867   LLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslsta  688
             +LGY+FGTI+++ FGLPT + AGIML SCVSGAQLSNYATFLTDPP+APLSIVMTSLSTA
Sbjct  180   ILGYIFGTISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPLAPLSIVMTSLSTA  239

Query  687   taaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPP  508
             TA  VTP LSLLLIGKRLPVDV GM+S+I+QIVVVP+AAGLLLNRFFP++CNAIRPFLPP
Sbjct  240   TAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIVVVPIAAGLLLNRFFPRICNAIRPFLPP  299

Query  507   LSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKP  328
             LSV VT+ CVGAPLAINI+SV+SP GL++LLL+I FHLSAF++GY + G AF +A DVK 
Sbjct  300   LSVLVTACCVGAPLAINIESVMSPFGLTILLLIITFHLSAFVAGYVVTGLAFAEAHDVKA  359

Query  327   LQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             LQRTLSYETGMQSSLLALALAN+FFQDPLV VPPAIS VIMSLMGF LVM W K   
Sbjct  360   LQRTLSYETGMQSSLLALALANRFFQDPLVSVPPAISTVIMSLMGFFLVMLWAKKSE  416



>ref|XP_008448926.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X1 [Cucumis melo]
Length=426

 Score =   498 bits (1281),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 325/419 (78%), Gaps = 17/419 (4%)
 Frame = -1

Query  1362  LLQPQLNQGFKIHHPSLPKPLPCI---NLEFHYPFLSLP----------RKSFNSSARSS  1222
             +L   L Q  ++H   L  P  CI   N    +P    P            SF SS  SS
Sbjct  7     ILGKNLLQIHRLHRSQLEFP-TCISSRNQSISHPLHRFPPQINGVSVRCSNSFLSSDWSS  65

Query  1221  RLPVS-RCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTI  1045
             R  +S RCV ++ S+S+R +   + ++ S EI   K+ +F+ VL+ +N++LPHVVL ST+
Sbjct  66    RFSISTRCVPDSSSESLRLDC--DSSSSSPEILNQKKTTFVDVLKQSNSLLPHVVLASTL  123

Query  1044  LALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPL  865
             LAL++PPSF WFTSRYYAPALGFLMFAVGVNSSEKDF EAF +P AI AGY+GQF VKP+
Sbjct  124   LALIFPPSFAWFTSRYYAPALGFLMFAVGVNSSEKDFFEAFKQPAAIFAGYVGQFFVKPV  183

Query  864   LGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstat  685
             LGYLFGTIA+  FGLPT++ AGIML SCVSGAQLS+YATFLTDP +APLS+VMTSLSTAT
Sbjct  184   LGYLFGTIAVTLFGLPTAIGAGIMLVSCVSGAQLSSYATFLTDPALAPLSVVMTSLSTAT  243

Query  684   aaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPL  505
             A  VTPFLSLLLIGKRLPVDV GMIS+I QIVV P+AAGLLLNRFFP++C AIRPFLPPL
Sbjct  244   AVFVTPFLSLLLIGKRLPVDVKGMISSITQIVVAPIAAGLLLNRFFPRICEAIRPFLPPL  303

Query  504   SVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPL  325
             SV VT+ CVGAP AINI +V+SP G S+LLL++AFHLSAFI+GY L G AF  + DVK L
Sbjct  304   SVLVTACCVGAPFAINIHAVISPFGFSILLLIVAFHLSAFIAGYALTGLAFHRSLDVKAL  363

Query  324   QRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV  148
             QRTLSYETGMQSSLLALALAN+FFQDPLV VPPAIS V+MSLMGFSLVM WNK K  N+
Sbjct  364   QRTLSYETGMQSSLLALALANRFFQDPLVSVPPAISTVMMSLMGFSLVMIWNKGKEKNM  422



>ref|XP_007040026.1| Sodium Bile acid symporter family isoform 1 [Theobroma cacao]
 gb|EOY24527.1| Sodium Bile acid symporter family isoform 1 [Theobroma cacao]
Length=410

 Score =   497 bits (1279),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 278/404 (69%), Positives = 318/404 (79%), Gaps = 9/404 (2%)
 Frame = -1

Query  1356  QPQLN----QGFKIHHPSLPKPLPCINLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSEN  1189
             +P+ N    Q    H P   +  P + L  H P   +P  S  S   SSRL V +C SE 
Sbjct  12    RPRFNHVYLQNISFHLPKQVR-FPVLPLNSHVP---VPVSSI-SPFGSSRLLVCKCASEK  66

Query  1188  LSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWF  1009
              S S   +    Y  +S++  K K+ S + +L+ +N+ILPHVVL ST+LALVYPPSFTWF
Sbjct  67    FSGSFERDPGQEYGLDSNQTVKQKKASIVEILKQSNSILPHVVLASTVLALVYPPSFTWF  126

Query  1008  TSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAA  829
             TSRYYAPALGFLMFAVGVNSSEKDF+EAF RP AI AGY+GQFVVKPLLGY+FG IA+  
Sbjct  127   TSRYYAPALGFLMFAVGVNSSEKDFIEAFKRPYAIFAGYVGQFVVKPLLGYIFGMIAVTV  186

Query  828   FGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLL  649
             F LPT L AGIML SCVSGAQLSNYATFLTDPP+APLSIVMTSLSTATA  VTP LSLLL
Sbjct  187   FCLPTPLGAGIMLVSCVSGAQLSNYATFLTDPPLAPLSIVMTSLSTATAVFVTPMLSLLL  246

Query  648   IGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAP  469
             IGKRLPVDV+GM+S+I+QIV+ P+AAGLLLNR FP++C AIRPFLPPLSV  T+ CVGAP
Sbjct  247   IGKRLPVDVMGMVSSILQIVIAPIAAGLLLNRLFPRLCEAIRPFLPPLSVLDTAFCVGAP  306

Query  468   LAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQS  289
             LAINI SV+SP GL+V LL++AFHLSAFI+G+ L+G  F  APDVK LQRTLS+ETGMQS
Sbjct  307   LAININSVLSPFGLTVSLLIVAFHLSAFIAGFFLSGFVFHKAPDVKALQRTLSFETGMQS  366

Query  288   SLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             SLLALALAN+FFQDPLVGVPPAIS VIMSLMGFSLVM W K K 
Sbjct  367   SLLALALANRFFQDPLVGVPPAISTVIMSLMGFSLVMLWAKKKE  410



>gb|KDO63707.1| hypothetical protein CISIN_1g0148931mg, partial [Citrus sinensis]
Length=372

 Score =   494 bits (1272),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 265/357 (74%), Positives = 306/357 (86%), Gaps = 1/357 (0%)
 Frame = -1

Query  1227  SSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGST  1048
             SSR  V+  VSEN+S     +   NY  ES+++   +E S + +L+ +N+ LPHVVLGST
Sbjct  17    SSRNFVTNSVSENISGPFDQDPDRNYVTESNQVLN-QEFSLVNILKQSNSFLPHVVLGST  75

Query  1047  ILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKP  868
             +LALV+PPSFTWFT+RYYAPALGFLMFAVGVNSSEKDF+EAF RP AI AGY+GQFVVKP
Sbjct  76    MLALVFPPSFTWFTARYYAPALGFLMFAVGVNSSEKDFIEAFKRPAAIFAGYVGQFVVKP  135

Query  867   LLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslsta  688
             +LGY+FGTI+++ FGLPT + AGIML SCVSGAQLSNYATFLTDPP+APLSIVMTSLSTA
Sbjct  136   ILGYIFGTISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPLAPLSIVMTSLSTA  195

Query  687   taaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPP  508
             TA  VTP LSLLLIGKRLPVDV GM+S+I+QIVVVP+AAGLLLNRFFP++CNAIRPFLPP
Sbjct  196   TAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIVVVPIAAGLLLNRFFPRICNAIRPFLPP  255

Query  507   LSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKP  328
             LSV VT+ CVGAPLAINI+SV+SP GL++LLL+I FHLSAF++GY + G AF +A DVK 
Sbjct  256   LSVLVTACCVGAPLAINIESVMSPFGLTILLLIITFHLSAFVAGYVVTGLAFAEAHDVKA  315

Query  327   LQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             LQRTLSYETGMQSSLLALALAN+FFQDPLV VPPAIS VIMSLMGF LVM W K   
Sbjct  316   LQRTLSYETGMQSSLLALALANRFFQDPLVSVPPAISTVIMSLMGFFLVMLWAKKSE  372



>gb|KGN55930.1| hypothetical protein Csa_3G036560 [Cucumis sativus]
Length=426

 Score =   495 bits (1275),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 266/369 (72%), Positives = 314/369 (85%), Gaps = 3/369 (1%)
 Frame = -1

Query  1251  KSFNSSARSSRLPVS-RCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAI  1075
              +F  S  S R  +S RCV ++ S+S+R +   + ++ S EI   K+ +F+ +L+ +N++
Sbjct  56    NTFLYSDWSLRFSISTRCVPDSSSESLRLDC--DSSSSSPEIIDQKKTTFVEILKQSNSL  113

Query  1074  LPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAG  895
             LPHVVL ST++AL++PPSF WFTSRYYAPALGFLMFAVGVNSSEKDFLEAF +P AI AG
Sbjct  114   LPHVVLASTLVALIFPPSFAWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFKQPAAIFAG  173

Query  894   YIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLS  715
             Y+GQF VKPLLGYLFGTIA+  FGLPT++ AGIML SCVSGAQLS+YATFLTDP +APLS
Sbjct  174   YVGQFFVKPLLGYLFGTIAVTLFGLPTAIGAGIMLVSCVSGAQLSSYATFLTDPSLAPLS  233

Query  714   IVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVC  535
             +VMTSLSTATA +VTPFLSLLLIGKRLPVDV GMIS+I QIVV P+AAGLLLNRFFP++C
Sbjct  234   VVMTSLSTATAVVVTPFLSLLLIGKRLPVDVKGMISSITQIVVAPIAAGLLLNRFFPRIC  293

Query  534   NAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAA  355
              AIRPFLPPLSV VT+ CVGAPLAINI +V+SP GLS+LLL++AFHLSAFI+GY+L G A
Sbjct  294   EAIRPFLPPLSVLVTACCVGAPLAININAVISPFGLSILLLIVAFHLSAFIAGYSLTGLA  353

Query  354   FRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMF  175
             F  +PDVK LQRTLSYETGMQSSLLALALAN+FFQDPLV VPPAIS V+MSLMGFSLVM 
Sbjct  354   FHGSPDVKALQRTLSYETGMQSSLLALALANRFFQDPLVSVPPAISTVMMSLMGFSLVMI  413

Query  174   WNKNKSTNV  148
             W+K K  N+
Sbjct  414   WSKRKEKNM  422



>ref|XP_008448927.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X2 [Cucumis melo]
Length=423

 Score =   495 bits (1274),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 276/416 (66%), Positives = 324/416 (78%), Gaps = 14/416 (3%)
 Frame = -1

Query  1362  LLQPQLNQGFKIHHPSLPKPLPCI---NLEFHYPFLSLP-------RKSFNSSARSSRLP  1213
             +L   L Q  ++H   L  P  CI   N    +P    P        +  NS   SSR  
Sbjct  7     ILGKNLLQIHRLHRSQLEFP-TCISSRNQSISHPLHRFPPQINGVSVRCSNSFHWSSRFS  65

Query  1212  VS-RCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILAL  1036
             +S RCV ++ S+S+R +   + ++ S EI   K+ +F+ VL+ +N++LPHVVL ST+LAL
Sbjct  66    ISTRCVPDSSSESLRLDC--DSSSSSPEILNQKKTTFVDVLKQSNSLLPHVVLASTLLAL  123

Query  1035  VYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGY  856
             ++PPSF WFTSRYYAPALGFLMFAVGVNSSEKDF EAF +P AI AGY+GQF VKP+LGY
Sbjct  124   IFPPSFAWFTSRYYAPALGFLMFAVGVNSSEKDFFEAFKQPAAIFAGYVGQFFVKPVLGY  183

Query  855   LFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaL  676
             LFGTIA+  FGLPT++ AGIML SCVSGAQLS+YATFLTDP +APLS+VMTSLSTATA  
Sbjct  184   LFGTIAVTLFGLPTAIGAGIMLVSCVSGAQLSSYATFLTDPALAPLSVVMTSLSTATAVF  243

Query  675   VTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVF  496
             VTPFLSLLLIGKRLPVDV GMIS+I QIVV P+AAGLLLNRFFP++C AIRPFLPPLSV 
Sbjct  244   VTPFLSLLLIGKRLPVDVKGMISSITQIVVAPIAAGLLLNRFFPRICEAIRPFLPPLSVL  303

Query  495   VTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRT  316
             VT+ CVGAP AINI +V+SP G S+LLL++AFHLSAFI+GY L G AF  + DVK LQRT
Sbjct  304   VTACCVGAPFAINIHAVISPFGFSILLLIVAFHLSAFIAGYALTGLAFHRSLDVKALQRT  363

Query  315   LSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV  148
             LSYETGMQSSLLALALAN+FFQDPLV VPPAIS V+MSLMGFSLVM WNK K  N+
Sbjct  364   LSYETGMQSSLLALALANRFFQDPLVSVPPAISTVMMSLMGFSLVMIWNKGKEKNM  419



>ref|XP_006440451.1| hypothetical protein CICLE_v10020346mg [Citrus clementina]
 gb|ESR53691.1| hypothetical protein CICLE_v10020346mg [Citrus clementina]
Length=416

 Score =   494 bits (1272),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 265/357 (74%), Positives = 306/357 (86%), Gaps = 1/357 (0%)
 Frame = -1

Query  1227  SSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGST  1048
             SSR  V+  VSEN+S     +   NY  ES+++   +E S + +L+ +N+ LPHVVLGST
Sbjct  61    SSRNFVTNSVSENISGPFDQDPDRNYVTESNQVLN-QEFSLVNILKQSNSFLPHVVLGST  119

Query  1047  ILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKP  868
             +LALV+PPSFTWFT+RYYAPALGFLMFAVGVNSSEKDF+EAF RP AI AGY+GQFVVKP
Sbjct  120   MLALVFPPSFTWFTARYYAPALGFLMFAVGVNSSEKDFIEAFKRPAAIFAGYVGQFVVKP  179

Query  867   LLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslsta  688
             +LGY+FGTI+++ FGLPT + AGIML SCVSGAQLSNYATFLTDPP+APLSIVMTSLSTA
Sbjct  180   ILGYIFGTISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPLAPLSIVMTSLSTA  239

Query  687   taaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPP  508
             TA  VTP LSLLLIGKRLPVDV GM+S+I+QIVVVP+AAGLLLNRFFP++CNAIRPFLPP
Sbjct  240   TAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIVVVPIAAGLLLNRFFPRICNAIRPFLPP  299

Query  507   LSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKP  328
             LSV VT+ CVGAPLAINI+SV+SP GL++LLL+I FHLSAF++GY + G AF +A DVK 
Sbjct  300   LSVLVTACCVGAPLAINIESVMSPFGLTILLLIITFHLSAFVAGYVVTGLAFAEAHDVKA  359

Query  327   LQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             LQRTLSYETGMQSSLLALALAN+FFQDPLV VPPAIS VIMSLMGF LVM W K   
Sbjct  360   LQRTLSYETGMQSSLLALALANRFFQDPLVSVPPAISTVIMSLMGFFLVMLWAKKSE  416



>gb|KDP25572.1| hypothetical protein JCGZ_20728 [Jatropha curcas]
Length=423

 Score =   493 bits (1270),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 260/360 (72%), Positives = 300/360 (83%), Gaps = 1/360 (0%)
 Frame = -1

Query  1233  ARSSRLPVSRCVSENLSDSIRPESLS-NYAAESSEIFKPKENSFLTVLRGANAILPHVVL  1057
             +R+SR  VS+C SE  SD    +    N+A E +++ K KE S + +L+ +N++LPHVVL
Sbjct  63    SRNSRFLVSKCSSEKFSDPFEEQDQGPNFATEQNKVLKQKEFSIVNILQQSNSLLPHVVL  122

Query  1056  GSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFV  877
              ST+LALVYPPSFTWFT+RYYAPALGFLMFAVGVNSSEKDF+EAF RP AILAGYIGQFV
Sbjct  123   ASTLLALVYPPSFTWFTTRYYAPALGFLMFAVGVNSSEKDFVEAFKRPAAILAGYIGQFV  182

Query  876   VKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtsl  697
             VKP+LGY FG I+++ FGLPT + AGIML SCVSGAQLSNYATFLTDPPMAPLSIVMTSL
Sbjct  183   VKPILGYFFGIISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPMAPLSIVMTSL  242

Query  696   stataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPF  517
             STATA  VTP LSLLLIGKRLPVDV GMIS+I+QIVV P+AAGLLLNRFFP + NAIRPF
Sbjct  243   STATAVFVTPLLSLLLIGKRLPVDVKGMISSILQIVVAPIAAGLLLNRFFPWISNAIRPF  302

Query  516   LPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPD  337
             LPPLSV VT+ CVGAPLAIN++SV+S  G ++L L++ FHL AF+ GY LAG  F   PD
Sbjct  303   LPPLSVLVTACCVGAPLAINVESVMSSFGATILSLIVLFHLLAFVLGYVLAGLVFPKEPD  362

Query  336   VKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             +K LQRT+S+ETGMQSSLLALALAN+FFQDPLV VPPAIS V+MSLMGF LVM W K K 
Sbjct  363   LKALQRTMSFETGMQSSLLALALANRFFQDPLVAVPPAISTVMMSLMGFFLVMVWTKRKE  422



>ref|XP_008356518.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X2 [Malus domestica]
Length=429

 Score =   493 bits (1269),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 280/403 (69%), Positives = 316/403 (78%), Gaps = 15/403 (4%)
 Frame = -1

Query  1350  QLNQGFKIHHP---SLPKPLPCINLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSD  1180
             Q+ +   IH+P    LPK      L F  P    P   F+  +RS    +S   S  LS 
Sbjct  39    QIQRRLNIHNPPQIQLPK------LSFSIPIS--PSLRFSLXSRS----ISPLRSHKLSA  86

Query  1179  SIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSR  1000
             S    S  NYA+E  +I +  + SFL VL+ +N+ LPHV L ST+LALV+PPSFTWFT+R
Sbjct  87    SFDSGSGQNYASEPPQIPQQNKVSFLEVLKKSNSFLPHVTLASTLLALVFPPSFTWFTNR  146

Query  999   YYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGL  820
             YYAP LGFLMFAVGVNSSEKDFLEAF RP AILAGY GQF+VKP+LGY+FGTI +A FGL
Sbjct  147   YYAPXLGFLMFAVGVNSSEKDFLEAFKRPAAILAGYTGQFLVKPILGYVFGTIXVAIFGL  206

Query  819   PTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGK  640
             PT + AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+A  +TP LSLLLIGK
Sbjct  207   PTPVGAGIMLVSCVSGAQLSNYATFLTDPTMAPLSIVMTSLSTASAVFITPLLSLLLIGK  266

Query  639   RLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAI  460
             RLPVDV GM+S+I+QIVV PVAAGLLLNRF P++C AIRPFLPPLSVFVT+ CVGAPLAI
Sbjct  267   RLPVDVRGMVSSILQIVVTPVAAGLLLNRFLPRICGAIRPFLPPLSVFVTACCVGAPLAI  326

Query  459   NIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLL  280
             NI+SV+SP GL+VLLLVIAFH +AF++GY L G  F  APDVK LQRTLSYETGMQSSLL
Sbjct  327   NIESVMSPFGLTVLLLVIAFHXTAFVAGYFLTGVVFHTAPDVKALQRTLSYETGMQSSLL  386

Query  279   ALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTN  151
             ALALAN+FFQDPLVGVPPAIS VIMSLMGFSLVM W K K   
Sbjct  387   ALALANRFFQDPLVGVPPAISTVIMSLMGFSLVMVWAKKKEEQ  429



>ref|XP_008373870.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X2 [Malus domestica]
Length=429

 Score =   493 bits (1268),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 280/403 (69%), Positives = 316/403 (78%), Gaps = 15/403 (4%)
 Frame = -1

Query  1350  QLNQGFKIHHP---SLPKPLPCINLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSD  1180
             Q+ +   IH+P    LPK      L F  P    P   F+  +RS    +S   S  LS 
Sbjct  39    QIQRRLNIHNPPQIQLPK------LXFSIPIS--PSLRFSLXSRS----ISPLRSHKLSA  86

Query  1179  SIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSR  1000
             S    S  NYA+E  +I +  + SFL VL+ +N+ LPHV L ST+LALV+PPSFTWFT+R
Sbjct  87    SFDSGSGQNYASEPPQIPQQNKVSFLEVLKKSNSFLPHVTLASTLLALVFPPSFTWFTNR  146

Query  999   YYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGL  820
             YYAP LGFLMFAVGVNSSEKDFLEAF RP AILAGY GQF+VKP+LGY+FGTI +A FGL
Sbjct  147   YYAPXLGFLMFAVGVNSSEKDFLEAFKRPAAILAGYTGQFLVKPILGYVFGTIXVAIFGL  206

Query  819   PTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGK  640
             PT + AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+A  +TP LSLLLIGK
Sbjct  207   PTPVGAGIMLVSCVSGAQLSNYATFLTDPTMAPLSIVMTSLSTASAVFITPLLSLLLIGK  266

Query  639   RLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAI  460
             RLPVDV GM+S+I+QIVV PVAAGLLLNRF P++C AIRPFLPPLSVFVT+ CVGAPLAI
Sbjct  267   RLPVDVRGMVSSILQIVVTPVAAGLLLNRFLPRICGAIRPFLPPLSVFVTACCVGAPLAI  326

Query  459   NIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLL  280
             NI+SV+SP GL+VLLLVIAFH +AF++GY L G  F  APDVK LQRTLSYETGMQSSLL
Sbjct  327   NIESVMSPFGLTVLLLVIAFHXTAFVAGYFLTGVVFHTAPDVKALQRTLSYETGMQSSLL  386

Query  279   ALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTN  151
             ALALAN+FFQDPLVGVPPAIS VIMSLMGFSLVM W K K   
Sbjct  387   ALALANRFFQDPLVGVPPAISTVIMSLMGFSLVMVWAKKKEEQ  429



>ref|XP_008356517.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X1 [Malus domestica]
Length=435

 Score =   493 bits (1268),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 280/403 (69%), Positives = 316/403 (78%), Gaps = 15/403 (4%)
 Frame = -1

Query  1350  QLNQGFKIHHP---SLPKPLPCINLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSD  1180
             Q+ +   IH+P    LPK      L F  P    P   F+  +RS    +S   S  LS 
Sbjct  45    QIQRRLNIHNPPQIQLPK------LSFSIPIS--PSLRFSLXSRS----ISPLRSHKLSA  92

Query  1179  SIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSR  1000
             S    S  NYA+E  +I +  + SFL VL+ +N+ LPHV L ST+LALV+PPSFTWFT+R
Sbjct  93    SFDSGSGQNYASEPPQIPQQNKVSFLEVLKKSNSFLPHVTLASTLLALVFPPSFTWFTNR  152

Query  999   YYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGL  820
             YYAP LGFLMFAVGVNSSEKDFLEAF RP AILAGY GQF+VKP+LGY+FGTI +A FGL
Sbjct  153   YYAPXLGFLMFAVGVNSSEKDFLEAFKRPAAILAGYTGQFLVKPILGYVFGTIXVAIFGL  212

Query  819   PTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGK  640
             PT + AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+A  +TP LSLLLIGK
Sbjct  213   PTPVGAGIMLVSCVSGAQLSNYATFLTDPTMAPLSIVMTSLSTASAVFITPLLSLLLIGK  272

Query  639   RLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAI  460
             RLPVDV GM+S+I+QIVV PVAAGLLLNRF P++C AIRPFLPPLSVFVT+ CVGAPLAI
Sbjct  273   RLPVDVRGMVSSILQIVVTPVAAGLLLNRFLPRICGAIRPFLPPLSVFVTACCVGAPLAI  332

Query  459   NIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLL  280
             NI+SV+SP GL+VLLLVIAFH +AF++GY L G  F  APDVK LQRTLSYETGMQSSLL
Sbjct  333   NIESVMSPFGLTVLLLVIAFHXTAFVAGYFLTGVVFHTAPDVKALQRTLSYETGMQSSLL  392

Query  279   ALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTN  151
             ALALAN+FFQDPLVGVPPAIS VIMSLMGFSLVM W K K   
Sbjct  393   ALALANRFFQDPLVGVPPAISTVIMSLMGFSLVMVWAKKKEEQ  435



>ref|XP_008356519.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X3 [Malus domestica]
Length=424

 Score =   492 bits (1267),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 280/403 (69%), Positives = 316/403 (78%), Gaps = 15/403 (4%)
 Frame = -1

Query  1350  QLNQGFKIHHP---SLPKPLPCINLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSD  1180
             Q+ +   IH+P    LPK      L F  P    P   F+  +RS    +S   S  LS 
Sbjct  34    QIQRRLNIHNPPQIQLPK------LSFSIPIS--PSLRFSLXSRS----ISPLRSHKLSA  81

Query  1179  SIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSR  1000
             S    S  NYA+E  +I +  + SFL VL+ +N+ LPHV L ST+LALV+PPSFTWFT+R
Sbjct  82    SFDSGSGQNYASEPPQIPQQNKVSFLEVLKKSNSFLPHVTLASTLLALVFPPSFTWFTNR  141

Query  999   YYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGL  820
             YYAP LGFLMFAVGVNSSEKDFLEAF RP AILAGY GQF+VKP+LGY+FGTI +A FGL
Sbjct  142   YYAPXLGFLMFAVGVNSSEKDFLEAFKRPAAILAGYTGQFLVKPILGYVFGTIXVAIFGL  201

Query  819   PTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGK  640
             PT + AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+A  +TP LSLLLIGK
Sbjct  202   PTPVGAGIMLVSCVSGAQLSNYATFLTDPTMAPLSIVMTSLSTASAVFITPLLSLLLIGK  261

Query  639   RLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAI  460
             RLPVDV GM+S+I+QIVV PVAAGLLLNRF P++C AIRPFLPPLSVFVT+ CVGAPLAI
Sbjct  262   RLPVDVRGMVSSILQIVVTPVAAGLLLNRFLPRICGAIRPFLPPLSVFVTACCVGAPLAI  321

Query  459   NIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLL  280
             NI+SV+SP GL+VLLLVIAFH +AF++GY L G  F  APDVK LQRTLSYETGMQSSLL
Sbjct  322   NIESVMSPFGLTVLLLVIAFHXTAFVAGYFLTGVVFHTAPDVKALQRTLSYETGMQSSLL  381

Query  279   ALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTN  151
             ALALAN+FFQDPLVGVPPAIS VIMSLMGFSLVM W K K   
Sbjct  382   ALALANRFFQDPLVGVPPAISTVIMSLMGFSLVMVWAKKKEEQ  424



>ref|XP_008373871.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X3 [Malus domestica]
Length=424

 Score =   492 bits (1267),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 280/403 (69%), Positives = 316/403 (78%), Gaps = 15/403 (4%)
 Frame = -1

Query  1350  QLNQGFKIHHP---SLPKPLPCINLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSD  1180
             Q+ +   IH+P    LPK      L F  P    P   F+  +RS    +S   S  LS 
Sbjct  34    QIQRRLNIHNPPQIQLPK------LXFSIPIS--PSLRFSLXSRS----ISPLRSHKLSA  81

Query  1179  SIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSR  1000
             S    S  NYA+E  +I +  + SFL VL+ +N+ LPHV L ST+LALV+PPSFTWFT+R
Sbjct  82    SFDSGSGQNYASEPPQIPQQNKVSFLEVLKKSNSFLPHVTLASTLLALVFPPSFTWFTNR  141

Query  999   YYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGL  820
             YYAP LGFLMFAVGVNSSEKDFLEAF RP AILAGY GQF+VKP+LGY+FGTI +A FGL
Sbjct  142   YYAPXLGFLMFAVGVNSSEKDFLEAFKRPAAILAGYTGQFLVKPILGYVFGTIXVAIFGL  201

Query  819   PTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGK  640
             PT + AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+A  +TP LSLLLIGK
Sbjct  202   PTPVGAGIMLVSCVSGAQLSNYATFLTDPTMAPLSIVMTSLSTASAVFITPLLSLLLIGK  261

Query  639   RLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAI  460
             RLPVDV GM+S+I+QIVV PVAAGLLLNRF P++C AIRPFLPPLSVFVT+ CVGAPLAI
Sbjct  262   RLPVDVRGMVSSILQIVVTPVAAGLLLNRFLPRICGAIRPFLPPLSVFVTACCVGAPLAI  321

Query  459   NIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLL  280
             NI+SV+SP GL+VLLLVIAFH +AF++GY L G  F  APDVK LQRTLSYETGMQSSLL
Sbjct  322   NIESVMSPFGLTVLLLVIAFHXTAFVAGYFLTGVVFHTAPDVKALQRTLSYETGMQSSLL  381

Query  279   ALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTN  151
             ALALAN+FFQDPLVGVPPAIS VIMSLMGFSLVM W K K   
Sbjct  382   ALALANRFFQDPLVGVPPAISTVIMSLMGFSLVMVWAKKKEEQ  424



>ref|XP_008373869.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X1 [Malus domestica]
Length=435

 Score =   492 bits (1267),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 280/403 (69%), Positives = 316/403 (78%), Gaps = 15/403 (4%)
 Frame = -1

Query  1350  QLNQGFKIHHP---SLPKPLPCINLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSD  1180
             Q+ +   IH+P    LPK      L F  P    P   F+  +RS    +S   S  LS 
Sbjct  45    QIQRRLNIHNPPQIQLPK------LXFSIPIS--PSLRFSLXSRS----ISPLRSHKLSA  92

Query  1179  SIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSR  1000
             S    S  NYA+E  +I +  + SFL VL+ +N+ LPHV L ST+LALV+PPSFTWFT+R
Sbjct  93    SFDSGSGQNYASEPPQIPQQNKVSFLEVLKKSNSFLPHVTLASTLLALVFPPSFTWFTNR  152

Query  999   YYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGL  820
             YYAP LGFLMFAVGVNSSEKDFLEAF RP AILAGY GQF+VKP+LGY+FGTI +A FGL
Sbjct  153   YYAPXLGFLMFAVGVNSSEKDFLEAFKRPAAILAGYTGQFLVKPILGYVFGTIXVAIFGL  212

Query  819   PTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGK  640
             PT + AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+A  +TP LSLLLIGK
Sbjct  213   PTPVGAGIMLVSCVSGAQLSNYATFLTDPTMAPLSIVMTSLSTASAVFITPLLSLLLIGK  272

Query  639   RLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAI  460
             RLPVDV GM+S+I+QIVV PVAAGLLLNRF P++C AIRPFLPPLSVFVT+ CVGAPLAI
Sbjct  273   RLPVDVRGMVSSILQIVVTPVAAGLLLNRFLPRICGAIRPFLPPLSVFVTACCVGAPLAI  332

Query  459   NIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLL  280
             NI+SV+SP GL+VLLLVIAFH +AF++GY L G  F  APDVK LQRTLSYETGMQSSLL
Sbjct  333   NIESVMSPFGLTVLLLVIAFHXTAFVAGYFLTGVVFHTAPDVKALQRTLSYETGMQSSLL  392

Query  279   ALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTN  151
             ALALAN+FFQDPLVGVPPAIS VIMSLMGFSLVM W K K   
Sbjct  393   ALALANRFFQDPLVGVPPAISTVIMSLMGFSLVMVWAKKKEEQ  435



>ref|XP_004300727.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=409

 Score =   491 bits (1264),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 279/403 (69%), Positives = 322/403 (80%), Gaps = 17/403 (4%)
 Frame = -1

Query  1326  HHPSLPKPLPCINL-EFHY----------PFLSLPR-KSFNSSARSSRL-PVSRCVSENL  1186
             HH  +P+P    NL  FH+           + ++P   S   S RS  + P+ RC S   
Sbjct  11    HHFRIPRP----NLSRFHHRLPNPPPPNLTYSAVPHSHSLRLSLRSYSISPICRCASVTS  66

Query  1185  SDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFT  1006
             SDS   +S  NYA++  +I +    +FL +L+ +++ LP V + ST+LALV+PPSFTWFT
Sbjct  67    SDSFDSDSDQNYASQPPQIPQRNNVAFLELLKKSSSFLPQVTIASTLLALVFPPSFTWFT  126

Query  1005  SRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAF  826
             +RYYAPALGFLMFAVGVNSSEKDFLEAF RP AI AGY+GQFVVKPLLGY+FG I++A F
Sbjct  127   NRYYAPALGFLMFAVGVNSSEKDFLEAFKRPAAIFAGYVGQFVVKPLLGYIFGIISVAMF  186

Query  825   GLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLI  646
             GLPT++ AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTSLSTATA  VTPFLSL+LI
Sbjct  187   GLPTTVGAGIMLVSCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTATAVFVTPFLSLMLI  246

Query  645   GKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPL  466
             GKRLPVDV GM+S+I+QIVV P+ AGLLLNRF PQVCNAIRPFLPPLSV VT+ CVGAPL
Sbjct  247   GKRLPVDVKGMVSSILQIVVTPIVAGLLLNRFLPQVCNAIRPFLPPLSVLVTACCVGAPL  306

Query  465   AINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSS  286
             AINI+SV+SP GL++LLLVIAFH +AFI+GY L G AF  APDVKPLQRTLSYETGMQSS
Sbjct  307   AINIESVLSPFGLTILLLVIAFHFTAFIAGYFLTGMAFHGAPDVKPLQRTLSYETGMQSS  366

Query  285   LLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             LLALALAN+FFQDPLVGVPPAIS V+MSLMGFSLVM W K K 
Sbjct  367   LLALALANRFFQDPLVGVPPAISTVMMSLMGFSLVMVWTKRKE  409



>ref|XP_008238677.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
[Prunus mume]
Length=405

 Score =   488 bits (1255),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 282/404 (70%), Positives = 324/404 (80%), Gaps = 3/404 (1%)
 Frame = -1

Query  1362  LLQPQLNQGFKIHHPSLPK--PLPCINLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSEN  1189
             L  P  NQ  +IH  +L     +   NL F+ P +S  R +  S + S  L + +CVSE 
Sbjct  3     LHAPVNNQQSQIHRLNLHHRTQIQLRNLYFNIP-ISQSRGTLRSRSISHPLLLRKCVSEK  61

Query  1188  LSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWF  1009
             +S S   +S  NYA+E  EI +    SF+ VL+ +N+ LPHV L ST+LALV+PPSFTWF
Sbjct  62    ISGSFDSDSGRNYASEPPEIPQQNNVSFVEVLKKSNSFLPHVTLASTLLALVFPPSFTWF  121

Query  1008  TSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAA  829
             T+RYYAPALGFLMFAVGVNSSEKDFLEAF RP AILAGYIGQF+VKPLLGY+FG I++A 
Sbjct  122   TNRYYAPALGFLMFAVGVNSSEKDFLEAFKRPTAILAGYIGQFLVKPLLGYIFGIISVAI  181

Query  828   FGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLL  649
             FGLPT + AGIML SCVSGAQLSNYATFLTDPPMAPLSIVMTSLSTATA  +TP LSLLL
Sbjct  182   FGLPTPVGAGIMLVSCVSGAQLSNYATFLTDPPMAPLSIVMTSLSTATAVFITPLLSLLL  241

Query  648   IGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAP  469
             IGKRLPVDV GM+S+I+QIVV PVAAGLLLNRFFP++C+AIRPFLPPLSV VT+ CVGAP
Sbjct  242   IGKRLPVDVKGMVSSILQIVVTPVAAGLLLNRFFPRICDAIRPFLPPLSVLVTACCVGAP  301

Query  468   LAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQS  289
             LAINI+SV+SP GL++LLL+IAFH +AF++GY L G  F   PDVK LQRTLSYETG  S
Sbjct  302   LAINIESVMSPFGLTILLLIIAFHSTAFVAGYFLTGMVFHKTPDVKALQRTLSYETGSSS  361

Query  288   SLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             SLLALALAN+FFQDPLVGVPPAIS VIMSLMGFSLVM W K K 
Sbjct  362   SLLALALANRFFQDPLVGVPPAISTVIMSLMGFSLVMVWAKRKE  405



>gb|EYU39046.1| hypothetical protein MIMGU_mgv1a007118mg [Erythranthe guttata]
Length=418

 Score =   488 bits (1256),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 269/379 (71%), Positives = 308/379 (81%), Gaps = 9/379 (2%)
 Frame = -1

Query  1278  HYPFLSLPRKSFN--SSARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSF  1105
             H+  L L    F   S   S  L + +C  +NL     P     +  ES +I   +E SF
Sbjct  47    HFSGLRLSCSPFRLGSGGFSRLLCIGKCAPDNL-----PPDYPTHGTESPKI--KEEVSF  99

Query  1104  LTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEA  925
               +L+GAN+ LP VV+ ST+LAL+YPPSFTWFT+RYYAPALGFLMFAVGVNSSEKDFLEA
Sbjct  100   TNILKGANSFLPQVVIASTVLALIYPPSFTWFTNRYYAPALGFLMFAVGVNSSEKDFLEA  159

Query  924   FNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATF  745
             FNRP AI AGY+GQFVVKPLLG++FGTI++  FGLPT LAAGIMLTSCVSGAQLSNYATF
Sbjct  160   FNRPSAIFAGYVGQFVVKPLLGFIFGTISMTIFGLPTPLAAGIMLTSCVSGAQLSNYATF  219

Query  744   LTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGL  565
             LTDP MAPLSIVMTSLSTATA  VTPFLSLLLIGKRLPVDV GM+SNI+QIVV P+A GL
Sbjct  220   LTDPQMAPLSIVMTSLSTATAVFVTPFLSLLLIGKRLPVDVKGMVSNILQIVVTPIATGL  279

Query  564   LLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAF  385
              LNRFFP++C+AIR  LP LSVFVT+LCVGAPLAIN+ S++S SG+SVL++VIAFHLSAF
Sbjct  280   FLNRFFPKICDAIRVILPLLSVFVTALCVGAPLAINVGSLMSVSGISVLVVVIAFHLSAF  339

Query  384   ISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIM  205
             I+G++L G  FRD+PDVK LQRTLSYETGMQSSLLALALAN+FFQDPLV + PAIS VIM
Sbjct  340   IAGFSLTGLVFRDSPDVKALQRTLSYETGMQSSLLALALANRFFQDPLVSIAPAISTVIM  399

Query  204   SLMGFSLVMFWNKNKSTNV  148
             SLMGFSLVM W   K + V
Sbjct  400   SLMGFSLVMLWAPTKKSAV  418



>ref|XP_010908919.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Elaeis guineensis]
Length=416

 Score =   483 bits (1244),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 259/400 (65%), Positives = 318/400 (80%), Gaps = 13/400 (3%)
 Frame = -1

Query  1326  HHPS---LPKPLPCINLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSDSIRPESLS  1156
             H PS   + +   C ++ FH         S    ++ SR+ V+RC+S   +DS  P+   
Sbjct  19    HRPSALLIHRRSGCCSVPFH------AASSTVMWSKGSRVLVTRCISAKTTDSFEPDRTR  72

Query  1155  NYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGF  976
               A   ++  + K+   L +LRGAN+I+PHVVL ST+LALVYPPSFTWFT+RYYAPALGF
Sbjct  73    EDAFVLAQEVERKDIDVLKILRGANSIIPHVVLASTVLALVYPPSFTWFTNRYYAPALGF  132

Query  975   LMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGI  796
             LMFAVGVNSS KDF+EA  RP  I  GY+GQF++KPLLGY+FGTI+++ F LPTSL AGI
Sbjct  133   LMFAVGVNSSPKDFIEAIKRPDVIAVGYVGQFIIKPLLGYIFGTISVSTFDLPTSLGAGI  192

Query  795   MLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIG  616
             ML SCVSGAQLSNYATFLTDPPMAPLSIVMTSLSTATA  VTP LSLLLIGK+LPVDV G
Sbjct  193   MLVSCVSGAQLSNYATFLTDPPMAPLSIVMTSLSTATAVFVTPMLSLLLIGKKLPVDVKG  252

Query  615   MISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsp  436
             M+S+I+QIVV P+AAGLLLNRFFP+ C+AI+PFLPPLSVFVT+LCVG+PLA+NI +++SP
Sbjct  253   MMSSIMQIVVAPIAAGLLLNRFFPRFCSAIQPFLPPLSVFVTALCVGSPLAMNIGAIISP  312

Query  435   sglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKF  256
              G++++LL+  FH ++F+SGY+L G  F+ + DVK LQRT+S+ETGMQSSLLALALANKF
Sbjct  313   FGIAIVLLIFGFHAASFMSGYSLTGMVFQKSADVKALQRTISFETGMQSSLLALALANKF  372

Query  255   FQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV*QLH  136
             FQDPLVGVP AISVV+MSLMGF+LVM W+K K     Q+H
Sbjct  373   FQDPLVGVPAAISVVLMSLMGFALVMIWSKRKQ----QMH  408



>ref|XP_002509642.1| sodium-bile acid cotransporter, putative [Ricinus communis]
 gb|EEF51029.1| sodium-bile acid cotransporter, putative [Ricinus communis]
Length=413

 Score =   481 bits (1239),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 252/357 (71%), Positives = 300/357 (84%), Gaps = 0/357 (0%)
 Frame = -1

Query  1227  SSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGST  1048
             S++   S C+SE LSDS   +   N   + ++IF+ +E S + +L+ +N++LPHVVL ST
Sbjct  56    STKTQFSICLSEKLSDSFDQDPSLNIVNKHNKIFEQEEFSLINILKKSNSLLPHVVLAST  115

Query  1047  ILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKP  868
             +LALVYPPSFTWFT+RYYAPALGFLMFAVGVNSSEKDF+EAF RP AI AGY+GQF+VKP
Sbjct  116   LLALVYPPSFTWFTTRYYAPALGFLMFAVGVNSSEKDFVEAFKRPSAIFAGYLGQFIVKP  175

Query  867   LLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslsta  688
             +LGY+FG I+++ F LPT + AGIML SCVSGAQLSNYATFLTDPPMAPLSIVMTSLSTA
Sbjct  176   ILGYIFGIISVSVFNLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPMAPLSIVMTSLSTA  235

Query  687   taaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPP  508
             TA  VTP LSLLLIGKRLPVDV GM+S+I+QIVV P+AAGLLLNRF P + NAIRPFLPP
Sbjct  236   TAVFVTPLLSLLLIGKRLPVDVTGMVSSILQIVVAPIAAGLLLNRFLPWISNAIRPFLPP  295

Query  507   LSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKP  328
             LSV VT+ CVGAPLAIN++SV+SP G ++L L+I+FHL AF++GY L G  F  APD+K 
Sbjct  296   LSVLVTACCVGAPLAINVKSVISPFGATILSLIISFHLLAFVAGYVLTGLVFPKAPDLKA  355

Query  327   LQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             LQRT+S+ETGMQSSLLALALAN+FF+DPLV VPPAIS V+MSLMGF+LVM W K K 
Sbjct  356   LQRTMSFETGMQSSLLALALANRFFRDPLVAVPPAISTVMMSLMGFTLVMVWAKKKE  412



>ref|XP_004147983.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic-like 
[Cucumis sativus]
Length=420

 Score =   481 bits (1239),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 254/334 (76%), Positives = 292/334 (87%), Gaps = 0/334 (0%)
 Frame = -1

Query  1149  AAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLM  970
             A     I   K+ +F+ +L+ +N++LPHVVL ST++AL++PPSF WFTSRYYAPALGFLM
Sbjct  83    AVRQRLIIDQKKTTFVEILKQSNSLLPHVVLASTLVALIFPPSFAWFTSRYYAPALGFLM  142

Query  969   FAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIML  790
             FAVGVNSSEKDFLEAF +P AI AGY+GQF VKPLLGYLFGTIA+  FGLPT++ AGIML
Sbjct  143   FAVGVNSSEKDFLEAFKQPAAIFAGYVGQFFVKPLLGYLFGTIAVTLFGLPTAIGAGIML  202

Query  789   TSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMI  610
              SCVSGAQLS+YATFLTDP +APLS+VMTSLSTATA +VTPFLSLLLIGKRLPVDV GMI
Sbjct  203   VSCVSGAQLSSYATFLTDPSLAPLSVVMTSLSTATAVVVTPFLSLLLIGKRLPVDVKGMI  262

Query  609   SNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsg  430
             S+I QIVV P+AAGLLLNRFFP++C AIRPFLPPLSV VT+ CVGAPLAINI +V+SP G
Sbjct  263   SSITQIVVAPIAAGLLLNRFFPRICEAIRPFLPPLSVLVTACCVGAPLAININAVISPFG  322

Query  429   lsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQ  250
             LS+LLL++AFHLSAFI+GY+L G AF  +PDVK LQRTLSYETGMQSSLLALALAN+FFQ
Sbjct  323   LSILLLIVAFHLSAFIAGYSLTGLAFHGSPDVKALQRTLSYETGMQSSLLALALANRFFQ  382

Query  249   DPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV  148
             DPLV VPPAIS V+MSLMGFSLVM W+K K  N+
Sbjct  383   DPLVSVPPAISTVMMSLMGFSLVMIWSKRKEKNM  416



>ref|XP_004159525.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic-like 
[Cucumis sativus]
Length=420

 Score =   481 bits (1237),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 273/414 (66%), Positives = 317/414 (77%), Gaps = 13/414 (3%)
 Frame = -1

Query  1362  LLQPQLNQGFKIHHPSL--PKPLPCINLEFHYPFLSLPRKSFNSSARSSR-------LPV  1210
             +L   L Q  ++H   L  P  +   N      F   P +    S R S        L V
Sbjct  7     ILGKNLMQIHRLHRSQLDFPTSISSRNQSISGLFHRFPPQINGVSVRCSNTFHSPYPLDV  66

Query  1209  SRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVY  1030
              R V  NL   I    +   A     I   K+ +F+ +L+ +N++LPHVVL ST++AL++
Sbjct  67    YRTVLLNLCGWI----VILLAVRQRLIIDQKKTTFVEILKQSNSLLPHVVLASTLVALIF  122

Query  1029  PPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLF  850
             PPSF WFTSRYYAPALGFLMFAVGVNSSEKDFLEAF +P AI AGY+GQF VKPLLGYLF
Sbjct  123   PPSFAWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFKQPAAIFAGYVGQFFVKPLLGYLF  182

Query  849   GTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVT  670
             GTIA+  FGLPT++ AGIML SCVSGAQLS+YATFLTDP +APLS+VMTSLSTATA +VT
Sbjct  183   GTIAVTLFGLPTAIGAGIMLVSCVSGAQLSSYATFLTDPSLAPLSVVMTSLSTATAVVVT  242

Query  669   PFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVT  490
             PFLSLLLIGKRLPVDV GMIS+I QIVV P+AAGLLLNRFFP++C AIRPFLPPLSV VT
Sbjct  243   PFLSLLLIGKRLPVDVKGMISSITQIVVAPIAAGLLLNRFFPRICEAIRPFLPPLSVLVT  302

Query  489   SLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLS  310
             + CVGAPLAINI +V+SP GLS+LLL++AFHLSAFI+GY+L G AF  +PDVK LQRTLS
Sbjct  303   ACCVGAPLAININAVISPFGLSILLLIVAFHLSAFIAGYSLTGLAFHGSPDVKGLQRTLS  362

Query  309   YETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV  148
             YETGMQSSLLALALAN+FFQDPLV VPPAIS V+MSLMGFSLVM W+K K  N+
Sbjct  363   YETGMQSSLLALALANRFFQDPLVSVPPAISTVMMSLMGFSLVMIWSKRKEKNM  416



>ref|XP_008781310.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Phoenix dactylifera]
Length=416

 Score =   479 bits (1233),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 252/366 (69%), Positives = 303/366 (83%), Gaps = 4/366 (1%)
 Frame = -1

Query  1233  ARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLG  1054
             ++ SR+ V+RC S   +DS  P+     A    +  + K+   L +LRGAN+ILPHVVL 
Sbjct  47    SKGSRVLVARCSSAKTADSFEPDRTREDAFVPGQEVERKDTDVLKILRGANSILPHVVLA  106

Query  1053  STILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVV  874
             ST+LALVYPPSF WFT+RYYAPALGFLMFAVGVNSS KDF+EA  RP AI  GY+GQF++
Sbjct  107   STVLALVYPPSFMWFTNRYYAPALGFLMFAVGVNSSPKDFIEAVKRPDAIAIGYVGQFII  166

Query  873   KPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtsls  694
             KPLLGY+FGTI+++ F LP SL AGIML SCVSGAQLSNYAT+LTDPPMAPLSIVMTSLS
Sbjct  167   KPLLGYIFGTISVSTFNLPASLGAGIMLVSCVSGAQLSNYATYLTDPPMAPLSIVMTSLS  226

Query  693   tataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFL  514
             TATA  VTP LSLLLIGK+LPVDV GM+S+I+QIVV P+AAGLLLNRFFP+ C AI+PFL
Sbjct  227   TATAVFVTPMLSLLLIGKKLPVDVKGMMSSIMQIVVAPIAAGLLLNRFFPRFCGAIQPFL  286

Query  513   PPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDV  334
             PPLSVFVT+LCVG+PLAINI +++SP G++++LL+  FH ++F+SGY+LAG  F+ + DV
Sbjct  287   PPLSVFVTALCVGSPLAINIGAIMSPFGIAIVLLIFGFHAASFMSGYSLAGVVFQKSADV  346

Query  333   KPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKST  154
             K LQRT+S+ETGMQSSLLALALAN FFQDPLVGVP AISVV+MSLMGF+LVM W+K K  
Sbjct  347   KALQRTISFETGMQSSLLALALANTFFQDPLVGVPAAISVVLMSLMGFALVMIWSKRKQ-  405

Query  153   NV*QLH  136
                Q+H
Sbjct  406   ---QMH  408



>ref|XP_010055564.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X2 [Eucalyptus grandis]
 gb|KCW72054.1| hypothetical protein EUGRSUZ_E00496 [Eucalyptus grandis]
Length=419

 Score =   479 bits (1234),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 259/363 (71%), Positives = 298/363 (82%), Gaps = 1/363 (0%)
 Frame = -1

Query  1236  SARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKEN-SFLTVLRGANAILPHVV  1060
             S  S R   S+C S + S+ + PE+     AES +   P E  S + VL+ +N+ LPHVV
Sbjct  56    SVHSRRNGSSKCKSGDFSEPLEPETGWESPAESIQPSVPGEQFSIVEVLKKSNSFLPHVV  115

Query  1059  LGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQF  880
             L ST+LAL+YPPSF WFT+RYYAPALGFLMFAVGVNSSE+DFLEAF RP AI AGYIGQ+
Sbjct  116   LASTLLALIYPPSFAWFTNRYYAPALGFLMFAVGVNSSERDFLEAFKRPAAIFAGYIGQY  175

Query  879   VVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMts  700
             +VKPLLGY FG +++  F LPTS+ AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTS
Sbjct  176   IVKPLLGYFFGMMSVTMFSLPTSIGAGIMLVSCVSGAQLSNYATFLTDPSMAPLSIVMTS  235

Query  699   lstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRP  520
             LSTATA  VTP LSLLLIGKRLPVDV GM+S+I+QIVV P+ AGLLLNRFFP +CNAIRP
Sbjct  236   LSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIVVTPITAGLLLNRFFPWICNAIRP  295

Query  519   FLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAP  340
              LPPLSVFVT+LCVGAPLAIN+ S++S  GL +LLL+IAFHLSAF+ GY L G  F+ AP
Sbjct  296   LLPPLSVFVTALCVGAPLAINVDSIMSSFGLMILLLIIAFHLSAFVIGYFLPGFFFQKAP  355

Query  339   DVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNK  160
             DVK LQRTLS+ETGMQSSLLALALAN+FFQDPLV VPPAIS V+MSLMGFSLVM W + +
Sbjct  356   DVKALQRTLSFETGMQSSLLALALANRFFQDPLVAVPPAISTVMMSLMGFSLVMVWARGR  415

Query  159   STN  151
             +T 
Sbjct  416   ATG  418



>ref|XP_009418728.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=406

 Score =   478 bits (1231),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 258/389 (66%), Positives = 310/389 (80%), Gaps = 4/389 (1%)
 Frame = -1

Query  1311  PKPLPCINLEFHYPFLSLPRKSFN----SSARSSRLPVSRCVSENLSDSIRPESLSNYAA  1144
             P P P I      P L     S      SS+   ++ +  CVS   +DS  P+  +  A 
Sbjct  11    PIPFPAIYARTSLPLLRRRTASLRFSSSSSSNDDKILLGSCVSAKAADSFEPDRSAKDAF  70

Query  1143  ESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFA  964
               S+  +  E S L +L+GAN+I+PHVVL ST+LALVYPPSFTWFT+RYYAPALGFLMFA
Sbjct  71    RPSQEVRQDEISILKILKGANSIIPHVVLASTVLALVYPPSFTWFTTRYYAPALGFLMFA  130

Query  963   VGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTS  784
             VGVNSS  DF+EAF +P AI AGY+GQF++KPLLGYLFG+I+++ F LP SL AGIML S
Sbjct  131   VGVNSSLNDFVEAFKKPDAIAAGYVGQFIIKPLLGYLFGSISVSLFKLPNSLGAGIMLVS  190

Query  783   CVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISN  604
             CVSGAQLSNYATFLTDPPMAPLSIVMTSLSTATA  VTP LSLLLIG++LPVDV GM+S+
Sbjct  191   CVSGAQLSNYATFLTDPPMAPLSIVMTSLSTATAVFVTPTLSLLLIGQKLPVDVKGMMSS  250

Query  603   IIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsgls  424
             I+QIVV P+AAGL LNRF P++C AI+PFLPPLSVFVT+LCVG+PLAIN+++++SP G++
Sbjct  251   IVQIVVAPIAAGLFLNRFLPRICAAIQPFLPPLSVFVTALCVGSPLAINMKAIISPFGVA  310

Query  423   vlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDP  244
             ++LL+ AFH SAFISGY  AG  FR + DVK LQRT+S+ETGMQSSLLAL LANKFF+DP
Sbjct  311   IVLLLFAFHASAFISGYGFAGILFRRSTDVKALQRTISFETGMQSSLLALTLANKFFKDP  370

Query  243   LVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             LVGVPPAISVV+MSLMGF+LVM W+K K 
Sbjct  371   LVGVPPAISVVLMSLMGFALVMIWSKGKQ  399



>ref|XP_010055568.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X6 [Eucalyptus grandis]
 gb|KCW72051.1| hypothetical protein EUGRSUZ_E00493 [Eucalyptus grandis]
Length=408

 Score =   478 bits (1229),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 261/378 (69%), Positives = 305/378 (81%), Gaps = 2/378 (1%)
 Frame = -1

Query  1278  HYPFLSLPRKSF-NSSARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKEN-SF  1105
              Y   +LPR S  ++S  S R   S+C S + S+ + PE      AES +   P++  S 
Sbjct  30    RYGVPTLPRNSLLSASVHSRRHGSSKCKSGDFSEPLEPEMGWESPAESIQPSVPRDQFSV  89

Query  1104  LTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEA  925
             + VL+ +N+ LPHVVL ST+LAL+YPPSFTWFT+RYYAPALGFLMFAVGVNSSE+DFLEA
Sbjct  90    VEVLKNSNSFLPHVVLASTLLALIYPPSFTWFTNRYYAPALGFLMFAVGVNSSERDFLEA  149

Query  924   FNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATF  745
             F RP AI AG+IGQ++VKPLLGY FG +++  F LPTS+ AGIML SCVSGAQLSNYATF
Sbjct  150   FKRPAAIFAGFIGQYIVKPLLGYFFGMMSVTMFSLPTSIGAGIMLVSCVSGAQLSNYATF  209

Query  744   LTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGL  565
             LTDP MAPLSIVMTSLSTATA  VTP LSLLLIGKRLPVDV GM+S+I+QI V P+ AGL
Sbjct  210   LTDPSMAPLSIVMTSLSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIAVAPITAGL  269

Query  564   LLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAF  385
             LLNRFFP +CNAIRP LPPLSVFVT+L VGAPLAIN+ S++S  GL +LLL+IAFHLSAF
Sbjct  270   LLNRFFPWICNAIRPLLPPLSVFVTALGVGAPLAINVDSIMSSFGLMILLLIIAFHLSAF  329

Query  384   ISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIM  205
             + GY L G  F+ APDVK LQRTLS+ETGMQSSLLALALAN+FFQDPLV VPPAIS V+M
Sbjct  330   VIGYFLPGFFFQKAPDVKALQRTLSFETGMQSSLLALALANRFFQDPLVAVPPAISTVMM  389

Query  204   SLMGFSLVMFWNKNKSTN  151
             SLMGFSLVM W + ++T 
Sbjct  390   SLMGFSLVMVWARGRATG  407



>emb|CAN76453.1| hypothetical protein VITISV_011475 [Vitis vinifera]
Length=352

 Score =   475 bits (1223),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 251/315 (80%), Positives = 287/315 (91%), Gaps = 1/315 (0%)
 Frame = -1

Query  1119  KENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEK  940
             K+ S   +L+GAN ILPHVVL ST++AL+YPPSFTWFT+RYYAPALGFLMFAVGVNSSEK
Sbjct  5     KKASIXDILKGANGILPHVVLASTLVALIYPPSFTWFTTRYYAPALGFLMFAVGVNSSEK  64

Query  939   DFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLS  760
             DFLEAFNRP AI AGY+GQFVVKPLLGYLFGTIA+  FGLPT++ AGIMLTSCVSGAQLS
Sbjct  65    DFLEAFNRPMAIFAGYVGQFVVKPLLGYLFGTIAVTIFGLPTAIGAGIMLTSCVSGAQLS  124

Query  759   NYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVP  580
             NYATFLTDPPMAPLSIVMTSLSTATA  VTP LSLLLIGKRLPVDV GM+S+I+QIVV P
Sbjct  125   NYATFLTDPPMAPLSIVMTSLSTATAVFVTPILSLLLIGKRLPVDVKGMVSSILQIVVAP  184

Query  579   VAAGLLLNRFF-PQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIA  403
             +AAGLLLNR+F P++CNAIRPFLPPLSV VT+ CVG+PLAIN++SV+SP G++V +L+IA
Sbjct  185   IAAGLLLNRWFLPRICNAIRPFLPPLSVLVTACCVGSPLAINVESVLSPFGVTVSMLIIA  244

Query  402   FHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPA  223
             FH +AF++GY L+G  F +APDVK +QRTLS+ETGMQSSLLALALAN+FFQD LVGVPPA
Sbjct  245   FHFTAFVAGYGLSGLVFHEAPDVKAIQRTLSFETGMQSSLLALALANRFFQDSLVGVPPA  304

Query  222   ISVVIMSLMGFSLVM  178
             ISVVIMSLMGF+LVM
Sbjct  305   ISVVIMSLMGFALVM  319



>ref|XP_010055566.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X4 [Eucalyptus grandis]
Length=419

 Score =   477 bits (1228),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 256/363 (71%), Positives = 298/363 (82%), Gaps = 1/363 (0%)
 Frame = -1

Query  1236  SARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKEN-SFLTVLRGANAILPHVV  1060
             S  S R   S+C S + S+ + PE+     AES ++  P+E  S + VL+ +N+ LPHVV
Sbjct  56    SVHSRRHGSSKCKSGDFSEPLEPETGRESPAESIQLSVPREQLSIVEVLKNSNSFLPHVV  115

Query  1059  LGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQF  880
             L ST+LAL+YPPSF WFT+RYYAPALGFLMFAVGVNSSE+DFLEAF RP AI AG+IGQ+
Sbjct  116   LASTLLALIYPPSFAWFTNRYYAPALGFLMFAVGVNSSERDFLEAFKRPAAIFAGFIGQY  175

Query  879   VVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMts  700
             +VKPLLGY FG +++  F LPTS+ AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTS
Sbjct  176   IVKPLLGYFFGMMSVTMFSLPTSIGAGIMLVSCVSGAQLSNYATFLTDPSMAPLSIVMTS  235

Query  699   lstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRP  520
             LSTATA  VTP LSLLLIGKRLPVDV GM+S+I+QI V P+ AGLLLNRFFP +CNAIRP
Sbjct  236   LSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIAVAPITAGLLLNRFFPWICNAIRP  295

Query  519   FLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAP  340
              LPPLSVFVT+L VGAPLAIN+ S++S  GL +LLL+IAFHLSAF+ GY L G  F+ AP
Sbjct  296   LLPPLSVFVTALGVGAPLAINVDSIMSSFGLMILLLIIAFHLSAFVIGYFLPGFFFQKAP  355

Query  339   DVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNK  160
             DVK LQRTLS+ETGMQSSLLALALAN+FFQDPLV VPPAIS V+MSLMGFSLVM W + +
Sbjct  356   DVKALQRTLSFETGMQSSLLALALANRFFQDPLVAVPPAISTVMMSLMGFSLVMVWARGR  415

Query  159   STN  151
             +T 
Sbjct  416   ATG  418



>ref|XP_010055567.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X5 [Eucalyptus grandis]
Length=419

 Score =   477 bits (1227),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 256/363 (71%), Positives = 298/363 (82%), Gaps = 1/363 (0%)
 Frame = -1

Query  1236  SARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKEN-SFLTVLRGANAILPHVV  1060
             S  S R   S+C S + S+ + PE+     AES ++  P+E  S + VL+ +N+ LPHVV
Sbjct  56    SVHSRRHGSSKCKSGDFSEPLEPETGRESPAESIQLSVPREQLSIVEVLKNSNSFLPHVV  115

Query  1059  LGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQF  880
             L ST+LAL+YPPSF WFT+RYYAPALGFLMFAVGVNSSE+DFLEAF RP AI AG+IGQ+
Sbjct  116   LASTLLALIYPPSFAWFTNRYYAPALGFLMFAVGVNSSERDFLEAFKRPAAIFAGFIGQY  175

Query  879   VVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMts  700
             +VKPLLGY FG +++  F LPTS+ AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTS
Sbjct  176   IVKPLLGYFFGMMSVTMFSLPTSIGAGIMLVSCVSGAQLSNYATFLTDPSMAPLSIVMTS  235

Query  699   lstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRP  520
             LSTATA  VTP LSLLLIGKRLPVDV GM+S+I+QI V P+ AGLLLNRFFP +CNAIRP
Sbjct  236   LSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIAVAPITAGLLLNRFFPWICNAIRP  295

Query  519   FLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAP  340
              LPPLSVFVT+L VGAPLAIN+ S++S  GL +LLL+IAFHLSAF+ GY L G  F+ AP
Sbjct  296   LLPPLSVFVTALGVGAPLAINVDSIMSSFGLMILLLIIAFHLSAFVIGYFLPGFFFQKAP  355

Query  339   DVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNK  160
             DVK LQRTLS+ETGMQSSLLALALAN+FFQDPLV VPPAIS V+MSLMGFSLVM W + +
Sbjct  356   DVKALQRTLSFETGMQSSLLALALANRFFQDPLVAVPPAISTVMMSLMGFSLVMVWARGR  415

Query  159   STN  151
             +T 
Sbjct  416   ATG  418



>ref|XP_010676632.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   476 bits (1224),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 263/360 (73%), Positives = 291/360 (81%), Gaps = 17/360 (5%)
 Frame = -1

Query  1227  SSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENS----FLTVLRGANAILPHVV  1060
             SSR  V +CV E              ++E   I  P+E         +L  AN+ LPH+V
Sbjct  66    SSRNVVVKCVPEQ-------------SSELESIVVPQEAETKVGISEILSKANSFLPHIV  112

Query  1059  LGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQF  880
             L ST+LAL YPPSFTWFTSRYYAPALGFLMFAVG+NSSEKDFLEAF RP AI AGYIGQF
Sbjct  113   LASTLLALAYPPSFTWFTSRYYAPALGFLMFAVGLNSSEKDFLEAFKRPTAIFAGYIGQF  172

Query  879   VVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMts  700
              VKPLLG +FGTIA+  FGLPT   AGIMLTSCVSGAQLSNYATFLTDP MAPLSIVMTS
Sbjct  173   AVKPLLGLIFGTIAVTVFGLPTPAGAGIMLTSCVSGAQLSNYATFLTDPQMAPLSIVMTS  232

Query  699   lstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRP  520
             LSTA+A  VTP LSLLLIGKRLPVDV GM+++I+QIVVVP+A+GLLLNR FP+VC AIRP
Sbjct  233   LSTASATFVTPLLSLLLIGKRLPVDVKGMMTSIMQIVVVPIASGLLLNRLFPEVCKAIRP  292

Query  519   FLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAP  340
             FLPPLSVFVTSLCVGAPLAINI +V+SP GL +LLLVI FHLSAFI+GY ++G  F DAP
Sbjct  293   FLPPLSVFVTSLCVGAPLAININAVMSPFGLIILLLVIMFHLSAFIAGYLMSGLVFHDAP  352

Query  339   DVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNK  160
             D K LQRTLSYETGMQSSLL LALAN+FF+DP+VGVPPAIS VIMSLMGFSLVM W K K
Sbjct  353   DAKALQRTLSYETGMQSSLLGLALANRFFEDPVVGVPPAISTVIMSLMGFSLVMLWAKKK  412



>ref|XP_010108094.1| putative sodium-dependent transporter yocS [Morus notabilis]
 gb|EXC17826.1| putative sodium-dependent transporter yocS [Morus notabilis]
Length=418

 Score =   474 bits (1220),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 252/338 (75%), Positives = 294/338 (87%), Gaps = 2/338 (1%)
 Frame = -1

Query  1215  PVSRCVSENLSDSIRPESLSNYAAESSEI--FKPKENSFLTVLRGANAILPHVVLGSTIL  1042
             P+ R  SE L  S   E   ++A++ +E+   + KE S L +L+ AN+ LPHVVL S +L
Sbjct  59    PLRRRFSEQLPGSFESEQDQDFASKDAEVVTLEQKEVSALEILKKANSFLPHVVLASILL  118

Query  1041  ALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLL  862
             ALVYPPSFTWFT+RYYAPALGFLMFAVGVNSSEKDFLEAF RP AILAGY+GQFVVKPLL
Sbjct  119   ALVYPPSFTWFTTRYYAPALGFLMFAVGVNSSEKDFLEAFKRPAAILAGYVGQFVVKPLL  178

Query  861   GYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstata  682
             GYLFG I++A FGLPT + AGIML SCVSGAQLSNYATFLTDPPMAPLSIVMTSLSTATA
Sbjct  179   GYLFGIISVAVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPMAPLSIVMTSLSTATA  238

Query  681   aLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLS  502
              +VTP LSLLLIGKRLPVDV GM+S+I+QIV+ P+A+GLLLNRFFP++C+AIRPFLPPLS
Sbjct  239   VVVTPLLSLLLIGKRLPVDVKGMVSSILQIVIAPIASGLLLNRFFPRLCDAIRPFLPPLS  298

Query  501   VFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQ  322
             V VT+LCVGAPLAINI+SV+SP G+++LLL++AFHL+AF++GY L G  F+ APDVK LQ
Sbjct  299   VLVTALCVGAPLAINIKSVLSPFGVTILLLIVAFHLAAFVAGYILTGVVFQKAPDVKALQ  358

Query  321   RTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
             RTLSYETGMQSSLLALALAN+FFQDPLVGVPPAIS+ +
Sbjct  359   RTLSYETGMQSSLLALALANRFFQDPLVGVPPAISLFV  396



>ref|XP_010055565.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X3 [Eucalyptus grandis]
Length=419

 Score =   473 bits (1218),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 256/363 (71%), Positives = 297/363 (82%), Gaps = 1/363 (0%)
 Frame = -1

Query  1236  SARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKEN-SFLTVLRGANAILPHVV  1060
             S  S R   S+C S + S+ + PE      AES +   P++  S + VL+ +N+ LPHVV
Sbjct  56    SVHSRRHGSSKCKSGDFSEPLEPEMGWESPAESIQPSVPRDQFSVVEVLKNSNSFLPHVV  115

Query  1059  LGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQF  880
             L ST+LAL+YPPSFTWFT+RYYAPALGFLMFAVGVNSSE+DFLEAF RP AI AG+IGQ+
Sbjct  116   LASTLLALIYPPSFTWFTNRYYAPALGFLMFAVGVNSSERDFLEAFKRPAAIFAGFIGQY  175

Query  879   VVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMts  700
             +VKPLLGY FG +++  F LPTS+ AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTS
Sbjct  176   IVKPLLGYFFGMMSVTMFSLPTSIGAGIMLVSCVSGAQLSNYATFLTDPSMAPLSIVMTS  235

Query  699   lstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRP  520
             LSTATA  VTP LSLLLIGKRLPVDV GM+S+I+QI V P+ AGLLLNRFFP +CNAIRP
Sbjct  236   LSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIAVAPITAGLLLNRFFPWICNAIRP  295

Query  519   FLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAP  340
              LPPLSVFVT+L VGAPLAIN+ S++S  GL +LLL+IAFHLSAF+ GY L G  F+ AP
Sbjct  296   LLPPLSVFVTALGVGAPLAINVDSIMSSFGLMILLLIIAFHLSAFVIGYFLPGFFFQKAP  355

Query  339   DVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNK  160
             DVK LQRTLS+ETGMQSSLLALALAN+FFQDPLV VPPAIS V+MSLMGFSLVM W + +
Sbjct  356   DVKALQRTLSFETGMQSSLLALALANRFFQDPLVAVPPAISTVMMSLMGFSLVMVWARGR  415

Query  159   STN  151
             +T 
Sbjct  416   ATG  418



>ref|XP_002304447.2| bile acid:sodium symporter family protein [Populus trichocarpa]
 gb|EEE79426.2| bile acid:sodium symporter family protein [Populus trichocarpa]
Length=325

 Score =   468 bits (1205),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 246/323 (76%), Positives = 279/323 (86%), Gaps = 0/323 (0%)
 Frame = -1

Query  1125  KPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSS  946
             + KE S + +L  +N++LPH+VL ST+LALV+PPSFTWFT+RYYAPALGFLMFAVGVNSS
Sbjct  3     EQKEASIVDMLEQSNSLLPHIVLASTLLALVHPPSFTWFTTRYYAPALGFLMFAVGVNSS  62

Query  945   EKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQ  766
             EKDFLEAFNRP AILAGY+GQFVVKP LGYLFG I+++ FGLPT + AGIML SCVSGAQ
Sbjct  63    EKDFLEAFNRPAAILAGYVGQFVVKPSLGYLFGIISVSVFGLPTPIGAGIMLVSCVSGAQ  122

Query  765   LSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVV  586
             LSNYATFLTDPPMAPLSIVMTS+STATA  VTP LSLLLIGKRLPVDV GM+S+I+QIVV
Sbjct  123   LSNYATFLTDPPMAPLSIVMTSMSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSIMQIVV  182

Query  585   VPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVI  406
              P+AAGLLLNR FPQ+   IRPFLPPLSV VT+ CVGAPLAIN+ SV+SP G++++ L+I
Sbjct  183   APIAAGLLLNRLFPQISGVIRPFLPPLSVLVTACCVGAPLAINVDSVMSPFGVTIVSLII  242

Query  405   AFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPP  226
             AFHLSAF+ GY   G  F  A D+K LQRTLSYETGMQSSLLALALAN+FF+DPLV VPP
Sbjct  243   AFHLSAFVVGYYFTGFVFHKASDLKALQRTLSYETGMQSSLLALALANRFFKDPLVAVPP  302

Query  225   AISVVIMSLMGFSLVMFWNKNKS  157
             AIS VIMSLMGFSLVM W K K 
Sbjct  303   AISTVIMSLMGFSLVMIWAKKKE  325



>ref|XP_010277424.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X3 [Nelumbo nucifera]
Length=402

 Score =   470 bits (1210),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 252/345 (73%), Positives = 296/345 (86%), Gaps = 3/345 (1%)
 Frame = -1

Query  1245  FNSSARSSRLPVSRCVSENLSDSIRPESL-SNYAAESSEIFKPKENSFLTVLRGANAILP  1069
             ++S  R S+    RCVSEN S S   + +  N +    +I    + + L +L+GAN+ILP
Sbjct  58    WSSKPRGSKASHRRCVSENFSSSFELDRVPENISGPIQKI--EGKGTVLDILKGANSILP  115

Query  1068  HVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYI  889
             HVVL ST+LAL++PPSFTWFT+RYYAPALGFLMFAVGVNSSEKDF+EAFNRP AI AGY+
Sbjct  116   HVVLASTVLALIFPPSFTWFTNRYYAPALGFLMFAVGVNSSEKDFIEAFNRPAAIFAGYV  175

Query  888   GQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIV  709
             GQF++KPLLGYLFGTI++ AF LPTSL AGIMLTSCVSGAQLSNYATFLTDPPMAPLSIV
Sbjct  176   GQFIMKPLLGYLFGTISVTAFHLPTSLGAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIV  235

Query  708   MtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNA  529
             MTSLSTATA  VTP LSLLLIGKRLPVDV GM+S+I+QIVV P+AAGLLLNRF P++C+A
Sbjct  236   MTSLSTATAVFVTPMLSLLLIGKRLPVDVRGMVSSIMQIVVAPIAAGLLLNRFLPRICDA  295

Query  528   IRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFR  349
             IRP LPPLSVFVT+LCVG+PLAINI +V+SP G+++L+L+I FHLS+F++GY L+G  F 
Sbjct  296   IRPILPPLSVFVTALCVGSPLAININAVLSPFGMTILMLIIGFHLSSFVAGYVLSGLFFH  355

Query  348   DAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISV  214
              APDVK LQRTLS+ETGMQSSLLALALANKFFQDPLVGVPPAIS+
Sbjct  356   RAPDVKALQRTLSFETGMQSSLLALALANKFFQDPLVGVPPAISI  400



>gb|EPS60545.1| hypothetical protein M569_14259 [Genlisea aurea]
Length=375

 Score =   466 bits (1200),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 247/321 (77%), Positives = 286/321 (89%), Gaps = 0/321 (0%)
 Frame = -1

Query  1119  KENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEK  940
             ++ SF+ +L+GA + LP VV+ S +LA++YPPSFTWFTSRYYAPALGFLMFAVGVNS+EK
Sbjct  51    EDFSFMKMLKGAGSFLPVVVIASAVLAIIYPPSFTWFTSRYYAPALGFLMFAVGVNSTEK  110

Query  939   DFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLS  760
             DF+EAFN+P A++AGY GQF+VKPLLGYLFG+I++A FGLP SLAAGIMLTSCVSGAQLS
Sbjct  111   DFVEAFNQPSAVVAGYTGQFLVKPLLGYLFGSISMAIFGLPASLAAGIMLTSCVSGAQLS  170

Query  759   NYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVP  580
             NYATFLTDP MAPLSIVMTSLSTATA  VTP LSLLLIGK+LPVDV GM++NI+QIVV P
Sbjct  171   NYATFLTDPQMAPLSIVMTSLSTATAVFVTPSLSLLLIGKKLPVDVKGMVANILQIVVTP  230

Query  579   VAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAF  400
             VA GLLLNRFFP++  AIRPFLP LSVFVT+LCVGAPLAIN++ + +PSG+SVLLLVIAF
Sbjct  231   VATGLLLNRFFPEISRAIRPFLPSLSVFVTALCVGAPLAINVKLISTPSGVSVLLLVIAF  290

Query  399   HLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAI  220
             HLSAF++GY L G  FR + DVK LQRTLSYETGMQSSLLALALANKFF DPLVG+PPAI
Sbjct  291   HLSAFVAGYGLTGLFFRKSSDVKALQRTLSYETGMQSSLLALALANKFFPDPLVGIPPAI  350

Query  219   SVVIMSLMGFSLVMFWNKNKS  157
             S VIMSLMGFSLV+ W++ + 
Sbjct  351   STVIMSLMGFSLVLVWSQRRE  371



>ref|XP_010055570.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X7 [Eucalyptus grandis]
Length=407

 Score =   465 bits (1197),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 261/394 (66%), Positives = 307/394 (78%), Gaps = 13/394 (3%)
 Frame = -1

Query  1296  CINLEFHYPFLSLPRKSFNS----SARSSRLPVSRCVSENLSDSIRPES--LSNYAAESS  1135
             C    F  P   L R+ F S    +  ++R  VS+ +S +LS      S  L+ Y   + 
Sbjct  14    CRGTRFFRP-RCLRRRWFRSVQFIAEDTARANVSQGISRSLSSQRWAGSRRLNRYRCGNR  72

Query  1134  EIF-----KPKEN-SFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFL  973
              +F      P++  S + VL+ +N+ LPHVVL ST+LAL+YPPSFTWFT+RYYAPALGFL
Sbjct  73    RLFFFQPSVPRDQFSVVEVLKNSNSFLPHVVLASTLLALIYPPSFTWFTNRYYAPALGFL  132

Query  972   MFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIM  793
             MFAVGVNSSE+DFLEAF RP AI AG+IGQ++VKPLLGY FG +++  F LPTS+ AGIM
Sbjct  133   MFAVGVNSSERDFLEAFKRPAAIFAGFIGQYIVKPLLGYFFGMMSVTMFSLPTSIGAGIM  192

Query  792   LTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGM  613
             L SCVSGAQLSNYATFLTDP MAPLSIVMTSLSTATA  VTP LSLLLIGKRLPVDV GM
Sbjct  193   LVSCVSGAQLSNYATFLTDPSMAPLSIVMTSLSTATAVFVTPLLSLLLIGKRLPVDVKGM  252

Query  612   ISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsps  433
             +S+I+QI V P+ AGLLLNRFFP +CNAIRP LPPLSVFVT+L VGAPLAIN+ S++S  
Sbjct  253   VSSILQIAVAPITAGLLLNRFFPWICNAIRPLLPPLSVFVTALGVGAPLAINVDSIMSSF  312

Query  432   glsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFF  253
             GL +LLL+IAFHLSAF+ GY L G  F+ APDVK LQRTLS+ETGMQSSLLALALAN+FF
Sbjct  313   GLMILLLIIAFHLSAFVIGYFLPGFFFQKAPDVKALQRTLSFETGMQSSLLALALANRFF  372

Query  252   QDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTN  151
             QDPLV VPPAIS V+MSLMGFSLVM W + ++T 
Sbjct  373   QDPLVAVPPAISTVMMSLMGFSLVMVWARGRATG  406



>ref|XP_010055571.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X8 [Eucalyptus grandis]
Length=396

 Score =   462 bits (1189),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 254/367 (69%), Positives = 298/367 (81%), Gaps = 8/367 (2%)
 Frame = -1

Query  1227  SSRLPVSRCVSENLSDSIRPES--LSNYAAESSEIF-----KPKEN-SFLTVLRGANAIL  1072
             ++R  VS+ +S +LS      S  L+ Y   +  +F      P++  S + VL+ +N+ L
Sbjct  29    TARANVSQGISRSLSSQRWAGSRRLNRYRCGNRRLFFFQPSVPRDQFSVVEVLKNSNSFL  88

Query  1071  PHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGY  892
             PHVVL ST+LAL+YPPSFTWFT+RYYAPALGFLMFAVGVNSSE+DFLEAF RP AI AG+
Sbjct  89    PHVVLASTLLALIYPPSFTWFTNRYYAPALGFLMFAVGVNSSERDFLEAFKRPAAIFAGF  148

Query  891   IGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSI  712
             IGQ++VKPLLGY FG +++  F LPTS+ AGIML SCVSGAQLSNYATFLTDP MAPLSI
Sbjct  149   IGQYIVKPLLGYFFGMMSVTMFSLPTSIGAGIMLVSCVSGAQLSNYATFLTDPSMAPLSI  208

Query  711   VMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCN  532
             VMTSLSTATA  VTP LSLLLIGKRLPVDV GM+S+I+QI V P+ AGLLLNRFFP +CN
Sbjct  209   VMTSLSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIAVAPITAGLLLNRFFPWICN  268

Query  531   AIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAF  352
             AIRP LPPLSVFVT+L VGAPLAIN+ S++S  GL +LLL+IAFHLSAF+ GY L G  F
Sbjct  269   AIRPLLPPLSVFVTALGVGAPLAINVDSIMSSFGLMILLLIIAFHLSAFVIGYFLPGFFF  328

Query  351   RDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFW  172
             + APDVK LQRTLS+ETGMQSSLLALALAN+FFQDPLV VPPAIS V+MSLMGFSLVM W
Sbjct  329   QKAPDVKALQRTLSFETGMQSSLLALALANRFFQDPLVAVPPAISTVMMSLMGFSLVMVW  388

Query  171   NKNKSTN  151
              + ++T 
Sbjct  389   ARGRATG  395



>ref|XP_002274965.3| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Vitis vinifera]
 ref|XP_010647571.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Vitis vinifera]
 ref|XP_010647572.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Vitis vinifera]
Length=338

 Score =   457 bits (1177),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 247/331 (75%), Positives = 281/331 (85%), Gaps = 11/331 (3%)
 Frame = -1

Query  1119  KENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEK  940
             K+ S   +L+GAN ILPHVVL ST++AL+YPPSFTWFT+RYYAPALGFLMFAVGVNSSEK
Sbjct  5     KKASITDILKGANGILPHVVLASTLVALIYPPSFTWFTTRYYAPALGFLMFAVGVNSSEK  64

Query  939   DFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLS  760
             DFLEAFNRP AI AGY+GQFVVKPLLGYLFGTIA+  FGLPT++ AGIMLTSCVSGAQLS
Sbjct  65    DFLEAFNRPMAIFAGYVGQFVVKPLLGYLFGTIAVTIFGLPTAIGAGIMLTSCVSGAQLS  124

Query  759   NYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVP  580
             NYATFLTDPPMAPLSIVMTSLSTATA  VTP LSLLLIGKRLPVDV GM+S+I QIVV P
Sbjct  125   NYATFLTDPPMAPLSIVMTSLSTATAVFVTPILSLLLIGKRLPVDVKGMVSSISQIVVAP  184

Query  579   VAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAF  400
             +AAGLLLNRF P++CNAIRPFLPPLSV VT+ CVG+PLAIN++SV+SP G++V +L+IAF
Sbjct  185   IAAGLLLNRFLPRICNAIRPFLPPLSVLVTACCVGSPLAINVESVLSPFGVTVSMLIIAF  244

Query  399   HLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAI  220
             H +AF++GY L+G  F +APDVK LQRTLS+ETGMQSSLLALALAN+FFQD LVGVPPAI
Sbjct  245   HFTAFVAGYGLSGLVFHEAPDVKALQRTLSFETGMQSSLLALALANRFFQDSLVGVPPAI  304

Query  219   SVVIMSLMGFSLVM-------FWNKNKSTNV  148
             S    S     +V         WNKN  + V
Sbjct  305   SFENSS----DIVQDKDDDRPLWNKNNGSQV  331



>ref|XP_010540193.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X3 [Tarenaya hassleriana]
 ref|XP_010540198.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X3 [Tarenaya hassleriana]
Length=324

 Score =   456 bits (1174),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 242/321 (75%), Positives = 277/321 (86%), Gaps = 0/321 (0%)
 Frame = -1

Query  1119  KENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEK  940
             K+ S + VL+ AN+ILPHVVLGSTILAL+YPPSFTWFTSRY+ PALGFLMFAVG+NS+EK
Sbjct  4     KKASLVDVLKQANSILPHVVLGSTILALLYPPSFTWFTSRYFVPALGFLMFAVGINSNEK  63

Query  939   DFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLS  760
             DFLEAF RP AI AGY+GQ+V+KPLLGY+FG +A++ F LPT + AGIML SCVSGAQLS
Sbjct  64    DFLEAFKRPDAIFAGYVGQYVIKPLLGYIFGIMAVSIFHLPTPIGAGIMLVSCVSGAQLS  123

Query  759   NYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVP  580
             NYATFLTDP +APLSIVMTSLSTATA LVTP LS+ LIGKRLPVDV GMIS+I+Q+V+ P
Sbjct  124   NYATFLTDPSLAPLSIVMTSLSTATAVLVTPMLSVFLIGKRLPVDVKGMISSILQVVIAP  183

Query  579   VAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAF  400
             +AAGLLLNR FP++CNAIRPFLP LSV  T+ C+GAPLA+NI SV+SP G ++L LV AF
Sbjct  184   IAAGLLLNRLFPRLCNAIRPFLPVLSVLDTACCIGAPLALNINSVMSPFGATILFLVTAF  243

Query  399   HLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAI  220
             HL+AFI+GY L G AF  APDVK LQR LSYETGMQSSLLALALA KFFQDPLVGVPPAI
Sbjct  244   HLTAFIAGYFLTGYAFSKAPDVKALQRMLSYETGMQSSLLALALATKFFQDPLVGVPPAI  303

Query  219   SVVIMSLMGFSLVMFWNKNKS  157
             S V+MSLMGF+LVM W   K 
Sbjct  304   STVVMSLMGFTLVMLWTSRKE  324



>ref|NP_001158917.1| bile acid sodium symporter [Zea mays]
 gb|ACF87008.1| unknown [Zea mays]
 tpg|DAA62343.1| TPA: bile acid sodium symporter [Zea mays]
Length=409

 Score =   459 bits (1181),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 248/367 (68%), Positives = 299/367 (81%), Gaps = 3/367 (1%)
 Frame = -1

Query  1257  PRKSFNSSARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANA  1078
             PR S+    + S +   R +  + S S   +++   A   S+I    +  FL +L+ AN+
Sbjct  45    PRVSWQ---QGSGVVAKRLLWASASGSFEKDNIGEDAVLPSQIAVENKVDFLKILKSANS  101

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             I+PH+VLGSTILALVYPPSFTWFT+RYYAPALGFLMFAVGVNSS KDF+EA  RP AI A
Sbjct  102   IIPHIVLGSTILALVYPPSFTWFTTRYYAPALGFLMFAVGVNSSAKDFIEAIKRPDAIAA  161

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             GYIGQFV+KPL G+LFGT+A+A   LP +L AGIML SCVSGAQLSNYATFLTDP MAPL
Sbjct  162   GYIGQFVIKPLFGFLFGTLAVAVLNLPAALGAGIMLVSCVSGAQLSNYATFLTDPHMAPL  221

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             SIVMTSLSTATA  VTP LS  LIG++LPVDV GM+S+I+QIVV P+AAGLLLNRF P++
Sbjct  222   SIVMTSLSTATAVFVTPTLSYFLIGQKLPVDVKGMMSSIVQIVVAPIAAGLLLNRFLPRL  281

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
             C AI+PFLP +SVFVT+LCVG+PLAINI++V+SP GL+++LL+ AFH S+F++GY LAG 
Sbjct  282   CAAIQPFLPSMSVFVTALCVGSPLAINIKAVLSPFGLTIVLLLFAFHTSSFVAGYHLAGT  341

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
              FR + DVK LQRT+S+ETGMQSSLLALALANKFF DPLVGVPPAISVV+MSLMGF+LVM
Sbjct  342   WFRKSDDVKALQRTISFETGMQSSLLALALANKFFPDPLVGVPPAISVVLMSLMGFALVM  401

Query  177   FWNKNKS  157
              W+K + 
Sbjct  402   VWSKKRE  408



>ref|NP_001063701.1| Os09g0520600 [Oryza sativa Japonica Group]
 sp|Q650U0.1|BASS5_ORYSJ RecName: Full=Probable sodium/metabolite cotransporter BASS5, 
chloroplastic; AltName: Full=Bile acid-sodium symporter family 
protein 5; Flags: Precursor [Oryza sativa Japonica Group]
 sp|B8BDK4.1|BASS5_ORYSI RecName: Full=Probable sodium/metabolite cotransporter BASS5, 
chloroplastic; AltName: Full=Bile acid-sodium symporter family 
protein 5; Flags: Precursor [Oryza sativa Indica Group]
 dbj|BAD46677.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25615.1| Os09g0520600 [Oryza sativa Japonica Group]
 dbj|BAG95277.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84897.1| hypothetical protein OsI_32074 [Oryza sativa Indica Group]
 gb|EEE70066.1| hypothetical protein OsJ_30046 [Oryza sativa Japonica Group]
Length=401

 Score =   456 bits (1174),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 247/360 (69%), Positives = 297/360 (83%), Gaps = 1/360 (0%)
 Frame = -1

Query  1239  SSARSSRLPVSRCVSENLSDSIRPESLSNYAAESS-EIFKPKENSFLTVLRGANAILPHV  1063
             S  + S +  S  V  + S S   + + +    +S +I +  +   L +L+ AN I+PHV
Sbjct  39    SRQKGSVVAASGRVWASASGSFEKDRIGDDDVLASPQIVEESKVDLLKILKSANTIIPHV  98

Query  1062  VLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQ  883
             VLGSTILALVYPPSFTWFT+RYYAPALGFLMFAVGVNSS KDF+EA  RP AI AGY+GQ
Sbjct  99    VLGSTILALVYPPSFTWFTTRYYAPALGFLMFAVGVNSSVKDFIEAIQRPDAIAAGYVGQ  158

Query  882   FVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMt  703
             F++KP LG+LFGT+A+  F LPT+L AGIML SCVSGAQLSNYATFLTDP MAPLSIVMT
Sbjct  159   FIIKPFLGFLFGTLAVTIFNLPTALGAGIMLVSCVSGAQLSNYATFLTDPHMAPLSIVMT  218

Query  702   slstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIR  523
             SLSTATA  VTP LS  LIGK+LPVDV GM+S+I+QIVV P+AAGLLLNR+ P++C+AI+
Sbjct  219   SLSTATAVFVTPTLSYFLIGKKLPVDVKGMMSSIVQIVVAPIAAGLLLNRYLPRLCSAIQ  278

Query  522   PFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDA  343
             PFLPPLSVFVT+LCVG+PLAINI++V+SP GL+ +LL+ AFH S+FI+GY LAG  FR++
Sbjct  279   PFLPPLSVFVTALCVGSPLAINIKAVLSPFGLATVLLLFAFHTSSFIAGYHLAGTWFRES  338

Query  342   PDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
              DVK LQRT+S+ETGMQSSLLALALAN+FF DPLVGVPPAISVV+MSLMGF+LVM W+K 
Sbjct  339   ADVKALQRTVSFETGMQSSLLALALANRFFPDPLVGVPPAISVVLMSLMGFALVMVWSKR  398



>ref|XP_010540192.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=413

 Score =   456 bits (1174),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 246/334 (74%), Positives = 283/334 (85%), Gaps = 1/334 (0%)
 Frame = -1

Query  1158  SNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALG  979
             S   A+S E+   K+ S + VL+ AN+ILPHVVLGSTILAL+YPPSFTWFTSRY+ PALG
Sbjct  81    SGEEADSIEM-PEKKASLVDVLKQANSILPHVVLGSTILALLYPPSFTWFTSRYFVPALG  139

Query  978   FLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAG  799
             FLMFAVG+NS+EKDFLEAF RP AI AGY+GQ+V+KPLLGY+FG +A++ F LPT + AG
Sbjct  140   FLMFAVGINSNEKDFLEAFKRPDAIFAGYVGQYVIKPLLGYIFGIMAVSIFHLPTPIGAG  199

Query  798   IMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVI  619
             IML SCVSGAQLSNYATFLTDP +APLSIVMTSLSTATA LVTP LS+ LIGKRLPVDV 
Sbjct  200   IMLVSCVSGAQLSNYATFLTDPSLAPLSIVMTSLSTATAVLVTPMLSVFLIGKRLPVDVK  259

Query  618   GMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvs  439
             GMIS+I+Q+V+ P+AAGLLLNR FP++CNAIRPFLP LSV  T+ C+GAPLA+NI SV+S
Sbjct  260   GMISSILQVVIAPIAAGLLLNRLFPRLCNAIRPFLPVLSVLDTACCIGAPLALNINSVMS  319

Query  438   psglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANK  259
             P G ++L LV AFHL+AFI+GY L G AF  APDVK LQR LSYETGMQSSLLALALA K
Sbjct  320   PFGATILFLVTAFHLTAFIAGYFLTGYAFSKAPDVKALQRMLSYETGMQSSLLALALATK  379

Query  258   FFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             FFQDPLVGVPPAIS V+MSLMGF+LVM W   K 
Sbjct  380   FFQDPLVGVPPAISTVVMSLMGFTLVMLWTSRKE  413



>ref|XP_010540185.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=418

 Score =   455 bits (1170),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 242/321 (75%), Positives = 277/321 (86%), Gaps = 0/321 (0%)
 Frame = -1

Query  1119  KENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEK  940
             K+ S + VL+ AN+ILPHVVLGSTILAL+YPPSFTWFTSRY+ PALGFLMFAVG+NS+EK
Sbjct  98    KKASLVDVLKQANSILPHVVLGSTILALLYPPSFTWFTSRYFVPALGFLMFAVGINSNEK  157

Query  939   DFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLS  760
             DFLEAF RP AI AGY+GQ+V+KPLLGY+FG +A++ F LPT + AGIML SCVSGAQLS
Sbjct  158   DFLEAFKRPDAIFAGYVGQYVIKPLLGYIFGIMAVSIFHLPTPIGAGIMLVSCVSGAQLS  217

Query  759   NYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVP  580
             NYATFLTDP +APLSIVMTSLSTATA LVTP LS+ LIGKRLPVDV GMIS+I+Q+V+ P
Sbjct  218   NYATFLTDPSLAPLSIVMTSLSTATAVLVTPMLSVFLIGKRLPVDVKGMISSILQVVIAP  277

Query  579   VAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAF  400
             +AAGLLLNR FP++CNAIRPFLP LSV  T+ C+GAPLA+NI SV+SP G ++L LV AF
Sbjct  278   IAAGLLLNRLFPRLCNAIRPFLPVLSVLDTACCIGAPLALNINSVMSPFGATILFLVTAF  337

Query  399   HLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAI  220
             HL+AFI+GY L G AF  APDVK LQR LSYETGMQSSLLALALA KFFQDPLVGVPPAI
Sbjct  338   HLTAFIAGYFLTGYAFSKAPDVKALQRMLSYETGMQSSLLALALATKFFQDPLVGVPPAI  397

Query  219   SVVIMSLMGFSLVMFWNKNKS  157
             S V+MSLMGF+LVM W   K 
Sbjct  398   STVVMSLMGFTLVMLWTSRKE  418



>ref|XP_006440449.1| hypothetical protein CICLE_v10020346mg [Citrus clementina]
 gb|ESR53689.1| hypothetical protein CICLE_v10020346mg [Citrus clementina]
 gb|KDO63711.1| hypothetical protein CISIN_1g0148931mg [Citrus sinensis]
Length=297

 Score =   449 bits (1156),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 239/297 (80%), Positives = 268/297 (90%), Gaps = 0/297 (0%)
 Frame = -1

Query  1047  ILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKP  868
             +LALV+PPSFTWFT+RYYAPALGFLMFAVGVNSSEKDF+EAF RP AI AGY+GQFVVKP
Sbjct  1     MLALVFPPSFTWFTARYYAPALGFLMFAVGVNSSEKDFIEAFKRPAAIFAGYVGQFVVKP  60

Query  867   LLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslsta  688
             +LGY+FGTI+++ FGLPT + AGIML SCVSGAQLSNYATFLTDPP+APLSIVMTSLSTA
Sbjct  61    ILGYIFGTISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPLAPLSIVMTSLSTA  120

Query  687   taaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPP  508
             TA  VTP LSLLLIGKRLPVDV GM+S+I+QIVVVP+AAGLLLNRFFP++CNAIRPFLPP
Sbjct  121   TAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIVVVPIAAGLLLNRFFPRICNAIRPFLPP  180

Query  507   LSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKP  328
             LSV VT+ CVGAPLAINI+SV+SP GL++LLL+I FHLSAF++GY + G AF +A DVK 
Sbjct  181   LSVLVTACCVGAPLAINIESVMSPFGLTILLLIITFHLSAFVAGYVVTGLAFAEAHDVKA  240

Query  327   LQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             LQRTLSYETGMQSSLLALALAN+FFQDPLV VPPAIS VIMSLMGF LVM W K   
Sbjct  241   LQRTLSYETGMQSSLLALALANRFFQDPLVSVPPAISTVIMSLMGFFLVMLWAKKSE  297



>emb|CDX98774.1| BnaA03g45590D [Brassica napus]
Length=414

 Score =   451 bits (1161),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 244/354 (69%), Positives = 291/354 (82%), Gaps = 7/354 (2%)
 Frame = -1

Query  1206  RCVSENLSD-SIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVY  1030
             R  S+  SD  + P       A S ++F  + +S +  L+ AN+ILPHVVL ST+LAL+Y
Sbjct  67    RYASDKFSDMGLDP------GAGSDKMFNERASSIVETLKKANSILPHVVLASTVLALLY  120

Query  1029  PPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLF  850
             PPSFTWFTSRY+ PALGFLMFAVG+NS+EKDFLEAF RP AIL GY+GQ+++KPLLG++F
Sbjct  121   PPSFTWFTSRYFVPALGFLMFAVGINSNEKDFLEAFKRPKAILLGYLGQYLIKPLLGFIF  180

Query  849   GTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVT  670
             G  A++ F LPT + AGIML SCVSGAQLSNYATFLTDP +APLSIVMTSLSTATA LVT
Sbjct  181   GLAAVSLFQLPTPIGAGIMLVSCVSGAQLSNYATFLTDPALAPLSIVMTSLSTATAVLVT  240

Query  669   PFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVT  490
             P LSLLLIGK+LPVDV GM+S+I+Q+V+ P+AAGLLLN+ FP++ NAIRPFLP LSV  T
Sbjct  241   PMLSLLLIGKKLPVDVKGMVSSILQVVIAPIAAGLLLNKLFPKLSNAIRPFLPVLSVLDT  300

Query  489   SLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLS  310
             + CVGAPLA+NI SVVSP G ++LLLV  FHLSAF+SGY L G+ FR+APD K LQRTLS
Sbjct  301   ACCVGAPLALNINSVVSPFGATILLLVTMFHLSAFLSGYFLTGSVFRNAPDSKALQRTLS  360

Query  309   YETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV  148
             YETGMQSSLLALALA KFFQDPLVG+PPAIS V+MSLMGF+LVM W+  K  ++
Sbjct  361   YETGMQSSLLALALATKFFQDPLVGIPPAISTVVMSLMGFTLVMIWSNEKELSI  414



>ref|XP_008651591.1| PREDICTED: bile acid sodium symporter isoform X1 [Zea mays]
Length=406

 Score =   451 bits (1159),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 246/362 (68%), Positives = 296/362 (82%), Gaps = 3/362 (1%)
 Frame = -1

Query  1257  PRKSFNSSARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANA  1078
             PR S+    + S +   R +  + S S   +++   A   S+I    +  FL +L+ AN+
Sbjct  45    PRVSWQ---QGSGVVAKRLLWASASGSFEKDNIGEDAVLPSQIAVENKVDFLKILKSANS  101

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             I+PH+VLGSTILALVYPPSFTWFT+RYYAPALGFLMFAVGVNSS KDF+EA  RP AI A
Sbjct  102   IIPHIVLGSTILALVYPPSFTWFTTRYYAPALGFLMFAVGVNSSAKDFIEAIKRPDAIAA  161

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             GYIGQFV+KPL G+LFGT+A+A   LP +L AGIML SCVSGAQLSNYATFLTDP MAPL
Sbjct  162   GYIGQFVIKPLFGFLFGTLAVAVLNLPAALGAGIMLVSCVSGAQLSNYATFLTDPHMAPL  221

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             SIVMTSLSTATA  VTP LS  LIG++LPVDV GM+S+I+QIVV P+AAGLLLNRF P++
Sbjct  222   SIVMTSLSTATAVFVTPTLSYFLIGQKLPVDVKGMMSSIVQIVVAPIAAGLLLNRFLPRL  281

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
             C AI+PFLP +SVFVT+LCVG+PLAINI++V+SP GL+++LL+ AFH S+F++GY LAG 
Sbjct  282   CAAIQPFLPSMSVFVTALCVGSPLAINIKAVLSPFGLTIVLLLFAFHTSSFVAGYHLAGT  341

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
              FR + DVK LQRT+S+ETGMQSSLLALALANKFF DPLVGVPPAISVV+MSLMGF+LVM
Sbjct  342   WFRKSDDVKALQRTISFETGMQSSLLALALANKFFPDPLVGVPPAISVVLMSLMGFALVM  401

Query  177   FW  172
              +
Sbjct  402   IY  403



>ref|XP_002867746.1| bile acid:sodium symporter family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH44005.1| bile acid:sodium symporter family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=406

 Score =   450 bits (1158),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 248/376 (66%), Positives = 301/376 (80%), Gaps = 6/376 (2%)
 Frame = -1

Query  1257  PRKSFNSSARSSRL---PVSRCV-SENLSDSIRPESLSNYAA--ESSEIFKPKENSFLTV  1096
             P   F++S+ SS L   P+S+ + S NL      +  S      E++ +    + S +  
Sbjct  31    PPNIFSNSSLSSPLRIDPISQGIGSRNLWRRYASDHFSEMGLDPEANSVKVIDKASIVDT  90

Query  1095  LRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNR  916
             ++ AN+ILPHVVL STILAL+YPPSFTWFTSRY+ PALGFLMFAVG+NS+EKDFLEAF R
Sbjct  91    MKKANSILPHVVLASTILALLYPPSFTWFTSRYFVPALGFLMFAVGINSNEKDFLEAFKR  150

Query  915   PGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTD  736
             P AIL GY+GQ++VKP+LG++FG  A++ F LPT + AGIML SCVSGAQLSNYATFLTD
Sbjct  151   PKAILLGYVGQYLVKPILGFIFGLAAVSVFQLPTPIGAGIMLVSCVSGAQLSNYATFLTD  210

Query  735   PPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLN  556
             P +APLSIVMTSLSTATA LVTP LSLLLIGK+LPVDV GMIS+I+Q+V+ P+AAGLLLN
Sbjct  211   PALAPLSIVMTSLSTATAVLVTPMLSLLLIGKKLPVDVKGMISSILQVVIAPIAAGLLLN  270

Query  555   RFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISG  376
             + FP+V NAIRPFLP LSV  T+ CVGAPLA+NI SV+SP G ++LLLV  FHLSAF++G
Sbjct  271   KLFPKVSNAIRPFLPILSVLDTACCVGAPLALNINSVMSPFGATILLLVTMFHLSAFLAG  330

Query  375   YTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLM  196
             Y L G+ FR+APD K +QRTLSYETGMQSSLLALALA KFFQDPLVG+PPA+S V+MSLM
Sbjct  331   YFLTGSVFRNAPDAKAMQRTLSYETGMQSSLLALALATKFFQDPLVGIPPAVSTVVMSLM  390

Query  195   GFSLVMFWNKNKSTNV  148
             GF+LVM W+  K  N+
Sbjct  391   GFTLVMIWSNEKEKNI  406



>ref|XP_010433982.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
[Camelina sativa]
Length=413

 Score =   451 bits (1159),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 254/369 (69%), Positives = 298/369 (81%), Gaps = 9/369 (2%)
 Frame = -1

Query  1242  NSSARSSRL---PVSRCV-SENLSDSIRPESLS----NYAAESSEIFKPKENSFLTVLRG  1087
             NSS+ SS L   PVS+   S NL  S   +  S    N  A+S E+F  K  S +  L+ 
Sbjct  43    NSSSLSSPLRIKPVSQVGGSRNLWRSYASDKFSDMGLNPGADSFEMFSEKV-SIMDTLKK  101

Query  1086  ANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGA  907
             AN+ILPHVVL STILAL+YPPSFTWFTSRY+ PALGFLMFAVG+NS EKDFLEAF RP A
Sbjct  102   ANSILPHVVLASTILALLYPPSFTWFTSRYFVPALGFLMFAVGINSDEKDFLEAFKRPKA  161

Query  906   ILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPM  727
             IL GY+GQ+++KPLLG++FG  A++ F LPT + AGIML SCVSGAQLSNYATFLTDP +
Sbjct  162   ILLGYVGQYLIKPLLGFVFGLAAVSLFNLPTPIGAGIMLVSCVSGAQLSNYATFLTDPAL  221

Query  726   APLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFF  547
             APLSIVMTSLSTATA L+TP LSLLLIGK+LPVDV GMIS+I+Q+V+ P+AAGLLLN+ F
Sbjct  222   APLSIVMTSLSTATAVLITPMLSLLLIGKKLPVDVKGMISSILQVVIAPIAAGLLLNKLF  281

Query  546   PQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTL  367
             P+V NAIRPFLP LSV  T+ C+GAPLA+NI SV+SP G ++LLLV  FHLSAF++GY L
Sbjct  282   PKVSNAIRPFLPILSVLDTACCIGAPLALNINSVMSPFGATILLLVTMFHLSAFLAGYFL  341

Query  366   AGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
              G+ F +APD K LQRTLSYETGMQSSLLALALA KFFQDPLVG+PPAIS V+MSLMGF+
Sbjct  342   TGSVFSNAPDAKALQRTLSYETGMQSSLLALALATKFFQDPLVGIPPAISTVVMSLMGFT  401

Query  186   LVMFWNKNK  160
             LVM W+  K
Sbjct  402   LVMIWSNEK  410



>ref|XP_006660855.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic-like 
[Oryza brachyantha]
Length=370

 Score =   448 bits (1153),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 236/326 (72%), Positives = 278/326 (85%), Gaps = 0/326 (0%)
 Frame = -1

Query  1140  SSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAV  961
             S +I +      L +L+ AN I+PH+VLGSTILALVYPPSFTWFT+RYYAPALGFLMFAV
Sbjct  42    SPQIVEESNVDLLKILKSANTIIPHIVLGSTILALVYPPSFTWFTTRYYAPALGFLMFAV  101

Query  960   GVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSC  781
             GVNSS  DF+EA  RP AI AGY+GQF++KP  G+LFGT+A+  F LPT+L AGIML SC
Sbjct  102   GVNSSVNDFIEAIQRPDAIAAGYVGQFIIKPFFGFLFGTLAVTVFNLPTALGAGIMLVSC  161

Query  780   VSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNI  601
             VSGAQLSNYATFLTDP MAPLSIVMTSLSTATA  VTP LS  LIGK+LPVDV GM+S+I
Sbjct  162   VSGAQLSNYATFLTDPHMAPLSIVMTSLSTATAVFVTPTLSYFLIGKKLPVDVKGMMSSI  221

Query  600   IQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsv  421
             +QIVV P+AAGLLLNR+ P +C+AI+PFLPPLSVFVT+LCVG+PLAINI++V+SP GL+ 
Sbjct  222   VQIVVAPIAAGLLLNRYIPWLCSAIQPFLPPLSVFVTALCVGSPLAINIKAVLSPFGLAT  281

Query  420   lllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPL  241
             +LL+ AFH + F++GY LAG  FR + DVK LQRT+S+ETGMQSSLLALALAN+FF DPL
Sbjct  282   VLLLFAFHTTCFVAGYHLAGTWFRKSADVKALQRTVSFETGMQSSLLALALANRFFPDPL  341

Query  240   VGVPPAISVVIMSLMGFSLVMFWNKN  163
             VGVPPAISVV+MSLMGF+LVM W+K 
Sbjct  342   VGVPPAISVVLMSLMGFALVMVWSKR  367



>ref|XP_009137288.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
[Brassica rapa]
Length=414

 Score =   450 bits (1157),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 244/354 (69%), Positives = 290/354 (82%), Gaps = 7/354 (2%)
 Frame = -1

Query  1206  RCVSENLSD-SIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVY  1030
             R  S+  SD  + P       A S ++F  +  S +  L+ AN+ILPHVVL ST+LAL+Y
Sbjct  67    RYASDKFSDMGLDP------GAGSDKMFNERAASIVETLKKANSILPHVVLASTVLALLY  120

Query  1029  PPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLF  850
             PPSFTWFTSRY+ PALGFLMFAVG+NS+EKDFLEAF RP AIL GY+GQ+++KPLLG++F
Sbjct  121   PPSFTWFTSRYFVPALGFLMFAVGINSNEKDFLEAFKRPKAILLGYLGQYLIKPLLGFIF  180

Query  849   GTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVT  670
             G  A++ F LPT + AGIML SCVSGAQLSNYATFLTDP +APLSIVMTSLSTATA LVT
Sbjct  181   GLAAVSLFQLPTPIGAGIMLVSCVSGAQLSNYATFLTDPALAPLSIVMTSLSTATAVLVT  240

Query  669   PFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVT  490
             P LSLLLIGK+LPVDV GM+S+I+Q+V+ P+AAGLLLN+ FP++ NAIRPFLP LSV  T
Sbjct  241   PMLSLLLIGKKLPVDVKGMVSSILQVVIAPIAAGLLLNKLFPKLSNAIRPFLPVLSVLDT  300

Query  489   SLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLS  310
             + CVGAPLA+NI SVVSP G ++LLLV  FHLSAF+SGY L G+ FR+APD K LQRTLS
Sbjct  301   ACCVGAPLALNINSVVSPFGATILLLVTMFHLSAFLSGYFLTGSVFRNAPDSKALQRTLS  360

Query  309   YETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV  148
             YETGMQSSLLALALA KFFQDPLVG+PPAIS V+MSLMGF+LVM W+  K  ++
Sbjct  361   YETGMQSSLLALALATKFFQDPLVGIPPAISTVVMSLMGFTLVMIWSNEKELSI  414



>gb|KDO63708.1| hypothetical protein CISIN_1g0148931mg, partial [Citrus sinensis]
Length=354

 Score =   446 bits (1148),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 247/357 (69%), Positives = 288/357 (81%), Gaps = 19/357 (5%)
 Frame = -1

Query  1227  SSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGST  1048
             SSR  V+  VSEN+S     +   NY  ES+++   +E S + +L+ +N+ LPHVVLGST
Sbjct  17    SSRNFVTNSVSENISGPFDQDPDRNYVTESNQVLN-QEFSLVNILKQSNSFLPHVVLGST  75

Query  1047  ILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKP  868
             +LALV+PPSFTWFT+                  SEKDF+EAF RP AI AGY+GQFVVKP
Sbjct  76    MLALVFPPSFTWFTA------------------SEKDFIEAFKRPAAIFAGYVGQFVVKP  117

Query  867   LLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslsta  688
             +LGY+FGTI+++ FGLPT + AGIML SCVSGAQLSNYATFLTDPP+APLSIVMTSLSTA
Sbjct  118   ILGYIFGTISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPLAPLSIVMTSLSTA  177

Query  687   taaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPP  508
             TA  VTP LSLLLIGKRLPVDV GM+S+I+QIVVVP+AAGLLLNRFFP++CNAIRPFLPP
Sbjct  178   TAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIVVVPIAAGLLLNRFFPRICNAIRPFLPP  237

Query  507   LSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKP  328
             LSV VT+ CVGAPLAINI+SV+SP GL++LLL+I FHLSAF++GY + G AF +A DVK 
Sbjct  238   LSVLVTACCVGAPLAINIESVMSPFGLTILLLIITFHLSAFVAGYVVTGLAFAEAHDVKA  297

Query  327   LQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             LQRTLSYETGMQSSLLALALAN+FFQDPLV VPPAIS VIMSLMGF LVM W K   
Sbjct  298   LQRTLSYETGMQSSLLALALANRFFQDPLVSVPPAISTVIMSLMGFFLVMLWAKKSE  354



>ref|XP_006282633.1| hypothetical protein CARUB_v10004948mg [Capsella rubella]
 gb|EOA15531.1| hypothetical protein CARUB_v10004948mg [Capsella rubella]
Length=407

 Score =   448 bits (1153),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 250/374 (67%), Positives = 301/374 (80%), Gaps = 9/374 (2%)
 Frame = -1

Query  1257  PRKSFNSSARSSRL---PVSRCV-SENLSDSIRPESLS----NYAAESSEIFKPKENSFL  1102
             P  +F +S+ SS L   P+S+   S NL  S   +  S    N  A+S EIF  K  S +
Sbjct  34    PPNTFTNSSLSSSLRIEPISQVGGSRNLWRSYVSDKFSDMGLNPGADSFEIFSEKA-SIV  92

Query  1101  TVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAF  922
               L+ AN++LPHVVL STILAL+YPPSFTWFTSRY+ PALGFLMFAVG+NS+EKDFLEAF
Sbjct  93    DTLKKANSVLPHVVLASTILALIYPPSFTWFTSRYFVPALGFLMFAVGINSNEKDFLEAF  152

Query  921   NRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFL  742
              RP AIL GY+GQ+++KPLLG++FG  A++ F LPT + AGIML SCVSGAQLSNYATFL
Sbjct  153   KRPKAILLGYVGQYLIKPLLGFIFGLAAVSLFHLPTPIGAGIMLVSCVSGAQLSNYATFL  212

Query  741   TDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLL  562
             TDP +APLSIVMTSLSTATA L+TP LSLLLIGK+LPVDV GMIS+I+Q+VV P+AAGLL
Sbjct  213   TDPALAPLSIVMTSLSTATAVLITPMLSLLLIGKKLPVDVKGMISSILQVVVAPIAAGLL  272

Query  561   LNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFI  382
             LN+ FP+V NAIRPFLP LSV  T+ CVGAPLA+NI SV+SP G ++L LV  FHL+AF+
Sbjct  273   LNKLFPKVSNAIRPFLPILSVLDTACCVGAPLALNINSVMSPFGATILFLVTMFHLAAFL  332

Query  381   SGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMS  202
             +GY L G+ F ++PD K LQRTLS+ETGMQSSLLALALA KFFQDPLVG+PPAIS V+MS
Sbjct  333   AGYFLTGSVFSNSPDAKALQRTLSFETGMQSSLLALALATKFFQDPLVGIPPAISTVVMS  392

Query  201   LMGFSLVMFWNKNK  160
             LMGF+LVM W+ ++
Sbjct  393   LMGFTLVMIWSNDR  406



>ref|XP_006413612.1| hypothetical protein EUTSA_v10025337mg [Eutrema salsugineum]
 gb|ESQ55065.1| hypothetical protein EUTSA_v10025337mg [Eutrema salsugineum]
Length=411

 Score =   448 bits (1153),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 251/405 (62%), Positives = 302/405 (75%), Gaps = 21/405 (5%)
 Frame = -1

Query  1299  PCINLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSDSIRPESLSN----------Y  1150
             P   L        LPR S   S R    P++     +L+  +R + +S           Y
Sbjct  7     PIETLHLKSTLRLLPRGSVYRSQRIQLFPLNTFSDSSLTSPLRIDPISQGGGSRNLWRRY  66

Query  1149  AAE-----------SSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTS  1003
             A++            S+    +  S +  L+ AN+ILPHVVL STILAL+YPPSFTWFTS
Sbjct  67    ASDKFSEMGLDPGADSDKMYNEMASIVDTLKKANSILPHVVLASTILALLYPPSFTWFTS  126

Query  1002  RYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFG  823
             RY+ PALGFLMFAVG+NS+EKDFLEAF RP AIL GYIGQ+++KP+LG++FG  A++ F 
Sbjct  127   RYFVPALGFLMFAVGINSNEKDFLEAFKRPKAILLGYIGQYLIKPILGFIFGLAAVSLFQ  186

Query  822   LPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIG  643
             LPT + AGIML SCVSGAQLSNYATFLTDP +APLSIVMTSLSTATA LVTP LSLLLIG
Sbjct  187   LPTPIGAGIMLVSCVSGAQLSNYATFLTDPALAPLSIVMTSLSTATAVLVTPMLSLLLIG  246

Query  642   KRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLA  463
             K+LPVDV GMIS+I+Q+V+ P+AAGLLLN+ FP++ NAIRPFLP LSV  T+ CVGAPLA
Sbjct  247   KKLPVDVKGMISSILQVVIAPIAAGLLLNKLFPKLSNAIRPFLPVLSVLDTACCVGAPLA  306

Query  462   INIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSL  283
             +NI SV+SP G ++LLLV  FHLSAF++GY L G+ FR+ PD K LQRTLSYETGMQSSL
Sbjct  307   LNINSVMSPFGATILLLVTTFHLSAFLAGYFLTGSVFRNTPDGKALQRTLSYETGMQSSL  366

Query  282   LALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV  148
             LALALA KFFQDPLVG+PPAIS V+MSLMGF+LVM W+  K  N+
Sbjct  367   LALALATKFFQDPLVGIPPAISTVVMSLMGFTLVMIWSNEKEQNI  411



>emb|CDX94131.1| BnaC07g37650D [Brassica napus]
Length=414

 Score =   448 bits (1153),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 252/395 (64%), Positives = 302/395 (76%), Gaps = 24/395 (6%)
 Frame = -1

Query  1260  LPRKSFN--SSARSSRLPVSRCVSENLSDSIRPESLSN----------YAAE--------  1141
             LPR S     S R   LP++   + +L+   R  SLS           YA++        
Sbjct  20    LPRASTAPYRSQRVQLLPLNALSNSSLTSPARIVSLSQGGGSIDLWRRYASDKFSDMGLD  79

Query  1140  ----SSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFL  973
                 S ++F     S +  L+ AN+ILPHVVL ST+LAL+YPPSFTWFTSRY+ PALGFL
Sbjct  80    PGTGSDKMFNETPTSIVETLKKANSILPHVVLASTVLALLYPPSFTWFTSRYFVPALGFL  139

Query  972   MFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIM  793
             MFAVG+NS+EKDFLEAF RP AIL GY+GQ+++KPLLG++FG  A++ F LPT + AGIM
Sbjct  140   MFAVGINSNEKDFLEAFKRPKAILLGYLGQYLIKPLLGFIFGLAAVSLFQLPTPIGAGIM  199

Query  792   LTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGM  613
             L SCVSGAQLSNYATFLTDP +APLSIVMTSLSTATA LVTP LSLLLIGK+LPVDV GM
Sbjct  200   LVSCVSGAQLSNYATFLTDPALAPLSIVMTSLSTATAVLVTPMLSLLLIGKKLPVDVRGM  259

Query  612   ISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsps  433
             +S+I+Q+V+ P+AAGLLLN+ FP++ NAIRPFLP LSV  T+ CVGAPLA+NI SV+SP 
Sbjct  260   VSSILQVVIAPIAAGLLLNKLFPKLSNAIRPFLPVLSVLDTACCVGAPLALNINSVMSPF  319

Query  432   glsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFF  253
             G ++LLLV  FHLSAF SGY L G+ FR+APD K LQRTLSYETGMQSSLLALALA KFF
Sbjct  320   GATILLLVTMFHLSAFFSGYFLTGSVFRNAPDAKALQRTLSYETGMQSSLLALALATKFF  379

Query  252   QDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV  148
             QDPLVG+PPAIS V+MSLMGF+LVM W+  K  ++
Sbjct  380   QDPLVGIPPAISTVVMSLMGFTLVMIWSNGKEQSI  414



>ref|NP_001150034.1| bile acid sodium symporter [Zea mays]
 gb|ACG37581.1| bile acid sodium symporter [Zea mays]
Length=409

 Score =   448 bits (1152),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 244/367 (66%), Positives = 294/367 (80%), Gaps = 3/367 (1%)
 Frame = -1

Query  1257  PRKSFNSSARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANA  1078
             PR S+    + S +   R +  + S S   +++       S+I    +   L +L+ AN+
Sbjct  45    PRVSWQ---QGSGVVAKRLLWASASGSFEKDNIGEDVVLPSQIAVENKVDLLKILKSANS  101

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             I+PH+VLGSTILALVYPPSFTWFT+RYYAPALGFLMFAVGVNSS  DF+EA  RP AI A
Sbjct  102   IIPHIVLGSTILALVYPPSFTWFTTRYYAPALGFLMFAVGVNSSANDFIEAIKRPDAIAA  161

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             GYIGQFV+KPL G+LF T+A+A   LP +L AGIML SCVSGAQLSNYATFLTDP MAPL
Sbjct  162   GYIGQFVIKPLFGFLFDTLAVAVLNLPAALGAGIMLVSCVSGAQLSNYATFLTDPHMAPL  221

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             SIVMTSLSTATA  VTP LS  LIG++LPVDV GM+S+IIQIVV P+AAGLLLNRF P++
Sbjct  222   SIVMTSLSTATAVFVTPTLSYFLIGQKLPVDVKGMMSSIIQIVVAPIAAGLLLNRFLPRL  281

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
             C AI+PFLP +SVFVT+LCVG+PLAINI++V+SP GL+++LL+ AFH S+F++GY LAG 
Sbjct  282   CAAIQPFLPSMSVFVTALCVGSPLAINIKAVLSPFGLTIVLLLFAFHTSSFVAGYHLAGT  341

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
              F  + DVK LQRT+S+ETGMQSSLLALALANKFF DPLVGVPPAISVV+MSLMGF+LVM
Sbjct  342   WFSKSDDVKALQRTISFETGMQSSLLALALANKFFPDPLVGVPPAISVVLMSLMGFALVM  401

Query  177   FWNKNKS  157
              W+K + 
Sbjct  402   VWSKKRE  408



>ref|XP_010448822.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X2 [Camelina sativa]
Length=414

 Score =   448 bits (1152),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 252/369 (68%), Positives = 299/369 (81%), Gaps = 9/369 (2%)
 Frame = -1

Query  1242  NSSARSSRL---PVSRCV-SENLSDSIRPESLS----NYAAESSEIFKPKENSFLTVLRG  1087
             NSS+ SS L   PVS+   S NL  S   +  S    N  A+S E+F  K  S +  L+ 
Sbjct  44    NSSSLSSPLHIKPVSQVGGSRNLWRSYASDKFSDMGLNPGADSFEMFSEKV-SIMDTLKK  102

Query  1086  ANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGA  907
             AN+ILPHVVL STILAL+YPPSFTWFTSRY+ PALGFLMFAVG+NS EKDFLEAF RP A
Sbjct  103   ANSILPHVVLASTILALLYPPSFTWFTSRYFVPALGFLMFAVGINSDEKDFLEAFKRPKA  162

Query  906   ILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPM  727
             IL GY+GQ+++KPLLG++FG  A++ F LPT + AGIML SCVSGAQLSNYATFLTDP +
Sbjct  163   ILLGYVGQYLIKPLLGFVFGLAAVSLFHLPTPIGAGIMLVSCVSGAQLSNYATFLTDPAL  222

Query  726   APLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFF  547
             APLSIVMTSLSTATA L+TP LSLLLIGK+LPVDV GMIS+I+Q+V+ P+AAGLLLN+ F
Sbjct  223   APLSIVMTSLSTATAVLITPMLSLLLIGKKLPVDVKGMISSILQVVIAPIAAGLLLNKLF  282

Query  546   PQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTL  367
             P+V NA+RPFLP LSV  T+ CVGAPLA+NI SV+SP G+++LLLV  FH+SAF++GY L
Sbjct  283   PKVSNAVRPFLPILSVLDTACCVGAPLALNINSVMSPFGVTILLLVTMFHISAFLAGYFL  342

Query  366   AGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
              G+ F ++PD K LQRTLSYETGMQSSLLALALA KFFQDPLVG+PPAIS V+MSLMGF+
Sbjct  343   TGSVFSNSPDAKALQRTLSYETGMQSSLLALALATKFFQDPLVGIPPAISTVVMSLMGFT  402

Query  186   LVMFWNKNK  160
             LVM W+  K
Sbjct  403   LVMIWSNEK  411



>ref|XP_003576744.2| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Brachypodium distachyon]
Length=487

 Score =   450 bits (1158),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 241/318 (76%), Positives = 278/318 (87%), Gaps = 0/318 (0%)
 Frame = -1

Query  1125  KPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSS  946
             +  +  FL +L+ AN+I+PHVVLGSTILALVYPPSFTWFT+RYYAPALGFLMFAVGVNSS
Sbjct  84    EESKVDFLKILKSANSIIPHVVLGSTILALVYPPSFTWFTTRYYAPALGFLMFAVGVNSS  143

Query  945   EKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQ  766
              KDF+EA  RP AI AGYIGQF+ KP  G+LFGT+A   F LPT+L AGIML SCVSGAQ
Sbjct  144   VKDFIEAIQRPDAIAAGYIGQFMFKPFFGFLFGTLAATTFNLPTALGAGIMLVSCVSGAQ  203

Query  765   LSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVV  586
             LSNYATFLTDP MAPLSIVMTSLSTATA  VTP LS LLIGK+LPVDVIGM+S+I+QIVV
Sbjct  204   LSNYATFLTDPHMAPLSIVMTSLSTATAVFVTPTLSYLLIGKKLPVDVIGMMSSIVQIVV  263

Query  585   VPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVI  406
              P+AAGLLLNRF P++C+AI+PFLPPLSVFVT+LCVG+PLAINI+SV+SP GLS++ L+ 
Sbjct  264   APIAAGLLLNRFLPRLCSAIQPFLPPLSVFVTALCVGSPLAINIKSVLSPYGLSIVFLLF  323

Query  405   AFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPP  226
             AFH ++FI+GY LAG  FR + DVK LQRT+S+ETGMQSSLLALALAN+FF DPLVGVPP
Sbjct  324   AFHTTSFIAGYHLAGTWFRKSADVKALQRTISFETGMQSSLLALALANRFFPDPLVGVPP  383

Query  225   AISVVIMSLMGFSLVMFW  172
             A+SVV+MSLMGF LVM W
Sbjct  384   AVSVVLMSLMGFGLVMVW  401



>ref|NP_567671.1| putative sodium/metabolite cotransporter BASS6 [Arabidopsis thaliana]
 sp|Q8VYY4.1|BASS6_ARATH RecName: Full=Probable sodium/metabolite cotransporter BASS6, 
chloroplastic; AltName: Full=Bile acid transporter 4; AltName: 
Full=Bile acid-sodium symporter family protein 6; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL38902.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51324.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67166.1| unknown [Arabidopsis thaliana]
 gb|AEE84665.1| putative sodium/metabolite cotransporter BASS6 [Arabidopsis thaliana]
Length=409

 Score =   446 bits (1146),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 250/375 (67%), Positives = 302/375 (81%), Gaps = 6/375 (2%)
 Frame = -1

Query  1257  PRKSFNSSARSSRL---PVSRCV-SENLSDSIRPESLSNYAAE-SSEIFKPKEN-SFLTV  1096
             P   F++++ SS L   P+S+   S NL      ++ S    +  ++ FK  E  S +  
Sbjct  34    PPNIFSNTSLSSPLRIDPISQVGGSRNLWRRYASDNFSEMGLDPGADPFKVIEKPSIVDR  93

Query  1095  LRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNR  916
             ++ AN+ILPHVVL STILAL+YPPSFTWFTSRY+ PALGFLMFAVG+NS+EKDFLEAF R
Sbjct  94    MKKANSILPHVVLASTILALIYPPSFTWFTSRYFVPALGFLMFAVGINSNEKDFLEAFKR  153

Query  915   PGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTD  736
             P AIL GY+GQ++VKP+LG++FG  A++ F LPT + AGIML SCVSGAQLSNYATFLTD
Sbjct  154   PKAILLGYVGQYLVKPVLGFIFGLAAVSLFQLPTPIGAGIMLVSCVSGAQLSNYATFLTD  213

Query  735   PPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLN  556
             P +APLSIVMTSLSTATA LVTP LSLLLIGK+LPVDV GMIS+I+Q+V+ P+AAGLLLN
Sbjct  214   PALAPLSIVMTSLSTATAVLVTPMLSLLLIGKKLPVDVKGMISSILQVVIAPIAAGLLLN  273

Query  555   RFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISG  376
             + FP+V NAIRPFLP LSV  T+ CVGAPLA+NI SV+SP G ++LLLV  FHLSAF++G
Sbjct  274   KLFPKVSNAIRPFLPILSVLDTACCVGAPLALNINSVMSPFGATILLLVTMFHLSAFLAG  333

Query  375   YTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLM  196
             Y L G+ FR+APD K +QRTLSYETGMQSSLLALALA KFFQDPLVG+PPAIS V+MSLM
Sbjct  334   YFLTGSVFRNAPDAKAMQRTLSYETGMQSSLLALALATKFFQDPLVGIPPAISTVVMSLM  393

Query  195   GFSLVMFWNKNKSTN  151
             GF+LV+ W+K KS  
Sbjct  394   GFTLVLIWSKEKSNT  408



>ref|XP_003611207.1| hypothetical protein MTR_5g011440 [Medicago truncatula]
 gb|AES94165.1| Na+-bile acid cotransporter [Medicago truncatula]
Length=425

 Score =   445 bits (1144),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 245/360 (68%), Positives = 293/360 (81%), Gaps = 14/360 (4%)
 Frame = -1

Query  1227  SSRLPVSRCVSE--NLSDSIRPESLSNYAAESSEIFKPKENSFLTVL---RGANAILPHV  1063
             SSRLP+ +C S   N SD             SS   KP + SFL++L   + +N++LP  
Sbjct  66    SSRLPL-KCASSSTNFSDPT--------PNHSSHPTKPVKQSFLSILDILKNSNSLLPPA  116

Query  1062  VLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQ  883
             ++ ST+LAL++PPS TWFT+RY+APALGFLMFAVGVNSSEKDF+EAFNRP  I  GY GQ
Sbjct  117   IVSSTLLALIFPPSLTWFTTRYFAPALGFLMFAVGVNSSEKDFIEAFNRPAEIATGYFGQ  176

Query  882   FVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMt  703
             FVVKPLLGYLF  IA+  FGLPT + AG++L +CVSGAQLSNYATFLTDP MAPLSIVMT
Sbjct  177   FVVKPLLGYLFYIIAVTVFGLPTGIGAGMVLVACVSGAQLSNYATFLTDPEMAPLSIVMT  236

Query  702   slstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIR  523
             SLSTA+A  VTP L LLLIGKRLP+DV GM+ +I QIVVVP+A GLLLNRFFP +CNAIR
Sbjct  237   SLSTASAVFVTPLLLLLLIGKRLPIDVKGMVFSITQIVVVPIAVGLLLNRFFPPICNAIR  296

Query  522   PFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDA  343
             PFLPPLSV   ++C GAPLA+N++ + SP G+S+LLLV+AFHLSAFI+GY L+G+ FRD+
Sbjct  297   PFLPPLSVLTAAICAGAPLALNVECIKSPLGISILLLVVAFHLSAFIAGYMLSGSVFRDS  356

Query  342   PDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
             PDVKPLQRT+S+ETGMQSSLLALALANKFF+DP+VG+PPAIS  IMSLMGF LV+ WNK+
Sbjct  357   PDVKPLQRTISFETGMQSSLLALALANKFFEDPVVGMPPAISTAIMSLMGFGLVLIWNKS  416



>gb|KEH27447.1| Na+-bile acid cotransporter [Medicago truncatula]
Length=432

 Score =   445 bits (1144),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 245/360 (68%), Positives = 293/360 (81%), Gaps = 14/360 (4%)
 Frame = -1

Query  1227  SSRLPVSRCVSE--NLSDSIRPESLSNYAAESSEIFKPKENSFLTVL---RGANAILPHV  1063
             SSRLP+ +C S   N SD             SS   KP + SFL++L   + +N++LP  
Sbjct  73    SSRLPL-KCASSSTNFSDPT--------PNHSSHPTKPVKQSFLSILDILKNSNSLLPPA  123

Query  1062  VLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQ  883
             ++ ST+LAL++PPS TWFT+RY+APALGFLMFAVGVNSSEKDF+EAFNRP  I  GY GQ
Sbjct  124   IVSSTLLALIFPPSLTWFTTRYFAPALGFLMFAVGVNSSEKDFIEAFNRPAEIATGYFGQ  183

Query  882   FVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMt  703
             FVVKPLLGYLF  IA+  FGLPT + AG++L +CVSGAQLSNYATFLTDP MAPLSIVMT
Sbjct  184   FVVKPLLGYLFYIIAVTVFGLPTGIGAGMVLVACVSGAQLSNYATFLTDPEMAPLSIVMT  243

Query  702   slstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIR  523
             SLSTA+A  VTP L LLLIGKRLP+DV GM+ +I QIVVVP+A GLLLNRFFP +CNAIR
Sbjct  244   SLSTASAVFVTPLLLLLLIGKRLPIDVKGMVFSITQIVVVPIAVGLLLNRFFPPICNAIR  303

Query  522   PFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDA  343
             PFLPPLSV   ++C GAPLA+N++ + SP G+S+LLLV+AFHLSAFI+GY L+G+ FRD+
Sbjct  304   PFLPPLSVLTAAICAGAPLALNVECIKSPLGISILLLVVAFHLSAFIAGYMLSGSVFRDS  363

Query  342   PDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
             PDVKPLQRT+S+ETGMQSSLLALALANKFF+DP+VG+PPAIS  IMSLMGF LV+ WNK+
Sbjct  364   PDVKPLQRTISFETGMQSSLLALALANKFFEDPVVGMPPAISTAIMSLMGFGLVLIWNKS  423



>gb|KFK39256.1| hypothetical protein AALP_AA3G220600 [Arabis alpina]
Length=411

 Score =   438 bits (1127),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 242/361 (67%), Positives = 290/361 (80%), Gaps = 8/361 (2%)
 Frame = -1

Query  1239  SSARSSRLPVSRCVSENLSD-SIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHV  1063
             S    SR+   R  S+  SD  + P + SN           +++S +  L+ AN+ILP V
Sbjct  53    SQGVGSRILWRRYASDEFSDMGLDPGADSNKMNN-------EKDSIVETLKKANSILPQV  105

Query  1062  VLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQ  883
             VL ST+LALVYPPSFTWFTSRY+ PALGFLMFAVG+NS+EKDFLEAF RP AIL GY+GQ
Sbjct  106   VLASTVLALVYPPSFTWFTSRYFVPALGFLMFAVGINSNEKDFLEAFKRPKAILLGYVGQ  165

Query  882   FVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMt  703
             +++KP+LG++FG  A++ F LPT + AGIML SCVSGAQLSNYATFLTDP +APLSIVMT
Sbjct  166   YLIKPILGFIFGLAAVSLFQLPTPIGAGIMLVSCVSGAQLSNYATFLTDPSLAPLSIVMT  225

Query  702   slstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIR  523
             SLSTATA LVTP LSLLLIGK+LPVDV GMIS+I+Q+V+ P+AAGLLLN+ FP+V NAIR
Sbjct  226   SLSTATAVLVTPMLSLLLIGKKLPVDVKGMISSILQVVLAPIAAGLLLNKLFPKVSNAIR  285

Query  522   PFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDA  343
             PFLP LSV  T+ CVGAPLA+NI SV+SP G ++LLLV  FHLSAF++GY L G+ F +A
Sbjct  286   PFLPILSVLDTACCVGAPLALNISSVMSPFGATILLLVTMFHLSAFLAGYFLTGSVFGNA  345

Query  342   PDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
             PD K LQRTLSYETGMQSSLLALALA +FF+DPLVG+PPA+S V+MSLMGFSLVM W+  
Sbjct  346   PDGKALQRTLSYETGMQSSLLALALATRFFEDPLVGIPPAVSTVVMSLMGFSLVMIWSNE  405

Query  162   K  160
             K
Sbjct  406   K  406



>ref|XP_010448821.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X1 [Camelina sativa]
Length=427

 Score =   438 bits (1127),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 252/382 (66%), Positives = 299/382 (78%), Gaps = 22/382 (6%)
 Frame = -1

Query  1242  NSSARSSRL---PVSRCV-SENLSDSIRPESLS----NYAAESSEIFKPKENSFLTVLRG  1087
             NSS+ SS L   PVS+   S NL  S   +  S    N  A+S E+F  K  S +  L+ 
Sbjct  44    NSSSLSSPLHIKPVSQVGGSRNLWRSYASDKFSDMGLNPGADSFEMFSEKV-SIMDTLKK  102

Query  1086  ANAILPHVVLGSTILALVYPPSFTWFTSR-------------YYAPALGFLMFAVGVNSS  946
             AN+ILPHVVL STILAL+YPPSFTWFTSR             Y+ PALGFLMFAVG+NS 
Sbjct  103   ANSILPHVVLASTILALLYPPSFTWFTSRFLLYIIHGILSTRYFVPALGFLMFAVGINSD  162

Query  945   EKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQ  766
             EKDFLEAF RP AIL GY+GQ+++KPLLG++FG  A++ F LPT + AGIML SCVSGAQ
Sbjct  163   EKDFLEAFKRPKAILLGYVGQYLIKPLLGFVFGLAAVSLFHLPTPIGAGIMLVSCVSGAQ  222

Query  765   LSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVV  586
             LSNYATFLTDP +APLSIVMTSLSTATA L+TP LSLLLIGK+LPVDV GMIS+I+Q+V+
Sbjct  223   LSNYATFLTDPALAPLSIVMTSLSTATAVLITPMLSLLLIGKKLPVDVKGMISSILQVVI  282

Query  585   VPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVI  406
              P+AAGLLLN+ FP+V NA+RPFLP LSV  T+ CVGAPLA+NI SV+SP G+++LLLV 
Sbjct  283   APIAAGLLLNKLFPKVSNAVRPFLPILSVLDTACCVGAPLALNINSVMSPFGVTILLLVT  342

Query  405   AFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPP  226
              FH+SAF++GY L G+ F ++PD K LQRTLSYETGMQSSLLALALA KFFQDPLVG+PP
Sbjct  343   MFHISAFLAGYFLTGSVFSNSPDAKALQRTLSYETGMQSSLLALALATKFFQDPLVGIPP  402

Query  225   AISVVIMSLMGFSLVMFWNKNK  160
             AIS V+MSLMGF+LVM W+  K
Sbjct  403   AISTVVMSLMGFTLVMIWSNEK  424



>ref|NP_974538.1| probable sodium/metabolite cotransporter BASS5 [Arabidopsis thaliana]
 sp|F4JPW1.1|BASS5_ARATH RecName: Full=Probable sodium/metabolite cotransporter BASS5, 
chloroplastic; AltName: Full=Bile acid transporter 5; AltName: 
Full=Bile acid-sodium symporter family protein 5; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE83087.1| probable sodium/metabolite cotransporter BASS5 [Arabidopsis thaliana]
Length=407

 Score =   432 bits (1112),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 238/371 (64%), Positives = 288/371 (78%), Gaps = 3/371 (1%)
 Frame = -1

Query  1263  SLPRKSFNSSARSS-RLPV-SRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLR  1090
             + PR SF+S    S   P+ S  +S+N S SI P       ++S+E++  K +S +  L+
Sbjct  38    NFPRNSFSSLGSCSVDFPLRSNPISQN-SKSIHPWRRYVSESDSNELYHKKVSSIMETLK  96

Query  1089  GANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPG  910
              A + +PH +L STILALVYPPSFTWF  RY+ P LGF+MFAVG+NS+E+DFLEA  RP 
Sbjct  97    QAYSFIPHGILLSTILALVYPPSFTWFKPRYFVPGLGFMMFAVGINSNERDFLEALKRPD  156

Query  909   AILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPP  730
             AI AGYIGQ+++KPLLGY+FG IA++ F LPTS+ AGIML SCVSGAQLSNY TFLTDP 
Sbjct  157   AIFAGYIGQYLIKPLLGYIFGVIAVSLFNLPTSIGAGIMLVSCVSGAQLSNYTTFLTDPS  216

Query  729   MAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRF  550
             +A LSIVMTS+STATA LVTP LSLLLIGK+LPVDV GMIS+I+Q+V+ P+AAGLLLNR 
Sbjct  217   LAALSIVMTSISTATAVLVTPMLSLLLIGKKLPVDVFGMISSILQVVITPIAAGLLLNRL  276

Query  549   FPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYT  370
             FP++ NAI+PFLP L+V   S C+GAPLA+NI S++SP G ++L LVI FHL AF++GY 
Sbjct  277   FPRLSNAIKPFLPALTVIDMSCCIGAPLALNIDSILSPFGATILFLVITFHLLAFVAGYF  336

Query  369   LAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGF  190
               G  F  APDVK LQRT+SYETGMQSSLLALALA KFFQDPLVGVPPAIS V+MSLMG 
Sbjct  337   FTGFFFSKAPDVKALQRTISYETGMQSSLLALALATKFFQDPLVGVPPAISTVVMSLMGV  396

Query  189   SLVMFWNKNKS  157
             SLV  W   K 
Sbjct  397   SLVTIWKNRKE  407



>gb|KHN34981.1| Putative sodium-dependent transporter yocS [Glycine soja]
Length=416

 Score =   432 bits (1111),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 241/397 (61%), Positives = 298/397 (75%), Gaps = 8/397 (2%)
 Frame = -1

Query  1332  KIHHPSLPKPLPCINLEFHYPFLSLPRKSFNSS--ARSSRLPVSRCVSENLSDSIRPESL  1159
             K   P  P  +PC     H    S     FNS    RS ++P+ +C   + SDS+ P+  
Sbjct  22    KSQQPPNPIIVPCCRTNTHNNISSPFSIRFNSPFPYRSPKIPL-KCAPLHSSDSLPPD--  78

Query  1158  SNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALG  979
                 + +S   +    S L +L+ +N+ LPH ++ S +LAL+YP S TWFTSR+YAPALG
Sbjct  79    ---PSSASTQMEQNSMSILEILKQSNSYLPHALIASILLALIYPRSLTWFTSRFYAPALG  135

Query  978   FLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAG  799
             FLMFAVGVNS+E DFLEAF RP  I+ GY GQF VKPLLGYLF  IA+   GLPT++ AG
Sbjct  136   FLMFAVGVNSNENDFLEAFKRPAEIVTGYFGQFAVKPLLGYLFCMIAVTVLGLPTTVGAG  195

Query  798   IMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVI  619
             I+L +CVSGAQLS+YATFLTDP MAPLSIVMTSLSTA+A  VTP L LLLIGK+LP+DV 
Sbjct  196   IVLVACVSGAQLSSYATFLTDPQMAPLSIVMTSLSTASAVFVTPLLLLLLIGKKLPIDVK  255

Query  618   GMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvs  439
             GM+ NI QIVVVP+AAGLLLNRFFP++CN IRPFLPPLSV V S+C GAPLA+N++++ S
Sbjct  256   GMVYNITQIVVVPIAAGLLLNRFFPRICNVIRPFLPPLSVLVASICAGAPLALNVETMKS  315

Query  438   psglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANK  259
             P G+++LLLV+AFHLS+FI+GY L+G  FRD+ DVK LQRT+S+ETGMQSSLLALALANK
Sbjct  316   PLGVAILLLVVAFHLSSFIAGYILSGFVFRDSLDVKALQRTISFETGMQSSLLALALANK  375

Query  258   FFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV  148
             FF+DP V +PPAIS  IMSLMGF LV+ W +   + +
Sbjct  376   FFEDPKVAIPPAISTSIMSLMGFVLVLIWTRRGKSEI  412



>ref|XP_002872639.1| bile acid:sodium symporter family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH48898.1| bile acid:sodium symporter family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=409

 Score =   431 bits (1109),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 235/373 (63%), Positives = 288/373 (77%), Gaps = 5/373 (1%)
 Frame = -1

Query  1263  SLPRKSFNSSARSS---RLPV-SRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTV  1096
             + P  SF+ S++ S     P+ S  +S+N   S  P       ++S+E++  K +S +  
Sbjct  38    TFPCNSFSFSSQGSCSVDFPIQSNLISQN-GKSSYPWRRYVSESDSNEMYHKKVSSIMET  96

Query  1095  LRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNR  916
             L+ AN+ +PH +L STILAL+YPPSFTWF  RY+ P LGF+MFAVG+NS+E+DFLEA  R
Sbjct  97    LKQANSFIPHAILLSTILALLYPPSFTWFKPRYFVPGLGFMMFAVGINSNERDFLEALKR  156

Query  915   PGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTD  736
             P AI AGYIGQ+++KPLLGY+FG IA++ F LPTS+ AGIML SCVSGAQLSNY TFLTD
Sbjct  157   PDAIFAGYIGQYLIKPLLGYIFGVIAVSLFNLPTSIGAGIMLVSCVSGAQLSNYTTFLTD  216

Query  735   PPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLN  556
             P +APLSIVMTS+STATA LVTP LSLLLIGK+LPVDVIGMIS+I+Q+VV P+AAGLLLN
Sbjct  217   PSLAPLSIVMTSVSTATAVLVTPMLSLLLIGKKLPVDVIGMISSILQVVVTPIAAGLLLN  276

Query  555   RFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISG  376
             R FP++ NAI+PFLP L+V     C+GAPLA+NI S++SP G ++L +VI FHL AF++G
Sbjct  277   RLFPRLSNAIKPFLPALTVIDMGCCIGAPLALNIDSILSPFGATILFIVITFHLLAFVAG  336

Query  375   YTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLM  196
             Y   G  F   PDVK LQRT+SYETGMQSSLLALALA KFFQDPLVGVPPAIS V+MSLM
Sbjct  337   YFFTGFFFSKVPDVKALQRTISYETGMQSSLLALALATKFFQDPLVGVPPAISTVVMSLM  396

Query  195   GFSLVMFWNKNKS  157
             G SLV  W   K 
Sbjct  397   GVSLVTIWKNRKE  409



>emb|CAA16569.1| predicted protein [Arabidopsis thaliana]
 emb|CAA19799.1| putative protein [Arabidopsis thaliana]
 emb|CAB79239.1| predicted protein [Arabidopsis thaliana]
Length=460

 Score =   433 bits (1114),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 240/366 (66%), Positives = 291/366 (80%), Gaps = 8/366 (2%)
 Frame = -1

Query  1224  SRLPVSRCVSENLS--------DSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILP  1069
             SR    R  S+N S        D  +  ++ ++   S   +  ++ S +  ++ AN+ILP
Sbjct  94    SRNLWRRYASDNFSEMGLDPGADPFKVCAMGSFLFHSMLCWVIEKPSIVDRMKKANSILP  153

Query  1068  HVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYI  889
             HVVL STILAL+YPPSFTWFTSR++    GFLMFAVG+NS+EKDFLEAF RP AIL GY+
Sbjct  154   HVVLASTILALIYPPSFTWFTSRFFPLEQGFLMFAVGINSNEKDFLEAFKRPKAILLGYV  213

Query  888   GQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIV  709
             GQ++VKP+LG++FG  A++ F LPT + AGIML SCVSGAQLSNYATFLTDP +APLSIV
Sbjct  214   GQYLVKPVLGFIFGLAAVSLFQLPTPIGAGIMLVSCVSGAQLSNYATFLTDPALAPLSIV  273

Query  708   MtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNA  529
             MTSLSTATA LVTP LSLLLIGK+LPVDV GMIS+I+Q+V+ P+AAGLLLN+ FP+V NA
Sbjct  274   MTSLSTATAVLVTPMLSLLLIGKKLPVDVKGMISSILQVVIAPIAAGLLLNKLFPKVSNA  333

Query  528   IRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFR  349
             IRPFLP LSV  T+ CVGAPLA+NI SV+SP G ++LLLV  FHLSAF++GY L G+ FR
Sbjct  334   IRPFLPILSVLDTACCVGAPLALNINSVMSPFGATILLLVTMFHLSAFLAGYFLTGSVFR  393

Query  348   DAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWN  169
             +APD K +QRTLSYETGMQSSLLALALA KFFQDPLVG+PPAIS V+MSLMGF+LV+ W+
Sbjct  394   NAPDAKAMQRTLSYETGMQSSLLALALATKFFQDPLVGIPPAISTVVMSLMGFTLVLIWS  453

Query  168   KNKSTN  151
             K KS  
Sbjct  454   KEKSNT  459



>gb|KHN42731.1| Putative sodium-dependent transporter yocS [Glycine soja]
Length=408

 Score =   431 bits (1107),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 241/404 (60%), Positives = 301/404 (75%), Gaps = 29/404 (7%)
 Frame = -1

Query  1326  HHPSLPKP--LPC---------INLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSD  1180
             H P    P  LPC         I    H+P+            RS+++P+ +C   + SD
Sbjct  19    HFPKSKPPILLPCCPTISSPFSIRFNSHFPY------------RSTKVPL-KCAPLHSSD  65

Query  1179  SIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSR  1000
             S+ P+ LS+   ++ +       S L +L+ +N+ LPHV++ S +LAL+YPPS TWFTSR
Sbjct  66    SLPPD-LSDAPTQTEQ----NSMSILEILKQSNSYLPHVLIASILLALIYPPSLTWFTSR  120

Query  999   YYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGL  820
             YYAPALGFLMFAVGVNS+E DFLEAF RP  I+ GY GQF VKPLLGYLF  IA+    L
Sbjct  121   YYAPALGFLMFAVGVNSNENDFLEAFKRPAEIVTGYFGQFAVKPLLGYLFCMIAVTVLSL  180

Query  819   PTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGK  640
             PT++ AGI+L +CVSGAQLS+YATFLTDP MAPLSIVMTSLSTA+A  VTP L LLLIGK
Sbjct  181   PTTVGAGIVLVACVSGAQLSSYATFLTDPQMAPLSIVMTSLSTASAVFVTPLLLLLLIGK  240

Query  639   RLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAI  460
             +LP+DV GM+ +I QIVVVP+AAGLLLNRF+P++CN IRPFLPPLSV V S+C GAPLA 
Sbjct  241   KLPIDVRGMVYSITQIVVVPIAAGLLLNRFYPRICNVIRPFLPPLSVLVASICAGAPLAF  300

Query  459   NIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLL  280
             N++++ SP G+++LLLV+AFHLS+FI+GY L+G  FRD+ DVK LQRT+S+ETGMQSSLL
Sbjct  301   NVETMKSPLGVAILLLVVAFHLSSFIAGYILSGFVFRDSLDVKALQRTISFETGMQSSLL  360

Query  279   ALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV  148
             ALALANKFF+DP V +PPAIS  IMSLMGF LV+ W +    ++
Sbjct  361   ALALANKFFEDPKVAIPPAISTSIMSLMGFVLVLIWTRRGKRDI  404



>ref|XP_009114643.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Brassica rapa]
Length=408

 Score =   430 bits (1106),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 229/330 (69%), Positives = 274/330 (83%), Gaps = 1/330 (0%)
 Frame = -1

Query  1146  AESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMF  967
             +ES+E++  K  S + VL+ AN+ +PHV L STILAL+YPPSFTWF  RY+ P LGF+MF
Sbjct  80    SESAEVYNEKV-SIMEVLKKANSFIPHVTLSSTILALLYPPSFTWFKPRYFVPGLGFMMF  138

Query  966   AVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLT  787
             AVG+NS+E+DFLEA  RP AI AGYIGQ+++KPLLGY+FG IA++ F LPT + AGIML 
Sbjct  139   AVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYMFGLIAVSHFKLPTPIGAGIMLV  198

Query  786   SCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMIS  607
             SCVSGAQLSNY TFLTDP +APLSIVMTS+STATAALVTP LSLLLIGK+LPVDV+GM+S
Sbjct  199   SCVSGAQLSNYTTFLTDPSLAPLSIVMTSISTATAALVTPMLSLLLIGKKLPVDVVGMVS  258

Query  606   NIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsgl  427
             +I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L++   + C+GAPLA+NI S++SP G 
Sbjct  259   SILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTLIDMACCLGAPLALNIDSILSPFGA  318

Query  426   svlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQD  247
             ++LLLVI FHL AF++GY L G  F  APDVK LQRTLSYETGMQSSLLALALA KFFQD
Sbjct  319   TILLLVITFHLLAFVAGYFLTGLLFSKAPDVKALQRTLSYETGMQSSLLALALATKFFQD  378

Query  246   PLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             PLVGVPPAIS V+MSLMG SLV  W   K 
Sbjct  379   PLVGVPPAISTVVMSLMGVSLVTIWKNRKE  408



>ref|XP_003517442.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic-like 
[Glycine max]
Length=408

 Score =   430 bits (1105),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 237/385 (62%), Positives = 296/385 (77%), Gaps = 19/385 (5%)
 Frame = -1

Query  1299  PC-INLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFK  1123
             PC I    H+P+            RS+++P+ +C     SDS+ P+ LS+   ++ +   
Sbjct  38    PCSIRFNSHFPY------------RSTKVPL-KCAPLPSSDSLPPD-LSDAPTQTEQ---  80

Query  1122  PKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSE  943
                 S L +L+ +N+ LPHV++ S +LAL+YPPS TWFTSRYYAPALGFLMFAVGVNS+E
Sbjct  81    -NSMSILEILKQSNSYLPHVLIASILLALIYPPSLTWFTSRYYAPALGFLMFAVGVNSNE  139

Query  942   KDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQL  763
              DFLEAF RP  I+ GY GQF VKPLLGYLF  IA+    LPT++ AGI+L +CVSGAQL
Sbjct  140   NDFLEAFKRPAEIVTGYFGQFAVKPLLGYLFCMIAVTVLSLPTTVGAGIVLVACVSGAQL  199

Query  762   SNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVV  583
             S+YATFLTDP MAPLSIVMTSLSTA+A  VTP L LLLIGK+LP+DV GM+ +I QIVVV
Sbjct  200   SSYATFLTDPQMAPLSIVMTSLSTASAVFVTPLLLLLLIGKKLPIDVRGMVYSITQIVVV  259

Query  582   PVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIA  403
             P+AAGLLLNRF+P++CN IRPFLPPLSV V S+C GAPLA N++++ SP G+++LLLV+A
Sbjct  260   PIAAGLLLNRFYPRICNVIRPFLPPLSVLVASICAGAPLAFNVETMKSPLGVAILLLVVA  319

Query  402   FHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPA  223
             FHLS+FI+GY L+G  FRD+ DVK LQRT+S+ETGMQSSLLALALANKFF+DP V +PPA
Sbjct  320   FHLSSFIAGYILSGFVFRDSLDVKALQRTISFETGMQSSLLALALANKFFEDPKVAIPPA  379

Query  222   ISVVIMSLMGFSLVMFWNKNKSTNV  148
             IS  IMSLMGF LV+ W +    ++
Sbjct  380   ISTSIMSLMGFVLVLIWTRRGKRDI  404



>ref|XP_009761033.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X4 [Nicotiana sylvestris]
Length=276

 Score =   425 bits (1092),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 235/273 (86%), Positives = 248/273 (91%), Gaps = 0/273 (0%)
 Frame = -1

Query  972  MFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIM  793
            MFAVGVNSSEKDFLEAF +P AI AGYIGQF VKPLLGYLFGT+A+  F LPTSLAAGIM
Sbjct  1    MFAVGVNSSEKDFLEAFKKPAAIFAGYIGQFAVKPLLGYLFGTLAMTVFDLPTSLAAGIM  60

Query  792  LTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGM  613
            LTSCVSGAQLSNYATFLTDP MAPLSIVMTSLSTATA  VTP LSLLLIGK+LPVDV GM
Sbjct  61   LTSCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTATAVFVTPILSLLLIGKKLPVDVKGM  120

Query  612  ISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsps  433
            +SNI+QIVV PVA GLL+NRFFPQ+CNAIRP LPPLSVFVT+LCVGAPLAINI+S+VSPS
Sbjct  121  VSNILQIVVAPVAGGLLMNRFFPQICNAIRPLLPPLSVFVTALCVGAPLAINIESLVSPS  180

Query  432  glsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFF  253
            G+SVLLLVIAFHLSAFI GY L+G AF  APDVK LQRTLSYETGMQSSLLALALANKFF
Sbjct  181  GMSVLLLVIAFHLSAFILGYLLSGIAFHKAPDVKALQRTLSYETGMQSSLLALALANKFF  240

Query  252  QDPLVGVPPAISVVIMSLMGFSLVMFWNKNKST  154
            QDPLVGVPPAISVVIMSLMGFSLVM W K K T
Sbjct  241  QDPLVGVPPAISVVIMSLMGFSLVMLWAKKKET  273



>ref|XP_004511635.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic-like 
[Cicer arietinum]
Length=411

 Score =   430 bits (1105),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 229/314 (73%), Positives = 268/314 (85%), Gaps = 0/314 (0%)
 Frame = -1

Query  1104  LTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEA  925
             + +L+ +N++LP  +  ST+LAL++PPS TWFT+RYYAPALGFLMFAVGVNSSEKDFLEA
Sbjct  88    IAILKNSNSLLPPAIFASTLLALIFPPSLTWFTTRYYAPALGFLMFAVGVNSSEKDFLEA  147

Query  924   FNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATF  745
             FNRP  I  GY GQFVVKPLLGYLF  IA+  FGLPT + AGI+L  CVSGAQLSNYATF
Sbjct  148   FNRPAEIATGYFGQFVVKPLLGYLFYIIAVNVFGLPTGIGAGIVLVGCVSGAQLSNYATF  207

Query  744   LTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGL  565
             LTDP MAPLSIVMTSLSTA+A  VTP L LLLIGKRLPVDV GM+ +I QIVV P+AAGL
Sbjct  208   LTDPQMAPLSIVMTSLSTASAVFVTPLLLLLLIGKRLPVDVKGMVFSITQIVVAPIAAGL  267

Query  564   LLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAF  385
             LLNRFFP++CNAIRPFLPPLSV V ++C GAPLA+NI  + SP G+S+LLL++AFHLSAF
Sbjct  268   LLNRFFPRICNAIRPFLPPLSVLVAAICAGAPLALNIDCIKSPLGVSILLLLVAFHLSAF  327

Query  384   ISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIM  205
             I+GY L+G+ FRD+ DVKPLQRT+S+ETGMQSSLLALAL+NKFF+DP+V +PPAIS  IM
Sbjct  328   IAGYVLSGSVFRDSLDVKPLQRTISFETGMQSSLLALALSNKFFEDPVVSMPPAISTAIM  387

Query  204   SLMGFSLVMFWNKN  163
             SLMGF LV+ W K 
Sbjct  388   SLMGFGLVLIWTKR  401



>ref|XP_003538535.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic-like 
[Glycine max]
Length=416

 Score =   429 bits (1103),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 240/397 (60%), Positives = 298/397 (75%), Gaps = 8/397 (2%)
 Frame = -1

Query  1332  KIHHPSLPKPLPCINLEFHYPFLSLPRKSFNSS--ARSSRLPVSRCVSENLSDSIRPESL  1159
             K   P  P  +PC     +    S     FNS    RS ++P+ +C   + SDS+ P+  
Sbjct  22    KSQQPPNPIIVPCCRTNTNNNISSPFSIRFNSPFPYRSPKIPL-KCAPLHSSDSLPPD--  78

Query  1158  SNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALG  979
                 + +S   +    S L +L+ +N+ LPH ++ S +LAL+YP S TWFTSR+YAPALG
Sbjct  79    ---PSSASTQMEQNSMSILEILKQSNSYLPHALIASILLALIYPRSLTWFTSRFYAPALG  135

Query  978   FLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAG  799
             FLMFAVGVNS+E DFLEAF RP  I+ GY GQF VKPLLGYLF  IA+   GLPT++ AG
Sbjct  136   FLMFAVGVNSNENDFLEAFKRPAEIVTGYFGQFAVKPLLGYLFCMIAVTVLGLPTTVGAG  195

Query  798   IMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVI  619
             I+L +CVSGAQLS+YATFLTDP MAPLSIVMTSLSTA+A  VTP L LLLIGK+LP+DV 
Sbjct  196   IVLVACVSGAQLSSYATFLTDPQMAPLSIVMTSLSTASAVFVTPLLLLLLIGKKLPIDVK  255

Query  618   GMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvs  439
             GM+ NI QIVVVP+AAGLLLNRFFP++CN IRPFLPPLSV V S+C GAPLA+N++++ S
Sbjct  256   GMVYNITQIVVVPIAAGLLLNRFFPRICNVIRPFLPPLSVLVASICAGAPLALNVETMKS  315

Query  438   psglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANK  259
             P G+++LLLV+AFHLS+FI+GY L+G  FRD+ DVK LQRT+S+ETGMQSSLLALALANK
Sbjct  316   PLGVAILLLVVAFHLSSFIAGYILSGFVFRDSLDVKALQRTISFETGMQSSLLALALANK  375

Query  258   FFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV  148
             FF+DP V +PPAIS  IMSLMGF LV+ W +   + +
Sbjct  376   FFEDPKVAIPPAISTSIMSLMGFVLVLIWTRRGKSEI  412



>gb|EMS66927.1| putative sodium-dependent transporter yocS [Triticum urartu]
Length=655

 Score =   437 bits (1123),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 235/339 (69%), Positives = 277/339 (82%), Gaps = 26/339 (8%)
 Frame = -1

Query  1110  SFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTS------------------------  1003
              FL +L+ AN+I+PHVVLGSTILAL+YPPSFTWFT+                        
Sbjct  231   DFLKILKSANSIIPHVVLGSTILALLYPPSFTWFTTSEQGYDELTMDKCSIDSIKLERWY  290

Query  1002  --RYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAA  829
               RYYAPALGFLMFAVGVNSS KDF+EA  RPGAI AGYIGQF+ KP  G+LFGT+A+  
Sbjct  291   LLRYYAPALGFLMFAVGVNSSVKDFIEAIKRPGAIAAGYIGQFIAKPFFGFLFGTLAVTT  350

Query  828   FGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLL  649
             F LPT++ AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+A   TP LS LL
Sbjct  351   FNLPTAVGAGIMLVSCVSGAQLSNYATFLTDPHMAPLSIVMTSLSTASAVFFTPTLSYLL  410

Query  648   IGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAP  469
             IGK+LPVDV+GM+S+I+QIVV P+AAGLLLNRF P++C+AI+PFLPPLSVFVT+LCVG+P
Sbjct  411   IGKKLPVDVVGMMSSIVQIVVAPIAAGLLLNRFLPRLCSAIQPFLPPLSVFVTALCVGSP  470

Query  468   LAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQS  289
             LAINI++V+SP GLS++ L+ AFH ++F++GY LAG  FR + DVK LQRT+S+ETGMQS
Sbjct  471   LAINIKAVLSPYGLSIVFLLFAFHTTSFVAGYHLAGTWFRKSADVKALQRTISFETGMQS  530

Query  288   SLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFW  172
             SLLALALAN+FF DPLVGVPPA+SVV+MSLMGF LVM W
Sbjct  531   SLLALALANRFFPDPLVGVPPAVSVVLMSLMGFGLVMLW  569



>ref|XP_004959610.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic-like 
[Setaria italica]
Length=409

 Score =   428 bits (1100),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 231/338 (68%), Positives = 278/338 (82%), Gaps = 0/338 (0%)
 Frame = -1

Query  1227  SSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGST  1048
             S  + + R +  + S S+  + +   A   S++ +  +   L +LR AN ++PH+VLGST
Sbjct  49    SGGVAMRRRLWVSASGSMEQDDVGEDAVLPSQVVEEGKVDLLKILRSANTVIPHIVLGST  108

Query  1047  ILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKP  868
             ILALVYPPSFTWFT+RYYAPALGFLMF+VGVNSS KDF+EA  RP AI AGYIGQFV+KP
Sbjct  109   ILALVYPPSFTWFTTRYYAPALGFLMFSVGVNSSVKDFVEAIKRPDAIAAGYIGQFVIKP  168

Query  867   LLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslsta  688
             L G+LFGT+A+A    PT+L AGIML SCVSGAQLSNYATFLTDP MAPLSIVMT+LSTA
Sbjct  169   LFGFLFGTLAVAVLNFPTALGAGIMLVSCVSGAQLSNYATFLTDPHMAPLSIVMTALSTA  228

Query  687   taaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPP  508
             TA  VTP LS  LIG++LPVDV GM+S+I+QIVV P+AAGLLLNRF P++C AI+PFLPP
Sbjct  229   TAVFVTPTLSYFLIGQKLPVDVKGMMSSIVQIVVAPIAAGLLLNRFLPRLCAAIQPFLPP  288

Query  507   LSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKP  328
             LSVFVT+LCVG+PLAINI++V+SP GL+++LL+ AFH S+F+SGY LAG  F  + DVK 
Sbjct  289   LSVFVTALCVGSPLAINIKAVLSPFGLAIVLLLFAFHTSSFLSGYHLAGTWFHKSADVKA  348

Query  327   LQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISV  214
             LQRT+S+ETGMQSSLLALALANKFF DPLVGVPPAISV
Sbjct  349   LQRTISFETGMQSSLLALALANKFFPDPLVGVPPAISV  386



>ref|XP_011033862.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
[Populus euphratica]
Length=392

 Score =   426 bits (1096),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 232/375 (62%), Positives = 284/375 (76%), Gaps = 19/375 (5%)
 Frame = -1

Query  1377  SPCVKLLQPQLNQGFKIHHPSLPKPLPCIN---------------LEFHYPFLSLPRKSF  1243
             S  +++ +P ++Q   IH+  +     C N               LE      S+P K  
Sbjct  6     SRTLQIQRPDISQ---IHNQKISHVRKCCNNQLSVLTPSRSFKSFLELRSLGFSMPLKP-  61

Query  1242  NSSARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHV  1063
             N    SSR  VSRC S+  SDS+ P+   NY  +SS++ + K+ S + +L  +N++LPH+
Sbjct  62    NFHCGSSRFLVSRCESQKFSDSLEPDHDQNYVTDSSQMVEQKKASIVDMLEQSNSLLPHI  121

Query  1062  VLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQ  883
             VL ST++ALV+PPSFTWFT+RYYAPALGFLMFAVG+NSSEKDFLEAFNRP AILAGY+GQ
Sbjct  122   VLASTLVALVHPPSFTWFTTRYYAPALGFLMFAVGINSSEKDFLEAFNRPAAILAGYVGQ  181

Query  882   FVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMt  703
             FVVKP+LGYLFG I+++ FGLPT + AGIML SCVSGAQLSNYATFLTDPPMAPLSIVMT
Sbjct  182   FVVKPILGYLFGIISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPMAPLSIVMT  241

Query  702   slstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIR  523
             S+STATA  VTP LSLLLIGKRLPVDV GM+S+I+QIV+ P+AAGLLLNR FPQ+ + IR
Sbjct  242   SMSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSIMQIVIAPIAAGLLLNRLFPQISDVIR  301

Query  522   PFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDA  343
             PFLPPLSV VT+ CVGAPLAIN+ SV+SP G++++ L+IAFHLSAF+ GY   G  F  A
Sbjct  302   PFLPPLSVLVTACCVGAPLAINVDSVMSPFGVTIVSLIIAFHLSAFVVGYYFTGFVFHKA  361

Query  342   PDVKPLQRTLSYETG  298
              D+K LQRTLSYETG
Sbjct  362   FDLKALQRTLSYETG  376



>ref|XP_010422171.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X2 [Camelina sativa]
Length=400

 Score =   426 bits (1094),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 224/330 (68%), Positives = 271/330 (82%), Gaps = 1/330 (0%)
 Frame = -1

Query  1146  AESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMF  967
             ++++E++  K+ S +  L+ AN+ +PH +L STILAL+YPPSFTWF  RY+ P LGF+MF
Sbjct  72    SDTNEMYH-KKVSIMETLKQANSYIPHAILSSTILALLYPPSFTWFKPRYFVPGLGFMMF  130

Query  966   AVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLT  787
             AVG+NS+E+DFLEA  RP AI AGYIGQ+++KPLLGY+FG IA++ F LPTS+ AGIML 
Sbjct  131   AVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYIFGLIAVSLFNLPTSIGAGIMLV  190

Query  786   SCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMIS  607
             SCVSGAQLSNY TFLTDP +APLSIVMTS+STATA LVTP LSLLLIGK+LPVDVIGMIS
Sbjct  191   SCVSGAQLSNYTTFLTDPSLAPLSIVMTSVSTATAVLVTPMLSLLLIGKKLPVDVIGMIS  250

Query  606   NIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsgl  427
             +I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     C+GAPLA+NI S++SP G 
Sbjct  251   SILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGCCIGAPLALNIDSILSPFGA  310

Query  426   svlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQD  247
             ++L LV+ FHL AF++GY   G  F  APDVK LQRT+SYETGMQSSLLALALA KFFQD
Sbjct  311   TILFLVVTFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYETGMQSSLLALALATKFFQD  370

Query  246   PLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             PLVGVPPAIS V+MSLMG SLV  W   K 
Sbjct  371   PLVGVPPAISTVVMSLMGVSLVTIWKNRKE  400



>ref|XP_010422170.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X1 [Camelina sativa]
Length=409

 Score =   426 bits (1094),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 224/330 (68%), Positives = 271/330 (82%), Gaps = 1/330 (0%)
 Frame = -1

Query  1146  AESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMF  967
             ++++E++  K+ S +  L+ AN+ +PH +L STILAL+YPPSFTWF  RY+ P LGF+MF
Sbjct  81    SDTNEMYH-KKVSIMETLKQANSYIPHAILSSTILALLYPPSFTWFKPRYFVPGLGFMMF  139

Query  966   AVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLT  787
             AVG+NS+E+DFLEA  RP AI AGYIGQ+++KPLLGY+FG IA++ F LPTS+ AGIML 
Sbjct  140   AVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYIFGLIAVSLFNLPTSIGAGIMLV  199

Query  786   SCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMIS  607
             SCVSGAQLSNY TFLTDP +APLSIVMTS+STATA LVTP LSLLLIGK+LPVDVIGMIS
Sbjct  200   SCVSGAQLSNYTTFLTDPSLAPLSIVMTSVSTATAVLVTPMLSLLLIGKKLPVDVIGMIS  259

Query  606   NIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsgl  427
             +I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     C+GAPLA+NI S++SP G 
Sbjct  260   SILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGCCIGAPLALNIDSILSPFGA  319

Query  426   svlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQD  247
             ++L LV+ FHL AF++GY   G  F  APDVK LQRT+SYETGMQSSLLALALA KFFQD
Sbjct  320   TILFLVVTFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYETGMQSSLLALALATKFFQD  379

Query  246   PLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             PLVGVPPAIS V+MSLMG SLV  W   K 
Sbjct  380   PLVGVPPAISTVVMSLMGVSLVTIWKNRKE  409



>ref|XP_010433855.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X2 [Camelina sativa]
Length=400

 Score =   425 bits (1093),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 224/330 (68%), Positives = 271/330 (82%), Gaps = 1/330 (0%)
 Frame = -1

Query  1146  AESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMF  967
             ++++E++  K+ S +  L+ AN+ +PH +L STILAL+YPPSFTWF  RY+ P LGF+MF
Sbjct  72    SDTNEMYH-KKVSIMETLKQANSFIPHAILSSTILALLYPPSFTWFKPRYFVPGLGFMMF  130

Query  966   AVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLT  787
             AVG+NS+E+DFLEA  RP AI AGYIGQ+++KPLLGY+FG IA++ F LPTS+ AGIML 
Sbjct  131   AVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYIFGLIAVSLFNLPTSIGAGIMLV  190

Query  786   SCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMIS  607
             SCVSGAQLSNY TFLTDP +APLSIVMTS+STATA LVTP LSLLLIGK+LPVDVIGMIS
Sbjct  191   SCVSGAQLSNYTTFLTDPSLAPLSIVMTSVSTATAVLVTPMLSLLLIGKKLPVDVIGMIS  250

Query  606   NIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsgl  427
             +I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     C+GAPLA+NI S++SP G 
Sbjct  251   SILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGCCIGAPLALNIDSILSPFGA  310

Query  426   svlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQD  247
             ++L LV+ FHL AF++GY   G  F  APDVK LQRT+SYETGMQSSLLALALA KFFQD
Sbjct  311   TILFLVVTFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYETGMQSSLLALALATKFFQD  370

Query  246   PLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             PLVGVPPAIS V+MSLMG SLV  W   K 
Sbjct  371   PLVGVPPAISTVVMSLMGVSLVTIWKNRKE  400



>ref|XP_006290019.1| hypothetical protein CARUB_v10003651mg [Capsella rubella]
 gb|EOA22917.1| hypothetical protein CARUB_v10003651mg [Capsella rubella]
Length=412

 Score =   426 bits (1094),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 230/351 (66%), Positives = 280/351 (80%), Gaps = 2/351 (1%)
 Frame = -1

Query  1209  SRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVY  1030
             S  +S+N  +S  P       ++++E++  K+ S +  L+ AN+ +PH +L STILAL+Y
Sbjct  64    SNPISQN-GNSSYPWRRYVSESDTNEMYH-KKVSIMETLKQANSFIPHAILSSTILALLY  121

Query  1029  PPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLF  850
             PPSFTWF  RY+ P LGF+MFAVG+NS+E+DFLEA  RP AI AGYIGQ+++KPLLGYLF
Sbjct  122   PPSFTWFKPRYFVPGLGFMMFAVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYLF  181

Query  849   GTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVT  670
             G I+++ F LPTS+ AGIML SCVSGAQLSNY TFLTDP +APLSIVMTS+STATAALVT
Sbjct  182   GVISVSLFNLPTSIGAGIMLVSCVSGAQLSNYTTFLTDPSLAPLSIVMTSVSTATAALVT  241

Query  669   PFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVT  490
             P LSLLLIGK+LPVDV+GMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V   
Sbjct  242   PMLSLLLIGKKLPVDVVGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDM  301

Query  489   SLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLS  310
               C+GAPLA+NI S++SP G ++L LVI FHL AF++GY   G  F  APDVK LQRT+S
Sbjct  302   GCCIGAPLALNIDSILSPFGATILFLVITFHLLAFVAGYFFTGFFFSKAPDVKALQRTIS  361

Query  309   YETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             YETGMQSSLLALALA KFFQDPLVGVPPAIS V+MSLMG SLV  W   K 
Sbjct  362   YETGMQSSLLALALATKFFQDPLVGVPPAISTVVMSLMGVSLVTIWKNRKE  412



>gb|AES94166.2| Na+-bile acid cotransporter [Medicago truncatula]
Length=330

 Score =   422 bits (1086),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 269/314 (86%), Gaps = 0/314 (0%)
 Frame = -1

Query  1119  KENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEK  940
             K  S L +L+ AN+ILP+VVL ST++ALV+PPSFTWFTSRYYAPALG+LMFAVGVNSSEK
Sbjct  4     KPMSILEILKQANSILPYVVLASTLVALVFPPSFTWFTSRYYAPALGYLMFAVGVNSSEK  63

Query  939   DFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLS  760
             DFLEAFNRP  ++  Y+GQFVVKPLLGYL   I++  FGLP+++ AGI+L +CVSGAQLS
Sbjct  64    DFLEAFNRPAELVTAYVGQFVVKPLLGYLLCIISVNLFGLPSAIGAGIVLLACVSGAQLS  123

Query  759   NYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVP  580
             +YATFL+DP MAPLSIVMTSLST +A  VTP L L  IGKRLP+DV GM+ +I QIV+VP
Sbjct  124   SYATFLSDPQMAPLSIVMTSLSTISAVFVTPLLLLFFIGKRLPIDVKGMVFSITQIVLVP  183

Query  579   VAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAF  400
             +  GLLLNRF+P +CNAIRPFLPPLSV V +L  GAPLA+NI+SV SP G S+LLL +AF
Sbjct  184   ITFGLLLNRFYPNICNAIRPFLPPLSVLVAALSAGAPLALNIKSVKSPFGFSILLLAVAF  243

Query  399   HLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAI  220
             HLS+F+SGY L+G  FRD+PDVKPLQRT+S+ETGMQSSLLALALANKFF+DP+VG+P AI
Sbjct  244   HLSSFVSGYILSGFIFRDSPDVKPLQRTISFETGMQSSLLALALANKFFEDPVVGMPSAI  303

Query  219   SVVIMSLMGFSLVM  178
             S  +MSLMGFSLV+
Sbjct  304   SSPLMSLMGFSLVL  317



>ref|XP_010433847.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
isoform X1 [Camelina sativa]
Length=409

 Score =   425 bits (1093),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 224/330 (68%), Positives = 271/330 (82%), Gaps = 1/330 (0%)
 Frame = -1

Query  1146  AESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMF  967
             ++++E++  K+ S +  L+ AN+ +PH +L STILAL+YPPSFTWF  RY+ P LGF+MF
Sbjct  81    SDTNEMYH-KKVSIMETLKQANSFIPHAILSSTILALLYPPSFTWFKPRYFVPGLGFMMF  139

Query  966   AVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLT  787
             AVG+NS+E+DFLEA  RP AI AGYIGQ+++KPLLGY+FG IA++ F LPTS+ AGIML 
Sbjct  140   AVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYIFGLIAVSLFNLPTSIGAGIMLV  199

Query  786   SCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMIS  607
             SCVSGAQLSNY TFLTDP +APLSIVMTS+STATA LVTP LSLLLIGK+LPVDVIGMIS
Sbjct  200   SCVSGAQLSNYTTFLTDPSLAPLSIVMTSVSTATAVLVTPMLSLLLIGKKLPVDVIGMIS  259

Query  606   NIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsgl  427
             +I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     C+GAPLA+NI S++SP G 
Sbjct  260   SILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGCCIGAPLALNIDSILSPFGA  319

Query  426   svlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQD  247
             ++L LV+ FHL AF++GY   G  F  APDVK LQRT+SYETGMQSSLLALALA KFFQD
Sbjct  320   TILFLVVTFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYETGMQSSLLALALATKFFQD  379

Query  246   PLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             PLVGVPPAIS V+MSLMG SLV  W   K 
Sbjct  380   PLVGVPPAISTVVMSLMGVSLVTIWKNRKE  409



>ref|XP_008448928.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X3 [Cucumis melo]
Length=297

 Score =   421 bits (1082),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 226/285 (79%), Positives = 250/285 (88%), Gaps = 0/285 (0%)
 Frame = -1

Query  1002  RYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFG  823
             RYYAPALGFLMFAVGVNSSEKDF EAF +P AI AGY+GQF VKP+LGYLFGTIA+  FG
Sbjct  9     RYYAPALGFLMFAVGVNSSEKDFFEAFKQPAAIFAGYVGQFFVKPVLGYLFGTIAVTLFG  68

Query  822   LPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIG  643
             LPT++ AGIML SCVSGAQLS+YATFLTDP +APLS+VMTSLSTATA  VTPFLSLLLIG
Sbjct  69    LPTAIGAGIMLVSCVSGAQLSSYATFLTDPALAPLSVVMTSLSTATAVFVTPFLSLLLIG  128

Query  642   KRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLA  463
             KRLPVDV GMIS+I QIVV P+AAGLLLNRFFP++C AIRPFLPPLSV VT+ CVGAP A
Sbjct  129   KRLPVDVKGMISSITQIVVAPIAAGLLLNRFFPRICEAIRPFLPPLSVLVTACCVGAPFA  188

Query  462   INIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSL  283
             INI +V+SP G S+LLL++AFHLSAFI+GY L G AF  + DVK LQRTLSYETGMQSSL
Sbjct  189   INIHAVISPFGFSILLLIVAFHLSAFIAGYALTGLAFHRSLDVKALQRTLSYETGMQSSL  248

Query  282   LALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV  148
             LALALAN+FFQDPLV VPPAIS V+MSLMGFSLVM WNK K  N+
Sbjct  249   LALALANRFFQDPLVSVPPAISTVMMSLMGFSLVMIWNKGKEKNM  293



>gb|KDO63709.1| hypothetical protein CISIN_1g0148931mg, partial [Citrus sinensis]
 gb|KDO63710.1| hypothetical protein CISIN_1g0148931mg, partial [Citrus sinensis]
Length=339

 Score =   421 bits (1083),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 227/312 (73%), Positives = 268/312 (86%), Gaps = 1/312 (0%)
 Frame = -1

Query  1227  SSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGST  1048
             SSR  V+  VSEN+S     +   NY  ES+++   +E S + +L+ +N+ LPHVVLGST
Sbjct  17    SSRNFVTNSVSENISGPFDQDPDRNYVTESNQVLN-QEFSLVNILKQSNSFLPHVVLGST  75

Query  1047  ILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKP  868
             +LALV+PPSFTWFT+RYYAPALGFLMFAVGVNSSEKDF+EAF RP AI AGY+GQFVVKP
Sbjct  76    MLALVFPPSFTWFTARYYAPALGFLMFAVGVNSSEKDFIEAFKRPAAIFAGYVGQFVVKP  135

Query  867   LLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslsta  688
             +LGY+FGTI+++ FGLPT + AGIML SCVSGAQLSNYATFLTDPP+APLSIVMTSLSTA
Sbjct  136   ILGYIFGTISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPLAPLSIVMTSLSTA  195

Query  687   taaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPP  508
             TA  VTP LSLLLIGKRLPVDV GM+S+I+QIVVVP+AAGLLLNRFFP++CNAIRPFLPP
Sbjct  196   TAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIVVVPIAAGLLLNRFFPRICNAIRPFLPP  255

Query  507   LSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKP  328
             LSV VT+ CVGAPLAINI+SV+SP GL++LLL+I FHLSAF++GY + G AF +A DVK 
Sbjct  256   LSVLVTACCVGAPLAINIESVMSPFGLTILLLIITFHLSAFVAGYVVTGLAFAEAHDVKA  315

Query  327   LQRTLSYETGMQ  292
             LQRTLSYETG+ 
Sbjct  316   LQRTLSYETGVM  327



>ref|XP_006396806.1| hypothetical protein EUTSA_v10028698mg [Eutrema salsugineum]
 gb|ESQ38259.1| hypothetical protein EUTSA_v10028698mg [Eutrema salsugineum]
Length=408

 Score =   424 bits (1089),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 226/330 (68%), Positives = 272/330 (82%), Gaps = 1/330 (0%)
 Frame = -1

Query  1146  AESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMF  967
             ++S+EI+  K  S +  L+ AN+ +PHV+L STILAL++PPSFTWF  RY+ P LGF+MF
Sbjct  80    SDSNEIYTNKV-SIMEALKQANSFIPHVILSSTILALLHPPSFTWFKPRYFVPGLGFMMF  138

Query  966   AVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLT  787
             AVG+NS+E+DFLEA  RP AI AGYIGQ+++KPLLGY+FG IA++ F LPT + AGIML 
Sbjct  139   AVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYIFGVIAVSVFNLPTPIGAGIMLV  198

Query  786   SCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMIS  607
             SCVSGAQLSNY TFLTDP +APLSIVMTS+STATAA+VTP LSLLLIGK+LPVDVIGMIS
Sbjct  199   SCVSGAQLSNYTTFLTDPSLAPLSIVMTSISTATAAIVTPMLSLLLIGKKLPVDVIGMIS  258

Query  606   NIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsgl  427
             +I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L++   + C+GAPLA+NI S++SP G 
Sbjct  259   SILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTLIDMACCIGAPLALNIDSILSPFGA  318

Query  426   svlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQD  247
             ++L LVI FHL AFI+GY  +G  F  A DVK LQRTLSYETGMQSSLLALALA KFFQD
Sbjct  319   TILFLVITFHLLAFIAGYYFSGFFFSKAHDVKALQRTLSYETGMQSSLLALALATKFFQD  378

Query  246   PLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             PLVGVPPAIS V+MSLMG SLV  W   K 
Sbjct  379   PLVGVPPAISTVVMSLMGVSLVTIWKNRKE  408



>ref|XP_010455635.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Camelina sativa]
Length=409

 Score =   423 bits (1088),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 223/330 (68%), Positives = 270/330 (82%), Gaps = 1/330 (0%)
 Frame = -1

Query  1146  AESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMF  967
             ++++E++  K+ S +  L+ AN+ +PH +L STILAL+YPPSFTWF  RY+ P LGF+MF
Sbjct  81    SDTNEMYH-KKVSIMETLKQANSYIPHAILSSTILALLYPPSFTWFKPRYFVPGLGFMMF  139

Query  966   AVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLT  787
             AVG+NS+E+DFLEA  RP AI AGYIGQ+++KPLLGY+FG IA++ F LPTS+ AGIML 
Sbjct  140   AVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYIFGLIAVSLFNLPTSIGAGIMLV  199

Query  786   SCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMIS  607
             SCVSGAQLSNY TFLTDP +APLSIVMTS+STATA LVTP LSLLLIG +LPVDVIGMIS
Sbjct  200   SCVSGAQLSNYTTFLTDPSLAPLSIVMTSVSTATAVLVTPMLSLLLIGTKLPVDVIGMIS  259

Query  606   NIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsgl  427
             +I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     C+GAPLA+NI S++SP G 
Sbjct  260   SILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMCCCIGAPLALNIDSILSPFGA  319

Query  426   svlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQD  247
             ++L LV+ FHL AF++GY   G  F  APDVK LQRT+SYETGMQSSLLALALA KFFQD
Sbjct  320   TILFLVVTFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYETGMQSSLLALALATKFFQD  379

Query  246   PLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             PLVGVPPAIS V+MSLMG SLV  W   K 
Sbjct  380   PLVGVPPAISTVVMSLMGVSLVTIWKNRKE  409



>ref|XP_006440450.1| hypothetical protein CICLE_v10020346mg [Citrus clementina]
 gb|ESR53690.1| hypothetical protein CICLE_v10020346mg [Citrus clementina]
Length=383

 Score =   422 bits (1085),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 227/311 (73%), Positives = 268/311 (86%), Gaps = 1/311 (0%)
 Frame = -1

Query  1227  SSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGST  1048
             SSR  V+  VSEN+S     +   NY  ES+++   +E S + +L+ +N+ LPHVVLGST
Sbjct  61    SSRNFVTNSVSENISGPFDQDPDRNYVTESNQVLN-QEFSLVNILKQSNSFLPHVVLGST  119

Query  1047  ILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKP  868
             +LALV+PPSFTWFT+RYYAPALGFLMFAVGVNSSEKDF+EAF RP AI AGY+GQFVVKP
Sbjct  120   MLALVFPPSFTWFTARYYAPALGFLMFAVGVNSSEKDFIEAFKRPAAIFAGYVGQFVVKP  179

Query  867   LLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslsta  688
             +LGY+FGTI+++ FGLPT + AGIML SCVSGAQLSNYATFLTDPP+APLSIVMTSLSTA
Sbjct  180   ILGYIFGTISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPLAPLSIVMTSLSTA  239

Query  687   taaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPP  508
             TA  VTP LSLLLIGKRLPVDV GM+S+I+QIVVVP+AAGLLLNRFFP++CNAIRPFLPP
Sbjct  240   TAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIVVVPIAAGLLLNRFFPRICNAIRPFLPP  299

Query  507   LSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKP  328
             LSV VT+ CVGAPLAINI+SV+SP GL++LLL+I FHLSAF++GY + G AF +A DVK 
Sbjct  300   LSVLVTACCVGAPLAINIESVMSPFGLTILLLIITFHLSAFVAGYVVTGLAFAEAHDVKA  359

Query  327   LQRTLSYETGM  295
             LQRTLSYETG+
Sbjct  360   LQRTLSYETGV  370



>gb|AFK35401.1| unknown [Lotus japonicus]
Length=414

 Score =   422 bits (1086),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 221/359 (62%), Positives = 283/359 (79%), Gaps = 1/359 (0%)
 Frame = -1

Query  1227  SSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGST  1048
             S +LP+ +C     SDS+ P+    ++ + ++  K    SFL +L+ +N++LP+V L ST
Sbjct  52    SPKLPL-KCAPLTSSDSLGPDQFPVHSGDLTQTLKQNWVSFLEILKQSNSLLPYVALTST  110

Query  1047  ILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKP  868
             ++ALV P SFTWFT+R+YAPALGFLMFAVGVNS EKDFL+A  RP  +L  Y  QF++KP
Sbjct  111   LIALVIPQSFTWFTTRHYAPALGFLMFAVGVNSKEKDFLDALKRPTELLTAYACQFILKP  170

Query  867   LLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslsta  688
             LLGYL   I++  FGLPT++ AGI+L SCVSGAQLS+YATFL+DP MAPLSIVMTSLST 
Sbjct  171   LLGYLLCIISVNVFGLPTAIGAGIVLLSCVSGAQLSSYATFLSDPEMAPLSIVMTSLSTV  230

Query  687   taaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPP  508
             +A  VTP L LL+IGKRLP+DV GM+ +I QIV+VP+  GLLLNRFFP +CN+IRPFLPP
Sbjct  231   SAVFVTPLLLLLIIGKRLPIDVKGMVFSITQIVLVPITGGLLLNRFFPHICNSIRPFLPP  290

Query  507   LSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKP  328
             LSV V +L  GAP+A NI+SV SP G+++ LL +AFHL++FI GY ++G  FRD+PD KP
Sbjct  291   LSVLVAALSAGAPIAHNIESVKSPFGVAIFLLAVAFHLTSFIIGYIISGFTFRDSPDAKP  350

Query  327   LQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTN  151
             LQRT+S+E GMQSSLLALALANKFF+DP+VG+P AIS  +MSLMGFSLV+ W+K + + 
Sbjct  351   LQRTISFEMGMQSSLLALALANKFFEDPVVGIPSAISSPLMSLMGFSLVLIWSKGRKSK  409



>ref|XP_006396804.1| hypothetical protein EUTSA_v10028698mg [Eutrema salsugineum]
 gb|ESQ38257.1| hypothetical protein EUTSA_v10028698mg [Eutrema salsugineum]
Length=316

 Score =   418 bits (1074),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 221/316 (70%), Positives = 263/316 (83%), Gaps = 0/316 (0%)
 Frame = -1

Query  1104  LTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEA  925
             +  L+ AN+ +PHV+L STILAL++PPSFTWF  RY+ P LGF+MFAVG+NS+E+DFLEA
Sbjct  1     MEALKQANSFIPHVILSSTILALLHPPSFTWFKPRYFVPGLGFMMFAVGINSNERDFLEA  60

Query  924   FNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATF  745
               RP AI AGYIGQ+++KPLLGY+FG IA++ F LPT + AGIML SCVSGAQLSNY TF
Sbjct  61    LKRPDAIFAGYIGQYLIKPLLGYIFGVIAVSVFNLPTPIGAGIMLVSCVSGAQLSNYTTF  120

Query  744   LTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGL  565
             LTDP +APLSIVMTS+STATAA+VTP LSLLLIGK+LPVDVIGMIS+I+Q+VV P+AAGL
Sbjct  121   LTDPSLAPLSIVMTSISTATAAIVTPMLSLLLIGKKLPVDVIGMISSILQVVVTPIAAGL  180

Query  564   LLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAF  385
             LLNR FP++ NAI+PFLP L++   + C+GAPLA+NI S++SP G ++L LVI FHL AF
Sbjct  181   LLNRLFPRLSNAIKPFLPALTLIDMACCIGAPLALNIDSILSPFGATILFLVITFHLLAF  240

Query  384   ISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIM  205
             I+GY  +G  F  A DVK LQRTLSYETGMQSSLLALALA KFFQDPLVGVPPAIS V+M
Sbjct  241   IAGYYFSGFFFSKAHDVKALQRTLSYETGMQSSLLALALATKFFQDPLVGVPPAISTVVM  300

Query  204   SLMGFSLVMFWNKNKS  157
             SLMG SLV  W   K 
Sbjct  301   SLMGVSLVTIWKNRKE  316



>gb|KEH27448.1| Na+-bile acid cotransporter [Medicago truncatula]
Length=410

 Score =   420 bits (1079),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 234/343 (68%), Positives = 280/343 (82%), Gaps = 14/343 (4%)
 Frame = -1

Query  1227  SSRLPVSRCVSE--NLSDSIRPESLSNYAAESSEIFKPKENSFLTVL---RGANAILPHV  1063
             SSRLP+ +C S   N SD             SS   KP + SFL++L   + +N++LP  
Sbjct  73    SSRLPL-KCASSSTNFSDPT--------PNHSSHPTKPVKQSFLSILDILKNSNSLLPPA  123

Query  1062  VLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQ  883
             ++ ST+LAL++PPS TWFT+RY+APALGFLMFAVGVNSSEKDF+EAFNRP  I  GY GQ
Sbjct  124   IVSSTLLALIFPPSLTWFTTRYFAPALGFLMFAVGVNSSEKDFIEAFNRPAEIATGYFGQ  183

Query  882   FVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMt  703
             FVVKPLLGYLF  IA+  FGLPT + AG++L +CVSGAQLSNYATFLTDP MAPLSIVMT
Sbjct  184   FVVKPLLGYLFYIIAVTVFGLPTGIGAGMVLVACVSGAQLSNYATFLTDPEMAPLSIVMT  243

Query  702   slstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIR  523
             SLSTA+A  VTP L LLLIGKRLP+DV GM+ +I QIVVVP+A GLLLNRFFP +CNAIR
Sbjct  244   SLSTASAVFVTPLLLLLLIGKRLPIDVKGMVFSITQIVVVPIAVGLLLNRFFPPICNAIR  303

Query  522   PFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDA  343
             PFLPPLSV   ++C GAPLA+N++ + SP G+S+LLLV+AFHLSAFI+GY L+G+ FRD+
Sbjct  304   PFLPPLSVLTAAICAGAPLALNVECIKSPLGISILLLVVAFHLSAFIAGYMLSGSVFRDS  363

Query  342   PDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISV  214
             PDVKPLQRT+S+ETGMQSSLLALALANKFF+DP+VG+PPAISV
Sbjct  364   PDVKPLQRTISFETGMQSSLLALALANKFFEDPVVGMPPAISV  406



>ref|XP_003611208.1| Ileal sodium/bile acid cotransporter [Medicago truncatula]
Length=428

 Score =   419 bits (1076),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 238/376 (63%), Positives = 290/376 (77%), Gaps = 15/376 (4%)
 Frame = -1

Query  1335  FKIHHPSLPKPLPC-INLEFHYPFLSLPRKS-FNSSARSSRLPVSRCVSENLSDSIRPES  1162
             F +  P  P  +PC  NL       S+P  S F    RSS+  + +C S N S S+ P+ 
Sbjct  22    FHVRRP--PIYVPCSTNLS---SIFSIPSGSHFLRKYRSSKF-LLKCASLNSSGSLTPDP  75

Query  1161  LSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPAL  982
             +        +I   K  S L +L+ AN+ILP+VVL ST++ALV+PPSFTWFTSRYYAPAL
Sbjct  76    IP-------QIMNQKPMSILEILKQANSILPYVVLASTLVALVFPPSFTWFTSRYYAPAL  128

Query  981   GFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAA  802
             G+LMFAVGVNSSEKDFLEAFNRP  ++  Y+GQFVVKPLLGYL   I++  FGLP+++ A
Sbjct  129   GYLMFAVGVNSSEKDFLEAFNRPAELVTAYVGQFVVKPLLGYLLCIISVNLFGLPSAIGA  188

Query  801   GIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDV  622
             GI+L +CVSGAQLS+YATFL+DP MAPLSIVMTSLST +A  VTP L L  IGKRLP+DV
Sbjct  189   GIVLLACVSGAQLSSYATFLSDPQMAPLSIVMTSLSTISAVFVTPLLLLFFIGKRLPIDV  248

Query  621   IGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvv  442
              GM+ +I QIV+VP+  GLLLNRF+P +CNAIRPFLPPLSV V +L  GAPLA+NI+SV 
Sbjct  249   KGMVFSITQIVLVPITFGLLLNRFYPNICNAIRPFLPPLSVLVAALSAGAPLALNIKSVK  308

Query  441   spsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALAN  262
             SP G S+LLL +AFHLS+F+SGY L+G  FRD+PDVKPLQRT+S+ETGMQSSLLALALAN
Sbjct  309   SPFGFSILLLAVAFHLSSFVSGYILSGFIFRDSPDVKPLQRTISFETGMQSSLLALALAN  368

Query  261   KFFQDPLVGVPPAISV  214
             KFF+DP+VG+P AISV
Sbjct  369   KFFEDPVVGMPSAISV  384



>ref|XP_007158423.1| hypothetical protein PHAVU_002G151900g [Phaseolus vulgaris]
 gb|ESW30417.1| hypothetical protein PHAVU_002G151900g [Phaseolus vulgaris]
Length=423

 Score =   416 bits (1068),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 234/383 (61%), Positives = 286/383 (75%), Gaps = 15/383 (4%)
 Frame = -1

Query  1296  CINLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPK  1117
             C N +F Y              R+S +P  +C S + SDS+ P+  S     +    +  
Sbjct  52    CFNSQFPY--------------RTSNIPSLKCASLDSSDSLPPDP-SQIPTSAPVQMEQN  96

Query  1116  ENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKD  937
               S L +L+ +N+ LPHV++ S +LAL+YPPS TWFTSRYYAPALGFLMFAVGVNS+E D
Sbjct  97    SISILEILKQSNSYLPHVLIASLLLALIYPPSLTWFTSRYYAPALGFLMFAVGVNSNEND  156

Query  936   FLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSN  757
             F+EAF RP  I  GY GQFV+KPLLGYLF  IA+ A GLPT++ AGI+L +CVSGAQLS+
Sbjct  157   FIEAFKRPTEIATGYFGQFVLKPLLGYLFCLIAVTALGLPTTVGAGIVLVACVSGAQLSS  216

Query  756   YATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPV  577
             YATFLTDP MAPLSIVMTSLSTA+A  VTP L LLLIGK+LP+DV GM+ +I QIVVVP+
Sbjct  217   YATFLTDPNMAPLSIVMTSLSTASAVFVTPLLLLLLIGKKLPIDVKGMVFSITQIVVVPI  276

Query  576   AAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFH  397
             AAGLLLNRFFP++CN IRPFLPPLSV V ++C GAPLA N++ + S  G+++L LV+AFH
Sbjct  277   AAGLLLNRFFPRICNVIRPFLPPLSVLVAAICAGAPLAFNVEIMKSSLGIAILFLVVAFH  336

Query  396   LSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAIS  217
             LS+FI+GY L+G  FRD  D K LQRT+SYETGMQSSLLALALANKFF+DP V + PAIS
Sbjct  337   LSSFIAGYFLSGFVFRDFLDAKALQRTISYETGMQSSLLALALANKFFEDPAVAIAPAIS  396

Query  216   VVIMSLMGFSLVMFWNKNKSTNV  148
               IMSLMGF LV+ W +   +  
Sbjct  397   TSIMSLMGFGLVLIWTRKGKSET  419



>ref|XP_007209464.1| hypothetical protein PRUPE_ppa009895mg [Prunus persica]
 gb|EMJ10663.1| hypothetical protein PRUPE_ppa009895mg [Prunus persica]
Length=272

 Score =   406 bits (1043),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 220/272 (81%), Positives = 243/272 (89%), Gaps = 0/272 (0%)
 Frame = -1

Query  972  MFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIM  793
            MFAVGVNSSEKDFLEAF RP AILAGYIGQF+VKPLLGY+FG I+++ FGLPT + AGIM
Sbjct  1    MFAVGVNSSEKDFLEAFKRPTAILAGYIGQFLVKPLLGYIFGIISVSIFGLPTPVGAGIM  60

Query  792  LTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGM  613
            L SCVSGAQLSNYATFLTDPPMAPLSIVMTSLSTATA ++TP LSLLLIGKRLPVDV GM
Sbjct  61   LVSCVSGAQLSNYATFLTDPPMAPLSIVMTSLSTATAVIITPLLSLLLIGKRLPVDVKGM  120

Query  612  ISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsps  433
            +S+I+QIVV PVAAGLLLNRFFP++C+AIRPFLPPLSV VT+ CVGAPLAINI+SV SP 
Sbjct  121  VSSILQIVVTPVAAGLLLNRFFPRICDAIRPFLPPLSVLVTACCVGAPLAINIESVTSPF  180

Query  432  glsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFF  253
            GL++LLL+IAFH +AF++GY L G  F   PDVK LQRTLSYETGMQSSLLALALAN+FF
Sbjct  181  GLTILLLIIAFHFTAFVAGYFLTGMVFHKTPDVKALQRTLSYETGMQSSLLALALANRFF  240

Query  252  QDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
            QDPLVGVPPAIS VIMSLMGFSLVM W K K 
Sbjct  241  QDPLVGVPPAISTVIMSLMGFSLVMVWAKRKE  272



>gb|ACU23668.1| unknown [Glycine max]
Length=408

 Score =   410 bits (1055),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 235/385 (61%), Positives = 294/385 (76%), Gaps = 19/385 (5%)
 Frame = -1

Query  1299  PC-INLEFHYPFLSLPRKSFNSSARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFK  1123
             PC I    H+P+            RS+++P+ +C     SDS+ P+ LS+   ++ +   
Sbjct  38    PCSIRFNSHFPY------------RSTKVPL-KCAPLPSSDSLPPD-LSDAPTQTEQ---  80

Query  1122  PKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSE  943
                 S L +L+ +N+ LPHV++ S +LAL+YPPS TWFTSRYYAPALGFLMFAVGVNS+E
Sbjct  81    -NSMSILEILKQSNSYLPHVLIASILLALIYPPSLTWFTSRYYAPALGFLMFAVGVNSNE  139

Query  942   KDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQL  763
              DFLEAF RP  I+ GY GQF VKPLLGYLF  IA+    LPT++ AGI+L +CVSGAQL
Sbjct  140   NDFLEAFKRPAEIVTGYFGQFAVKPLLGYLFCMIAVTVLSLPTTVGAGIVLVACVSGAQL  199

Query  762   SNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVV  583
             S+YATFLTDP MAPLSIVMTSLSTA+A  VTP L LLLIGK+LP+DV GM+ +I QIVVV
Sbjct  200   SSYATFLTDPQMAPLSIVMTSLSTASAVFVTPLLLLLLIGKKLPIDVRGMVYSITQIVVV  259

Query  582   PVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIA  403
             P+AAGLLLNRF+P++CN IRPFLPPLSV V S+C GAPLA N++++ SP G+ +LLLV+A
Sbjct  260   PIAAGLLLNRFYPRICNVIRPFLPPLSVLVASICAGAPLAFNVETMKSPLGVVILLLVVA  319

Query  402   FHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPA  223
             FHLS+FI+GY L+G  FRD+ DVK LQRT+S+ETG+QSSLLALALANKFF+DP V +PPA
Sbjct  320   FHLSSFIAGYILSGFVFRDSLDVKALQRTISFETGLQSSLLALALANKFFEDPKVAIPPA  379

Query  222   ISVVIMSLMGFSLVMFWNKNKSTNV  148
             I   IMSLMGF LV+ W +    ++
Sbjct  380   IFTSIMSLMGFVLVLIWTRRGKRDI  404



>gb|KFK31950.1| hypothetical protein AALP_AA6G181000 [Arabis alpina]
Length=404

 Score =   409 bits (1050),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 228/352 (65%), Positives = 280/352 (80%), Gaps = 4/352 (1%)
 Frame = -1

Query  1206  RC--VSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALV  1033
             RC  +S+N   S  P       +ES+EI+K K+ S +  L+ AN+ +PH VL STILAL+
Sbjct  55    RCEPISQNGRSSF-PWRRYVSESESNEIYK-KKISIMETLKQANSFIPHAVLLSTILALL  112

Query  1032  YPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYL  853
             +PPSF WF  RY+ PALGF+MFAVG+NS+E+DFLEA  RP A+ AGYIGQ+++KP+LGY+
Sbjct  113   HPPSFVWFKPRYFVPALGFMMFAVGINSNERDFLEALKRPDALFAGYIGQYLIKPILGYI  172

Query  852   FGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLV  673
             FG IA++ F LPT + AGIML SCVSGAQLS+Y TFLTDP  AP+SIVMTS+STATA LV
Sbjct  173   FGVIAVSLFHLPTPVGAGIMLVSCVSGAQLSSYTTFLTDPSFAPISIVMTSISTATAVLV  232

Query  672   TPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFV  493
             TP LSLLLIGK+LP+DV GMIS+I+Q+V+ P+AAGLLLNR FP++ NAI+PFLP L+V  
Sbjct  233   TPMLSLLLIGKKLPIDVFGMISSILQVVITPIAAGLLLNRLFPRLSNAIKPFLPALTVID  292

Query  492   TSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTL  313
              + CVGAP+++NI S++SP G ++L LV+ FHL AF++GY  AG  F  APDVK LQRTL
Sbjct  293   MACCVGAPISLNINSILSPFGATILFLVVTFHLLAFVAGYFFAGFFFSKAPDVKALQRTL  352

Query  312   SYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             SYETGMQSSLLALALA KFFQDPLVGVPPAIS V+MSLMG SLVM W   K 
Sbjct  353   SYETGMQSSLLALALATKFFQDPLVGVPPAISTVVMSLMGSSLVMIWKNRKE  404



>ref|XP_006440448.1| hypothetical protein CICLE_v10020346mg [Citrus clementina]
 gb|ESR53688.1| hypothetical protein CICLE_v10020346mg [Citrus clementina]
Length=272

 Score =   403 bits (1035),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 217/272 (80%), Positives = 243/272 (89%), Gaps = 0/272 (0%)
 Frame = -1

Query  972  MFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIM  793
            MFAVGVNSSEKDF+EAF RP AI AGY+GQFVVKP+LGY+FGTI+++ FGLPT + AGIM
Sbjct  1    MFAVGVNSSEKDFIEAFKRPAAIFAGYVGQFVVKPILGYIFGTISVSVFGLPTPIGAGIM  60

Query  792  LTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGM  613
            L SCVSGAQLSNYATFLTDPP+APLSIVMTSLSTATA  VTP LSLLLIGKRLPVDV GM
Sbjct  61   LVSCVSGAQLSNYATFLTDPPLAPLSIVMTSLSTATAVFVTPLLSLLLIGKRLPVDVKGM  120

Query  612  ISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsps  433
            +S+I+QIVVVP+AAGLLLNRFFP++CNAIRPFLPPLSV VT+ CVGAPLAINI+SV+SP 
Sbjct  121  VSSILQIVVVPIAAGLLLNRFFPRICNAIRPFLPPLSVLVTACCVGAPLAINIESVMSPF  180

Query  432  glsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFF  253
            GL++LLL+I FHLSAF++GY + G AF +A DVK LQRTLSYETGMQSSLLALALAN+FF
Sbjct  181  GLTILLLIITFHLSAFVAGYVVTGLAFAEAHDVKALQRTLSYETGMQSSLLALALANRFF  240

Query  252  QDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
            QDPLV VPPAIS VIMSLMGF LVM W K   
Sbjct  241  QDPLVSVPPAISTVIMSLMGFFLVMLWAKKSE  272



>emb|CDY51554.1| BnaC03g73000D [Brassica napus]
Length=408

 Score =   408 bits (1048),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 236/378 (62%), Positives = 291/378 (77%), Gaps = 6/378 (2%)
 Frame = -1

Query  1278  HYPFLSLPRKSFNS---SARSSRLPV-SRCVSENLSDSIRPESLSNYAAESSEIFKPKEN  1111
             H    + PR SF+     + S   P+ S  +++N   S  P   +   ++++EI+  K+ 
Sbjct  33    HRRVTNFPRNSFSPFCLGSSSVDFPLRSGPITQN-DRSSYPWRRNVSESDTNEIYN-KQV  90

Query  1110  SFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFL  931
             S +  L+ AN+ +PHV+L STILAL++PPSFTWF  RY+ P LGF+MFAVG+NS+E+DFL
Sbjct  91    SIMETLKQANSFIPHVILSSTILALLHPPSFTWFKPRYFVPGLGFMMFAVGINSNERDFL  150

Query  930   EAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYA  751
             EA  RP AI AGYIGQ+++KPLLGY+FG IA++ F LPT + AGIML SCVSGAQLSNY 
Sbjct  151   EALKRPDAIFAGYIGQYLIKPLLGYMFGLIAVSLFNLPTPIGAGIMLVSCVSGAQLSNYT  210

Query  750   TFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAA  571
             TFLTDP +APLSIVMTS+STATAALVTP LSLLLIGK+LPVDVIGMIS+I+Q+VV P+AA
Sbjct  211   TFLTDPSLAPLSIVMTSISTATAALVTPMLSLLLIGKKLPVDVIGMISSILQVVVTPIAA  270

Query  570   GLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLS  391
             GLLLNR  P++ NAI+PFLP L++   + C+GAPLA+NI S++SP G ++L LVI FHL 
Sbjct  271   GLLLNRLLPRLSNAIKPFLPALTLIDMACCIGAPLALNIDSILSPFGATILFLVIMFHLL  330

Query  390   AFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVV  211
             AF++GY   G  F  APDVK LQRTLSYETGMQSSLLALALA KFFQDPLVGVPPAIS V
Sbjct  331   AFVAGYIFTGFFFSKAPDVKSLQRTLSYETGMQSSLLALALATKFFQDPLVGVPPAISTV  390

Query  210   IMSLMGFSLVMFWNKNKS  157
             +MSLMG SLV  W   K 
Sbjct  391   VMSLMGVSLVTIWKNRKE  408



>ref|XP_010676633.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=272

 Score =   402 bits (1034),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 219/272 (81%), Positives = 239/272 (88%), Gaps = 0/272 (0%)
 Frame = -1

Query  972  MFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIM  793
            MFAVG+NSSEKDFLEAF RP AI AGYIGQF VKPLLG +FGTIA+  FGLPT   AGIM
Sbjct  1    MFAVGLNSSEKDFLEAFKRPTAIFAGYIGQFAVKPLLGLIFGTIAVTVFGLPTPAGAGIM  60

Query  792  LTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGM  613
            LTSCVSGAQLSNYATFLTDP MAPLSIVMTSLSTA+A  VTP LSLLLIGKRLPVDV GM
Sbjct  61   LTSCVSGAQLSNYATFLTDPQMAPLSIVMTSLSTASATFVTPLLSLLLIGKRLPVDVKGM  120

Query  612  ISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsps  433
            +++I+QIVVVP+A+GLLLNR FP+VC AIRPFLPPLSVFVTSLCVGAPLAINI +V+SP 
Sbjct  121  MTSIMQIVVVPIASGLLLNRLFPEVCKAIRPFLPPLSVFVTSLCVGAPLAININAVMSPF  180

Query  432  glsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFF  253
            GL +LLLVI FHLSAFI+GY ++G  F DAPD K LQRTLSYETGMQSSLL LALAN+FF
Sbjct  181  GLIILLLVIMFHLSAFIAGYLMSGLVFHDAPDAKALQRTLSYETGMQSSLLGLALANRFF  240

Query  252  QDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
            +DP+VGVPPAIS VIMSLMGFSLVM W K K 
Sbjct  241  EDPVVGVPPAISTVIMSLMGFSLVMLWAKKKK  272



>ref|XP_009134253.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Brassica rapa]
Length=408

 Score =   407 bits (1047),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 229/350 (65%), Positives = 278/350 (79%), Gaps = 8/350 (2%)
 Frame = -1

Query  1185  SDSIRPESLSNY-------AAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYP  1027
             SD I     S+Y        ++++EI+  K+ S +  L+ AN+ +PHV+L STILAL++P
Sbjct  60    SDPISQNDRSSYPWRRHVSESDTNEIYN-KKVSIMETLKQANSFIPHVILSSTILALLHP  118

Query  1026  PSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFG  847
             PSFTWF  RY+ P LGF+MFAVG+NS+E+DFLEA  RP AI AGYIGQ+++KPLLGY+FG
Sbjct  119   PSFTWFKPRYFVPGLGFMMFAVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYIFG  178

Query  846   TIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTP  667
              IA++ F LPT + AGIML SCVSGAQLSNY TFLTDP +APLSIVMTS+STATAA+VTP
Sbjct  179   LIAVSLFNLPTPIGAGIMLVSCVSGAQLSNYTTFLTDPSLAPLSIVMTSISTATAAVVTP  238

Query  666   FLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTS  487
              LSLLLIGK+LPVDVIGMIS+I+Q+VV P+AAGLLLNR  P++ NAI+PFLP L++   +
Sbjct  239   ILSLLLIGKKLPVDVIGMISSILQVVVTPIAAGLLLNRLLPRLSNAIKPFLPALTLIDMA  298

Query  486   LCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSY  307
              C+GAPLA+NI S++SP G ++L LVI FHL AF++GY   G  F  APDVK LQRTLSY
Sbjct  299   CCIGAPLALNIDSILSPFGATILFLVIMFHLLAFVAGYIFTGFFFSKAPDVKALQRTLSY  358

Query  306   ETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             ETGMQSSLLALALA KFFQDPLVGVPPAIS V+MSLMG SLV  W   K 
Sbjct  359   ETGMQSSLLALALATKFFQDPLVGVPPAISTVVMSLMGVSLVTIWKNRKE  408



>emb|CDX90815.1| BnaA03g24950D [Brassica napus]
Length=408

 Score =   407 bits (1047),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 229/350 (65%), Positives = 278/350 (79%), Gaps = 8/350 (2%)
 Frame = -1

Query  1185  SDSIRPESLSNY-------AAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYP  1027
             SD I     S+Y        ++++EI+  K+ S +  L+ AN+ +PHV+L STILAL++P
Sbjct  60    SDPISQNDKSSYPWRRYVSESDTNEIYN-KKVSIMEALKRANSFIPHVILSSTILALLHP  118

Query  1026  PSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFG  847
             PSFTWF  RY+ P LGF+MFAVG+NS+E+DFLEA  RP AI AGYIGQ+++KPLLGY+FG
Sbjct  119   PSFTWFKPRYFVPGLGFMMFAVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYMFG  178

Query  846   TIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTP  667
              IA++ F LPT + AGIML SCVSGAQLSNY TFLTDP +APLSIVMTS+STATAA+VTP
Sbjct  179   LIAVSLFNLPTPIGAGIMLVSCVSGAQLSNYTTFLTDPSLAPLSIVMTSISTATAAVVTP  238

Query  666   FLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTS  487
              LSLLLIGK+LPVDVIGMIS+I+Q+VV P+AAGLLLNR  P++ NAI+PFLP L++   +
Sbjct  239   MLSLLLIGKKLPVDVIGMISSILQVVVTPIAAGLLLNRLLPRLSNAIKPFLPALTLIDMA  298

Query  486   LCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSY  307
              C+GAPLA+NI S++SP G ++L LVI FHL AF++GY   G  F  APDVK LQRTLSY
Sbjct  299   CCIGAPLALNIDSILSPFGATILFLVIMFHLLAFVAGYIFTGFFFSKAPDVKALQRTLSY  358

Query  306   ETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
             ETGMQSSLLALALA KFFQDPLVGVPPAIS V+MSLMG SLV  W   K 
Sbjct  359   ETGMQSSLLALALATKFFQDPLVGVPPAISTVVMSLMGVSLVTIWKNRKE  408



>ref|XP_010055563.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
isoform X1 [Eucalyptus grandis]
Length=460

 Score =   399 bits (1026),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 254/313 (81%), Gaps = 1/313 (0%)
 Frame = -1

Query  1236  SARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKEN-SFLTVLRGANAILPHVV  1060
             S  S R   S+C S + S+ + PE+     AES +   P E  S + VL+ +N+ LPHVV
Sbjct  56    SVHSRRNGSSKCKSGDFSEPLEPETGWESPAESIQPSVPGEQFSIVEVLKKSNSFLPHVV  115

Query  1059  LGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQF  880
             L ST+LAL+YPPSF WFT+RYYAPALGFLMFAVGVNSSE+DFLEAF RP AI AGYIGQ+
Sbjct  116   LASTLLALIYPPSFAWFTNRYYAPALGFLMFAVGVNSSERDFLEAFKRPAAIFAGYIGQY  175

Query  879   VVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMts  700
             +VKPLLGY FG +++  F LPTS+ AGIML SCVSGAQLSNYATFLTDP MAPLSIVMTS
Sbjct  176   IVKPLLGYFFGMMSVTMFSLPTSIGAGIMLVSCVSGAQLSNYATFLTDPSMAPLSIVMTS  235

Query  699   lstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRP  520
             LSTATA  VTP LSLLLIGKRLPVDV GM+S+I+QIVV P+ AGLLLNRFFP +CNAIRP
Sbjct  236   LSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIVVTPITAGLLLNRFFPWICNAIRP  295

Query  519   FLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAP  340
              LPPLSVFVT+LCVGAPLAIN+ S++S  GL +LLL+IAFHLSAF+ GY L G  F+ AP
Sbjct  296   LLPPLSVFVTALCVGAPLAINVDSIMSSFGLMILLLIIAFHLSAFVIGYFLPGFFFQKAP  355

Query  339   DVKPLQRTLSYET  301
             DVK LQRTLS+ET
Sbjct  356   DVKALQRTLSFET  368



>ref|XP_006440452.1| hypothetical protein CICLE_v10020346mg [Citrus clementina]
 gb|ESR53692.1| hypothetical protein CICLE_v10020346mg [Citrus clementina]
Length=264

 Score =   377 bits (967),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 201/252 (80%), Positives = 230/252 (91%), Gaps = 0/252 (0%)
 Frame = -1

Query  1047  ILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKP  868
             +LALV+PPSFTWFT+RYYAPALGFLMFAVGVNSSEKDF+EAF RP AI AGY+GQFVVKP
Sbjct  1     MLALVFPPSFTWFTARYYAPALGFLMFAVGVNSSEKDFIEAFKRPAAIFAGYVGQFVVKP  60

Query  867   LLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslsta  688
             +LGY+FGTI+++ FGLPT + AGIML SCVSGAQLSNYATFLTDPP+APLSIVMTSLSTA
Sbjct  61    ILGYIFGTISVSVFGLPTPIGAGIMLVSCVSGAQLSNYATFLTDPPLAPLSIVMTSLSTA  120

Query  687   taaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPP  508
             TA  VTP LSLLLIGKRLPVDV GM+S+I+QIVVVP+AAGLLLNRFFP++CNAIRPFLPP
Sbjct  121   TAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIVVVPIAAGLLLNRFFPRICNAIRPFLPP  180

Query  507   LSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKP  328
             LSV VT+ CVGAPLAINI+SV+SP GL++LLL+I FHLSAF++GY + G AF +A DVK 
Sbjct  181   LSVLVTACCVGAPLAINIESVMSPFGLTILLLIITFHLSAFVAGYVVTGLAFAEAHDVKA  240

Query  327   LQRTLSYETGMQ  292
             LQRTLSYETG+ 
Sbjct  241   LQRTLSYETGVM  252



>ref|NP_567385.1| probable sodium/metabolite cotransporter BASS5 [Arabidopsis thaliana]
 gb|AAK91464.1| AT4g12030/F16J13_100 [Arabidopsis thaliana]
 gb|AAM19874.1| AT3g20560/K10D20_9 [Arabidopsis thaliana]
 gb|AEE83088.1| probable sodium/metabolite cotransporter BASS5 [Arabidopsis thaliana]
Length=273

 Score =   361 bits (926),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 194/273 (71%), Positives = 227/273 (83%), Gaps = 0/273 (0%)
 Frame = -1

Query  975  LMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGI  796
            +MFAVG+NS+E+DFLEA  RP AI AGYIGQ+++KPLLGY+FG IA++ F LPTS+ AGI
Sbjct  1    MMFAVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYIFGVIAVSLFNLPTSIGAGI  60

Query  795  MLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIG  616
            ML SCVSGAQLSNY TFLTDP +A LSIVMTS+STATA LVTP LSLLLIGK+LPVDV G
Sbjct  61   MLVSCVSGAQLSNYTTFLTDPSLAALSIVMTSISTATAVLVTPMLSLLLIGKKLPVDVFG  120

Query  615  MISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsp  436
            MIS+I+Q+V+ P+AAGLLLNR FP++ NAI+PFLP L+V   S C+GAPLA+NI S++SP
Sbjct  121  MISSILQVVITPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMSCCIGAPLALNIDSILSP  180

Query  435  sglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKF  256
             G ++L LVI FHL AF++GY   G  F  APDVK LQRT+SYETGMQSSLLALALA KF
Sbjct  181  FGATILFLVITFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYETGMQSSLLALALATKF  240

Query  255  FQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
            FQDPLVGVPPAIS V+MSLMG SLV  W   K 
Sbjct  241  FQDPLVGVPPAISTVVMSLMGVSLVTIWKNRKE  273



>emb|CAB40944.1| putative transport protein [Arabidopsis thaliana]
 emb|CAB78246.1| putative transport protein [Arabidopsis thaliana]
Length=379

 Score =   357 bits (917),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 202/321 (63%), Positives = 240/321 (75%), Gaps = 32/321 (10%)
 Frame = -1

Query  1134  EIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGV  955
             +++  K +S +  L+ A + +PH +L STILALVYPPSFTWF  RY+ P LGF+MFAVG+
Sbjct  64    QLYHKKVSSIMETLKQAYSFIPHGILLSTILALVYPPSFTWFKPRYFVPGLGFMMFAVGI  123

Query  954   NSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVS  775
             NS+E+DFLEA  RP AI AGYIGQ+++KPLLG                  AGIML SCVS
Sbjct  124   NSNERDFLEALKRPDAIFAGYIGQYLIKPLLG------------------AGIMLVSCVS  165

Query  774   GAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQ  595
             GAQLSNY TFLTDP +A LSIVMTS+STATA LVTP LSLLLIGK+LPVDV GMIS+I+Q
Sbjct  166   GAQLSNYTTFLTDPSLAALSIVMTSISTATAVLVTPMLSLLLIGKKLPVDVFGMISSILQ  225

Query  594   IVVVPVAAGLLLNR--------------FFPQVCNAIRPFLPPLSVFVTSLCVGAPLAIN  457
             +V+ P+AAGLLLNR               FP++ NAI+PFLP L+V   S C+GAPLA+N
Sbjct  226   VVITPIAAGLLLNRKNKKLTLRYKCECRLFPRLSNAIKPFLPALTVIDMSCCIGAPLALN  285

Query  456   IQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLA  277
             I S++SP G ++L LVI FHL AF++GY   G  F  APDVK LQRT+SYETGMQSSLLA
Sbjct  286   IDSILSPFGATILFLVITFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYETGMQSSLLA  345

Query  276   LALANKFFQDPLVGVPPAISV  214
             LALA KFFQDPLVGVPPAISV
Sbjct  346   LALATKFFQDPLVGVPPAISV  366



>ref|XP_001782711.1| predicted protein [Physcomitrella patens]
 gb|EDQ52476.1| predicted protein [Physcomitrella patens]
Length=325

 Score =   349 bits (896),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 243/312 (78%), Gaps = 0/312 (0%)
 Frame = -1

Query  1095  LRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNR  916
             L+  N  +PH V+ ST+LAL YPPSFTWFT++YYAPALGFLMFAVGVN S  DF  A  R
Sbjct  12    LKHVNVYIPHAVVASTVLALSYPPSFTWFTTKYYAPALGFLMFAVGVNLSIDDFKHAVER  71

Query  915   PGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTD  736
             PG +  G   Q+V+KPLLG LF T A     LP ++ +G++L +CVSGAQLSNYATFLT+
Sbjct  72    PGPVALGLAAQYVLKPLLGVLFATFATRLMQLPEAIGSGLILCACVSGAQLSNYATFLTE  131

Query  735   PPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLN  556
             P +APLSIVMT+LSTA A +VTP L+LLL+GKRLP+D++GMI+NI +IVVVP+A+GL LN
Sbjct  132   PTLAPLSIVMTALSTALAVVVTPLLTLLLLGKRLPIDLVGMITNITEIVVVPIASGLFLN  191

Query  555   RFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISG  376
             RF PQV   IRPFLP LS+  T  C+G+PLA+NI ++ SP GL +LL V++FH SAF++G
Sbjct  192   RFLPQVTRLIRPFLPALSLLTTCCCIGSPLAVNINAIRSPFGLGILLPVVSFHTSAFLAG  251

Query  375   YTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLM  196
             Y +    F  A D+  L RT+S+E+GMQSSLL LALANKFF DP+VG+P AISVVIMSLM
Sbjct  252   YKITEVLFPKADDLTALARTISFESGMQSSLLGLALANKFFPDPVVGLPSAISVVIMSLM  311

Query  195   GFSLVMFWNKNK  160
              F LV+ WNK+K
Sbjct  312   AFGLVIHWNKHK  323



>ref|XP_007040027.1| Sodium Bile acid symporter family isoform 2 [Theobroma cacao]
 gb|EOY24528.1| Sodium Bile acid symporter family isoform 2 [Theobroma cacao]
Length=289

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 186/238 (78%), Positives = 208/238 (87%), Gaps = 0/238 (0%)
 Frame = -1

Query  1002  RYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFG  823
             RYYAPALGFLMFAVGVNSSEKDF+EAF RP AI AGY+GQFVVKPLLGY+FG IA+  F 
Sbjct  45    RYYAPALGFLMFAVGVNSSEKDFIEAFKRPYAIFAGYVGQFVVKPLLGYIFGMIAVTVFC  104

Query  822   LPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIG  643
             LPT L AGIML SCVSGAQLSNYATFLTDPP+APLSIVMTSLSTATA  VTP LSLLLIG
Sbjct  105   LPTPLGAGIMLVSCVSGAQLSNYATFLTDPPLAPLSIVMTSLSTATAVFVTPMLSLLLIG  164

Query  642   KRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLA  463
             KRLPVDV+GM+S+I+QIV+ P+AAGLLLNR FP++C AIRPFLPPLSV  T+ CVGAPLA
Sbjct  165   KRLPVDVMGMVSSILQIVIAPIAAGLLLNRLFPRLCEAIRPFLPPLSVLDTAFCVGAPLA  224

Query  462   INIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQS  289
             INI SV+SP GL+V LL++AFHLSAFI+G+ L+G  F  APDVK LQRTLS+ETG  S
Sbjct  225   ININSVLSPFGLTVSLLIVAFHLSAFIAGFFLSGFVFHKAPDVKALQRTLSFETGENS  282



>ref|XP_010058201.1| PREDICTED: probable sodium/metabolite cotransporter BASS5, chloroplastic 
[Eucalyptus grandis]
Length=299

 Score =   322 bits (826),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 183/252 (73%), Positives = 207/252 (82%), Gaps = 0/252 (0%)
 Frame = -1

Query  972  MFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIM  793
            MFAV VNSSE+DFLEAF RP AI A  I QF+ KPLLGY FG +++A   LPTS+ AGIM
Sbjct  1    MFAVRVNSSERDFLEAFRRPAAIFARSINQFIEKPLLGYFFGMMSVAMVSLPTSIGAGIM  60

Query  792  LTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGM  613
            L SC+S AQLSNYAT LTDP +APLSIVMTSLSTATA  VTP LSLLLIGKRLPV V GM
Sbjct  61   LLSCISAAQLSNYATSLTDPSVAPLSIVMTSLSTATAVFVTPLLSLLLIGKRLPVHVKGM  120

Query  612  ISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsps  433
            +S+I+QIVV P+AAGLLLNRFFP + NAIRP LPPL VFVT+LCVGAPL +NI S++S  
Sbjct  121  VSSILQIVVTPIAAGLLLNRFFPWISNAIRPLLPPLYVFVTALCVGAPLVMNIDSIISSF  180

Query  432  glsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFF  253
            GL++L LVIAFHL+AF+ GY L G  FR AP VK L+R LS+ETGMQSSLLALAL N+FF
Sbjct  181  GLTILSLVIAFHLTAFVIGYFLPGFFFRKAPAVKALRRALSFETGMQSSLLALALGNRFF  240

Query  252  QDPLVGVPPAIS  217
            Q PLV VPPAIS
Sbjct  241  QHPLVAVPPAIS  252



>gb|KCW72053.1| hypothetical protein EUGRSUZ_E00495 [Eucalyptus grandis]
Length=306

 Score =   287 bits (735),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 156/248 (63%), Positives = 186/248 (75%), Gaps = 9/248 (4%)
 Frame = -1

Query  1236  SARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKEN-SFLTVLRGANAILPHVV  1060
             S  S R   S+C S + S+ + PE+     AES ++  P+E  S + VL+ +N+ LPHVV
Sbjct  33    SVHSRRHGSSKCKSGDFSEPLEPETGRESPAESIQLSVPREQLSIVEVLKNSNSFLPHVV  92

Query  1059  LGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQF  880
             L ST+LAL+YPPSF WFT+RYY PA+GFLMFAVG+N SE+DFLEAF RP AI AGYIGQ+
Sbjct  93    LASTLLALIYPPSFAWFTNRYYPPAIGFLMFAVGINFSERDFLEAFKRPAAIFAGYIGQY  152

Query  879   VVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMts  700
             +VKPLLGY FG +++  F LPTS+ AG ML SCVSGAQLSNYATFLTDP MAPLSIVMTS
Sbjct  153   IVKPLLGYFFGMMSVTMFSLPTSIGAGNMLVSCVSGAQLSNYATFLTDPSMAPLSIVMTS  212

Query  699   lstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGL--------LLNRFFP  544
             LSTATA  VTP LSLLLIGKRLPVDV GM+S+I+QIVV P+ AG+        L NRFF 
Sbjct  213   LSTATAVFVTPLLSLLLIGKRLPVDVKGMVSSILQIVVAPITAGMQSSLLALALANRFFQ  272

Query  543   QVCNAIRP  520
                 A+ P
Sbjct  273   DPLVAVPP  280


 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -1

Query  300  GMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTN  151
            GMQSSLLALALAN+FFQDPLV VPPAIS  +MSLMGFSLVM W + ++T 
Sbjct  256  GMQSSLLALALANRFFQDPLVAVPPAISTAMMSLMGFSLVMVWARGRATG  305



>ref|XP_006858034.1| hypothetical protein AMTR_s00069p00204810 [Amborella trichopoda]
 gb|ERN19501.1| hypothetical protein AMTR_s00069p00204810 [Amborella trichopoda]
Length=312

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 147/230 (64%), Positives = 181/230 (79%), Gaps = 2/230 (1%)
 Frame = -1

Query  1236  SARSSRLPVSRCVSENL--SDSIRPESLSNYAAESSEIFKPKENSFLTVLRGANAILPHV  1063
             S  +SRL V+RC SE    S  +  +       + ++     EN  L +++ AN+ILPHV
Sbjct  83    SLENSRLFVARCQSEMTFESSELNLDHQQGDTLKVTQDIVQNENGPLMMMKNANSILPHV  142

Query  1062  VLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQ  883
             V+ ST+LAL++PPSFTWFT+RY+APALGFLMFAVGVNS+ KDFLEA  RPG I AG+ GQ
Sbjct  143   VIASTVLALIFPPSFTWFTTRYWAPALGFLMFAVGVNSTTKDFLEAVKRPGVIAAGFAGQ  202

Query  882   FVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMt  703
             +++KPLLGY+ GTIA++   LP  + +GIML SCVSGAQLSNYATFLTDP MAPLSIVMT
Sbjct  203   YIIKPLLGYILGTIAVSHLRLPDPIGSGIMLVSCVSGAQLSNYATFLTDPAMAPLSIVMT  262

Query  702   slstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNR  553
             SLSTATA  +TPFLSLLLIGKRLPVDV GM+++I+QIV+ P+AAGLLLNR
Sbjct  263   SLSTATAVFITPFLSLLLIGKRLPVDVRGMMTSIMQIVIAPIAAGLLLNR  312



>ref|XP_006396805.1| hypothetical protein EUTSA_v10028698mg [Eutrema salsugineum]
 gb|ESQ38258.1| hypothetical protein EUTSA_v10028698mg [Eutrema salsugineum]
Length=296

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 170/198 (86%), Gaps = 1/198 (1%)
 Frame = -1

Query  1146  AESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMF  967
             ++S+EI+  K  S +  L+ AN+ +PHV+L STILAL++PPSFTWF  RY+ P LGF+MF
Sbjct  80    SDSNEIYTNKV-SIMEALKQANSFIPHVILSSTILALLHPPSFTWFKPRYFVPGLGFMMF  138

Query  966   AVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLT  787
             AVG+NS+E+DFLEA  RP AI AGYIGQ+++KPLLGY+FG IA++ F LPT + AGIML 
Sbjct  139   AVGINSNERDFLEALKRPDAIFAGYIGQYLIKPLLGYIFGVIAVSVFNLPTPIGAGIMLV  198

Query  786   SCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMIS  607
             SCVSGAQLSNY TFLTDP +APLSIVMTS+STATAA+VTP LSLLLIGK+LPVDVIGMIS
Sbjct  199   SCVSGAQLSNYTTFLTDPSLAPLSIVMTSISTATAAIVTPMLSLLLIGKKLPVDVIGMIS  258

Query  606   NIIQIVVVPVAAGLLLNR  553
             +I+Q+VV P+AAGLLLNR
Sbjct  259   SILQVVVTPIAAGLLLNR  276



>emb|CDX94129.1| BnaC07g37630D [Brassica napus]
Length=173

 Score =   233 bits (593),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDV GMIS+I+Q+V+ P+AAGLLLN+ FP++ NAIRPFLP LSV  T+ 
Sbjct  2    LSLLLIGKKLPVDVKGMISSILQVVIAPIAAGLLLNKLFPKLSNAIRPFLPVLSVLDTAC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            CVGAPLA+NI SV+SP G ++LLLV  FHLSAF SGY L G+ FR+APD K LQRTLSYE
Sbjct  62   CVGAPLALNINSVMSPFGATILLLVTMFHLSAFFSGYFLTGSVFRNAPDSKALQRTLSYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKSTNV  148
            TGMQSSLLALALA KFFQDPLVG+PPAIS V+MSLMGF+LVM W+  K  ++
Sbjct  122  TGMQSSLLALALATKFFQDPLVGIPPAISTVVMSLMGFTLVMIWSSEKELSI  173



>ref|XP_001772544.1| predicted protein [Physcomitrella patens]
 gb|EDQ62586.1| predicted protein [Physcomitrella patens]
Length=371

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 204/310 (66%), Gaps = 8/310 (3%)
 Frame = -1

Query  1092  RGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRP  913
             +  + +LP+VVL + + AL+ P SF W +  YYAPALG +M ++GV  S  DF     RP
Sbjct  53    KSLSQMLPYVVLATAVSALIQPASFAWVSKDYYAPALGGIMLSIGVQLSVSDFALVIKRP  112

Query  912   GAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDP  733
               +L GY+ Q++VKPLLG L      AA  +  + ++G++LTSCV+GAQLS+YA FL++ 
Sbjct  113   LPVLVGYVAQYIVKPLLGLL----VCAALSVSPAFSSGLILTSCVAGAQLSSYAAFLSEG  168

Query  732   PMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNR  553
              +A LSI++TSL+T T+ ++TP L+  LIG  +PVDVI M  +I+Q+V++P+  GL LN 
Sbjct  169   DVA-LSIILTSLTTITSVIITPLLTKFLIGSVVPVDVIAMGKSILQVVILPIVLGLSLNT  227

Query  552   FFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGY  373
             +     + IRPF+P +++  TSLC+G+PLA+N   +VS  G  +L  V+AFH+SAF+ GY
Sbjct  228   YAKNFVDKIRPFMPLMAMVCTSLCIGSPLALNKSRIVSMEGFLLLFPVLAFHISAFVLGY  287

Query  372   TLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMG  193
              +    F    +   + RT+S  TGMQSS LA+ LA +F  D    VPPA SVV+M++MG
Sbjct  288   WVPRLPFWKQDE--KVSRTVSLCTGMQSSTLAMLLATQFLGDSH-AVPPACSVVVMAIMG  344

Query  192   FSLVMFWNKN  163
              SL  FW K 
Sbjct  345   LSLASFWGKG  354



>ref|XP_001777483.1| predicted protein [Physcomitrella patens]
 gb|EDQ57658.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   234 bits (596),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 141/324 (44%), Positives = 207/324 (64%), Gaps = 8/324 (2%)
 Frame = -1

Query  1134  EIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGV  955
             ++ + K    + V +  + +LP+VVL + + AL  P SF W +  YYAPALG +M ++GV
Sbjct  20    KVKRDKRGQKVDVTKSLSQLLPYVVLATAVSALTQPASFAWVSKDYYAPALGGIMLSIGV  79

Query  954   NSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVS  775
               S  DF     RP  +L GY+ Q++VKPLLG L      AAF +  + ++G++LTSCV+
Sbjct  80    QLSVSDFTLVLKRPLPVLVGYMSQYMVKPLLGLL----VCAAFSVSPAFSSGLILTSCVA  135

Query  774   GAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQ  595
             GAQLS+YA FL++  +A LSI++TSL+T T+ ++TP L+ LLIG  +PVD+I M  +I+Q
Sbjct  136   GAQLSSYAAFLSEGDVA-LSIILTSLTTVTSVIITPLLTKLLIGSVVPVDIIAMGKSILQ  194

Query  594   IVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvll  415
             +V++P+  GL LN +     + IR F+P +++  TSLC+G+PLA+N   +VS  G  +L 
Sbjct  195   VVILPIVLGLSLNTYAKGFVDKIRTFMPLMAMVCTSLCIGSPLALNRSRIVSMEGFRLLF  254

Query  414   lVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVG  235
              V+AFH+ AF+ GY +    F    +   + RT+S  TGMQSS LA+ LA +F       
Sbjct  255   PVLAFHIGAFVLGYWIPRLPFWKQDE--KVSRTISLCTGMQSSTLAMLLATQFLGGSH-A  311

Query  234   VPPAISVVIMSLMGFSLVMFWNKN  163
             VPPA SVV+M+ MG SL  FW K 
Sbjct  312   VPPACSVVVMATMGLSLASFWGKG  335



>ref|XP_010055572.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic 
[Eucalyptus grandis]
Length=200

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 154/214 (72%), Gaps = 30/214 (14%)
 Frame = -1

Query  795  MLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIG  616
            ML SCVSGAQLSNYATFLTDP MAPLSIV+TSLSTATA  VTP LSLLLIGKRLPVDV  
Sbjct  1    MLVSCVSGAQLSNYATFLTDPSMAPLSIVITSLSTATAVSVTPLLSLLLIGKRLPVDVKV  60

Query  615  MISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsp  436
            M S+I+QIVV P+ AGLLLNRFFP +CNAIR                             
Sbjct  61   MFSSILQIVVAPITAGLLLNRFFPWICNAIR--------------------------PLL  94

Query  435  sglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKF  256
              LS+LLL+IAFHLSAF+ GY      F+ AP VK LQRTLS+ETGMQSSLLALALAN+F
Sbjct  95   PPLSILLLIIAFHLSAFVIGYFF----FQKAPVVKALQRTLSFETGMQSSLLALALANRF  150

Query  255  FQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKST  154
            FQDPLV VPPAIS  + SLM FSLVM W + ++T
Sbjct  151  FQDPLVAVPPAISTAMTSLMAFSLVMLWARRRAT  184



>ref|XP_004512195.1| PREDICTED: probable sodium/metabolite cotransporter BASS6, chloroplastic-like 
[Cicer arietinum]
Length=209

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 161/203 (79%), Gaps = 2/203 (1%)
 Frame = -1

Query  867  LLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslsta  688
            + GYL   I++  F LPTS+  GI+L + VSGAQLS+YATFL+DP +APLSIVMTSLST 
Sbjct  8    IFGYLLCIISVNIFSLPTSI--GIVLLASVSGAQLSSYATFLSDPYVAPLSIVMTSLSTI  65

Query  687  taaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPP  508
            ++  +TP L LLLIGKRLP+DV GM+ +I QIV+VP+  GLLLNRFFP +CNAI PFLP 
Sbjct  66   SSVFITPLLLLLLIGKRLPIDVKGMVFSITQIVLVPITFGLLLNRFFPHICNAIPPFLPL  125

Query  507  LSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKP  328
            LSV V +L  GAPLA+NI SV S  G ++ LL +AFHLS+F++GY L+G  FR +PDVKP
Sbjct  126  LSVLVAALSAGAPLALNIDSVKSSFGFAIFLLAVAFHLSSFVAGYILSGFVFRYSPDVKP  185

Query  327  LQRTLSYETGMQSSLLALALANK  259
            LQRT+S+ETGMQSSLL LALAN 
Sbjct  186  LQRTISFETGMQSSLLTLALANN  208



>gb|ABK25200.1| unknown [Picea sitchensis]
Length=433

 Score =   226 bits (576),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 156/372 (42%), Positives = 220/372 (59%), Gaps = 18/372 (5%)
 Frame = -1

Query  1263  SLPRKSFNSSARSSRLPVSRCVSENLSDSIRPES-LSNYAAESSEIFKPKE---NSFLTV  1096
             S  R+  N   R   L +  C + + +  +   S + N    S EI KPK       +  
Sbjct  48    SCNRRKLN---RKHGLLLVSCSTPSYTGRVGTHSRVGNVTLASFEI-KPKRFPNGQRVDF  103

Query  1095  LRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNR  916
                 + +LP VV G+   AL+ P +F W +  YYAPALG +M ++GV  S KDF  AF R
Sbjct  104   TESLSGVLPLVVAGTAAAALIKPATFAWVSKEYYAPALGGIMLSIGVQLSVKDFALAFQR  163

Query  915   PGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTD  736
             P  +  GY+ Q+++KP+LG L       AFG P   AAG +LT+CV+GAQLS YA+FL+ 
Sbjct  164   PLPLTVGYLAQYLLKPILGVLIAR----AFGTPPIFAAGFILTACVAGAQLSTYASFLSK  219

Query  735   PPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLN  556
               +A LSIV+TSL+T ++ ++TP L+ LLIG  +PVD I M  +I+Q+V++PVA GL LN
Sbjct  220   GDVA-LSIVLTSLTTISSVIITPVLTGLLIGSVVPVDAIAMSKSILQVVLIPVALGLALN  278

Query  555   RFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISG  376
              +     N IRPF+P +++  TSLC+G+PLA+N   ++S  GL ++  V++FH  AF+ G
Sbjct  279   TYAKPFVNLIRPFMPLMAMVCTSLCIGSPLALNQSQIISMEGLQLVFPVLSFHTFAFVIG  338

Query  375   YTLAGA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSL  199
             Y +A     R   +V    RT+S  TGMQSS LA  LA +F       VP A SVV M++
Sbjct  339   YWVAKLPLLRQEENV---CRTISLCTGMQSSTLAGLLATQFLGST-NAVPAACSVVAMAI  394

Query  198   MGFSLVMFWNKN  163
             MG SL  FW + 
Sbjct  395   MGLSLASFWGRG  406



>ref|XP_006850283.1| hypothetical protein AMTR_s00020p00147840 [Amborella trichopoda]
 gb|ERN11864.1| hypothetical protein AMTR_s00020p00147840 [Amborella trichopoda]
Length=423

 Score =   224 bits (570),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 140/307 (46%), Positives = 199/307 (65%), Gaps = 10/307 (3%)
 Frame = -1

Query  1080  AILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAIL  901
              +LP VV  +   AL+YP +F+W +  YYAPALG +M ++G+  S  DF  AF RP  + 
Sbjct  102   GMLPLVVAATAAGALLYPVTFSWVSKEYYAPALGGIMLSIGIQLSINDFALAFQRPLPLS  161

Query  900   AGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAP  721
              G++ Q+V+KP+LG +     + AF +P   AAG +LTSCV GAQLS+YA+FLT   +A 
Sbjct  162   IGFMAQYVLKPMLGLMI----VRAFRMPPIFAAGFILTSCVCGAQLSSYASFLTQGDVA-  216

Query  720   LSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQ  541
             LSI++TS +T ++ LVTP L+ LLIG  +PVD + M  +I+Q+V++P+  GL+LN +   
Sbjct  217   LSILLTSCTTISSVLVTPLLTRLLIGSVVPVDAVAMSKSILQVVLLPITLGLVLNTYAKP  276

Query  540   VCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAG  361
             V NAIRPF+P L++  TSLC+G+PLAIN   +++  GL +L  V+ FH SAFI GY ++ 
Sbjct  277   VVNAIRPFMPFLAMICTSLCIGSPLAINRNQILTMDGLRLLAPVLVFHTSAFIVGYWVSK  336

Query  360   AAF-RDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSL  184
               F R   +V    RT+S  TGMQSS LA  LA +F       VP A SVV M+++G +L
Sbjct  337   LEFLRQEENVC---RTISLCTGMQSSTLAGLLATQFLGSSH-AVPAACSVVAMAILGLNL  392

Query  183   VMFWNKN  163
               +W   
Sbjct  393   AFYWGNG  399



>ref|XP_002973383.1| hypothetical protein SELMODRAFT_54929, partial [Selaginella moellendorffii]
 ref|XP_002976523.1| hypothetical protein SELMODRAFT_54930, partial [Selaginella moellendorffii]
 gb|EFJ22192.1| hypothetical protein SELMODRAFT_54930, partial [Selaginella moellendorffii]
 gb|EFJ25757.1| hypothetical protein SELMODRAFT_54929, partial [Selaginella moellendorffii]
Length=305

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 203/313 (65%), Gaps = 10/313 (3%)
 Frame = -1

Query  1104  LTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEA  925
             + + +  + +LP++V+ +   AL++P +F W    +YAPALG +M ++GV  S  DF   
Sbjct  2     IDIAKSLSKMLPYIVVATAAAALIHPATFAWVRKEHYAPALGGIMLSIGVQLSISDFAIV  61

Query  924   FNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATF  745
               RP  +  GY+ Q+V+KP+LG+L     +  FG+P S AAG++LT+CV+GAQLS+YA +
Sbjct  62    LQRPLPLCMGYVLQYVMKPILGFL----VVRGFGVPPSFAAGLILTACVAGAQLSSYAAY  117

Query  744   LTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGL  565
             L++  +A LSI++TS+ST T+ +VTPFL+  LIG  +PVDV+ M  +I+Q+V +PV  GL
Sbjct  118   LSEGDIA-LSIMLTSISTITSVIVTPFLTQFLIGSVVPVDVVAMAKSILQVVFLPVLTGL  176

Query  564   LLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAF  385
              LN +   + + IRP +P +++  TSLC+G+PLA+N   ++S  GL +L  V+ FH   F
Sbjct  177   TLNTYAKPLVDRIRPVMPLVAMVCTSLCIGSPLALNQSKIISMEGLQLLFPVLVFHALGF  236

Query  384   ISGYTLAGAAF-RDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
               GY ++   F R    V    RTLS  TGMQSS LA+ LA +F  D    VPPA SVVI
Sbjct  237   GLGYFISRLPFWRQNHKVS---RTLSLCTGMQSSTLAMLLATQFLGDT-QAVPPACSVVI  292

Query  207   MSLMGFSLVMFWN  169
             M++MG +L  +W 
Sbjct  293   MAVMGLTLATWWG  305



>gb|KFK39838.1| hypothetical protein AALP_AA3G294600 [Arabis alpina]
Length=428

 Score =   221 bits (563),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 163/411 (40%), Positives = 230/411 (56%), Gaps = 35/411 (9%)
 Frame = -1

Query  1317  SLPKPLPCINLEFHYPFLSLPRKS--FNSSARSSRLP------VSRC-VSENLSDSIRPE  1165
             SL  P P I  +   P   LP KS  F     +SRLP      +  C +S +L   +R  
Sbjct  6     SLSFPPPAIPRQTLVPDFRLPAKSRCFECQLPTSRLPSLSSISIDSCSLSNSLDFRVRRR  65

Query  1164  SLSNYAAESSEI-------FKPKENSFLTVLRGA---------NAILPHVVLGSTILALV  1033
             S    A  ++         ++    S L+   G          +A+LP VV  + + AL 
Sbjct  66    SGGALACSTTPFMGRVGLQWRDGNMSLLSFCGGTERADTSQVLSALLPFVVALTAVAALS  125

Query  1032  YPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYL  853
             YPPSFTW +   YAPALG +M ++G+  S +DF  AF RP  +  G+I Q+V+KPLLG L
Sbjct  126   YPPSFTWVSKELYAPALGGIMLSIGIQLSVQDFALAFKRPVPLSVGFIAQYVLKPLLGVL  185

Query  852   FGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLV  673
                    AFG+P +  AG +LT CV+GAQLS+YA+ L+   +A +SI++TS +T  + L 
Sbjct  186   VAN----AFGMPRTFYAGFVLTCCVAGAQLSSYASSLSKADVA-MSILLTSCTTIASVLF  240

Query  672   TPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFV  493
             TP LS  LIG  +PVD I M  +I+Q+V+VPV  GL+LN +   V + +RP +P +++  
Sbjct  241   TPMLSGFLIGSVVPVDAIAMSKSILQVVLVPVTLGLVLNTYAKPVVSLLRPVMPFVAMVC  300

Query  492   TSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA-AFRDAPDVKPLQRT  316
             TSLC+G+PL+IN   ++S  GL ++L VI FH  AF+ GY  +     R   +V    RT
Sbjct  301   TSLCIGSPLSINQSQILSAEGLRLILPVITFHALAFVVGYWFSKIPGLRQEEEVS---RT  357

Query  315   LSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
             +S  TGMQSS LA  LA++F       VP A SVV+M++MG  L  FW   
Sbjct  358   ISLCTGMQSSTLAGLLASQFLGSS-QAVPAACSVVVMAIMGLCLASFWGNG  407



>ref|XP_004247027.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Solanum lycopersicum]
Length=413

 Score =   219 bits (559),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 154/395 (39%), Positives = 228/395 (58%), Gaps = 24/395 (6%)
 Frame = -1

Query  1299  PCINLEFHYPFLSLPRKSFN-SSARSSRLPV----SRCVSENLSDS--------IRPE--  1165
             P +++++  PFLS+P   F+  S  S R PV    + C    L+ S         R E  
Sbjct  5     PFLSVKYPKPFLSIPNSIFHGKSTFSVRYPVLPGFNGCAVACLTSSPLTGRVGLQRREGN  64

Query  1164  -SLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAP  988
              SL ++ A     +  +++  +   +  +A+LP VV  + + AL +P +FTW +   YAP
Sbjct  65    LSLLSFGANPKSFYVAEDDEKVDYSQVLSALLPFVVAITAVAALSHPSTFTWVSKDLYAP  124

Query  987   ALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSL  808
             ALG +M ++G+  S  DF  A  RP  +  G++ Q+V+KP LG L       AFG+PT+ 
Sbjct  125   ALGGIMLSIGIKLSIDDFALAIKRPFPLSVGFVAQYVLKPALGLLLAQ----AFGMPTTF  180

Query  807   AAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPV  628
              AG +L SCV+GAQLS+YA+FL+   +A  SI++TS ST  + LVTP L+ LLIG  +PV
Sbjct  181   YAGFVLVSCVAGAQLSSYASFLSKSDVA-FSILLTSTSTIASVLVTPLLTGLLIGSVVPV  239

Query  627   DVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQs  448
             D + M  +I+Q+V++PVA GL+LN +   V + I+P +P +++  TSLC+G+PLAIN   
Sbjct  240   DAVAMAKSILQVVLLPVALGLVLNTYAKPVVSVIQPVMPFVAMICTSLCIGSPLAINRAQ  299

Query  447   vvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALAL  268
             ++S  G  ++  V+ FH  AF  GY L+        +   + RT+S  TGMQSS LA  L
Sbjct  300   ILSAEGAKLIAPVLTFHGMAFALGYWLSKLPILRFEE--EMCRTISLCTGMQSSTLAGLL  357

Query  267   ANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
             A +F       VPPA SVV M++MG  L  FW   
Sbjct  358   ATQFLGSSQ-AVPPACSVVAMAIMGLCLASFWGSG  391



>gb|EEC73156.1| hypothetical protein OsI_07191 [Oryza sativa Indica Group]
Length=424

 Score =   218 bits (554),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 139/307 (45%), Positives = 199/307 (65%), Gaps = 8/307 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +F+W +  YYAPALG +M ++G+  S  DF  AF RP  +
Sbjct  106   SALLPLVVAATAVAALGNPATFSWVSKEYYAPALGGIMLSIGIKLSIDDFALAFKRPVPL  165

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               GY+ Q++VKPL+G L       AFG+P++  AG +LT CVSGAQLS+YA+FL+   +A
Sbjct  166   TIGYMAQYIVKPLMGVLIAR----AFGMPSAFFAGFVLTCCVSGAQLSSYASFLSKGDVA  221

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS ST ++ +VTP L+ LLIG  +PVD I M  +I+Q+V+VPV  GLLLN +  
Sbjct  222   -LSILLTSCSTISSVVVTPVLTGLLIGSVVPVDGIAMAKSILQVVLVPVTLGLLLNTYAK  280

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N I+P +P +++  TSLC+G+PLAIN   ++S  G  +LL ++ FH++AFI GY ++
Sbjct  281   AVVNVIQPVMPFVAMLCTSLCIGSPLAINRSKILSSEGFLLLLPIVTFHIAAFIVGYWIS  340

Query  363   GAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSL  184
                     +  P+ RT+S  TGMQSS LA  LA +F       VP A SVVIM++ G +L
Sbjct  341   KLPMLRQEE--PVCRTISVCTGMQSSTLAGLLATQFLGSSQ-AVPAACSVVIMAIFGLTL  397

Query  183   VMFWNKN  163
               +W   
Sbjct  398   ASYWGNG  404



>emb|CDY27896.1| BnaA07g04860D [Brassica napus]
Length=415

 Score =   217 bits (553),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 195/308 (63%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL YP +FTW +   YAPALG +M ++G+  S +DF  AF RP  +
Sbjct  96    SALLPFVVALTALAALSYPSTFTWVSKELYAPALGGIMLSIGIQLSVQDFALAFKRPVPL  155

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KPLLG L       AFG+PT+  AG +LT CV+GAQLS+YA+ L+   +A
Sbjct  156   SVGFVAQYVLKPLLGVLVAN----AFGMPTTFYAGFVLTCCVAGAQLSSYASSLSKADVA  211

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI++TS +T  + L TP LS LLIG  +PVD + M  +I+Q+V+VPV  GL+LN +  
Sbjct  212   -MSILLTSSTTIASVLFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPVTLGLVLNTYAK  270

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   +RP +P +++  TSLC+G+PL+IN   ++S  GL ++L VI FH  AF+ GY  +
Sbjct  271   PVVTLLRPVMPFVAMVCTSLCIGSPLSINRSQILSAEGLRLILPVITFHAVAFVVGYWFS  330

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RT+S  TGMQSS LA  LA++F       VP A SVV+M++MG  
Sbjct  331   KIPGLRQEEEVS---RTISLCTGMQSSTLAGLLASQFLGSSQ-AVPAACSVVVMAIMGLC  386

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  387   LASFWGNG  394



>ref|NP_001046843.1| Os02g0475400 [Oryza sativa Japonica Group]
 sp|Q6K739.1|BASS3_ORYSJ RecName: Full=Probable sodium/metabolite cotransporter BASS3, 
chloroplastic; AltName: Full=Bile acid-sodium symporter family 
protein 3; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD21908.1| bile acid:sodium symporter-like [Oryza sativa Japonica Group]
 dbj|BAF08757.1| Os02g0475400 [Oryza sativa Japonica Group]
 dbj|BAH00271.1| unnamed protein product [Oryza sativa Japonica Group]
Length=423

 Score =   217 bits (553),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 139/307 (45%), Positives = 199/307 (65%), Gaps = 8/307 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +F+W +  YYAPALG +M ++G+  S  DF  AF RP  +
Sbjct  105   SALLPLVVAATAVAALGNPATFSWVSKEYYAPALGGIMLSIGIKLSIDDFALAFKRPVPL  164

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               GY+ Q++VKPL+G L       AFG+P++  AG +LT CVSGAQLS+YA+FL+   +A
Sbjct  165   TIGYMAQYIVKPLMGVLIAR----AFGMPSAFFAGFVLTCCVSGAQLSSYASFLSKGDVA  220

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS ST ++ +VTP L+ LLIG  +PVD I M  +I+Q+V+VPV  GLLLN +  
Sbjct  221   -LSILLTSCSTISSVVVTPVLTGLLIGSVVPVDGIAMAKSILQVVLVPVTLGLLLNTYAK  279

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N I+P +P +++  TSLC+G+PLAIN   ++S  G  +LL ++ FH++AFI GY ++
Sbjct  280   AVVNVIQPVMPFVAMLCTSLCIGSPLAINRSKILSSEGFLLLLPIVTFHIAAFIVGYWIS  339

Query  363   GAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSL  184
                     +  P+ RT+S  TGMQSS LA  LA +F       VP A SVVIM++ G +L
Sbjct  340   KLPMLRQEE--PVCRTISVCTGMQSSTLAGLLATQFLGSSQ-AVPAACSVVIMAIFGLTL  396

Query  183   VMFWNKN  163
               +W   
Sbjct  397   ASYWGNG  403



>ref|XP_006648635.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic-like, 
partial [Oryza brachyantha]
Length=328

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 138/308 (45%), Positives = 199/308 (65%), Gaps = 8/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +F+W +  YYAPALG +M ++G+  S  DF  AF RP  +
Sbjct  10    SALLPLVVAATAVAALGNPATFSWVSKEYYAPALGGIMLSIGIKLSIDDFALAFKRPVPL  69

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               GY+ Q+++KP LG L       AFG+P++  AG +LT CVSGAQLS+YA+FL+   +A
Sbjct  70    TIGYVAQYILKPALGVLIAR----AFGMPSAFFAGFVLTCCVSGAQLSSYASFLSKGDVA  125

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS ST ++ +VTP L+ LLIG  +PVD I M  +I+Q+V+VPV  GLLLN +  
Sbjct  126   -LSILLTSCSTISSVVVTPVLTGLLIGSVVPVDGIAMAKSILQVVLVPVTLGLLLNTYAK  184

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N I+P +P +++  TSLC+G+PLAIN   ++S  G  +LL ++ FH++AFI GY ++
Sbjct  185   AVVNVIQPVMPFVAMVCTSLCIGSPLAINRSMILSSEGFLLLLPIVTFHVAAFIVGYWVS  244

Query  363   GAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSL  184
                     +  P+ RT+S  TGMQSS LA  LA++F       VP A SVVIM++ G +L
Sbjct  245   KLPMLRQEE--PVCRTISVCTGMQSSTLAGLLASQFLGSSQ-AVPAACSVVIMAIFGLTL  301

Query  183   VMFWNKNK  160
               +W    
Sbjct  302   GSYWGNGS  309



>emb|CDY00836.1| BnaCnng00360D [Brassica napus]
Length=417

 Score =   216 bits (549),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 195/308 (63%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL YP +FTW +   YAPALG +M ++G+  S +DF  AF RP  +
Sbjct  98    SALLPFVVALTALAALSYPSTFTWVSKELYAPALGGIMLSIGIQLSIQDFALAFKRPVPL  157

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KPLLG L       AFG+PT+  AG +LT CV+GAQLS+YA+ L+   +A
Sbjct  158   SVGFVAQYVLKPLLGVLVAN----AFGMPTTFYAGFVLTCCVAGAQLSSYASSLSKADVA  213

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI++TS +T  + L TP LS LLIG  +PVD + M  +I+Q+V+VPV  GL+LN +  
Sbjct  214   -MSILLTSSTTIASVLFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPVTLGLVLNTYAK  272

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   +RP +P +++  TSLC+G+PL+IN   ++S  GL ++L VI FH  AF+ GY  +
Sbjct  273   PVVTLLRPVMPFVAMVCTSLCIGSPLSINRSQILSAEGLRLILPVITFHALAFVVGYWFS  332

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RT+S  TGMQSS LA  LA++F       VP A SVV+M++MG  
Sbjct  333   KIPGLRQEEEVS---RTISLCTGMQSSTLAGLLASQFLGSSQ-AVPAACSVVVMAIMGLC  388

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  389   LASFWGNG  396



>ref|XP_002885704.1| bile acid:sodium symporter family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH61963.1| bile acid:sodium symporter family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=424

 Score =   216 bits (549),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 195/308 (63%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL YPPSFTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  105   SALLPFVVALTAVAALCYPPSFTWVSKELYAPALGGIMLSIGIQLSIDDFALAFKRPVPL  164

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KPLLG L       AFG+P +  AG +LT CV+GAQLS+YA+ L+   +A
Sbjct  165   SVGFVAQYVLKPLLGVLIAN----AFGMPRTFYAGFVLTCCVAGAQLSSYASSLSKADVA  220

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI++TS +T  + + TP LS LLIG  +PVD + M  +I+Q+V+VPV+ GL+LN +  
Sbjct  221   -MSILLTSSTTIASVIFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPVSLGLVLNTYAK  279

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   ++P +P +++  TSLC+G+PL+IN   ++S  GL +++ ++ FH  AF+ GY  +
Sbjct  280   PVVTLLQPVMPFVAMVCTSLCIGSPLSINRSQILSAEGLGLIVPIVTFHAVAFVLGYWFS  339

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RT+S  TGMQSS LA  LA++F       VP A SVV+M++MG  
Sbjct  340   KIPGLRQEEEVS---RTISLCTGMQSSTLAGLLASQFLGSSQ-AVPAACSVVVMAIMGLC  395

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  396   LASFWGNG  403



>ref|XP_010488641.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Camelina sativa]
Length=427

 Score =   216 bits (549),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 135/308 (44%), Positives = 194/308 (63%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL YPPSFTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  108   SALLPFVVALTAVAALSYPPSFTWVSKEMYAPALGGIMLSIGIQLSIDDFALAFKRPVPL  167

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KPLLG L       AFG+P +  AG +LT CV+GAQLS+YA+ L+   +A
Sbjct  168   SVGFVAQYVLKPLLGVLVAN----AFGMPRTFYAGFVLTCCVAGAQLSSYASSLSKADVA  223

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI++TS +T  + L TP LS LLIG  +PVD + M  +I+Q+V+VPV  GL+LN +  
Sbjct  224   -MSILLTSSTTIASVLFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPVTLGLVLNTYAK  282

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   I+P +P +++  TSLC+G+PL+IN   ++S  GL +++ ++ FH  AF+ GY  +
Sbjct  283   PVVTLIQPMMPFVAMVCTSLCIGSPLSINRSQILSAEGLGLIIPIVTFHAVAFVLGYWFS  342

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RT+S  TGMQSS LA  LA++F       VP A SVV+M++MG  
Sbjct  343   KIPGLRQEEEVS---RTISLCTGMQSSTLAGLLASQFLGSSQ-AVPAACSVVVMAIMGLC  398

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  399   LASFWGNG  406



>ref|XP_006418632.1| hypothetical protein EUTSA_v10002537mg [Eutrema salsugineum]
 gb|ESQ37068.1| hypothetical protein EUTSA_v10002537mg [Eutrema salsugineum]
Length=428

 Score =   216 bits (549),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 196/308 (64%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL YP +FTW +   YAPALG +M ++G+  S +DF  AF RP  +
Sbjct  109   SALLPFVVALTAVAALSYPSTFTWVSKELYAPALGGIMLSIGIQLSVEDFALAFKRPVPL  168

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KPLLG L       AFG+P++  AG +LT CV+GAQLS+YA+ L+   +A
Sbjct  169   SVGFVAQYVLKPLLGVLIAK----AFGMPSTFYAGFVLTCCVAGAQLSSYASSLSKADVA  224

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI++TS +T  + L TP LS LLIG  +PVD I M  +I+Q+V+VPV  GL+LN +  
Sbjct  225   -MSILLTSCTTIASVLFTPLLSGLLIGSVVPVDAIAMSKSILQVVLVPVTLGLVLNTYAK  283

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   +RP +P +++  TSLC+G+PL+IN   ++SP G+ ++L VI FH  AF+ GY  +
Sbjct  284   PVVTLLRPVMPFVAMVCTSLCIGSPLSINRSQILSPEGIRLILPVITFHAVAFVLGYWFS  343

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RT+S  TGMQSS LA  LA++F       VP A SVV+M++MG  
Sbjct  344   KIPGLRQEEEVS---RTISLCTGMQSSTLAGLLASQFLGS-CQAVPAACSVVVMAIMGLC  399

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  400   LASFWGNG  407



>ref|XP_006345716.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic-like 
[Solanum tuberosum]
Length=471

 Score =   216 bits (550),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 156/396 (39%), Positives = 228/396 (58%), Gaps = 26/396 (7%)
 Frame = -1

Query  1299  PCINLEFHYPFLSLPRKSFNS-SARSSRLPVSR--------C-VSENLSDSI---RPE--  1165
             P +++++  PFLS+P   F S S  S R PV +        C  S  L+  +   R E  
Sbjct  63    PFLSVKYPKPFLSIPNSIFQSKSTFSIRYPVHKGFNGGAVACSTSSPLTGRVGLHRREGN  122

Query  1164  -SLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAP  988
              SL  + A     +  ++   +   +  +A+LP VV  + + AL +P +FTW +   YAP
Sbjct  123   LSLLLFGANPKSFYVAEDEEKVDYSQALSALLPFVVALTAVAALSHPSTFTWVSKELYAP  182

Query  987   ALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSL  808
             ALG +M ++G+  S  DF  A  RP  +  G++ Q+V+KP LG L       AFG+P + 
Sbjct  183   ALGGIMLSIGIRLSIDDFALAIKRPLPLSVGFVAQYVLKPALGLLVAQ----AFGIPPTF  238

Query  807   AAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPV  628
              AG +L SCV+GAQLS+YA+FL+   +A  SI++TS ST  + LVTP L+ LLIG  +PV
Sbjct  239   YAGFVLMSCVAGAQLSSYASFLSKSDVA-FSILLTSSSTIASVLVTPLLTGLLIGSVVPV  297

Query  627   DVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQs  448
             D + M  +I+Q+V++PVA GL+LN +   V + I+P +P +++  TSLC+G+PLAIN   
Sbjct  298   DAVAMAKSILQVVLLPVALGLVLNTYAKPVVSVIQPVMPFVAMICTSLCIGSPLAINRAQ  357

Query  447   vvspsglsvlllVIAFHLSAFISGYTLAGA-AFRDAPDVKPLQRTLSYETGMQSSLLALA  271
             ++S  G+ ++  V+ FH  AF  GY L+     R   +V    RT+S  TGMQSS LA  
Sbjct  358   ILSAEGVKLIAPVLTFHAMAFAVGYWLSKLPILRFEEEV---CRTISLCTGMQSSTLAGL  414

Query  270   LANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
             LA +F       VPPA SVV M++MG  L  FW   
Sbjct  415   LATQFLGSSQ-AVPPACSVVAMAIMGLCLASFWGSG  449



>ref|XP_010678956.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=430

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 195/308 (63%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV+ + I AL  P SFTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  111   SAMLPFVVVATAIAALSQPSSFTWVSKELYAPALGGIMLSIGIRLSIDDFALAFQRPLPL  170

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q++VKP+LG L       AFG+     AG +LT+CV+GAQLS+YA+FL+   +A
Sbjct  171   SLGFIAQYLVKPVLGVLIAQ----AFGVSPMFYAGFVLTACVAGAQLSSYASFLSKGDVA  226

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS ST  + +VTP L+ LLIG  +PVD + M  +I+Q+V+VPV+ GLLLN +  
Sbjct  227   -LSILLTSSSTIASVIVTPLLTRLLIGSVVPVDALAMSKSILQVVLVPVSLGLLLNTYAK  285

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N ++P +P +++  TSLC+G+PLAIN   ++S  GL ++  V+ FH +AF  GY L+
Sbjct  286   TVVNFLQPVMPIVAMVCTSLCIGSPLAINRGRILSAEGLRLIAPVLVFHATAFTLGYWLS  345

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RT+S  TGMQSS LA  LA +F       VP A SVV+M++MG  
Sbjct  346   KLPPLRQEEEVS---RTISLCTGMQSSTLAGLLATQFLGSS-QAVPSACSVVVMAIMGLV  401

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  402   LASFWGNG  409



>ref|XP_010466952.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Camelina sativa]
Length=427

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/308 (44%), Positives = 194/308 (63%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL YPPSFTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  108   SALLPFVVALTAVAALSYPPSFTWVSKEMYAPALGGIMLSIGIQLSIDDFALAFKRPVPL  167

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KPLLG L       AFG+P +  AG +LT CV+GAQLS+YA+ L+   +A
Sbjct  168   SVGFVAQYVLKPLLGVLVAN----AFGMPRTFYAGFVLTCCVAGAQLSSYASSLSKADVA  223

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI++TS +T  + L TP LS LLIG  +PVD + M  +I+Q+V+VPV  GL+LN +  
Sbjct  224   -MSILLTSSTTIASVLFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPVTLGLVLNTYAK  282

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              +   I+P +P +++  TSLC+G+PL+IN   ++S  GL +++ ++ FH  AFI GY  +
Sbjct  283   PLVTLIQPVMPFVAMVCTSLCIGSPLSINRSQILSAEGLGLIIPIVTFHAVAFILGYWFS  342

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RT+S  TGMQSS LA  LA++F       VP A SVV+M++MG  
Sbjct  343   KIPGLRQEEEVS---RTISLCTGMQSSTLAGLLASQFLGSSQ-AVPAACSVVVMAIMGLC  398

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  399   LASFWGNG  406



>ref|XP_009334244.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Pyrus x bretschneideri]
Length=425

 Score =   213 bits (543),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 194/309 (63%), Gaps = 10/309 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + I AL  P +FTW +   YAPALG +M ++GV  S  DF  AF RP  +
Sbjct  107   SAMLPFVVAATAIAALAQPSTFTWVSKDLYAPALGGIMLSIGVKLSIDDFALAFKRPLPL  166

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KP+LG L       AFG+P    AG +LT+CV+GAQLS+YA+FL+   +A
Sbjct  167   SVGFIAQYVLKPVLGVLIAN----AFGVPRMFYAGFVLTACVAGAQLSSYASFLSKGDVA  222

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T  + +VTP L+ LLIG  +PVD + M  +I+Q+V+VPV  GL+LN +  
Sbjct  223   -LSILLTSTTTIASVIVTPLLTGLLIGSVVPVDAVAMSKSILQVVLVPVTIGLVLNTYAK  281

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N +RP +P +++  TSLC+G+PLAIN   ++S  G  ++  VIAFH  AF  GY ++
Sbjct  282   PVVNFLRPVMPVVAMICTSLCIGSPLAINRSQILSVEGFRLIFPVIAFHAVAFTLGYWVS  341

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RTLS  TGMQSS LA  LA++F       VPPA SVV M+++G  
Sbjct  342   KTPGLRQEEEV---SRTLSLCTGMQSSTLAGLLASQFLGSSQ-AVPPACSVVAMAILGLF  397

Query  186   LVMFWNKNK  160
             L  FW    
Sbjct  398   LASFWGTGS  406



>ref|XP_008363828.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Malus domestica]
Length=429

 Score =   213 bits (543),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 193/309 (62%), Gaps = 10/309 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + I AL  P +FTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  111   SAMLPFVVAATAIAALAQPSTFTWVSKDLYAPALGGIMLSIGIKLSIDDFALAFKRPLPL  170

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KPLLG L       AFG+P    AG +LT+CV GAQLS+YA+FL+   +A
Sbjct  171   SVGFIAQYVLKPLLGVLIAN----AFGVPRMFYAGFVLTACVXGAQLSSYASFLSKGDVA  226

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T  + + TP L+ LLIG  +PVD + M  +I+Q+V+VPV  GL+LN +  
Sbjct  227   -LSILLTSTTTIASVIATPLLTGLLIGSVVPVDAVAMSKSILQVVLVPVTIGLVLNTYAK  285

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N +RP +P +++  TSLC+G+PLAIN   ++S  G  ++  VIAFH  AF  GY ++
Sbjct  286   PVVNFLRPVMPVVAMICTSLCIGSPLAINRSQILSVEGFRLIFPVIAFHAVAFTLGYWVS  345

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
              +   R   +V    RTLS  TGMQSS LA  LA++F       VPPA SVV M++MG  
Sbjct  346   KSPGLRQEEEVS---RTLSLCTGMQSSTLAGLLASQFLGSSQ-AVPPACSVVAMAIMGLF  401

Query  186   LVMFWNKNK  160
             L  FW    
Sbjct  402   LASFWGTGS  410



>ref|XP_010913121.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=422

 Score =   213 bits (542),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 206/321 (64%), Gaps = 15/321 (5%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + ALV P +F+W +  YYAPALG +M ++G+  S  DF  AF RP  +
Sbjct  104   SAMLPFVVAATAVAALVNPSTFSWVSKEYYAPALGGIMLSIGIRLSFDDFALAFRRPLPL  163

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               GYI Q+V+KPLLG +   +    F +P++   G +LTSCV+GAQLS+YA+FL+   +A
Sbjct  164   SVGYIAQYVLKPLLGLVIAKL----FRMPSTFFTGFLLTSCVAGAQLSSYASFLSKGDVA  219

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T ++  VTP L+ LLIG  +PVD + M  +I+Q+V++PVA GL LN +  
Sbjct  220   -LSILLTSSTTISSVFVTPLLTGLLIGSVIPVDGVAMSKSILQVVLLPVALGLFLNTYAK  278

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N I+P +P +++F TSLC+G+PLAIN   ++S  GL +L  ++ FHL AFI GY   
Sbjct  279   AVVNVIQPIMPIVAMFCTSLCIGSPLAINQSQILSSEGLLLLFPILTFHLVAFILGYW--  336

Query  363   GAAFRDAP---DVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMG  193
                F   P     +P+ RT+S  TGMQSS LA  LA +F       VP A+SVV M++MG
Sbjct  337   ---FPKLPLLRQEEPVCRTISLCTGMQSSTLAGLLATQFLGSSQA-VPAALSVVAMAIMG  392

Query  192   FSLVMFW-NKNKSTNV*QLHI  133
               L  FW N ++  ++  +H+
Sbjct  393   LCLASFWGNGSRIRDISLMHL  413



>ref|XP_009358975.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Pyrus x bretschneideri]
Length=429

 Score =   212 bits (540),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 194/309 (63%), Gaps = 10/309 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + I AL  P +FTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  111   SAMLPFVVAATAIAALAQPSTFTWVSKDLYAPALGGIMLSIGIKLSVDDFALAFKRPLPL  170

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KPLLG L       AFG+P    AG +LT+CV+GAQLS+YA+FL+   +A
Sbjct  171   SVGFIAQYVLKPLLGVLIAN----AFGVPRVFYAGFVLTACVAGAQLSSYASFLSKGDVA  226

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              L+I++TS +T  + +VTP L+ LLIG  +PVD + M  +I+Q+V+VPV  GL+LN +  
Sbjct  227   -LNILLTSTTTIASVIVTPLLTGLLIGSVVPVDAVAMSKSILQVVLVPVTIGLVLNTYAK  285

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N ++P +P +++  TSLC+G+PLAIN   ++S  G  ++  VIAFH  AF  GY ++
Sbjct  286   PVVNFLQPVMPVVAMICTSLCIGSPLAINRSQILSVEGFRLIFPVIAFHAVAFTLGYWVS  345

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RTLS  TGMQSS LA  LA++F       VPPA SVV M++MG  
Sbjct  346   KTPGLRQEEEVS---RTLSLCTGMQSSTLAGLLASQFLGSSQ-AVPPACSVVAMAIMGLF  401

Query  186   LVMFWNKNK  160
             L  FW    
Sbjct  402   LASFWGTGS  410



>ref|XP_010532927.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Tarenaya hassleriana]
Length=439

 Score =   212 bits (540),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 191/308 (62%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + I AL YP +FTW +   YAPALG +M ++G+  S  DF  A  R   +
Sbjct  118   SALLPFVVAATAIAALSYPATFTWVSKELYAPALGGIMLSIGIQLSIHDFALALKRSVPL  177

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+ +KPLLG L       AFG+  +  AG +L SCV+GAQLS+YA+FL    +A
Sbjct  178   SVGFVAQYFLKPLLGVLVAN----AFGMSRTFYAGFVLMSCVAGAQLSSYASFLGKGDVA  233

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS ST  + L TP LS LLIG  +PVD I M  +I+Q+V+VPV+ GL+LN +  
Sbjct  234   -LSILLTSCSTIASVLFTPLLSGLLIGSVVPVDAIAMSKSILQVVLVPVSLGLVLNTYAK  292

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   +RP +P +++  TSLC+G+PLAIN   ++S  GL ++L V+ FH  AF+SGY + 
Sbjct  293   PVVAWLRPVMPFVAMVCTSLCIGSPLAINQSRILSAEGLRLILPVLVFHAVAFVSGYWVT  352

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                A R   +V    RT+S  TGMQSS LA  LA +F       VPPA SVV M++MG  
Sbjct  353   KIPALRQEEEV---SRTISLCTGMQSSTLAGLLATQFLGSS-QAVPPACSVVAMAIMGLC  408

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  409   LASFWGNG  416



>gb|AAM63721.1| unknown [Arabidopsis thaliana]
Length=431

 Score =   212 bits (540),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 132/308 (43%), Positives = 193/308 (63%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL YPPSFTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  112   SALLPFVVALTAVAALSYPPSFTWVSKDLYAPALGGIMLSIGIQLSVDDFALAFKRPVPL  171

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KPLLG L       AFG+P +  AG +LT CV+GAQLS+YA+ L+   +A
Sbjct  172   SVGFVAQYVLKPLLGVLVAN----AFGMPRTFYAGFILTCCVAGAQLSSYASSLSKADVA  227

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI++TS +T  + + TP LS LLIG  +PVD + M  +I+Q+V+VP+  GL+LN +  
Sbjct  228   -MSILLTSSTTIASVIFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPITLGLVLNTYAK  286

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   ++P +P +++  TSLC+G+PL+IN   ++S  GL +++ ++ FH  AF  GY  +
Sbjct  287   PVVTLLQPVMPFVAMVCTSLCIGSPLSINRSQILSAEGLGLIVPIVTFHAVAFALGYWFS  346

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RT+S  TGMQSS LA  LA++F       VP A SVV+M++MG  
Sbjct  347   KIPGLRQEEEVS---RTISLCTGMQSSTLAGLLASQFLGSSQ-AVPAACSVVVMAIMGLC  402

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  403   LASFWGNG  410



>ref|XP_010514113.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Camelina sativa]
Length=428

 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/308 (43%), Positives = 194/308 (63%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL YPPSFTW +   YAPALG +M ++G+  S  DF  A  RP  +
Sbjct  109   SALLPFVVALTAVAALSYPPSFTWVSKEMYAPALGGIMLSIGIQLSIDDFALAVKRPVPL  168

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KPLLG+L       AFG+P +  AG +LT CV+GAQLS+YA+ L+   +A
Sbjct  169   SVGFVAQYVLKPLLGFLVAN----AFGMPRTFYAGFVLTCCVAGAQLSSYASSLSKADVA  224

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI++TS +T  + L TP L+ LLIG  +PVD + M  +I+Q+V+VPV  GL+LN +  
Sbjct  225   -MSILLTSSTTIASVLFTPLLTGLLIGSVVPVDAVAMSKSILQVVLVPVTLGLVLNTYAK  283

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   I+P +P +++  TS+C+G+PL+IN   ++S  GL +++ ++ FH  AF+ GY  +
Sbjct  284   PVVTLIQPVMPFVAMVCTSVCIGSPLSINRSQILSAEGLGLIIPIVTFHAVAFVLGYWFS  343

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RT+S  TGMQSS LA  LA++F       VP A SVV+M++MG  
Sbjct  344   KIPGLRQEEEVS---RTISLCTGMQSSTLAGLLASQFLGSSQ-AVPAACSVVVMAIMGLC  399

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  400   LASFWGNG  407



>ref|XP_003622828.1| Sodium-dependent transporter, putative [Medicago truncatula]
 gb|AES79046.1| Na+-bile acid cotransporter [Medicago truncatula]
Length=416

 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 138/310 (45%), Positives = 195/310 (63%), Gaps = 14/310 (5%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +FTW +   YAPALG +M ++G+  S +DF  AF RP  +
Sbjct  97    SALLPFVVAVTAVAALSQPSTFTWVSKELYAPALGGIMLSIGIGLSMEDFALAFKRPLPL  156

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KP+LG L       AFGLP    AG +LT+CVSGAQLS+YA+F++   +A
Sbjct  157   SIGFIAQYVLKPVLGVLIAK----AFGLPRMFYAGFVLTACVSGAQLSSYASFISKGDVA  212

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              L IV+TS +T  + +VTP L+ LLIG  +PVD + M  +I+Q+V+ PV  GLLLN +  
Sbjct  213   -LCIVLTSYTTIASVIVTPLLTGLLIGSVVPVDAVAMSKSILQVVLAPVTLGLLLNTYAK  271

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V + +RP +P +++  TSLC+G+PLAIN   ++S  GL ++  V+ FH +AF  GY   
Sbjct  272   PVVSILRPVMPFVAMICTSLCIGSPLAINRSQILSGEGLRLVAPVLIFHAAAFTLGYW--  329

Query  363   GAAFRDAPDVK---PLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMG  193
                F + P ++    + RT+S  TGMQSS LA  LA +F       VPPA SVV M++MG
Sbjct  330   ---FSNLPSLRQEEQVSRTISLCTGMQSSTLAGLLATQFLGSS-QAVPPACSVVAMAIMG  385

Query  192   FSLVMFWNKN  163
               L  FW K 
Sbjct  386   LCLASFWGKG  395



>ref|NP_566764.1| probable sodium/metabolite cotransporter BASS3 [Arabidopsis thaliana]
 sp|Q8RXE8.1|BASS3_ARATH RecName: Full=Probable sodium/metabolite cotransporter BASS3, 
chloroplastic; AltName: Full=Bile acid transporter 3; AltName: 
Full=Bile acid-sodium symporter family protein 3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL91190.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91181.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77008.1| probable sodium/metabolite cotransporter BASS3 [Arabidopsis thaliana]
Length=431

 Score =   212 bits (539),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/308 (43%), Positives = 193/308 (63%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL YPPSFTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  112   SALLPFVVALTAVAALSYPPSFTWVSKDLYAPALGGIMLSIGIQLSVDDFALAFKRPVPL  171

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KPLLG L       AFG+P +  AG +LT CV+GAQLS+YA+ L+   +A
Sbjct  172   SVGFVAQYVLKPLLGVLVAN----AFGMPRTFYAGFILTCCVAGAQLSSYASSLSKADVA  227

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI++TS +T  + + TP LS LLIG  +PVD + M  +I+Q+V+VP+  GL+LN +  
Sbjct  228   -MSILLTSSTTIASVIFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPITLGLVLNTYAK  286

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   ++P +P +++  TSLC+G+PL+IN   ++S  GL +++ ++ FH  AF  GY  +
Sbjct  287   PVVTLLQPVMPFVAMVCTSLCIGSPLSINRSQILSAEGLGLIVPIVTFHAVAFALGYWFS  346

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RT+S  TGMQSS LA  LA++F       VP A SVV+M++MG  
Sbjct  347   KIPGLRQEEEVS---RTISLCTGMQSSTLAGLLASQFLGSSQ-AVPAACSVVVMAIMGLC  402

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  403   LASFWGNG  410



>ref|XP_008355641.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Malus domestica]
Length=429

 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 192/309 (62%), Gaps = 10/309 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + I AL  P +FTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  111   SAMLPFVVAATAIAALAQPSTFTWVSKDLYAPALGGIMLSIGIKLSIDDFALAFKRPLPL  170

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KPLLG L       A G+P    AG +LT+CV GAQLS+YA+FL+   +A
Sbjct  171   SVGFIAQYVLKPLLGVLIAN----AXGVPRMFYAGFVLTACVXGAQLSSYASFLSKGDVA  226

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T  + + TP L+ LLIG  +PVD + M  +I+Q+V+VPV  GL+LN +  
Sbjct  227   -LSILLTSTTTIASVIATPLLTGLLIGSVVPVDAVAMSKSILQVVLVPVTIGLVLNTYAK  285

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N +RP +P +++  TSLC+G+PLAIN   ++S  G  ++  VIAFH  AF  GY ++
Sbjct  286   PVVNFLRPVMPVVAMICTSLCIGSPLAINRSQILSVEGFRLIFPVIAFHAVAFTLGYWVS  345

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
              +   R   +V    RTLS  TGMQSS LA  LA++F       VPPA SVV M++MG  
Sbjct  346   KSPGLRQEEEVS---RTLSLCTGMQSSTLAGLLASQFLGSSQ-AVPPACSVVAMAIMGLF  401

Query  186   LVMFWNKNK  160
             L  FW    
Sbjct  402   LASFWGTGS  410



>ref|XP_008358448.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Malus domestica]
Length=430

 Score =   210 bits (534),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 138/309 (45%), Positives = 193/309 (62%), Gaps = 10/309 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + I AL  P +FTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  112   SAMLPFVVAATAIAALAQPSTFTWVSKDLYAPALGGIMLSIGIKLSIDDFALAFKRPLPL  171

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KP+LG L       AFG+P    AG +LT+CV+GAQLS+YA+FL+   +A
Sbjct  172   SVGFIAQYVLKPVLGVLIAN----AFGVPRMFYAGFVLTACVAGAQLSSYASFLSKGDVA  227

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T  + +VTP L+ LLIG  +PVD + M  +I+Q+V+ PV  GL+LN +  
Sbjct  228   -LSILLTSTTTIASVIVTPLLTGLLIGSVVPVDAVAMSKSILQVVLFPVTIGLVLNTYAK  286

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N +RP +P +++  TSLC+G+PLAIN   ++S  G  ++  VIAFH  AF  GY ++
Sbjct  287   PVVNFLRPVMPVVAMICTSLCIGSPLAINRSQILSVEGFRLIFPVIAFHAVAFTLGYWVS  346

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RTLS  TGMQSS LA  LA++F       VPPA SVV M+++G  
Sbjct  347   KTPGLRQEEEVS---RTLSLCTGMQSSTLAGLLASQFLGSSQ-AVPPACSVVAMAIVGLF  402

Query  186   LVMFWNKNK  160
             L  FW    
Sbjct  403   LASFWGTGS  411



>ref|XP_008365930.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Malus domestica]
Length=430

 Score =   209 bits (533),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 138/309 (45%), Positives = 193/309 (62%), Gaps = 10/309 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + I AL  P +FTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  112   SAMLPFVVAATAIAALAQPSTFTWVSKDLYAPALGGIMLSIGIKLSIDDFALAFKRPLPL  171

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KP+LG L       AFG+P    AG +LT+CV+GAQLS+YA+FL+   +A
Sbjct  172   SVGFIAQYVLKPVLGVLIAN----AFGVPRMFYAGFVLTACVAGAQLSSYASFLSKGDVA  227

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T  + +VTP L+ LLIG  +PVD + M  +I+Q+V+ PV  GL+LN +  
Sbjct  228   -LSILLTSTTTIASVIVTPLLTGLLIGSVVPVDAVAMSKSILQVVLFPVTIGLVLNTYAK  286

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N +RP +P +++  TSLC+G+PLAIN   ++S  G  ++  VIAFH  AF  GY ++
Sbjct  287   PVVNFLRPVMPVVAMICTSLCIGSPLAINRSQILSVEGFRLIFPVIAFHAVAFTLGYWVS  346

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RTLS  TGMQSS LA  LA++F       VPPA SVV M+++G  
Sbjct  347   KTPGLRQEEEVS---RTLSLCTGMQSSTLAGLLASQFLGSSQ-AVPPACSVVAMAIVGLF  402

Query  186   LVMFWNKNK  160
             L  FW    
Sbjct  403   LASFWGTGS  411



>gb|ABS78850.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78851.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78857.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78861.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
Length=153

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LP+DVIGMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V  T+ 
Sbjct  2    LSLLLIGKKLPIDVIGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDTAC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G ++L L+I FHL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGATILFLIITFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>gb|ABS78812.1| At4g12030-like protein [Arabidopsis halleri subsp. halleri]
 gb|ABS78852.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78854.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78859.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78862.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
Length=153

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LP+DVIGMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V  T+ 
Sbjct  2    LSLLLIGKKLPIDVIGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDTAC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G ++L LVI FHL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGATILFLVITFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>ref|XP_009102742.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Brassica rapa]
Length=440

 Score =   209 bits (533),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 135/304 (44%), Positives = 193/304 (63%), Gaps = 10/304 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL YP +FTW +   YAPALG +M ++G+  S +DF  AF RP  +
Sbjct  97    SALLPFVVALTALAALSYPSTFTWVSKELYAPALGGIMLSIGIQLSVQDFALAFKRPVPL  156

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KPLLG L        FG+PT+  AG +LT CV+GAQLS+YA+ L+   +A
Sbjct  157   SVGFVAQYVLKPLLGVLVAN----TFGMPTTFYAGFVLTCCVAGAQLSSYASSLSKADVA  212

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI++TS +T  + L TP LS LLIG  +PVD + M  +I+Q+V+VPV  GL+LN +  
Sbjct  213   -MSILLTSSTTIASVLFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPVTLGLVLNTYAK  271

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   +RP +P +++  TSLC+G+PL+IN   ++S  GL ++L VI FH  AF+ GY  +
Sbjct  272   PVVTLLRPVMPFVAMVCTSLCIGSPLSINRSQILSAEGLRLILPVITFHAVAFVVGYWFS  331

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RT+S  TGMQSS LA  LA++F       VP A SVV+M++MG  
Sbjct  332   KIPGLRQEEEVS---RTISLCTGMQSSTLAGLLASQFLGSSQ-AVPAACSVVVMAIMGLC  387

Query  186   LVMF  175
             L  F
Sbjct  388   LASF  391



>ref|XP_008777510.1| PREDICTED: LOW QUALITY PROTEIN: probable sodium/metabolite cotransporter 
BASS3, chloroplastic [Phoenix dactylifera]
Length=412

 Score =   208 bits (530),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 139/311 (45%), Positives = 198/311 (64%), Gaps = 14/311 (5%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +F+W +  YYAP+LG +M ++G+  S  DF  AF RP  +
Sbjct  100   SAMLPFVVAATAVAALANPSTFSWVSKEYYAPSLGGIMLSIGIRLSFDDFALAFRRPLPL  159

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               GYI Q+V+KPLLG L   +    F +P+   AG +LTSCV+GAQLS+YA+FL+   +A
Sbjct  160   SVGYIAQYVLKPLLGLLIARL----FRMPSMFFAGFLLTSCVAGAQLSSYASFLSKGDVA  215

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T ++ LVTP L+ LLIG  +PVD + M  +I+Q+V++PVA GL LN +  
Sbjct  216   -LSILLTSSTTISSVLVTPLLTGLLIGSVVPVDGVAMSKSILQVVLLPVALGLFLNTYAK  274

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N ++P +P +++  TSLC+G+PLAIN   ++S  GL +L  ++ FHL AFI GY   
Sbjct  275   AVVNVVQPIMPFVAMICTSLCIGSPLAINQNQILSSGGLLLLFPILTFHLVAFILGYW--  332

Query  363   GAAFRDAP---DVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMG  193
                F   P     +P+ RT+S  TGMQSS LA  LA +F       VP A+SVV+M++MG
Sbjct  333   ---FPKLPLLRQEEPVCRTISLCTGMQSSTLAGLLATQFLGSSQA-VPAALSVVVMAIMG  388

Query  192   FSLVMFWNKNK  160
               L  FW    
Sbjct  389   LCLASFWGNGS  399



>gb|EEE56984.1| hypothetical protein OsJ_06717 [Oryza sativa Japonica Group]
Length=372

 Score =   207 bits (526),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/282 (46%), Positives = 183/282 (65%), Gaps = 8/282 (3%)
 Frame = -1

Query  1008  TSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAA  829
             +  YYAPALG +M ++G+  S  DF  AF RP  +  GY+ Q++VKPL+G L       A
Sbjct  79    SKEYYAPALGGIMLSIGIKLSIDDFALAFKRPVPLTIGYMAQYIVKPLMGVLIAR----A  134

Query  828   FGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLL  649
             FG+P++  AG +LT CVSGAQLS+YA+FL+   +A LSI++TS ST ++ +VTP L+ LL
Sbjct  135   FGMPSAFFAGFVLTCCVSGAQLSSYASFLSKGDVA-LSILLTSCSTISSVVVTPVLTGLL  193

Query  648   IGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAP  469
             IG  +PVD I M  +I+Q+V+VPV  GLLLN +   V N I+P +P +++  TSLC+G+P
Sbjct  194   IGSVVPVDGIAMAKSILQVVLVPVTLGLLLNTYAKAVVNVIQPVMPFVAMLCTSLCIGSP  253

Query  468   LAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQS  289
             LAIN   ++S  G  +LL ++ FH++AFI GY ++        +  P+ RT+S  TGMQS
Sbjct  254   LAINRSKILSSEGFLLLLPIVTFHIAAFIVGYWISKLPMLRQEE--PVCRTISVCTGMQS  311

Query  288   SLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
             S LA  LA +F       VP A SVVIM++ G +L  +W   
Sbjct  312   STLAGLLATQFLGSSQ-AVPAACSVVIMAIFGLTLASYWGNG  352



>ref|XP_004952506.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic-like 
[Setaria italica]
Length=420

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 136/311 (44%), Positives = 198/311 (64%), Gaps = 8/311 (3%)
 Frame = -1

Query  1092  RGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRP  913
             +  +A+LP VV  + + AL  P +F+W +  YYAPALG +M ++G+  S  DF  AF RP
Sbjct  99    KALSALLPLVVAATAVAALGNPATFSWVSKDYYAPALGGIMLSIGIKLSIDDFALAFKRP  158

Query  912   GAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDP  733
               +  GY  Q+V+KPLLG +       AF +P++  AG +LT CVSGAQLS+YA+FL+  
Sbjct  159   VPLSIGYAAQYVLKPLLGVMIAK----AFRMPSAFFAGFVLTCCVSGAQLSSYASFLSKG  214

Query  732   PMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNR  553
              +A LSI++TS ST ++ +VTP L+ LLIG  +PVD I M  +I+Q+V+VPV  GL LN 
Sbjct  215   DVA-LSILLTSCSTISSVVVTPVLTGLLIGSVVPVDGIAMAKSILQVVLVPVTVGLFLNT  273

Query  552   FFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGY  373
             +   V N I+P +P +++  TSLC+G+PLAIN   ++S  G  +LL ++AFH+ +F++GY
Sbjct  274   YAKGVVNVIQPVMPFVAMVCTSLCIGSPLAINRSKILSQEGFFLLLPIVAFHIVSFVAGY  333

Query  372   TLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMG  193
              +  +        +P+ RT+S  TGMQSS LA  LA +F       VP A SVVIM++ G
Sbjct  334   WI--SKLPQWRQEEPVCRTISVCTGMQSSTLAGLLATQFLGTSQ-AVPAACSVVIMAIFG  390

Query  192   FSLVMFWNKNK  160
              +L  +W    
Sbjct  391   LTLGSYWGSGS  401



>ref|XP_002527259.1| sodium-bile acid cotransporter, putative [Ricinus communis]
 gb|EEF35103.1| sodium-bile acid cotransporter, putative [Ricinus communis]
Length=356

 Score =   206 bits (524),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 142/333 (43%), Positives = 203/333 (61%), Gaps = 9/333 (3%)
 Frame = -1

Query  1161  LSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPAL  982
             ++N  AE + I K K  +  +  +  +A+LP VV  + + AL  P +FTW +   YAPAL
Sbjct  13    INNSNAEVAAITKTKTKTSDSS-QLLSAMLPFVVAITAVAALAQPSTFTWVSKDMYAPAL  71

Query  981   GFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAA  802
             G +M ++G+  S  DF  A  RP  +  GY+ Q+V+KP+LG L       A GL     A
Sbjct  72    GGIMLSIGIKLSIADFALALKRPIPLSVGYLAQYVMKPVLGVLLAK----ACGLSEMFYA  127

Query  801   GIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDV  622
             G +LTSCV+GAQLS+YA+FL+   +A +SI++TS +T T+ LVTP L+ LLIG  +PVD 
Sbjct  128   GFVLTSCVAGAQLSSYASFLSKGDVA-MSILLTSTTTITSVLVTPLLTGLLIGSVVPVDA  186

Query  621   IGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvv  442
             I M  +I+Q+V+ PV  GL+LN +   V N I+P +P +++  TS+C+G+PLAIN   ++
Sbjct  187   IAMSKSILQVVLAPVTLGLMLNTYAKPVVNIIQPLMPFVAMICTSICIGSPLAINRSQIL  246

Query  441   spsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALAN  262
             S  G  ++  V+AFH  AF  GY ++   F    +   + RT+S  TGMQSS LA  LA 
Sbjct  247   SAQGFRLVFPVLAFHTVAFTLGYWISRIPFLRLDE--EVSRTISLCTGMQSSTLAGLLAT  304

Query  261   KFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
             +F       VPPA SVV M++MG SL  FW   
Sbjct  305   QFLGTT-QAVPPACSVVAMAIMGLSLASFWGNG  336



>gb|KDO58570.1| hypothetical protein CISIN_1g037575mg [Citrus sinensis]
Length=406

 Score =   207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 137/321 (43%), Positives = 201/321 (63%), Gaps = 14/321 (4%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +FTW +   YAPALG +M ++G+  S +DF  AF RP  +
Sbjct  88    SAMLPFVVALTAVAALAQPSTFTWVSKELYAPALGGIMLSIGIRLSIEDFALAFKRPLPL  147

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+++KP+LG L       AFG+P    AG +LT+CVSGAQLS+YA+FL+   +A
Sbjct  148   SVGFVAQYIIKPILGVLIAK----AFGIPQIFYAGFVLTACVSGAQLSSYASFLSKGDVA  203

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI+++S +T  + L+TP L+ LLIG  +PVD + M  +I+Q+V+VPVA GL LN +  
Sbjct  204   -VSILLSSSTTIASVLITPLLTGLLIGSVIPVDAVAMSKSILQVVLVPVALGLGLNTYAK  262

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V + +RP +P +++  TSLC+G+PLAIN   ++S  GL ++L V+ FH  AF  GY ++
Sbjct  263   PVVSFLRPVMPFVAMICTSLCIGSPLAINRSQILSIEGLQLVLPVLTFHAVAFAVGYWVS  322

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                ++R   +V    RT+S  TGMQSS LA  LA +F       VPPA SV+ M++MG  
Sbjct  323   KIPSWRQGEEVS---RTISLCTGMQSSTLAGLLATQFLGSSQ-AVPPACSVIAMAIMGLC  378

Query  186   LVMFWNKNKS----TNV*QLH  136
             L  FW         TN+   H
Sbjct  379   LASFWGSGSRIRDLTNILNWH  399



>ref|XP_006492227.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic-like 
[Citrus sinensis]
Length=408

 Score =   207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 137/321 (43%), Positives = 201/321 (63%), Gaps = 14/321 (4%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +FTW +   YAPALG +M ++G+  S +DF  AF RP  +
Sbjct  90    SAMLPFVVALTAVAALAQPSTFTWVSKELYAPALGGIMLSIGIRLSIEDFALAFKRPLPL  149

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+++KP+LG L       AFG+P    AG +LT+CVSGAQLS+YA+FL+   +A
Sbjct  150   SVGFVAQYIIKPILGVLIAK----AFGIPQIFYAGFVLTACVSGAQLSSYASFLSKGDVA  205

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI+++S +T  + L+TP L+ LLIG  +PVD + M  +I+Q+V+VPVA GL LN +  
Sbjct  206   -VSILLSSSTTIASVLITPLLTGLLIGSVIPVDAVAMSKSILQVVLVPVALGLGLNTYAK  264

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V + +RP +P +++  TSLC+G+PLAIN   ++S  GL ++L V+ FH  AF  GY ++
Sbjct  265   PVVSFLRPVMPFVAMICTSLCIGSPLAINRSQILSIEGLQLVLPVLTFHAVAFAVGYWVS  324

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                ++R   +V    RT+S  TGMQSS LA  LA +F       VPPA SV+ M++MG  
Sbjct  325   KIPSWRQGEEVS---RTISLCTGMQSSTLAGLLATQFLGSSQ-AVPPACSVIAMAIMGLC  380

Query  186   LVMFWNKNKS----TNV*QLH  136
             L  FW         TN+   H
Sbjct  381   LASFWGSGSRIRDLTNILNWH  401



>ref|XP_006447990.1| hypothetical protein CICLE_v10015435mg [Citrus clementina]
 gb|ESR61230.1| hypothetical protein CICLE_v10015435mg [Citrus clementina]
Length=408

 Score =   207 bits (527),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 137/321 (43%), Positives = 201/321 (63%), Gaps = 14/321 (4%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +FTW +   YAPALG +M ++G+  S +DF  AF RP  +
Sbjct  90    SAMLPFVVALTAVAALAQPSTFTWVSKELYAPALGGIMLSIGIRLSIEDFALAFKRPLPL  149

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+++KP+LG L       AFG+P    AG +LT+CVSGAQLS+YA+FL+   +A
Sbjct  150   SVGFVTQYIIKPILGVLIAK----AFGIPQIFYAGFVLTACVSGAQLSSYASFLSKGDVA  205

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI+++S +T  + L+TP L+ LLIG  +PVD + M  +I+Q+V+VPVA GL LN +  
Sbjct  206   -VSILLSSSTTIASVLITPLLTGLLIGSVIPVDAVAMSKSILQVVLVPVALGLGLNTYAK  264

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V + +RP +P +++  TSLC+G+PLAIN   ++S  GL ++L V+ FH  AF  GY ++
Sbjct  265   PVVSFLRPVMPFVAMICTSLCIGSPLAINRSQILSIEGLQLVLPVLTFHAVAFAVGYWVS  324

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                ++R   +V    RT+S  TGMQSS LA  LA +F       VPPA SV+ M++MG  
Sbjct  325   KIPSWRQGEEVS---RTISLCTGMQSSTLAGLLATQFLGSSQ-AVPPACSVIAMAIMGLC  380

Query  186   LVMFWNKNKS----TNV*QLH  136
             L  FW         TN+   H
Sbjct  381   LASFWGSGSRIQDLTNILNWH  401



>gb|ABS78855.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
Length=153

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDVIGMIS+I+Q+VV P+AAGLLLNR FP++ NAI+ FLP L+V  T+ 
Sbjct  2    LSLLLIGKKLPVDVIGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKSFLPALTVIDTAC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G ++L LVI FHL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGATILFLVITFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>ref|XP_004492253.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic-like 
[Cicer arietinum]
Length=410

 Score =   207 bits (526),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 135/310 (44%), Positives = 194/310 (63%), Gaps = 14/310 (5%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +FTW +   YAPALG +M ++G+  S  DF  A  RP  +
Sbjct  92    SALLPFVVAATAVAALSQPSTFTWVSKDLYAPALGGIMLSIGIRLSIDDFALAIKRPLPL  151

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KP+LG L       AFGLP    AG +LT+CVSGAQLS+YA+F++   +A
Sbjct  152   SIGFIAQYVLKPVLGILIAK----AFGLPRMFYAGFVLTACVSGAQLSSYASFISKGDVA  207

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              L I++T+ +T  + +VTP L+ LLIG  +PVD + M  +I+Q+V+VPV  GLLLN +  
Sbjct  208   -LCILLTTYTTIASVIVTPLLTGLLIGSVVPVDAVAMSKSILQVVLVPVTLGLLLNTYAK  266

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V + I+P +P +++  TSLC+G+PLAIN   ++S  GL ++  ++ FH +AF  GY   
Sbjct  267   PVVSIIQPVMPFVAMICTSLCIGSPLAINRNQILSGEGLRLVAPILMFHAAAFTLGYW--  324

Query  363   GAAFRDAPDVKP---LQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMG  193
                F + P ++    + RT+S  TGMQSS LA  LA +F       VPPA SVV M++MG
Sbjct  325   ---FSNLPSLRQEEHVSRTISLCTGMQSSTLAGLLATQFLGTS-QAVPPACSVVAMAIMG  380

Query  192   FSLVMFWNKN  163
               L  FW K 
Sbjct  381   LCLASFWGKG  390



>gb|ABS78828.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78856.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78858.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
Length=153

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDVIGMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     
Sbjct  2    LSLLLIGKKLPVDVIGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G ++L +VI FHL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGATILFIVITFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>gb|ABS78824.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
Length=153

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDVIGMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     
Sbjct  2    LSLLLIGKKLPVDVIGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G ++L +VIAFHL AF++GY   G  F   PDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGATILFIVIAFHLLAFVAGYFFTGFFFSKVPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>gb|ABS78847.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
Length=153

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDVIGMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     
Sbjct  2    LSLLLIGKKLPVDVIGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G ++L +V+ FHL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGATILFIVVTFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>ref|XP_009780999.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Nicotiana sylvestris]
Length=421

 Score =   206 bits (524),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 189/306 (62%), Gaps = 10/306 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +FTW +   YAPALG +M ++G+  S  DF  A  RP  +
Sbjct  101   SALLPFVVALTAVAALSQPSTFTWVSKEMYAPALGGIMLSIGIRLSIDDFALAIKRPLPL  160

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KP LG L       AFG+P +  AG +L SCV+GAQLS+YA+FL+   +A
Sbjct  161   SVGFIAQYVLKPALGILVAQ----AFGMPQAFYAGFVLMSCVAGAQLSSYASFLSKSDVA  216

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
               SI++TS ST  + LVTP L+ LLIG  +PVD + M  +I+Q+V++PV  GL LN +  
Sbjct  217   -FSILLTSSSTIASVLVTPLLTGLLIGSVVPVDAVAMSKSILQVVLLPVTLGLALNTYAK  275

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V + I+P +P +++  TSLC+G+PLAIN   ++S  G  ++  V+ FH  AF  GY L+
Sbjct  276   PVVSVIQPVMPFVAMICTSLCIGSPLAINRAQILSAEGARLIGPVLTFHAVAFAVGYWLS  335

Query  363   GAA-FRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                 FR   +V    RT+S  TGMQSS LA  LA +F       VPPA SVV M++MG  
Sbjct  336   KLPFFRFEEEVC---RTISVCTGMQSSTLAGLLATQFLGST-QAVPPACSVVAMAIMGLC  391

Query  186   LVMFWN  169
             L  FW 
Sbjct  392   LASFWG  397



>ref|XP_010036742.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
isoform X1 [Eucalyptus grandis]
Length=435

 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 143/333 (43%), Positives = 203/333 (61%), Gaps = 16/333 (5%)
 Frame = -1

Query  1164  SLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPA  985
             S  N     SE+ +   +  L      +A+LP VV  + I AL  P +FTW +   YAPA
Sbjct  94    SFGNKQHVISEVDRTDSSQVL------SAMLPFVVAATAIAALAQPATFTWVSRELYAPA  147

Query  984   LGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLA  805
             LG +M ++G+  S  DF  AF RP  +  G+I Q+V+KP+LG L       AFG+     
Sbjct  148   LGGIMLSIGIRLSIDDFALAFKRPLPLSIGFIAQYVLKPVLGVLVAQ----AFGISHMFY  203

Query  804   AGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVD  625
             AG +LT+CV+GAQLS+YA+FL+   +A LSI++TS +T  + LVTP L+ LLIG  +PVD
Sbjct  204   AGFVLTACVAGAQLSSYASFLSKGDVA-LSILLTSCTTIASVLVTPILTGLLIGSVVPVD  262

Query  624   VIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsv  445
              + M  +I+Q+V+VP+  GLLLN +   V + ++P +P +++  TSLC+G+PLAIN   +
Sbjct  263   AVAMSKSILQVVLVPITFGLLLNTYAKPVVSILQPVMPLVAMVCTSLCIGSPLAINQSQI  322

Query  444   vspsglsvlllVIAFHLSAFISGYTLAGA-AFRDAPDVKPLQRTLSYETGMQSSLLALAL  268
             +S  GL ++L V+ FH  AF  GY ++   A R   +V    RT+S  TGMQSS LA  L
Sbjct  323   LSREGLRLVLPVLTFHAVAFTLGYWISKLPALRQEEEVG---RTISLCTGMQSSTLAGLL  379

Query  267   ANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWN  169
             A++F       VPPA SVV M++MG  L  FW 
Sbjct  380   ASQFLGSSQ-AVPPACSVVAMAIMGLCLASFWG  411



>gb|ABS78844.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
Length=153

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            +SLLLIGK+LPVDVIGMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     
Sbjct  2    ISLLLIGKKLPVDVIGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G+++L LVI FHL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGVTILFLVITFHLFAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>ref|XP_003574971.2| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Brachypodium distachyon]
Length=463

 Score =   207 bits (526),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 143/334 (43%), Positives = 211/334 (63%), Gaps = 11/334 (3%)
 Frame = -1

Query  1161  LSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPAL  982
             L ++ AE+ +     E++  T  +  +A+LP VV+ + + AL  P +F+W +   YAPAL
Sbjct  120   LLSFRAETDDSQSAAEDAGDTS-QAVSALLPLVVVATAVAALGNPATFSWVSKELYAPAL  178

Query  981   GFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAA  802
             G +M ++G+  S  DF  AF RP  +  GY  Q+++KPLLG L       AF +P++  A
Sbjct  179   GGIMLSIGIKLSFDDFALAFKRPVPLSIGYAAQYMLKPLLGVLIAR----AFRMPSAFFA  234

Query  801   GIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDV  622
             G MLT CVSGAQLS+YA+FL    +A LSI++T+ ST ++ +VTP L+ LLIG  +PVD 
Sbjct  235   GFMLTCCVSGAQLSSYASFLGKGDVA-LSILLTTYSTISSVIVTPILTGLLIGSVVPVDG  293

Query  621   IGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvv  442
             I M  +I+Q+V+VPV  GLLLN +   V N I+P +P +++  TSLC+G+PLAIN   ++
Sbjct  294   IAMAKSILQVVLVPVTLGLLLNTYAKPVVNVIQPVMPFVAMVCTSLCIGSPLAINRSMLL  353

Query  441   spsglsvlllVIAFHLSAFISGYTLAG-AAFRDAPDVKPLQRTLSYETGMQSSLLALALA  265
             SP G  +LL ++ FH++AF+ GY ++    FR     +P+ RT+S  TGMQSS LA  LA
Sbjct  354   SPQGFMLLLPIVIFHIAAFVVGYWVSKLPQFRQE---EPVCRTISVCTGMQSSTLAGLLA  410

Query  264   NKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
              +F       VP A SVV+M++ G +L  +W   
Sbjct  411   TQFLGIS-QAVPAACSVVVMAIFGLTLASYWGTG  443



>gb|ABS78827.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78830.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78832.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78833.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78835.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78837.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78839.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
Length=153

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDVIGMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     
Sbjct  2    LSLLLIGKKLPVDVIGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G ++L +VI FHL AF++GY   G  F   PDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGATILFIVITFHLLAFVAGYFFTGFFFSKVPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>ref|XP_009393764.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=419

 Score =   205 bits (522),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 140/312 (45%), Positives = 195/312 (63%), Gaps = 10/312 (3%)
 Frame = -1

Query  1092  RGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRP  913
             +G + +LP VV  + + AL  P +F+W +  YYAPALG +M ++G+  S  DF  AF RP
Sbjct  108   QGLSLLLPFVVAATAVAALANPATFSWVSKEYYAPALGGIMLSIGIRLSIDDFALAFKRP  167

Query  912   GAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDP  733
               +  GYI Q+V+KP+LG L   I    F  P+   AG +LT CV+GAQLS+YA+FL+  
Sbjct  168   LPLSVGYIAQYVLKPVLGLLIAKI----FRAPSMFYAGFILTCCVAGAQLSSYASFLSKG  223

Query  732   PMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNR  553
              +A LSI++TS +T ++ L+TP L+ LLIG  +PVD + M  +I+Q+V+VPVA GL+LN 
Sbjct  224   DVA-LSILLTSSTTISSVLMTPLLTGLLIGSVVPVDGVAMSKSILQVVLVPVALGLVLNT  282

Query  552   FFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGY  373
             +   V N I+P +P  ++  TSLC+G+PLAIN   ++S  GL +L  ++ FHL AF+ GY
Sbjct  283   YAKAVVNFIQPIMPFFAMVCTSLCIGSPLAINRNQILSSHGLMLLFPILTFHLVAFVLGY  342

Query  372   TLAG-AAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLM  196
               A    FR    V    RT+S  TGMQSS LA  LA +F       VP A SVV+M++M
Sbjct  343   WFAKFPFFRQEESVC---RTISLCTGMQSSTLAGLLATQFLGSTHA-VPAACSVVLMAIM  398

Query  195   GFSLVMFWNKNK  160
             G  L  FW    
Sbjct  399   GLCLASFWGNGS  410



>gb|ABS78825.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78826.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78829.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78834.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78836.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78840.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
 gb|ABS78853.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78860.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78863.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
Length=153

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDV GMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     
Sbjct  2    LSLLLIGKKLPVDVFGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G+++L LVI FHL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGVTILFLVITFHLFAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>gb|ABS78845.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78848.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78849.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
Length=153

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDV GMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     
Sbjct  2    LSLLLIGKKLPVDVFGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G+++L LVI FHL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGVTILFLVITFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>gb|ABS78814.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78815.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78816.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78817.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78818.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78819.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78820.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78821.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78822.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78823.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
 gb|ABS78846.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
Length=153

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDV GMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     
Sbjct  2    LSLLLIGKKLPVDVFGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G ++L LVI FHL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGATILFLVITFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>gb|ABS78843.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
Length=153

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDVIGMIS+I+Q+VV P+AAGLLLNR FP++  AI+PFLP L+V     
Sbjct  2    LSLLLIGKKLPVDVIGMISSILQVVVTPIAAGLLLNRLFPRLSTAIKPFLPALTVIDMGC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G ++L +VI FHL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGATILFIVITFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>gb|ABS78838.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
Length=153

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDV GMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     
Sbjct  2    LSLLLIGKKLPVDVFGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP GL++L LVI FHL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGLTILFLVITFHLFAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>gb|KCW48379.1| hypothetical protein EUGRSUZ_K02087 [Eucalyptus grandis]
Length=481

 Score =   206 bits (524),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 143/333 (43%), Positives = 203/333 (61%), Gaps = 16/333 (5%)
 Frame = -1

Query  1164  SLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPA  985
             S  N     SE+ +   +  L      +A+LP VV  + I AL  P +FTW +   YAPA
Sbjct  140   SFGNKQHVISEVDRTDSSQVL------SAMLPFVVAATAIAALAQPATFTWVSRELYAPA  193

Query  984   LGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLA  805
             LG +M ++G+  S  DF  AF RP  +  G+I Q+V+KP+LG L       AFG+     
Sbjct  194   LGGIMLSIGIRLSIDDFALAFKRPLPLSIGFIAQYVLKPVLGVLVAQ----AFGISHMFY  249

Query  804   AGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVD  625
             AG +LT+CV+GAQLS+YA+FL+   +A LSI++TS +T  + LVTP L+ LLIG  +PVD
Sbjct  250   AGFVLTACVAGAQLSSYASFLSKGDVA-LSILLTSCTTIASVLVTPILTGLLIGSVVPVD  308

Query  624   VIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsv  445
              + M  +I+Q+V+VP+  GLLLN +   V + ++P +P +++  TSLC+G+PLAIN   +
Sbjct  309   AVAMSKSILQVVLVPITFGLLLNTYAKPVVSILQPVMPLVAMVCTSLCIGSPLAINQSQI  368

Query  444   vspsglsvlllVIAFHLSAFISGYTLAGA-AFRDAPDVKPLQRTLSYETGMQSSLLALAL  268
             +S  GL ++L V+ FH  AF  GY ++   A R   +V    RT+S  TGMQSS LA  L
Sbjct  369   LSREGLRLVLPVLTFHAVAFTLGYWISKLPALRQEEEVG---RTISLCTGMQSSTLAGLL  425

Query  267   ANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWN  169
             A++F       VPPA SVV M++MG  L  FW 
Sbjct  426   ASQFLGSSQ-AVPPACSVVAMAIMGLCLASFWG  457



>ref|XP_009589251.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=425

 Score =   204 bits (520),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 138/334 (41%), Positives = 197/334 (59%), Gaps = 10/334 (3%)
 Frame = -1

Query  1164  SLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPA  985
             SL ++ A     +   E +  +  +  +A+LP VV  + + AL  P +FTW +   YAPA
Sbjct  80    SLLSFGANPRSFYVEDEKADYS--QALSALLPFVVALTAVAALSQPSTFTWVSKELYAPA  137

Query  984   LGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLA  805
             LG +M ++G+  S  DF  A  RP  +  G+I Q+V+KP LG     I   AFG+P +  
Sbjct  138   LGGIMLSIGIRLSIDDFALAIKRPLPLSVGFIAQYVLKPALG----IIVAQAFGMPQTFY  193

Query  804   AGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVD  625
             AG +L SCV+GAQLS+YA+FL+   +A  SI++TS ST  + LVTP L+ LLIG  +PVD
Sbjct  194   AGFVLMSCVAGAQLSSYASFLSKSDVA-FSILLTSSSTIASVLVTPLLTGLLIGSVVPVD  252

Query  624   VIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsv  445
              I M  +I+Q+V++PV  GL LN +   V + I+P +P +++  TSLC+G+PLAIN   +
Sbjct  253   AIAMSKSILQVVLLPVTLGLALNTYAKPVVSVIQPVMPFVAMICTSLCIGSPLAINRAQI  312

Query  444   vspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALA  265
             +S  G  ++  V+ FH  AF  GY  +   F    +   + RT+S  TGMQSS LA  LA
Sbjct  313   LSAEGARLIGPVLTFHAVAFAVGYWFSKLPFFRFEE--KVCRTISLCTGMQSSTLAGLLA  370

Query  264   NKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
              +F       VPPA SVV M++MG  L  FW   
Sbjct  371   TQFLGST-QAVPPACSVVAMAIMGLCLASFWGSG  403



>ref|XP_002320573.1| hypothetical protein POPTR_0014s17610g [Populus trichocarpa]
 gb|EEE98888.1| hypothetical protein POPTR_0014s17610g [Populus trichocarpa]
Length=417

 Score =   204 bits (518),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 189/308 (61%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + I AL  P +FTW +   YAPALG +M ++G+  S  DF  A  RP  +
Sbjct  99    SAMLPFVVAATAIAALAQPATFTWVSKELYAPALGGIMLSIGIKLSIHDFAPAIKRPLPL  158

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KP LG L       AFG+     AG +LTSCV+GAQLS+YA+FL+   +A
Sbjct  159   SVGFIAQYVLKPGLGVLIAK----AFGMSQMFFAGFVLTSCVAGAQLSSYASFLSKGDVA  214

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T  + L TP L+ LLIG  +PVD I M  +I+Q+V++PVA GL+LN +  
Sbjct  215   -LSILLTSSTTIASVLFTPLLTGLLIGSVVPVDAIAMSKSILQVVLIPVALGLVLNTYAK  273

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
             +V N + P +P +++  TSLC+G+PLAIN   ++S  GL ++  V+ FH  AF  GY ++
Sbjct  274   EVVNLLNPVMPFVAMVCTSLCIGSPLAINRSQILSKEGLWLIFPVLTFHAVAFTLGYWVS  333

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                A R   +     RT+S  TGMQSS LA  LA  F       VPPA SVV M++MG  
Sbjct  334   KIPALRQEEEA---SRTISLCTGMQSSTLAGLLATHFLGSTQ-AVPPACSVVAMAIMGLC  389

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  390   LASFWGNG  397



>gb|ABS78842.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
Length=153

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDV GMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V     
Sbjct  2    LSLLLIGKKLPVDVFGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMGC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G+++L LVI FHL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGVTILFLVITFHLFAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPP IS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPVISTVV  153



>ref|XP_003532243.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic-like 
[Glycine max]
Length=417

 Score =   203 bits (517),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 134/310 (43%), Positives = 191/310 (62%), Gaps = 14/310 (5%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +FTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  99    SALLPVVVAATAVAALAKPSTFTWVSKELYAPALGGIMLSIGIRLSVDDFALAFKRPLPL  158

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G I Q+V+KP+LG L       AFGL     AG +LT+CVSGAQLS+YA FL+   +A
Sbjct  159   TIGLIAQYVLKPVLGILVAK----AFGLSRMFYAGFVLTACVSGAQLSSYANFLSKGDVA  214

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              L I++TS +T  + +VTP L+ LLIG  +PVD + M  +I+Q+V+VPV  GLLLN +  
Sbjct  215   -LGILLTSYTTIASVIVTPLLTGLLIGSVVPVDAVAMSKSILQVVLVPVTLGLLLNTYAK  273

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V + ++P +P +++  TSLC+G+PLA+N   +++  GL ++  V+ FH+ AF  GY   
Sbjct  274   SVVSVLQPVMPFVAMICTSLCIGSPLALNRSQILTGEGLRLVFPVLTFHVVAFTLGYW--  331

Query  363   GAAFRDAPDVK---PLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMG  193
                F   P ++    + RT+S  TGMQSS LA  LA +F  D    VPPA SV+ M++MG
Sbjct  332   ---FSKIPSLRQEEQVSRTISLCTGMQSSTLAGLLATQFL-DSSQAVPPACSVIAMAIMG  387

Query  192   FSLVMFWNKN  163
               L  FW   
Sbjct  388   LCLASFWGSG  397



>gb|EYU40662.1| hypothetical protein MIMGU_mgv1a006964mg [Erythranthe guttata]
Length=424

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 195/313 (62%), Gaps = 20/313 (6%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +FTW +  +YAPALG +M ++G+  S +DF  AF RP  +
Sbjct  106   SALLPFVVALTAVAALSKPSTFTWVSKDFYAPALGGIMLSIGIKLSIEDFALAFKRPWPL  165

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KP LG         AFG+     AG +LTSCV+GAQLS+YA+FL+   +A
Sbjct  166   SIGFIAQYVLKPALGVFVAR----AFGISPMFYAGFVLTSCVAGAQLSSYASFLSKGDVA  221

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS ST  + L+TP L+ LLIG  +PVD + M  +I+Q+V+ PV  GL+LN +  
Sbjct  222   -LSILLTSSSTIASVLITPLLTGLLIGSVVPVDAVAMSKSILQVVLAPVFLGLVLNSYAK  280

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V + ++P +P +++  TS+C+G+PLAIN   ++S  GL ++  V++FH  AF  GY ++
Sbjct  281   PVVSVLQPVMPFVAMVCTSMCIGSPLAINRSQILSAEGLRLVGPVLSFHAVAFTLGYWIS  340

Query  363   GAAFRDAPDVKPLQ------RTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMS  202
                      ++PL+      RT+S  TGMQSS LA  LA++F       VPPA SVV M+
Sbjct  341   --------KLQPLRLEEEVCRTISLCTGMQSSTLAGLLASQFLGSTQ-AVPPACSVVAMA  391

Query  201   LMGFSLVMFWNKN  163
             +MG  L  FW   
Sbjct  392   IMGLCLASFWGSG  404



>emb|CDX86726.1| BnaA09g21160D [Brassica napus]
Length=153

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = -1

Query  615  MISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsp  436
            M+S+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L++   + C+GAPLA+NI S++SP
Sbjct  1    MVSSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTLIDMACCLGAPLALNIDSILSP  60

Query  435  sglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKF  256
             G ++LLLVI FHL AF++GY L G  F  APDVK LQRTLSYETGMQSSLLALALA KF
Sbjct  61   FGATILLLVITFHLLAFVAGYFLTGLLFSKAPDVKALQRTLSYETGMQSSLLALALATKF  120

Query  255  FQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
            FQDPLVGVPPAIS V+MSLMG SLV  W   K 
Sbjct  121  FQDPLVGVPPAISTVVMSLMGVSLVTIWKNRKE  153



>ref|XP_002263684.2| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Vitis vinifera]
 emb|CBI35586.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   202 bits (513),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +FTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  92    SALLPFVVAATAVAALAQPSTFTWVSRELYAPALGGIMLSIGIRLSIDDFALAFQRPLPL  151

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+ +KP LG L       A G+     AG +LT+CV+GAQLS+YA+FL+   +A
Sbjct  152   SIGFMAQYALKPALGVLIAR----ALGMSQLFYAGFVLTACVAGAQLSSYASFLSKGDVA  207

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T  + LVTP L+ LLIG  +PVD + M  +I+Q+V+VPV  GL LN +  
Sbjct  208   -LSILLTSSTTIASVLVTPLLTGLLIGSVVPVDAVAMSKSILQVVLVPVTLGLALNTYAK  266

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N +RP +P +++  TSLC+G+PLAIN   ++S  GL ++  V+AFH  AF  GY ++
Sbjct  267   PVVNLLRPVMPLVAMVCTSLCIGSPLAINRSQILSAEGLRLVFPVLAFHTVAFTVGYWVS  326

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                 FR   +V    RT+S  TGMQSS LA  LA +F       VPPA SVV M++MG S
Sbjct  327   KIPIFRQEEEVC---RTISLCTGMQSSTLAGLLATQFLGGS-QAVPPACSVVAMAIMGLS  382

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  383   LASFWGNG  390



>gb|ABS78841.1| At4g12030-like protein [Arabidopsis lyrata subsp. petraea]
Length=153

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDV GMIS+I+Q+VV P+AAGLLLNR FP++  AI+PFLP L+V     
Sbjct  2    LSLLLIGKKLPVDVXGMISSILQVVVTPIAAGLLLNRLFPRLSXAIKPFLPALTVIDMGC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G ++L  VI FHL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGXTILFJVITFHLLAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>emb|CDX94482.1| BnaC09g23540D [Brassica napus]
Length=153

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = -1

Query  615  MISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsp  436
            M+S+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L++   + C+GAPLA+NI S++SP
Sbjct  1    MVSSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTLIDMACCIGAPLALNIDSILSP  60

Query  435  sglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKF  256
             G ++LLLVI FHL AF++GY L G  F  APDVK LQRTLSYETGMQSSLLALALA KF
Sbjct  61   FGATILLLVITFHLLAFVAGYFLTGLFFSKAPDVKALQRTLSYETGMQSSLLALALATKF  120

Query  255  FQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
            FQDPLVGVPPAIS V+MSLMG SLV  W   K 
Sbjct  121  FQDPLVGVPPAISTVVMSLMGVSLVTIWKNRKE  153



>ref|XP_007200437.1| hypothetical protein PRUPE_ppa008857mg [Prunus persica]
 gb|EMJ01636.1| hypothetical protein PRUPE_ppa008857mg [Prunus persica]
Length=317

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 128/291 (44%), Positives = 182/291 (63%), Gaps = 10/291 (3%)
 Frame = -1

Query  1029  PPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLF  850
             P +FTW +   YAPALG +M ++G+  S  DF  AF RP  +  G++ Q+++KP+LG L 
Sbjct  17    PSTFTWVSKDLYAPALGGIMLSIGIKLSIDDFALAFKRPLPLSIGFMAQYMLKPVLGVLI  76

Query  849   GTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVT  670
                   AFG+     AG +LT+CV+GAQLS+YA+FL+   +A LSI++TS +T  + +VT
Sbjct  77    AK----AFGVSRIFYAGFVLTTCVAGAQLSSYASFLSKGDVA-LSILLTSTTTIASVIVT  131

Query  669   PFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVT  490
             P LS LLIG  +PVD + M  +I+Q+V+VPV  GL+LN +   V N + P +P +++  T
Sbjct  132   PLLSGLLIGSVVPVDAVAMSKSILQVVLVPVTIGLVLNTYAKPVVNFLGPVMPVVAMICT  191

Query  489   SLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA-AFRDAPDVKPLQRTL  313
             SLC+G+PLAIN   ++S  G  ++  VIAFH  AF  GY ++   + R   +V    RTL
Sbjct  192   SLCIGSPLAINRSQILSAEGFRLIFPVIAFHAVAFTVGYWVSKIPSLRQEEEVS---RTL  248

Query  312   SYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNK  160
             S  TGMQSS LA  LA++F       VPPA SVV M+++G  L  FW    
Sbjct  249   SLCTGMQSSTLAGLLASQFLGSSQ-AVPPACSVVAMAIVGLFLASFWGTGS  298



>ref|XP_008235897.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Prunus mume]
Length=430

 Score =   202 bits (513),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 140/327 (43%), Positives = 200/327 (61%), Gaps = 10/327 (3%)
 Frame = -1

Query  1140  SSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAV  961
             S+EI K    S     +  +A+LP VV  + + AL  P +FTW +   YAPALG +M ++
Sbjct  93    SAEISKEGAQSSDDSSQLLSAMLPFVVAATAVAALAQPSTFTWVSKDLYAPALGGIMLSI  152

Query  960   GVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSC  781
             G+  S  DF  AF RP  +  G++ Q+++KP+LG L       AFG+     AG +LT+C
Sbjct  153   GIKLSIDDFALAFKRPLPLSIGFMAQYMLKPVLGVLIA----KAFGVSRIFYAGFVLTTC  208

Query  780   VSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNI  601
             V+GAQLS+YA+FL+   +A LSI++TS +T  + +VTP LS LLIG  +PVD + M  +I
Sbjct  209   VAGAQLSSYASFLSKGDVA-LSILLTSTTTIASVIVTPLLSGLLIGSVVPVDAVAMSKSI  267

Query  600   IQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsv  421
             +Q+V+VPV  GL+LN +   V N + P +P +++  TSLC+G+PLAIN   ++S  G  +
Sbjct  268   LQVVLVPVTIGLVLNTYAKPVVNFLGPVMPVVAMICTSLCIGSPLAINRSQILSAEGFRL  327

Query  420   lllVIAFHLSAFISGYTLAGA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDP  244
             +  VIAFH  AF  GY ++   + R   +V    RTLS  TGMQSS LA  LA++F    
Sbjct  328   IFPVIAFHAVAFTVGYWVSKIPSLRQEEEV---SRTLSLCTGMQSSTLAGLLASQFLGSS  384

Query  243   LVGVPPAISVVIMSLMGFSLVMFWNKN  163
                VPPA SVV M+++G  L  FW   
Sbjct  385   Q-AVPPACSVVAMAIVGLFLASFWGTG  410



>ref|XP_011089619.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Sesamum indicum]
Length=422

 Score =   201 bits (512),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 191/313 (61%), Gaps = 20/313 (6%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +FTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  104   SALLPFVVALTAVAALSKPSTFTWVSKELYAPALGGIMLSIGIKLSIDDFALAFKRPVPL  163

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KP LG         AFG+     AG +LTSCV+GAQLS+Y +FL+   +A
Sbjct  164   FIGFIAQYVLKPALGVFVAR----AFGISPMFYAGFVLTSCVAGAQLSSYGSFLSKGDVA  219

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS ST  + LVTP L+ LLIG  +PVD + M  +I+Q+V+ PV  GL+LN +  
Sbjct  220   -LSILLTSSSTIASVLVTPLLTGLLIGSVVPVDAVAMSKSILQVVLAPVTLGLVLNSYAK  278

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
                + ++P +P +++  TSLC+G+PLAIN   ++S  GL ++  V++FH  AF  GY ++
Sbjct  279   PFVSILQPVMPFVAMVCTSLCIGSPLAINRSQILSAEGLRLIGPVLSFHAVAFTLGYWIS  338

Query  363   GAAFRDAPDVKPLQ------RTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMS  202
                      ++PL+      RT+S  TGMQSS LA  LA++F       VPPA SVV M+
Sbjct  339   --------KMQPLRLEEEVCRTISLCTGMQSSTLAGLLASQFLGST-QAVPPACSVVAMA  389

Query  201   LMGFSLVMFWNKN  163
             +MG  L  FW   
Sbjct  390   IMGLCLASFWGSG  402



>ref|XP_011009337.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Populus euphratica]
Length=417

 Score =   201 bits (510),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 187/308 (61%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + I AL  P +FTW +   YAPALG +M ++G+  S  DF  A  RP  +
Sbjct  99    SAMLPFVVAATAIAALAQPATFTWVSKELYAPALGGIMLSIGIKLSIHDFAPAIKRPLPL  158

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KP LG L       AFG+     AG +LTSCV+GAQLS+YA+FL+   +A
Sbjct  159   SVGFIAQYVLKPGLGVLVAK----AFGMSQMFFAGFVLTSCVAGAQLSSYASFLSKGDVA  214

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T  + L TP L+ LLIG  +PVD I M  +I+Q+V++PV  GL+LN +  
Sbjct  215   -LSILLTSSTTIASVLFTPLLTGLLIGSVVPVDAIAMSKSILQVVLIPVTLGLVLNTYAK  273

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N + P +P +++  TSLC+G+PLAIN   ++S  GL ++  V+ FH  AF  GY ++
Sbjct  274   AVVNLLNPVMPFVAMVCTSLCIGSPLAINRSQILSKEGLWLIFPVLTFHAVAFTLGYWVS  333

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                A R   +     RT+S  TGMQSS LA  LA  F       VPPA SVV M++MG  
Sbjct  334   KIPALRQEEEA---SRTISLCTGMQSSTLAGLLATHFLGSTQ-AVPPACSVVAMAIMGLC  389

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  390   LASFWGNG  397



>gb|ABS78831.1| At4g12030-like protein [Arabidopsis lyrata subsp. lyrata]
Length=153

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -1

Query  663  LSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSL  484
            LSLLLIGK+LPVDV GMIS+I+Q+VV P+AAGLLLNR FP++ NAI+P LP L+V     
Sbjct  2    LSLLLIGKKLPVDVFGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPCLPALTVIDMGC  61

Query  483  CVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYE  304
            C+GAPLA+NI S++SP G+++L LVI +HL AF++GY   G  F  APDVK LQRT+SYE
Sbjct  62   CIGAPLALNIDSILSPFGVTILFLVITYHLFAFVAGYFFTGFFFSKAPDVKALQRTISYE  121

Query  303  TGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            TGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  122  TGMQSSLLALALATKFFQDPLVGVPPAISTVV  153



>gb|KDP45244.1| hypothetical protein JCGZ_15109 [Jatropha curcas]
Length=421

 Score =   200 bits (508),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 141/334 (42%), Positives = 203/334 (61%), Gaps = 12/334 (4%)
 Frame = -1

Query  1164  SLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPA  985
             SL  +   +S +   K NS   +    +A+LP VV  + I ALV P +FTW +   YAPA
Sbjct  80    SLLYFGISNSNVEVEKTNSSQVL----SAMLPFVVAVTAIAALVQPSTFTWVSKELYAPA  135

Query  984   LGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLA  805
             LG +M ++G+  S  DF  A  RP  +  G++ Q+V+KP LG L       A G+     
Sbjct  136   LGGIMLSIGIKLSIDDFALALKRPLPLSIGFLAQYVLKPALGILIAK----ALGMSHMFF  191

Query  804   AGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVD  625
             +G +LT+CV+GAQLS+YA+FL+   +A +SI++TS +T T+ LVTP L+ LLIG  +PVD
Sbjct  192   SGFVLTACVAGAQLSSYASFLSKGDVA-MSILLTSTTTITSVLVTPLLTGLLIGSIVPVD  250

Query  624   VIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsv  445
              I M  +I+Q+V+VPV  GL LN +   V   I+P +P +++  TS+C+G+PLAIN   +
Sbjct  251   PIAMSKSILQVVLVPVTLGLALNTYAKPVVQLIQPVMPIIAMICTSVCIGSPLAINRSHI  310

Query  444   vspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALA  265
             +S  GL ++  V+AFH +AF  GY ++   F    +   + RT+S  TGMQSS LA  LA
Sbjct  311   LSAQGLRLVFPVLAFHTAAFTLGYWISRIPFLRLDE--EVSRTISLCTGMQSSTLAGLLA  368

Query  264   NKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
             ++F       VPPA SVV M++MG SL  FW   
Sbjct  369   SQFLGTTQ-AVPPACSVVAMAIMGLSLASFWGSG  401



>ref|XP_004310253.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=420

 Score =   198 bits (504),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 134/308 (44%), Positives = 191/308 (62%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +FTW +   YAPALG +M ++G+  S  DF  A  RP  +
Sbjct  101   SAMLPFVVAATAVAALAQPATFTWVSKDLYAPALGGIMLSIGIKLSIDDFALAVKRPLPL  160

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KP LG         AFG+P    AG +L++CV+GAQLS+YA+FL+   +A
Sbjct  161   SIGFIAQYVLKPALGVFIAM----AFGVPRMFYAGFVLSACVAGAQLSSYASFLSKGDVA  216

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T  + +VTP L+ LLIG  +PVD + M  +I+Q+V+ PV  GL LN +  
Sbjct  217   -LSILLTSSTTIASVIVTPLLTGLLIGSVVPVDAVAMAKSILQVVLAPVTIGLALNTYAK  275

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   +RP +P +++  TSLC+G+PLAIN + ++S  GL ++  V+AFH  AF  GY ++
Sbjct  276   PVVTILRPVMPFVAMICTSLCIGSPLAINQRQILSMDGLRLIFPVLAFHAVAFTVGYWVS  335

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                + R   +V    RTLS  TGMQSS LA  LA++F       VPPA SVV M++MG  
Sbjct  336   KIPSLRQEEEVS---RTLSLCTGMQSSTLAGLLASQFLGSS-QAVPPACSVVAMAIMGLF  391

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  392   LASFWGTG  399



>ref|XP_004150363.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic-like 
[Cucumis sativus]
Length=433

 Score =   198 bits (504),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 130/311 (42%), Positives = 190/311 (61%), Gaps = 14/311 (5%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + I AL +P +F W     YAPALG +M ++G+  S  DF  A  RP  +
Sbjct  115   SALLPFVVAATGISALSWPSTFNWVPKDLYAPALGGIMLSIGIKLSINDFALAMKRPVPL  174

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KP LG L       AFG+     AG +LT+CV GAQLS+YA+FL+   +A
Sbjct  175   SVGFVAQYVLKPALGVLIAR----AFGISPMFYAGFLLTACVGGAQLSSYASFLSKGDIA  230

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T ++ L+TP L+ +LIG  +PVD + M  +I+Q+V++PVA GL+LN +  
Sbjct  231   -LSILLTSFTTISSVLLTPLLTGILIGSVVPVDAVAMSKSILQVVLLPVALGLVLNSYAK  289

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              +   ++P +P +++  TSLC+G+PLAIN   ++S  G  ++L V+ FH  AF  GY  +
Sbjct  290   PIVAILQPVMPFVAMVCTSLCIGSPLAINKSQILSIDGARLVLPVLVFHTMAFTLGYWAS  349

Query  363   GAAFRDAPDVKPLQ---RTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMG  193
                    P V+  +   RT+S  TGMQSS LA  LA +F       VPPA SVV+M++MG
Sbjct  350   -----KIPIVRQEEEASRTISLCTGMQSSTLAGLLATQFLGSTH-AVPPACSVVVMAIMG  403

Query  192   FSLVMFWNKNK  160
               L  FW    
Sbjct  404   LCLASFWGSGS  414



>ref|XP_007049591.1| Sodium Bile acid symporter family [Theobroma cacao]
 gb|EOX93748.1| Sodium Bile acid symporter family [Theobroma cacao]
Length=425

 Score =   198 bits (504),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 135/308 (44%), Positives = 195/308 (63%), Gaps = 10/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + ALV P +FTW +   YAPALG +M ++G+  S  DF  A  RP  +
Sbjct  107   SAMLPFVVAVTAVAALVQPATFTWVSKELYAPALGGIMLSIGIRLSFDDFALAVKRPLPL  166

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+  Q+++KP LG L       AFG+     +G +LTSCV+GAQLS+YA+FL+   +A
Sbjct  167   SVGFFAQYMLKPALGVLIAK----AFGMSPLFYSGFVLTSCVAGAQLSSYASFLSKGDVA  222

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI++TS +T  + LVTP L+ LLIG  +PVD + M  +I+Q+V VPV  GL+LN +  
Sbjct  223   -VSILLTSFTTIASVLVTPLLTGLLIGSVVPVDAVAMSKSILQVVFVPVTIGLVLNTYAK  281

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   +RP +P +++  T++C+G+PLA+N   ++S  G+ ++L V+AFH +AFI GY ++
Sbjct  282   PVVTILRPVMPFVAMICTAMCIGSPLALNRSQILSKEGIQLVLPVLAFHTAAFIVGYWIS  341

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                AFR   +V    RT+S  TGMQSS LA  LA +F       VPPA SVV M++MG S
Sbjct  342   KIPAFRQREEV---CRTVSLCTGMQSSTLAGLLATQFLGGSQ-AVPPACSVVAMAIMGLS  397

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  398   LASFWGNG  405



>ref|XP_004164201.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic-like 
[Cucumis sativus]
Length=436

 Score =   198 bits (504),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 130/311 (42%), Positives = 190/311 (61%), Gaps = 14/311 (5%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + I AL +P +F W     YAPALG +M ++G+  S  DF  A  RP  +
Sbjct  115   SALLPFVVAATGISALSWPSTFNWVPKDLYAPALGGIMLSIGIKLSINDFALAMKRPVPL  174

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KP LG L       AFG+     AG +LT+CV GAQLS+YA+FL+   +A
Sbjct  175   SVGFVAQYVLKPALGVLIAR----AFGISPMFYAGFLLTACVGGAQLSSYASFLSKGDIA  230

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T ++ L+TP L+ +LIG  +PVD + M  +I+Q+V++PVA GL+LN +  
Sbjct  231   -LSILLTSFTTISSVLLTPLLTGILIGSVVPVDAVAMSKSILQVVLLPVALGLVLNSYAK  289

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              +   ++P +P +++  TSLC+G+PLAIN   ++S  G  ++L V+ FH  AF  GY  +
Sbjct  290   PIVAILQPVMPFVAMVCTSLCIGSPLAINKSQILSIDGARLVLPVLVFHTMAFTLGYWAS  349

Query  363   GAAFRDAPDVKPLQ---RTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMG  193
                    P V+  +   RT+S  TGMQSS LA  LA +F       VPPA SVV+M++MG
Sbjct  350   -----KIPIVRQEEEASRTISLCTGMQSSTLAGLLATQFLGSTH-AVPPACSVVVMAIMG  403

Query  192   FSLVMFWNKNK  160
               L  FW    
Sbjct  404   LCLASFWGSGS  414



>ref|XP_007140728.1| hypothetical protein PHAVU_008G136700g [Phaseolus vulgaris]
 gb|ESW12722.1| hypothetical protein PHAVU_008G136700g [Phaseolus vulgaris]
Length=408

 Score =   197 bits (501),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 138/338 (41%), Positives = 201/338 (59%), Gaps = 17/338 (5%)
 Frame = -1

Query  1167  ESLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAP  988
              SLS  A   + + + +E     +L   +A+LP VV  + + ALV P +FTW +   YAP
Sbjct  65    SSLSFGADNRNAVGEVRERDLSQLL---SALLPVVVAATAVAALVQPSTFTWVSKDLYAP  121

Query  987   ALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSL  808
             ALG +M ++G+  S  DF  AF RP  +  G I Q+V+KP+LG         AFGL    
Sbjct  122   ALGGIMLSIGIRLSADDFALAFKRPLPLTLGLIAQYVLKPVLGVFIAK----AFGLSRMF  177

Query  807   AAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPV  628
              AG +LT+CVSGAQLS+YA FL+   +A L I++TS +T  + +VTP L+ LLIG  + V
Sbjct  178   YAGFVLTACVSGAQLSSYANFLSKGDVA-LGILLTSYTTIASVVVTPLLTGLLIGSVVSV  236

Query  627   DVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQs  448
             D + M  +I+Q+V++PV  GL+LN +   V + ++P +P +++  TSLC+G+PLA+N   
Sbjct  237   DAVAMSKSILQVVLIPVTLGLILNTYAKPVVSVLQPVMPFVAMICTSLCIGSPLALNRSQ  296

Query  447   vvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKP---LQRTLSYETGMQSSLLA  277
             ++S  GL ++  V+ FH+ AF  GY      F   P ++    + RTLS  +GMQSS LA
Sbjct  297   ILSVEGLRLVFPVLTFHIVAFSLGYW-----FSKIPSLRQEEHVSRTLSLCSGMQSSTLA  351

Query  276   LALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
               LA +F  D    VPPA SV+ M++MG  L  FW   
Sbjct  352   GLLATQFL-DSSQAVPPACSVIAMAIMGLCLASFWGSG  388



>ref|XP_010244074.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Nelumbo nucifera]
Length=430

 Score =   197 bits (502),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 139/324 (43%), Positives = 200/324 (62%), Gaps = 14/324 (4%)
 Frame = -1

Query  1125  KPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSS  946
              P+E++     +  +A+LP VV  + + ALV P +F+W +   YAPALG +M ++G+  S
Sbjct  98    NPREHAKNDSSQALSAMLPFVVAATAVAALVQPATFSWVSKDLYAPALGGIMLSIGIQLS  157

Query  945   EKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQ  766
               DF  AF RP  +  GYI Q+V+KPLLG L       AFG P    AG +L  CV+GAQ
Sbjct  158   IDDFALAFRRPLPLSVGYIAQYVLKPLLGVLVAR----AFGAPPMFYAGFILMCCVAGAQ  213

Query  765   LSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVV  586
             LS+YA+FL+   +A LSI++TS +T ++ +VTP L+ LLIG  +PVD + M  +I+Q+V+
Sbjct  214   LSSYASFLSKGDVA-LSILLTSSTTVSSVVVTPILTGLLIGSVVPVDAVAMSKSILQVVL  272

Query  585   VPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVI  406
             +PVA GL+LN +   V   IRP +P +++  TSLC+G+PLAIN   ++S  GL ++L V+
Sbjct  273   LPVALGLVLNTYAKPVVGVIRPVMPFVAMLCTSLCIGSPLAINQSQILSAEGLRLILPVL  332

Query  405   AFHLSAFISGYTLAGAAFRDAPDVKPLQ---RTLSYETGMQSSLLALALANKFFQDPLVG  235
              FH  AF  GY ++       P ++  +   RT+S  TGMQSS LA  LA +F       
Sbjct  333   TFHAVAFTVGYWVS-----KIPHLRQEEAVCRTISLCTGMQSSTLAGLLATQFLGSS-QA  386

Query  234   VPPAISVVIMSLMGFSLVMFWNKN  163
             VP A SVV M++MG  L  FW + 
Sbjct  387   VPSACSVVAMAIMGLCLASFWGRG  410



>dbj|BAB01312.1| unnamed protein product [Arabidopsis thaliana]
Length=454

 Score =   197 bits (502),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 127/293 (43%), Positives = 185/293 (63%), Gaps = 10/293 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL YPPSFTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  112   SALLPFVVALTAVAALSYPPSFTWVSKDLYAPALGGIMLSIGIQLSVDDFALAFKRPVPL  171

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KPLLG L       AFG+P +  AG +LT CV+GAQLS+YA+ L+   +A
Sbjct  172   SVGFVAQYVLKPLLGVLVAN----AFGMPRTFYAGFILTCCVAGAQLSSYASSLSKADVA  227

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI++TS +T  + + TP LS LLIG  +PVD + M  +I+Q+V+VP+  GL+LN +  
Sbjct  228   -MSILLTSSTTIASVIFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPITLGLVLNTYAK  286

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   ++P +P +++  TSLC+G+PL+IN   ++S  GL +++ ++ FH  AF  GY  +
Sbjct  287   PVVTLLQPVMPFVAMVCTSLCIGSPLSINRSQILSAEGLGLIVPIVTFHAVAFALGYWFS  346

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
                  R   +V    RT+S  TGMQSS LA  LA++F       VP A SVVI
Sbjct  347   KIPGLRQEEEVS---RTISLCTGMQSSTLAGLLASQFLGSSQ-AVPAACSVVI  395



>ref|XP_008447226.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
[Cucumis melo]
Length=433

 Score =   197 bits (500),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 186/309 (60%), Gaps = 10/309 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             + +LP VV  + I AL  P +FTW     YAPALG +M ++G+  S  DF  A  RP  +
Sbjct  114   SGLLPFVVAATGISALTCPSTFTWVPKDLYAPALGGIMLSIGIKLSINDFALAMKRPVPL  173

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+V+KP LG L       AFG+     AG +LT+CV GAQLS+YA+FL+   +A
Sbjct  174   SIGFVAQYVLKPALGVLIAR----AFGISPLFYAGFLLTACVGGAQLSSYASFLSKGDIA  229

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T ++ L+TP L+ +LIG  +PVD   M  +I+Q+V++PVA GL+LN +  
Sbjct  230   -LSILLTSFTTISSVLLTPLLTGILIGSVVPVDAAAMSKSILQVVLLPVALGLVLNSYAK  288

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              +   I+P +P +++  TSLC+G+PLAIN   ++S  G  ++L V+AFH  AF  GY  +
Sbjct  289   PIVAIIQPVMPFVAIICTSLCIGSPLAINRSQILSIHGAQLVLPVLAFHAMAFTLGYWAS  348

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +     RT+S  TGMQSS LA  LA +F       VPPA SVV M++MG  
Sbjct  349   KIPIIRQEEEA---SRTISLCTGMQSSTLAGLLATQFLGSTH-AVPPACSVVAMAIMGLC  404

Query  186   LVMFWNKNK  160
             L  FW    
Sbjct  405   LASFWGSGS  413



>gb|ABS78813.1| At4g12030-like protein [Arabidopsis halleri subsp. halleri]
Length=143

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 124/153 (81%), Gaps = 10/153 (7%)
 Frame = -1

Query  666  FLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTS  487
             LSLLLIGK+LPVDVIGMIS+I+Q+VV P+AAGLLLNR FP++ NAI+PFLP L+V    
Sbjct  1    MLSLLLIGKKLPVDVIGMISSILQVVVTPIAAGLLLNRLFPRLSNAIKPFLPALTVIDMG  60

Query  486  LCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSY  307
             C+GAPLA+NI S++SP G ++L LVI FHL AF++GY          PDVK LQRT+SY
Sbjct  61   CCIGAPLALNIDSILSPFGATILFLVITFHLLAFVAGY----------PDVKALQRTISY  110

Query  306  ETGMQSSLLALALANKFFQDPLVGVPPAISVVI  208
            ETGMQSSLLALALA KFFQDPLVGVPPAIS V+
Sbjct  111  ETGMQSSLLALALATKFFQDPLVGVPPAISTVV  143



>ref|XP_006297609.1| hypothetical protein CARUB_v10013629mg, partial [Capsella rubella]
 gb|EOA30507.1| hypothetical protein CARUB_v10013629mg, partial [Capsella rubella]
Length=468

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 122/285 (43%), Positives = 177/285 (62%), Gaps = 10/285 (4%)
 Frame = -1

Query  1014  WFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAI  835
             W +   YAPALG +M ++G+  S  DF  AF RP  +  G++ Q+V+KPLLG L      
Sbjct  175   WVSKELYAPALGGIMLSIGIQLSVDDFALAFKRPVPLSVGFVAQYVLKPLLGVLVAN---  231

Query  834   AAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSL  655
              AFG+P +  AG +LT CV+GAQLS+YA+ L+   +A +SI++TS +T  + L TP LS 
Sbjct  232   -AFGMPRTFYAGFVLTCCVAGAQLSSYASSLSKADVA-MSILLTSSTTIASVLFTPLLSG  289

Query  654   LLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVG  475
             LLIG  +PVD + M  +I+Q+V+VPV  GL+LN +   V   I+P +P +++  TSLC+G
Sbjct  290   LLIGSVVPVDAVAMSKSILQVVLVPVTLGLVLNTYAKPVVTLIQPVMPFVAMVCTSLCIG  349

Query  474   APLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA-AFRDAPDVKPLQRTLSYETG  298
             +PL+IN   ++S  GL +++ ++ FH  AF+ GY  +     R   +V    RT+S  TG
Sbjct  350   SPLSINRSQILSAEGLGLIVPIVTFHAVAFVLGYWFSKIPGLRQEEEVS---RTISLCTG  406

Query  297   MQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
             MQSS LA  LA++F       VP A SVV+M++MG  L  FW   
Sbjct  407   MQSSTLAGLLASQFLGSSQ-AVPAACSVVVMAIMGLCLASFWGSG  450



>emb|CDP03966.1| unnamed protein product [Coffea canephora]
Length=439

 Score =   193 bits (490),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 131/312 (42%), Positives = 188/312 (60%), Gaps = 12/312 (4%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + AL  P +FTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  117   SAMLPFVVALTAVSALSQPSTFTWVSKELYAPALGGIMLSIGIRLSIDDFALAFKRPVPL  176

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G++ Q+ +KP LG L       AFG+     AG +L SCV+GAQLS+YA+FL+   +A
Sbjct  177   SIGFVAQYALKPALGVLVAR----AFGMSRIFFAGFVLMSCVAGAQLSSYASFLSKGDVA  232

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQ----IVVVPVAAGLLLN  556
              LSI++TS ST  + LVTP L+ LLIG  +PVD + M  +I+Q    +V+ PV  GL+LN
Sbjct  233   -LSILLTSSSTIASVLVTPLLTGLLIGSVVPVDAVAMSKSILQARNSVVLAPVTLGLVLN  291

Query  555   RFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISG  376
              +   V   ++P +P +++  TS+C+G+PLAIN   ++SP GL ++  V+ FH  AF  G
Sbjct  292   TYAKPVVYLLQPVMPFVAMICTSMCIGSPLAINRSQILSPEGLRLVAPVLTFHAVAFTLG  351

Query  375   YTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLM  196
             Y ++        +   + RT+S  TGMQSS LA  LA +F       VPPA SVV M++M
Sbjct  352   YWISKIPILRLEE--EVSRTVSLCTGMQSSTLAGLLATQFLGST-QAVPPACSVVAMAIM  408

Query  195   GFSLVMFWNKNK  160
             G  L  FW   +
Sbjct  409   GLCLASFWGSGR  420



>ref|XP_005649158.1| SBF-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24614.1| SBF-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=291

 Score =   187 bits (475),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 142/291 (49%), Positives = 183/291 (63%), Gaps = 23/291 (8%)
 Frame = -1

Query  1029  PPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLF  850
             P SF WFT   YAP LGFLMFAVGVN   + F E F +P  I  G +GQ++VKPLLG + 
Sbjct  23    PASFAWFTPPMYAPGLGFLMFAVGVNLKVEAFKEVFKKPQYIAVGAVGQWLVKPLLGLIL  82

Query  849   GTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVT  670
                 +   GLP ++  G++L SCVSGAQLSNYATFL  P  APLSIV+T+LSTA   L+T
Sbjct  83    ALTLVPMLGLPNAVGTGLILVSCVSGAQLSNYATFLVHPEQAPLSIVLTALSTAAGVLMT  142

Query  669   PFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVT  490
             P L+LLL+G R+PVD  GM  +I QIV+                     PFL  LS+  T
Sbjct  143   PALALLLLGARIPVDPQGMALSITQIVL---------------------PFLTFLSLLDT  181

Query  489   SLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLS  310
               CVGA LA N  +  S +GL+VLL V+  H++A+  G+ LA +    A +  PL R +S
Sbjct  182   CACVGASLASNSATARSSTGLTVLLPVVVLHVAAYYFGFRLARSTI--AKESIPLARCIS  239

Query  309   YETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNKS  157
              ETGMQSSLL L LA++FF DPLV +P  IS + M+L GF+LV++W +  +
Sbjct  240   LETGMQSSLLGLLLASRFFNDPLVSLPCGISTIFMTLSGFALVVWWKRKAA  290



>gb|EMT02361.1| Putative sodium-dependent transporter yocS [Aegilops tauschii]
Length=343

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 132/310 (43%), Positives = 197/310 (64%), Gaps = 8/310 (3%)
 Frame = -1

Query  1092  RGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRP  913
                +A+LP VV+ + + AL  P +F+W +   YAPALG +M ++G+  S  DF  AF RP
Sbjct  22    EAVSALLPLVVVATAVAALGNPATFSWVSKELYAPALGGIMLSIGIKLSFDDFALAFKRP  81

Query  912   GAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDP  733
               +  GY+ Q+++KPLLG L   +    F +P++  AG MLT CVSGAQLS+YA+FL   
Sbjct  82    VPLSIGYMAQYMLKPLLGVLIARV----FRMPSAFFAGFMLTCCVSGAQLSSYASFLGKG  137

Query  732   PMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNR  553
              +A LSI++T+ ST ++ +VTP L+ LLIG  +PV+ I M  +I+Q+V++PV  GLLLN 
Sbjct  138   DVA-LSILLTTYSTISSVIVTPILTGLLIGSVVPVNGIAMAKSILQVVLLPVTLGLLLNT  196

Query  552   FFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGY  373
             +   V N I+P +P +++  TSLC+G+PLAIN   ++S  G  +LL ++ FH++AF+ GY
Sbjct  197   YAKPVVNVIQPVMPFVAMVCTSLCIGSPLAINRTMLLSSQGFMLLLPIVTFHIAAFVVGY  256

Query  372   TLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMG  193
              +  +        +P+ RT+S  TGMQSS LA  LA +F       VP A SVV+M++ G
Sbjct  257   WV--SKLPQLRQEEPVCRTISVCTGMQSSTLAGLLATQFLGISQ-AVPAACSVVVMAIFG  313

Query  192   FSLVMFWNKN  163
              +L  +W   
Sbjct  314   LTLASYWGSG  323



>gb|KHG13148.1| putative sodium-dependent transporter yocS [Gossypium arboreum]
Length=415

 Score =   187 bits (474),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 130/308 (42%), Positives = 193/308 (63%), Gaps = 9/308 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + +LV P +FTW +   YAPALG +M ++G+  S  DF  A  RP  +
Sbjct  94    SAMLPFVVAATAVASLVQPSTFTWVSKELYAPALGGIMLSIGIKLSLDDFALAVKRPLPL  153

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G I Q+++KP LG L       AFG+     AG +LTSCV+GAQLS+YA+FL+   +A
Sbjct  154   SVGLIVQYMLKPGLGVLIAK----AFGMSPMFYAGFILTSCVAGAQLSSYASFLSKGDVA  209

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              +SI++TS +T  + L+TP L+ LLIG  +PVD + M  +I+Q+V+VPVA G++LN +  
Sbjct  210   -VSILLTSFTTIASVLLTPLLTCLLIGSVVPVDAVMMSKSILQVVLVPVALGVVLNTYAK  268

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGY-TL  367
              V   ++P +P +++  TSLC+G+PLA+N   ++S  GL ++L ++AFH  AF  GY  L
Sbjct  269   PVVTILQPVMPFVAMICTSLCIGSPLALNQSQILSKDGLQLVLPILAFHAVAFAIGYWIL  328

Query  366   AGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                +FR   +V    RT+S  +GMQSS +A  LA +F       VP A SV++M++MG S
Sbjct  329   KIPSFRQREEVC---RTVSLCSGMQSSTMAGLLAIQFLGGSSQAVPAACSVIVMAIMGLS  385

Query  186   LVMFWNKN  163
             L   W   
Sbjct  386   LASLWGSG  393



>ref|XP_009589252.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=346

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 123/282 (44%), Positives = 171/282 (61%), Gaps = 8/282 (3%)
 Frame = -1

Query  1008  TSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAA  829
             +   YAPALG +M ++G+  S  DF  A  RP  +  G+I Q+V+KP LG     I   A
Sbjct  51    SKELYAPALGGIMLSIGIRLSIDDFALAIKRPLPLSVGFIAQYVLKPALG----IIVAQA  106

Query  828   FGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLL  649
             FG+P +  AG +L SCV+GAQLS+YA+FL+   +A  SI++TS ST  + LVTP L+ LL
Sbjct  107   FGMPQTFYAGFVLMSCVAGAQLSSYASFLSKSDVA-FSILLTSSSTIASVLVTPLLTGLL  165

Query  648   IGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAP  469
             IG  +PVD I M  +I+Q+V++PV  GL LN +   V + I+P +P +++  TSLC+G+P
Sbjct  166   IGSVVPVDAIAMSKSILQVVLLPVTLGLALNTYAKPVVSVIQPVMPFVAMICTSLCIGSP  225

Query  468   LAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQS  289
             LAIN   ++S  G  ++  V+ FH  AF  GY  +   F    +   + RT+S  TGMQS
Sbjct  226   LAINRAQILSAEGARLIGPVLTFHAVAFAVGYWFSKLPFFRFEE--KVCRTISLCTGMQS  283

Query  288   SLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
             S LA  LA +F       VPPA SVV M++MG  L  FW   
Sbjct  284   STLAGLLATQFLGSTQ-AVPPACSVVAMAIMGLCLASFWGSG  324



>gb|KFK39837.1| hypothetical protein AALP_AA3G294600 [Arabis alpina]
Length=349

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 135/340 (40%), Positives = 194/340 (57%), Gaps = 30/340 (9%)
 Frame = -1

Query  1317  SLPKPLPCINLEFHYPFLSLPRKS--FNSSARSSRLP------VSRC-VSENLSDSIRPE  1165
             SL  P P I  +   P   LP KS  F     +SRLP      +  C +S +L   +R  
Sbjct  6     SLSFPPPAIPRQTLVPDFRLPAKSRCFECQLPTSRLPSLSSISIDSCSLSNSLDFRVRRR  65

Query  1164  SLSNYAAESSEI-------FKPKENSFLTVLRGA---------NAILPHVVLGSTILALV  1033
             S    A  ++         ++    S L+   G          +A+LP VV  + + AL 
Sbjct  66    SGGALACSTTPFMGRVGLQWRDGNMSLLSFCGGTERADTSQVLSALLPFVVALTAVAALS  125

Query  1032  YPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYL  853
             YPPSFTW +   YAPALG +M ++G+  S +DF  AF RP  +  G+I Q+V+KPLLG L
Sbjct  126   YPPSFTWVSKELYAPALGGIMLSIGIQLSVQDFALAFKRPVPLSVGFIAQYVLKPLLGVL  185

Query  852   FGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLV  673
                    AFG+P +  AG +LT CV+GAQLS+YA+ L+   +A +SI++TS +T  + L 
Sbjct  186   VAN----AFGMPRTFYAGFVLTCCVAGAQLSSYASSLSKADVA-MSILLTSCTTIASVLF  240

Query  672   TPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFV  493
             TP LS  LIG  +PVD I M  +I+Q+V+VPV  GL+LN +   V + +RP +P +++  
Sbjct  241   TPMLSGFLIGSVVPVDAIAMSKSILQVVLVPVTLGLVLNTYAKPVVSLLRPVMPFVAMVC  300

Query  492   TSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGY  373
             TSLC+G+PL+IN   ++S  GL ++L VI FH  AF+ GY
Sbjct  301   TSLCIGSPLSINQSQILSAEGLRLILPVITFHALAFVVGY  340



>dbj|BAJ88093.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=418

 Score =   186 bits (471),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 133/307 (43%), Positives = 197/307 (64%), Gaps = 8/307 (3%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV+ +   AL  P +F+W +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  100   SALLPLVVVATAAAALGNPATFSWVSKELYAPALGGIMLSIGIKLSFDDFALAFKRPVPL  159

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               GY+ Q+V+KPLLG L   +    F +P++  AG MLT CVSGAQLS+YA+FL    +A
Sbjct  160   SIGYMAQYVLKPLLGVLIARV----FRMPSAFFAGFMLTCCVSGAQLSSYASFLGKGDVA  215

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++T+ ST ++ +VTP L+ LLIG  +PV+ I M  +I+Q+V++PV  GLLLN +  
Sbjct  216   -LSILLTTYSTISSVIVTPILTGLLIGSVVPVNGIAMAKSILQVVLLPVTLGLLLNTYAK  274

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V N I+P +P +++  TSLC+G+PLAIN   ++S  GL +LL ++ FH++AF+ GY + 
Sbjct  275   PVVNVIQPVMPFVAMVCTSLCIGSPLAINRSILLSSQGLMLLLPIVTFHIAAFVVGYWV-  333

Query  363   GAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSL  184
              +        +P+ RT+S  TGMQSS LA  LA +F       VP A SVV+M++ G ++
Sbjct  334   -SKLPQLRQEEPVCRTISVCTGMQSSTLAGLLATQFLGISQ-AVPAACSVVVMAIFGLTI  391

Query  183   VMFWNKN  163
               +W   
Sbjct  392   ASYWGSG  398



>gb|KHN10925.1| Putative sodium-dependent transporter yocS [Glycine soja]
Length=282

 Score =   178 bits (452),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 117/273 (43%), Positives = 167/273 (61%), Gaps = 14/273 (5%)
 Frame = -1

Query  972  MFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIM  793
            M ++G+  S  DF  AF RP  +  G I Q+V+KP+LG L       AFGL     AG +
Sbjct  1    MLSIGIRLSVDDFALAFKRPLPLTIGLIAQYVLKPVLGILVA----KAFGLSRMFYAGFV  56

Query  792  LTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGM  613
            LT+CVSGAQLS+YA FL+   +A L I++TS +T  + +VTP L+ LLIG  +PVD + M
Sbjct  57   LTACVSGAQLSSYANFLSKGDVA-LGILLTSYTTIASVIVTPLLTGLLIGSVVPVDAVAM  115

Query  612  ISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsps  433
              +I+Q+V+VPV  GLLLN +   V + ++P +P +++  TSLC+G+PLA+N   +++  
Sbjct  116  SKSILQVVLVPVTLGLLLNTYAKSVVSVLQPVMPFVAMICTSLCIGSPLALNRSQILTGE  175

Query  432  glsvlllVIAFHLSAFISGYTLAGAAFRDAPDVK---PLQRTLSYETGMQSSLLALALAN  262
            GL ++  V+ FH+ AF  GY      F   P ++    + RT+S  TGMQSS LA  LA 
Sbjct  176  GLRLVFPVLTFHVVAFTLGY-----WFSKIPSLRQEEQVSRTISLCTGMQSSTLAGLLAT  230

Query  261  KFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
            +F  D    VPPA SV+ M++MG  L  FW   
Sbjct  231  QFL-DSSQAVPPACSVIAMAIMGLCLASFWGSG  262



>ref|XP_010100822.1| putative sodium-dependent transporter yocS [Morus notabilis]
 gb|EXB84520.1| putative sodium-dependent transporter yocS [Morus notabilis]
Length=409

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 129/308 (42%), Positives = 179/308 (58%), Gaps = 27/308 (9%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + I AL  P +FTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  116   SAMLPFVVAATAIAALAQPSTFTWVSKELYAPALGGIMLSIGIRLSIDDFALAFKRPLPL  175

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KP LG L       AFG                 AQLS+YA+FL+   +A
Sbjct  176   SVGFIAQYVLKPALGVLIAR----AFG-----------------AQLSSYASFLSKGDVA  214

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T  + L TP L+ LLIG  +PVD + M  +I+Q+V+VPV  GL+LN +  
Sbjct  215   -LSILLTSCTTIASVLFTPLLTGLLIGSVVPVDAVAMSKSILQVVLVPVTLGLVLNTYAR  273

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V   ++P +P +++  TSLC+G+PLAIN   ++SP G  ++  V+AFH  AF  GY ++
Sbjct  274   PVVTVLQPVMPFIAMICTSLCIGSPLAINRAQILSPEGFRLVFPVLAFHAVAFTLGYWVS  333

Query  363   GA-AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFS  187
                  R   +V    RT+S  TGMQSS LA  LA +F       VPPA SVV M++MG  
Sbjct  334   KIPVLRQEEEVS---RTISLCTGMQSSTLAGLLATQFLGSS-QAVPPACSVVAMAIMGLC  389

Query  186   LVMFWNKN  163
             L  FW   
Sbjct  390   LASFWGSG  397



>ref|XP_010913123.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
isoform X3 [Elaeis guineensis]
Length=345

 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 162/237 (68%), Gaps = 5/237 (2%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + ALV P +F+W +  YYAPALG +M ++G+  S  DF  AF RP  +
Sbjct  104   SAMLPFVVAATAVAALVNPSTFSWVSKEYYAPALGGIMLSIGIRLSFDDFALAFRRPLPL  163

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               GYI Q+V+KPLLG +   +    F +P++   G +LTSCV+GAQLS+YA+FL+   +A
Sbjct  164   SVGYIAQYVLKPLLGLVIAKL----FRMPSTFFTGFLLTSCVAGAQLSSYASFLSKGDVA  219

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T ++  VTP L+ LLIG  +PVD + M  +I+Q+V++PVA GL LN +  
Sbjct  220   -LSILLTSSTTISSVFVTPLLTGLLIGSVIPVDGVAMSKSILQVVLLPVALGLFLNTYAK  278

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGY  373
              V N I+P +P +++F TSLC+G+PLAIN   ++S  GL +L  ++ FHL AFI GY
Sbjct  279   AVVNVIQPIMPIVAMFCTSLCIGSPLAINQSQILSSEGLLLLFPILTFHLVAFILGY  335



>ref|XP_010913122.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=347

 Score =   176 bits (445),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 162/237 (68%), Gaps = 5/237 (2%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + + ALV P +F+W +  YYAPALG +M ++G+  S  DF  AF RP  +
Sbjct  104   SAMLPFVVAATAVAALVNPSTFSWVSKEYYAPALGGIMLSIGIRLSFDDFALAFRRPLPL  163

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               GYI Q+V+KPLLG +   +    F +P++   G +LTSCV+GAQLS+YA+FL+   +A
Sbjct  164   SVGYIAQYVLKPLLGLVIAKL----FRMPSTFFTGFLLTSCVAGAQLSSYASFLSKGDVA  219

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T ++  VTP L+ LLIG  +PVD + M  +I+Q+V++PVA GL LN +  
Sbjct  220   -LSILLTSSTTISSVFVTPLLTGLLIGSVIPVDGVAMSKSILQVVLLPVALGLFLNTYAK  278

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGY  373
              V N I+P +P +++F TSLC+G+PLAIN   ++S  GL +L  ++ FHL AFI GY
Sbjct  279   AVVNVIQPIMPIVAMFCTSLCIGSPLAINQSQILSSEGLLLLFPILTFHLVAFILGY  335



>gb|EPS74376.1| hypothetical protein M569_00378 [Genlisea aurea]
Length=392

 Score =   173 bits (438),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 127/331 (38%), Positives = 193/331 (58%), Gaps = 29/331 (9%)
 Frame = -1

Query  1155  NYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGF  976
              ++ E +E+     +  L+      A+LP VV  + + AL  P +FTW +   YAPALG 
Sbjct  74    KFSMEEAEVKSSDASEILS------ALLPFVVALTAVAALSKPSTFTWVSKELYAPALGG  127

Query  975   LMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGI  796
             +M ++G+  S  DF  AF RP  +  G I Q+VVKP LG +       AF L     AG 
Sbjct  128   IMLSIGIKLSIDDFALAFQRPLPLSIGLISQYVVKPALGVVIAR----AFSLSPIFYAGF  183

Query  795   MLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIG  616
             +LTSCV+GAQLS+YA++L+   +A LSI++TS S+  + +VTPFL+  LIG  + VD + 
Sbjct  184   VLTSCVAGAQLSSYASYLSKGDVA-LSILLTSSSSIVSVVVTPFLTRFLIGSVVVVDAVS  242

Query  615   MISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsp  436
             M  +I+Q+V+ P+  GLLLN +     + ++P +P +++  TS+C+G+PLAIN   ++SP
Sbjct  243   MAISILQVVLAPITVGLLLNTYAKPAVSVLQPLMPFVAMICTSMCIGSPLAINRSRILSP  302

Query  435   sglsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKF  256
              GL+++L V++FH  AF+ GY +A         ++PL+         QSS LA  LA +F
Sbjct  303   EGLNLILPVVSFHALAFVFGYWIA--------KIQPLR---------QSSTLAGLLATQF  345

Query  255   FQDPLVGVPPAISVVIMSLMGFSLVMFWNKN  163
                    VP A SV+ M++MG  +  FW   
Sbjct  346   L-GATQAVPSACSVITMAIMGLCVASFWGSG  375



>gb|KGN44688.1| hypothetical protein Csa_7G372340 [Cucumis sativus]
Length=282

 Score =   167 bits (423),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 167/274 (61%), Gaps = 14/274 (5%)
 Frame = -1

Query  972  MFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIM  793
            M ++G+  S  DF  A  RP  +  G++ Q+V+KP LG L       AFG+     AG +
Sbjct  1    MLSIGIKLSINDFALAMKRPVPLSVGFVAQYVLKPALGVLIAR----AFGISPMFYAGFL  56

Query  792  LTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGM  613
            LT+CV GAQLS+YA+FL+   +A LSI++TS +T ++ L+TP L+ +LIG  +PVD + M
Sbjct  57   LTACVGGAQLSSYASFLSKGDIA-LSILLTSFTTISSVLLTPLLTGILIGSVVPVDAVAM  115

Query  612  ISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvsps  433
              +I+Q+V++PVA GL+LN +   +   ++P +P +++  TSLC+G+PLAIN   ++S  
Sbjct  116  SKSILQVVLLPVALGLVLNSYAKPIVAILQPVMPFVAMVCTSLCIGSPLAINKSQILSID  175

Query  432  glsvlllVIAFHLSAFISGYTLAGAAFRDAPDVKPLQ---RTLSYETGMQSSLLALALAN  262
            G  ++L V+ FH  AF  GY  +       P V+  +   RT+S  TGMQSS LA  LA 
Sbjct  176  GARLVLPVLVFHTMAFTLGYWAS-----KIPIVRQEEEASRTISLCTGMQSSTLAGLLAT  230

Query  261  KFFQDPLVGVPPAISVVIMSLMGFSLVMFWNKNK  160
            +F       VPPA SVV+M++MG  L  FW    
Sbjct  231  QFLGSTH-AVPPACSVVVMAIMGLCLASFWGSGS  263



>ref|XP_010036747.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
isoform X4 [Eucalyptus grandis]
Length=356

 Score =   168 bits (425),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 167/267 (63%), Gaps = 11/267 (4%)
 Frame = -1

Query  1164  SLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPA  985
             S  N     SE+ +   +  L      +A+LP VV  + I AL  P +FTW +   YAPA
Sbjct  94    SFGNKQHVISEVDRTDSSQVL------SAMLPFVVAATAIAALAQPATFTWVSRELYAPA  147

Query  984   LGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLA  805
             LG +M ++G+  S  DF  AF RP  +  G+I Q+V+KP+LG L       AFG+     
Sbjct  148   LGGIMLSIGIRLSIDDFALAFKRPLPLSIGFIAQYVLKPVLGVLVAQ----AFGISHMFY  203

Query  804   AGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVD  625
             AG +LT+CV+GAQLS+YA+FL+   +A LSI++TS +T  + LVTP L+ LLIG  +PVD
Sbjct  204   AGFVLTACVAGAQLSSYASFLSKGDVA-LSILLTSCTTIASVLVTPILTGLLIGSVVPVD  262

Query  624   VIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsv  445
              + M  +I+Q+V+VP+  GLLLN +   V + ++P +P +++  TSLC+G+PLAIN   +
Sbjct  263   AVAMSKSILQVVLVPITFGLLLNTYAKPVVSILQPVMPLVAMVCTSLCIGSPLAINQSQI  322

Query  444   vspsglsvlllVIAFHLSAFISGYTLA  364
             +S  GL ++L V+ FH  AF  GY ++
Sbjct  323   LSREGLRLVLPVLTFHAVAFTLGYWIS  349



>ref|XP_010036743.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
isoform X2 [Eucalyptus grandis]
Length=363

 Score =   168 bits (425),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 167/267 (63%), Gaps = 11/267 (4%)
 Frame = -1

Query  1164  SLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPA  985
             S  N     SE+ +   +  L      +A+LP VV  + I AL  P +FTW +   YAPA
Sbjct  94    SFGNKQHVISEVDRTDSSQVL------SAMLPFVVAATAIAALAQPATFTWVSRELYAPA  147

Query  984   LGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLA  805
             LG +M ++G+  S  DF  AF RP  +  G+I Q+V+KP+LG L       AFG+     
Sbjct  148   LGGIMLSIGIRLSIDDFALAFKRPLPLSIGFIAQYVLKPVLGVLVAQ----AFGISHMFY  203

Query  804   AGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVD  625
             AG +LT+CV+GAQLS+YA+FL+   +A LSI++TS +T  + LVTP L+ LLIG  +PVD
Sbjct  204   AGFVLTACVAGAQLSSYASFLSKGDVA-LSILLTSCTTIASVLVTPILTGLLIGSVVPVD  262

Query  624   VIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsv  445
              + M  +I+Q+V+VP+  GLLLN +   V + ++P +P +++  TSLC+G+PLAIN   +
Sbjct  263   AVAMSKSILQVVLVPITFGLLLNTYAKPVVSILQPVMPLVAMVCTSLCIGSPLAINQSQI  322

Query  444   vspsglsvlllVIAFHLSAFISGYTLA  364
             +S  GL ++L V+ FH  AF  GY ++
Sbjct  323   LSREGLRLVLPVLTFHAVAFTLGYWIS  349



>ref|XP_010036746.1| PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic 
isoform X3 [Eucalyptus grandis]
Length=361

 Score =   168 bits (425),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 167/267 (63%), Gaps = 11/267 (4%)
 Frame = -1

Query  1164  SLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPA  985
             S  N     SE+ +   +  L      +A+LP VV  + I AL  P +FTW +   YAPA
Sbjct  94    SFGNKQHVISEVDRTDSSQVL------SAMLPFVVAATAIAALAQPATFTWVSRELYAPA  147

Query  984   LGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLA  805
             LG +M ++G+  S  DF  AF RP  +  G+I Q+V+KP+LG L       AFG+     
Sbjct  148   LGGIMLSIGIRLSIDDFALAFKRPLPLSIGFIAQYVLKPVLGVLVAQ----AFGISHMFY  203

Query  804   AGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVD  625
             AG +LT+CV+GAQLS+YA+FL+   +A LSI++TS +T  + LVTP L+ LLIG  +PVD
Sbjct  204   AGFVLTACVAGAQLSSYASFLSKGDVA-LSILLTSCTTIASVLVTPILTGLLIGSVVPVD  262

Query  624   VIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsv  445
              + M  +I+Q+V+VP+  GLLLN +   V + ++P +P +++  TSLC+G+PLAIN   +
Sbjct  263   AVAMSKSILQVVLVPITFGLLLNTYAKPVVSILQPVMPLVAMVCTSLCIGSPLAINQSQI  322

Query  444   vspsglsvlllVIAFHLSAFISGYTLA  364
             +S  GL ++L V+ FH  AF  GY ++
Sbjct  323   LSREGLRLVLPVLTFHAVAFTLGYWIS  349



>gb|KCW48383.1| hypothetical protein EUGRSUZ_K02087 [Eucalyptus grandis]
Length=402

 Score =   168 bits (425),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 108/240 (45%), Positives = 159/240 (66%), Gaps = 5/240 (2%)
 Frame = -1

Query  1083  NAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAI  904
             +A+LP VV  + I AL  P +FTW +   YAPALG +M ++G+  S  DF  AF RP  +
Sbjct  161   SAMLPFVVAATAIAALAQPATFTWVSRELYAPALGGIMLSIGIRLSIDDFALAFKRPLPL  220

Query  903   LAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMA  724
               G+I Q+V+KP+LG L       AFG+     AG +LT+CV+GAQLS+YA+FL+   +A
Sbjct  221   SIGFIAQYVLKPVLGVLVAQ----AFGISHMFYAGFVLTACVAGAQLSSYASFLSKGDVA  276

Query  723   PLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFP  544
              LSI++TS +T  + LVTP L+ LLIG  +PVD + M  +I+Q+V+VP+  GLLLN +  
Sbjct  277   -LSILLTSCTTIASVLVTPILTGLLIGSVVPVDAVAMSKSILQVVLVPITFGLLLNTYAK  335

Query  543   QVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLA  364
              V + ++P +P +++  TSLC+G+PLAIN   ++S  GL ++L V+ FH  AF  GY ++
Sbjct  336   PVVSILQPVMPLVAMVCTSLCIGSPLAINQSQILSREGLRLVLPVLTFHAVAFTLGYWIS  395



>gb|KCW48381.1| hypothetical protein EUGRSUZ_K02087 [Eucalyptus grandis]
 gb|KCW48382.1| hypothetical protein EUGRSUZ_K02087 [Eucalyptus grandis]
Length=407

 Score =   168 bits (425),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 167/267 (63%), Gaps = 11/267 (4%)
 Frame = -1

Query  1164  SLSNYAAESSEIFKPKENSFLTVLRGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPA  985
             S  N     SE+ +   +  L      +A+LP VV  + I AL  P +FTW +   YAPA
Sbjct  140   SFGNKQHVISEVDRTDSSQVL------SAMLPFVVAATAIAALAQPATFTWVSRELYAPA  193

Query  984   LGFLMFAVGVNSSEKDFLEAFNRPGAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLA  805
             LG +M ++G+  S  DF  AF RP  +  G+I Q+V+KP+LG L       AFG+     
Sbjct  194   LGGIMLSIGIRLSIDDFALAFKRPLPLSIGFIAQYVLKPVLGVLVAQ----AFGISHMFY  249

Query  804   AGIMLTSCVSGAQLSNYATFLTDPPMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVD  625
             AG +LT+CV+GAQLS+YA+FL+   +A LSI++TS +T  + LVTP L+ LLIG  +PVD
Sbjct  250   AGFVLTACVAGAQLSSYASFLSKGDVA-LSILLTSCTTIASVLVTPILTGLLIGSVVPVD  308

Query  624   VIGMISNIIQIVVVPVAAGLLLNRFFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsv  445
              + M  +I+Q+V+VP+  GLLLN +   V + ++P +P +++  TSLC+G+PLAIN   +
Sbjct  309   AVAMSKSILQVVLVPITFGLLLNTYAKPVVSILQPVMPLVAMVCTSLCIGSPLAINQSQI  368

Query  444   vspsglsvlllVIAFHLSAFISGYTLA  364
             +S  GL ++L V+ FH  AF  GY ++
Sbjct  369   LSREGLRLVLPVLTFHAVAFTLGYWIS  395



>ref|WP_032810125.1| MULTISPECIES: transporter [Leptospira]
Length=319

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 168/303 (55%), Gaps = 10/303 (3%)
 Frame = -1

Query  1071  PHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGY  892
             P  VL  +IL+  +P  FTWF+  +    LGF M  +G+    +DF + F  P  + AG 
Sbjct  23    PVWVLIGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLPQDFRDVFKTPIPVFAGV  82

Query  891   IGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSI  712
             + Q+ V PL G+  G +      LPT LA G+++ SC  G   SN  T+L    +A LS+
Sbjct  83    VLQYTVMPLSGWGIGIL----LNLPTPLATGLIVVSCCPGGVASNVITYLAKGDLA-LSV  137

Query  711   VMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCN  532
              MT+ ST  +  +TPFL+L LIGK +     G+ S+  Q+V++PVA G+L+N +FP V  
Sbjct  138   SMTASSTLLSVFMTPFLTLFLIGKGVEASAGGLFSDTFQVVILPVALGVLINVYFPWVSQ  197

Query  531   AIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAF  352
              I+   P ++VF+ ++ V + L    +  +  S   ++L V++ H S F  GY L+    
Sbjct  198   KIQAVSPLVAVFLITMIVSSILGAG-KERIISSAAILILSVVSLHASGFFFGYILSWFLI  256

Query  351   RDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFW  172
             R     +   RT+S E GMQ+S L + LA   F DPLV +P AIS ++ SL+G  L  FW
Sbjct  257   RK----QKTSRTISIEVGMQNSGLGVVLARNNFPDPLVAIPAAISSLVHSLIGSLLAAFW  312

Query  171   NKN  163
              ++
Sbjct  313   RRS  315



>ref|WP_026053809.1| transporter [Leptospira santarosai]
Length=319

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 168/303 (55%), Gaps = 10/303 (3%)
 Frame = -1

Query  1071  PHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGY  892
             P  VL  +IL+  +P  FTWF+  +    LGF M  +G+    +DF + F  P  + AG 
Sbjct  23    PVWVLTGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLPQDFRDVFKTPIPVFAGV  82

Query  891   IGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSI  712
             + Q+ V PL G+  G +      LPT LA G+++ SC  G   SN  T+L    +A LS+
Sbjct  83    VLQYTVMPLSGWGIGIL----LNLPTPLATGLIVVSCCPGGVASNVITYLAKGDLA-LSV  137

Query  711   VMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCN  532
              MT+ ST  +  +TPFL+L LIGK +     G+ S+  Q+V++PVA G+L+N +FP V  
Sbjct  138   SMTASSTLLSVFMTPFLTLFLIGKGVEASAGGLFSDTFQVVILPVALGVLINVYFPWVSQ  197

Query  531   AIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAF  352
              I+   P ++VF+ ++ V + L    +  +  S   ++L V++ H S F  GY L+    
Sbjct  198   KIQAVSPLVAVFLITMIVSSILGAG-KERIISSAAILILSVVSLHASGFFFGYILSWFLI  256

Query  351   RDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFW  172
             R     +   RT+S E GMQ+S L + L+   F DPLV +P AIS ++ SL+G  L  FW
Sbjct  257   RK----QKTSRTISIEVGMQNSGLGVVLSRNNFPDPLVAIPAAISSLVHSLIGSLLAAFW  312

Query  171   NKN  163
              ++
Sbjct  313   RRS  315



>ref|WP_032927139.1| transporter [Leptospira santarosai]
Length=319

 Score =   164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 167/303 (55%), Gaps = 10/303 (3%)
 Frame = -1

Query  1071  PHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGY  892
             P  VL  +IL+  +P  FTWF+  +    LGF M  +G+    +DF + F  P  + AG 
Sbjct  23    PVWVLTGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLPQDFRDVFKTPIPVFAGV  82

Query  891   IGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSI  712
             + Q+ V PL G+  G +      LPT LA G+++ SC  G   SN  T+L    +A LS+
Sbjct  83    VLQYTVMPLSGWGIGIL----LNLPTPLATGLIVVSCCPGGVASNVITYLAKGDLA-LSV  137

Query  711   VMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCN  532
              MT+ ST  +  +TPFL+L LIGK +     G+ S+  Q+V++P A G+L+N +FP V  
Sbjct  138   SMTASSTLLSVFMTPFLTLFLIGKGVEASAGGLFSDTFQVVILPAALGVLINVYFPWVSQ  197

Query  531   AIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAF  352
              I+   P ++VF+ ++ V + L    +  +  S   ++L V++ H S F  GY L+    
Sbjct  198   KIQAVSPLVAVFLITMIVSSILGAG-KERIISSAAILILSVVSLHASGFFFGYILSWFLI  256

Query  351   RDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFW  172
             R     +   RT+S E GMQ+S L + LA   F DPLV +P AIS ++ SL+G  L  FW
Sbjct  257   RK----QKTSRTISIEVGMQNSGLGVVLARNNFPDPLVAIPAAISSLVHSLIGSLLAAFW  312

Query  171   NKN  163
              ++
Sbjct  313   RRS  315



>ref|WP_032920941.1| transporter [Leptospira santarosai]
Length=319

 Score =   164 bits (414),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 167/303 (55%), Gaps = 10/303 (3%)
 Frame = -1

Query  1071  PHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGY  892
             P  VL  +IL+  +P  FTWF+  +    LGF M  +G+    +DF + F  P  + AG 
Sbjct  23    PVWVLTGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLPQDFRDVFKTPIPVFAGV  82

Query  891   IGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSI  712
             + Q+ V PL G+  G +      LPT LA G+++ SC  G   SN  T+L    +A LS+
Sbjct  83    VLQYTVMPLSGWGIGIL----LNLPTPLATGLIVVSCCPGGVASNVITYLAKGDLA-LSV  137

Query  711   VMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCN  532
              MT+ ST  +  +TP L+L LIGK +     G+ S+  Q+V++PVA G+L+N +FP V  
Sbjct  138   SMTASSTLLSVFMTPLLTLFLIGKGVEASAGGLFSDTFQVVILPVALGVLINVYFPWVSQ  197

Query  531   AIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAF  352
              I+   P ++VF+ ++ V + L    +  +  S   ++L V++ H S F  GY L+    
Sbjct  198   KIQAVSPLVAVFLITMIVSSILGAG-KERIISSAAILILSVVSLHASGFFFGYILSWFLI  256

Query  351   RDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFW  172
             R     +   RT+S E GMQ+S L + LA   F DPLV +P AIS ++ SL+G  L  FW
Sbjct  257   RK----QKTSRTISIEVGMQNSGLGVVLARNNFPDPLVAIPAAISSLVHSLIGSLLAAFW  312

Query  171   NKN  163
              ++
Sbjct  313   RRS  315



>ref|WP_002732116.1| sodium Bile acid symporter family protein [Leptospira borgpetersenii]
 gb|EMN59707.1| sodium Bile acid symporter family protein [Leptospira borgpetersenii 
serovar Javanica str. MK146]
 gb|EMO10007.1| sodium Bile acid symporter family protein [Leptospira borgpetersenii 
str. Noumea 25]
 gb|KGE21355.1| transporter [Leptospira borgpetersenii serovar Ballum]
Length=313

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 169/305 (55%), Gaps = 10/305 (3%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  F WFT  +    LGF M  +G+    +DF   F  P  I+ 
Sbjct  15    LFPVWVLTGSILSFFFPEWFIWFTGIWITYGLGFTMLGMGITLLPQDFRNVFQTPIPIVL  74

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G   Q+ V PL G+  G I    FGL T LAAG+++ SC  G   SN  ++L    +A L
Sbjct  75    GVALQYTVMPLSGWGIGII----FGLSTPLAAGLIVVSCCPGGVASNVISYLAKGDIA-L  129

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+LLLIGK + V V  +  +  Q+V++P   G+LLN +FP++
Sbjct  130   SVSMTASSTILSVFMTPLLTLLLIGKGVEVSVSRLFLDTFQVVILPTVFGILLNFYFPKI  189

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++V + ++ V + L    +  +  S  +++  VI+ H+S F+ GY L+  
Sbjct  190   SKKIQTISPFVAVLLITMIVASILGAG-RDKILQSMGTLIAAVISLHVSGFLFGYFLSWL  248

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     + + RT+S E GMQ+S L + L+   FQDPLV +P AIS ++ SL+G  L  
Sbjct  249   FIRK----QKISRTISIEVGMQNSGLGVVLSRNNFQDPLVAIPAAISSLVHSLIGSLLAA  304

Query  177   FWNKN  163
             FW K 
Sbjct  305   FWRKR  309



>gb|EKQ93436.1| sodium Bile acid symporter family protein [Leptospira borgpetersenii 
str. UI 09149]
 gb|EKR01081.1| sodium Bile acid symporter family protein [Leptospira borgpetersenii 
serovar Castellonis str. 200801910]
Length=314

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 169/305 (55%), Gaps = 10/305 (3%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  F WFT  +    LGF M  +G+    +DF   F  P  I+ 
Sbjct  16    LFPVWVLTGSILSFFFPEWFIWFTGIWITYGLGFTMLGMGITLLPQDFRNVFQTPIPIVL  75

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G   Q+ V PL G+  G I    FGL T LAAG+++ SC  G   SN  ++L    +A L
Sbjct  76    GVALQYTVMPLSGWGIGII----FGLSTPLAAGLIVVSCCPGGVASNVISYLAKGDIA-L  130

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+LLLIGK + V V  +  +  Q+V++P   G+LLN +FP++
Sbjct  131   SVSMTASSTILSVFMTPLLTLLLIGKGVEVSVSRLFLDTFQVVILPTVFGILLNFYFPKI  190

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++V + ++ V + L    +  +  S  +++  VI+ H+S F+ GY L+  
Sbjct  191   SKKIQTISPFVAVLLITMIVASILGAG-RDKILQSMGTLIAAVISLHVSGFLFGYFLSWL  249

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     + + RT+S E GMQ+S L + L+   FQDPLV +P AIS ++ SL+G  L  
Sbjct  250   FIRK----QKISRTISIEVGMQNSGLGVVLSRNNFQDPLVAIPAAISSLVHSLIGSLLAA  305

Query  177   FWNKN  163
             FW K 
Sbjct  306   FWRKR  310



>ref|WP_026053546.1| transporter [Leptospira santarosai]
Length=319

 Score =   163 bits (413),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 167/303 (55%), Gaps = 10/303 (3%)
 Frame = -1

Query  1071  PHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGY  892
             P  VL  +IL+  +P  FTWF+  +    LGF M  +G+    +DF + F  P  + AG 
Sbjct  23    PVWVLTGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLPQDFRDVFKTPIPVFAGV  82

Query  891   IGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSI  712
             + Q+ V PL G+  G +      LPT LA G+++ SC  G   SN  T+L    +A LS+
Sbjct  83    VLQYTVMPLSGWGIGIL----LNLPTPLATGLIVVSCCPGGVASNVITYLAKGDLA-LSV  137

Query  711   VMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCN  532
              MT+ ST  +  +TPFL+L LIGK +     G+  +  Q+V++PVA G+L+N +FP V  
Sbjct  138   SMTASSTLLSVFMTPFLTLFLIGKGVEASAGGLFLDTFQVVILPVALGVLINVYFPWVSQ  197

Query  531   AIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAF  352
              I+   P ++VF+ ++ V + L    +  +  S   ++L V++ H S F  GY L+    
Sbjct  198   KIQAVSPLVAVFLITMIVSSILGAG-KERIISSAAILILSVVSLHASGFFFGYILSWFLI  256

Query  351   RDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFW  172
             R     +   RT+S E GMQ+S L + LA   F DPLV +P AIS ++ SL+G  L  FW
Sbjct  257   RK----QKTSRTISIEVGMQNSGLGVVLARNNFPDPLVAIPAAISSLVHSLIGSLLAAFW  312

Query  171   NKN  163
              ++
Sbjct  313   RRS  315



>ref|WP_032919300.1| transporter [Leptospira santarosai]
Length=319

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 167/303 (55%), Gaps = 10/303 (3%)
 Frame = -1

Query  1071  PHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGY  892
             P  VL  +IL+  +P  FTWF+  +    LGF M  +G+    +DF + F  P  + AG 
Sbjct  23    PVWVLIGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLPQDFRDVFKTPIPVFAGV  82

Query  891   IGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSI  712
             + Q+ V PL G+  G +      LPT LA G+++ SC  G   SN  T+L    +A LS+
Sbjct  83    VLQYTVMPLSGWGIGIL----LNLPTPLATGLIVVSCCPGGVASNVITYLAKGDLA-LSV  137

Query  711   VMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCN  532
              MT+ ST  +  +TP L+L LIGK +     G+ S+  Q+V++PVA G+L+N +FP V  
Sbjct  138   SMTASSTLLSVFMTPLLTLFLIGKGVEASAGGLFSDTFQVVILPVALGVLINVYFPWVSQ  197

Query  531   AIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAF  352
              I+   P ++VF+ ++ V + L    +  +  S   ++L V++ H S F  GY L+    
Sbjct  198   KIQAVSPLVAVFLITMIVSSILGAG-KERIISSAAILILSVVSLHASGFFFGYILSWFLI  256

Query  351   RDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFW  172
             R     +   RT+S E GMQ+S L + LA   F DPLV +P AIS ++ SL+G  L  FW
Sbjct  257   RK----QKTSRTISIEVGMQNSGLGVVLARNNFPDPLVAIPAAISSLVHSLIGSLLAAFW  312

Query  171   NKN  163
              ++
Sbjct  313   RRS  315



>ref|WP_002765848.1| MULTISPECIES: sodium Bile acid symporter family protein [Leptospira]
 gb|EMG01110.1| sodium Bile acid symporter family protein [Leptospira borgpetersenii 
str. 200701203]
Length=313

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 167/305 (55%), Gaps = 10/305 (3%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  F WFT  +    LGF M  +G+    +DF   F  P  I+ 
Sbjct  15    LFPVWVLTGSILSFFFPEWFIWFTGIWITYGLGFTMLGMGITLLPQDFRNVFQTPIPIVL  74

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G   Q+ V PL G+  G I    FGL T LAAG+++ SC  G   SN  ++L    +A L
Sbjct  75    GVALQYTVMPLSGWGIGII----FGLSTPLAAGLIVVSCCPGGVASNVISYLAKGDIA-L  129

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+LLLIGK + V V  +  +  Q+V++P   G+LLN +FP++
Sbjct  130   SVSMTASSTILSVFMTPLLTLLLIGKGVEVSVSRLFLDTFQVVILPTVFGILLNFYFPKI  189

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++V + ++ V + L    +  +  S   ++  VI+ H+S F+ GY L+  
Sbjct  190   SKKIQTISPFVAVLLITMIVASILGAG-RDKILQSMGILIAAVISLHVSGFLFGYFLSWL  248

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     +   RT+S E GMQ+S L + L+   FQDPLV +P AIS ++ SL+G  L  
Sbjct  249   FIRK----QKTSRTISIEVGMQNSGLGVVLSRNNFQDPLVAIPAAISSLVHSLIGSLLAA  304

Query  177   FWNKN  163
             FW K 
Sbjct  305   FWRKR  309



>gb|EMK13775.1| sodium Bile acid symporter family protein [Leptospira sp. serovar 
Kenya str. Sh9]
Length=314

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 167/305 (55%), Gaps = 10/305 (3%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  F WFT  +    LGF M  +G+    +DF   F  P  I+ 
Sbjct  16    LFPVWVLTGSILSFFFPEWFIWFTGIWITYGLGFTMLGMGITLLPQDFRNVFQTPIPIVL  75

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G   Q+ V PL G+  G I    FGL T LAAG+++ SC  G   SN  ++L    +A L
Sbjct  76    GVALQYTVMPLSGWGIGII----FGLSTPLAAGLIVVSCCPGGVASNVISYLAKGDIA-L  130

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+LLLIGK + V V  +  +  Q+V++P   G+LLN +FP++
Sbjct  131   SVSMTASSTILSVFMTPLLTLLLIGKGVEVSVSRLFLDTFQVVILPTVFGILLNFYFPKI  190

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++V + ++ V + L    +  +  S   ++  VI+ H+S F+ GY L+  
Sbjct  191   SKKIQTISPFVAVLLITMIVASILGAG-RDKILQSMGILIAAVISLHVSGFLFGYFLSWL  249

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     +   RT+S E GMQ+S L + L+   FQDPLV +P AIS ++ SL+G  L  
Sbjct  250   FIRK----QKTSRTISIEVGMQNSGLGVVLSRNNFQDPLVAIPAAISSLVHSLIGSLLAA  305

Query  177   FWNKN  163
             FW K 
Sbjct  306   FWRKR  310



>ref|WP_026131306.1| transporter [Leptospira santarosai]
Length=319

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/303 (36%), Positives = 167/303 (55%), Gaps = 10/303 (3%)
 Frame = -1

Query  1071  PHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILAGY  892
             P  VL  +IL+  +P  FTWF+  +    LGF M  +G+    +DF + F  P  + AG 
Sbjct  23    PVWVLIGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLPQDFRDVFKTPIPVFAGV  82

Query  891   IGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPLSI  712
             + Q+ V PL G+  G +      LPT LA G+++ SC  G   SN  T+L    +A LS+
Sbjct  83    VLQYTVMPLSGWGIGIL----LNLPTPLATGLIVVSCCPGGVASNVITYLAKGDLA-LSV  137

Query  711   VMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQVCN  532
              MT+ ST  +  +TPFL+L LIGK +     G+  +  Q+V++PVA G+L+N +FP V  
Sbjct  138   SMTASSTLLSVFMTPFLTLFLIGKGVEASAGGLFLDTFQVVILPVALGVLINVYFPWVSQ  197

Query  531   AIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGAAF  352
              I+   P ++VF+ ++ V + L    +  +  S   ++L V++ H S F  GY L+    
Sbjct  198   KIQAVSPLVAVFLITMIVSSILGAG-KERIISSAAILILSVVSLHASGFFFGYILSWFLI  256

Query  351   RDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVMFW  172
             R     +   RT+S E GMQ+S L + LA   F DPLV +P AIS ++ SL+G  L  FW
Sbjct  257   RK----QKTSRTISIEVGMQNSGLGVVLARNNFPDPLVAIPAAISSLVHSLIGSLLAAFW  312

Query  171   NKN  163
              ++
Sbjct  313   RRS  315



>gb|EKP11734.1| sodium Bile acid symporter family protein [Leptospira borgpetersenii 
str. 200801926]
 gb|ENO62841.1| sodium Bile acid symporter family protein [Leptospira borgpetersenii 
serovar Mini str. 201000851]
Length=329

 Score =   162 bits (411),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 167/305 (55%), Gaps = 10/305 (3%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  F WFT  +    LGF M  +G+    +DF   F  P  I+ 
Sbjct  31    LFPVWVLTGSILSFFFPEWFIWFTGIWITYGLGFTMLGMGITLLPQDFRNVFQTPIPIVL  90

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G   Q+ V PL G+  G I    FGL T LAAG+++ SC  G   SN  ++L    +A L
Sbjct  91    GVALQYTVMPLSGWGIGII----FGLSTPLAAGLIVVSCCPGGVASNVISYLAKGDIA-L  145

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+LLLIGK + V V  +  +  Q+V++P   G+LLN +FP++
Sbjct  146   SVSMTASSTILSVFMTPLLTLLLIGKGVEVSVSRLFLDTFQVVILPTVFGILLNFYFPKI  205

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++V + ++ V + L    +  +  S   ++  VI+ H+S F+ GY L+  
Sbjct  206   SKKIQTISPFVAVLLITMIVASILGAG-RDKILQSMGILIAAVISLHVSGFLFGYFLSWL  264

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     +   RT+S E GMQ+S L + L+   FQDPLV +P AIS ++ SL+G  L  
Sbjct  265   FIRK----QKTSRTISIEVGMQNSGLGVVLSRNNFQDPLVAIPAAISSLVHSLIGSLLAA  320

Query  177   FWNKN  163
             FW K 
Sbjct  321   FWRKR  325



>ref|WP_002749670.1| sodium Bile acid symporter family protein [Leptospira borgpetersenii]
 gb|EKS00027.1| sodium Bile acid symporter family protein [Leptospira borgpetersenii 
str. 200901122]
 gb|EMO47826.1| sodium Bile acid symporter family protein [Leptospira borgpetersenii 
serovar Mini str. 200901116]
Length=314

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 107/305 (35%), Positives = 166/305 (54%), Gaps = 10/305 (3%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  F WFT  +    LGF M  +G+    +DF   F  P  +  
Sbjct  16    LFPIWVLTGSILSFFFPEWFIWFTGIWITYGLGFTMLGMGITLLPQDFRNVFQTPIPVFL  75

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G I Q+ V PL G+  G +    F LPT LA G+++ SC  G   SN  ++L    +A L
Sbjct  76    GVILQYTVMPLSGWGIGIL----FDLPTPLATGLIVVSCCPGGVASNVISYLAKGDLA-L  130

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+L+LIGK +   V G+  +  Q+V++P   G+LLN + P++
Sbjct  131   SVSMTASSTILSVFMTPLLTLILIGKGVEASVSGLFLDTFQVVILPTVLGILLNFYLPKI  190

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++V + ++ V + L    +  +  S  +++  VI+ H+S F+ GY L+  
Sbjct  191   SKKIQAISPFIAVLLITMIVASILGAG-RDKIIRSAGTLIAAVISLHISGFLFGYFLSWL  249

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     +   RT+S E GMQ+S L + L+   FQDPLV +P AIS ++ SL+G  L  
Sbjct  250   FIRK----QKTSRTISIEVGMQNSGLGVVLSRNNFQDPLVAIPAAISSLVHSLIGSLLAA  305

Query  177   FWNKN  163
             FW K 
Sbjct  306   FWRKR  310



>ref|WP_010579217.1| transporter [Leptospira alexanderi]
 gb|EQA61866.1| sodium Bile acid symporter family protein [Leptospira alexanderi 
serovar Manhao 3 str. L 60]
Length=314

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 107/305 (35%), Positives = 165/305 (54%), Gaps = 10/305 (3%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  FTWFT  +    LGF M  +G+    +DF   F  P  +  
Sbjct  16    LFPIWVLTGSILSFFFPEWFTWFTGIWITYGLGFTMLGMGITLLPQDFRNVFQTPIPVFL  75

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G I Q+ V PL G+  G +    F LP  LA G+++ SC  G   SN  ++L    +A L
Sbjct  76    GVILQYTVMPLSGWGIGIL----FDLPAPLATGLIVVSCCPGGVASNVISYLAKGDLA-L  130

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+LLLIGK +   V G+  +  Q+V++P   G+LLN + P++
Sbjct  131   SVSMTASSTILSVFMTPLLTLLLIGKGVEASVSGLFLDTFQVVILPTVLGILLNFYLPKI  190

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++V + ++ V + L    +  +  S   ++  V++ H+S F+ GY L+  
Sbjct  191   SKKIQTVSPFVAVLLITMIVASILGAG-RDKILRSAEILIAAVVSLHVSGFLFGYFLSWL  249

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     +   RT+S E GMQ+S L + L+   FQDPLV +P AIS ++ SL+G  L  
Sbjct  250   FIRK----QKTSRTISIEVGMQNSGLGVVLSRNNFQDPLVAIPAAISSLVHSLIGSLLAA  305

Query  177   FWNKN  163
             FW K 
Sbjct  306   FWRKR  310



>ref|XP_010541879.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X4 [Tarenaya hassleriana]
Length=409

 Score =   163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 112/370 (30%), Positives = 192/370 (52%), Gaps = 13/370 (4%)
 Frame = -1

Query  1266  LSLPRKSFNSSARSSRLPVSRCVSENLSDSIRPESLSNYAAE--SSEIFKPKENSFLTVL  1093
             L   + S   S +SS   V+   +  ++ S R   ++   A   S +      N++  ++
Sbjct  38    LDFGKGSAIQSKKSSNSMVALASASTVTHSSRTTRIACKGATDVSGDSSPSGTNTYQKII  97

Query  1092  RGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRP  913
                  + P  V+  T++ +  P + TWF +      + FLM ++G+  + KDF      P
Sbjct  98    ELLTTLFPVWVILGTVIGINKPAAVTWFKADLSTLGMKFLMLSMGMTLTFKDFGRCLRNP  157

Query  912   GAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDP  733
               ++ G++ Q+++KP+LG++  T    +  L   LA G++L SC  G + SN  T+++  
Sbjct  158   WTVVVGFLVQYLIKPMLGFVIAT----SLKLSRPLATGLILVSCCPGGRASNVVTYISKG  213

Query  732   PMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNR  553
              +A LS++MT+ S+  A ++TP L+      R+PVD  G+  +  Q+V+VP   G+L N 
Sbjct  214   NVA-LSVLMTTCSSIGAIVMTPLLTEFFFDMRIPVDAAGLALSTFQVVLVPTVLGVLSNE  272

Query  552   FFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGY  373
             FFP+  + I    P +SV +T+L   +P+   +  V+   G  +L  V   H  AF  GY
Sbjct  273   FFPKFTSKITTVTPLISVILTTLLWTSPIG-QVSEVLKTQGSQLLFSVALLHGMAFAVGY  331

Query  372   TLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMG  193
              ++  +F ++       RT+S E GMQ+S L   LA+K F+DPLV VP A+SV+ M+L G
Sbjct  332   GISKTSFGEST-----SRTISIECGMQNSSLGFFLAHKHFKDPLVAVPSAVSVICMALFG  386

Query  192   FSLVMFWNKN  163
              ++   W   
Sbjct  387   SAMAALWRNQ  396



>ref|WP_004764442.1| sodium Bile acid symporter family protein [Leptospira kirschneri]
 gb|EKO17085.1| sodium Bile acid symporter family protein [Leptospira kirschneri 
str. H1]
 gb|EKO60039.1| sodium Bile acid symporter family protein [Leptospira kirschneri 
str. H2]
Length=316

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 108/310 (35%), Positives = 167/310 (54%), Gaps = 10/310 (3%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  FTWFT       LGF M  +G+    KDF   F  P  +  
Sbjct  15    LFPAWVLIGSILSFFFPEWFTWFTGPAITYGLGFTMLGMGITLLPKDFRNIFKTPIPVFI  74

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G + Q+ V P+ G+  G +      LPT LA G+++ SC  G   SN  T+L    +A L
Sbjct  75    GVVLQYTVMPVSGWGIGVL----LDLPTPLATGLVVVSCCPGGVASNVITYLAKGDLA-L  129

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+L LIG+ + V   G+  +  QIV++PV  G+LLN + P+V
Sbjct  130   SVSMTASSTILSVFMTPLLTLFLIGQGIDVSPSGLFLDTFQIVILPVVLGILLNVYLPEV  189

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++VF+ ++ V + L    +  +  S   ++  V++ H+S F SGY ++  
Sbjct  190   SKKIQTVSPLIAVFLITMIVSSILGAG-KEKILQSAGILIFAVLSLHISGFFSGYIISWL  248

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     + + RT+S E GMQ+S L + L+   F DPLV +P AIS ++ SL+G  L  
Sbjct  249   FIRK----QKISRTISIEVGMQNSGLGVVLSKNNFSDPLVAIPAAISSLVHSLIGSLLAA  304

Query  177   FWNKNKSTNV  148
             FW K +   +
Sbjct  305   FWRKLEKETI  314



>ref|WP_004495214.1| MULTISPECIES: transporter [Leptospira]
 gb|EKR62219.1| sodium Bile acid symporter family protein [Leptospira weilii 
str. 2006001853]
 gb|EMJ63412.1| sodium Bile acid symporter family protein [Leptospira sp. P2653]
 gb|EMM74478.1| sodium Bile acid symporter family protein [Leptospira weilii 
str. 2006001855]
 gb|EMN44584.1| sodium Bile acid symporter family protein [Leptospira weilii 
str. LNT 1234]
 gb|EMN92190.1| sodium Bile acid symporter family protein [Leptospira weilii 
str. UI 13098]
Length=313

 Score =   160 bits (404),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 106/305 (35%), Positives = 164/305 (54%), Gaps = 10/305 (3%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  ++L+  +P  FTWF   +    LGF M  +G+    +DF   F  P  +  
Sbjct  15    LFPIWVLTGSVLSFFFPEWFTWFAGIWITYGLGFTMLGMGITLLPQDFRNVFQTPIPVFL  74

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G I Q+ V PL G+  G +    FGLPT  A G+++ SC  G   SN  ++L    +A L
Sbjct  75    GVILQYTVMPLSGWGIGIL----FGLPTPFATGLIVVSCCPGGVASNVISYLAKGDLA-L  129

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+LLLIG+ +   V G+  +  Q+V++P   G+LLN + P++
Sbjct  130   SVSMTASSTILSVFMTPLLTLLLIGRGVEASVSGLFLDTFQVVILPTVLGILLNFYLPKI  189

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P  +V + ++ V + L    +  +  S   ++  VI+ H+S F+ GY L+  
Sbjct  190   SEKIQTVSPFAAVLLITMIVASILGAG-RDKILRSAEILIAAVISLHVSGFLFGYFLSWL  248

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     +   RT+S E GMQ+S L + L+   FQDPLV +P AIS ++ SL+G  L  
Sbjct  249   FIRK----QKTSRTISIEVGMQNSGLGVVLSRNNFQDPLVAIPAAISSLVHSLIGSLLAA  304

Query  177   FWNKN  163
             FW K 
Sbjct  305   FWRKR  309



>ref|WP_004780689.1| sodium Bile acid symporter family protein [Leptospira kirschneri]
 gb|EKP07012.1| sodium Bile acid symporter family protein [Leptospira kirschneri 
str. 2008720114]
Length=316

 Score =   160 bits (405),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 108/310 (35%), Positives = 167/310 (54%), Gaps = 10/310 (3%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  FTWFT       LGF M  +G+    KDF   F  P  +  
Sbjct  15    LFPAWVLIGSILSFFFPEWFTWFTGPAITYGLGFTMLGMGITLLPKDFRNIFKTPIPVFI  74

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G + Q+ V P+ G+  G +      LP  LA G+++ SC  G   SN  T+L    +A L
Sbjct  75    GVVLQYTVMPVSGWGIGVL----LDLPMPLATGLVVVSCCPGGVASNVITYLAKGDLA-L  129

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+L LIG+ + V   G+  +  QIV++PV  G+LLN +FP+V
Sbjct  130   SVSMTASSTILSVFMTPLLTLFLIGQGIDVSPSGLFLDTFQIVILPVVLGILLNVYFPEV  189

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++VF+ ++ V + L    +  +  S   ++  V++ H+S F SGY ++  
Sbjct  190   SKKIQTVSPLVAVFLITMIVSSILGAG-KEKILQSAGILIFAVLSLHISGFFSGYIISWL  248

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     + + RT+S E GMQ+S L + L+   F DPLV +P AIS ++ SL+G  L  
Sbjct  249   FIRK----QKISRTISIEIGMQNSGLGVVLSKNNFSDPLVAIPAAISSLVHSLIGSLLAA  304

Query  177   FWNKNKSTNV  148
             FW K +   +
Sbjct  305   FWRKLEKETI  314



>ref|WP_004506848.1| sodium Bile acid symporter family protein [Leptospira weilii]
 gb|EMF81804.1| sodium Bile acid symporter family protein [Leptospira weilii 
serovar Topaz str. LT2116]
Length=313

 Score =   160 bits (404),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 106/305 (35%), Positives = 164/305 (54%), Gaps = 10/305 (3%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  + L+  +P  FTWF   +    LGF M  +G+    +DF   F  P  +  
Sbjct  15    LFPIWVLTGSALSFFFPECFTWFAGIWITYGLGFTMLGMGITLLPQDFRNVFQTPIPVFL  74

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G I Q+ V PL G+  G +    FGLPT  A G+++ SC  G   SN  ++L    +A L
Sbjct  75    GVILQYTVMPLSGWGIGIL----FGLPTPFATGLIVVSCCPGGVASNVISYLAKGDLA-L  129

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+LLLIG+ +   V G+  +  Q+V++P   G+LLN + P++
Sbjct  130   SVSMTASSTILSVFMTPLLTLLLIGRGVEASVSGLFLDTFQVVILPTVLGILLNFYLPKI  189

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++V + ++ V + L    +  +  S   ++  VI+ H+S F+ GY L+  
Sbjct  190   SEKIQTVSPFVAVLLITMIVASILGAG-RDKILRSAEILIAAVISLHVSGFLFGYFLSWL  248

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     +   RT+S E GMQ+S L + L+   FQDPLV +P AIS ++ SL+G  L  
Sbjct  249   FIRK----QKTSRTISIEVGMQNSGLGVVLSRNNFQDPLVAIPAAISSLVHSLIGSLLAA  304

Query  177   FWNKN  163
             FW K 
Sbjct  305   FWRKR  309



>ref|WP_020766540.1| sodium Bile acid symporter family protein [Leptospira santarosai]
 gb|EMK04960.1| sodium Bile acid symporter family protein [Leptospira santarosai 
str. CBC613]
Length=316

 Score =   160 bits (404),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 108/310 (35%), Positives = 166/310 (54%), Gaps = 10/310 (3%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  FTWFT       LGF M  +G+    KDF   F  P  +  
Sbjct  15    LFPAWVLIGSILSFFFPEWFTWFTGPAITYGLGFTMLGMGITLLPKDFRNIFKTPIPVFI  74

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G + Q+ V P+ G+  G +      LP  LA G+++ SC  G   SN  T+L    +A L
Sbjct  75    GVVLQYTVMPVSGWGIGVL----LDLPMPLATGLVVVSCCPGGVASNVITYLAKGDLA-L  129

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+L LIG+ + V   G+  +  QIV++PV  G+LLN +FP+V
Sbjct  130   SVSMTASSTILSVFMTPLLTLFLIGQGIDVSPSGLFLDTFQIVILPVVLGILLNVYFPEV  189

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++VF+ ++ V + L    +  +  S   ++  V+  H+S F SGY ++  
Sbjct  190   SKKIQTVSPLVAVFLITMIVSSILGAG-KEKILQSAGILIFAVLTLHISGFFSGYIISWL  248

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     + + RT+S E GMQ+S L + L+   F DPLV +P AIS ++ SL+G  L  
Sbjct  249   FIRK----QKISRTISIEVGMQNSGLGVVLSKNNFSDPLVAIPAAISSLVHSLIGSLLAA  304

Query  177   FWNKNKSTNV  148
             FW K +   +
Sbjct  305   FWRKLEKETI  314



>ref|XP_011012598.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Populus euphratica]
Length=420

 Score =   162 bits (411),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 124/370 (34%), Positives = 196/370 (53%), Gaps = 21/370 (6%)
 Frame = -1

Query  1272  PFLSLPRKSFNSSARSSRLPVSRCVSENLSDSIRPESLSNYAAESSEIFKPKENSFLTVL  1093
             P ++L   S +S   SSR P   C +   +    P+S ++      E           ++
Sbjct  60    PTVALTAPSPSSVIHSSRNPQVLCRAATNATGDVPDSSTHGGMSQYE----------RII  109

Query  1092  RGANAILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRP  913
                  + P  V+  TIL +  P + TW  +  +   LGFLM ++G+  + +DF      P
Sbjct  110   ETLTTLFPVWVVLGTILGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNP  169

Query  912   GAILAGYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDP  733
               +  G++ Q+++KPLLG++  T       L   LA G++L SC  G Q SN AT+++  
Sbjct  170   WTVGVGFLAQYLIKPLLGFVIAT----TLKLSAPLATGLILVSCCPGGQASNVATYISKG  225

Query  732   PMAPLSIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNR  553
              +A LS++MT+ ST  A ++TP L+ LL G+ +PVD +G+  +  Q+V+VP   G+L N 
Sbjct  226   NVA-LSVLMTTCSTIGAIIMTPLLTKLLAGQLVPVDAVGLAISTFQVVLVPTIVGVLSNE  284

Query  552   FFPQVCNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGY  373
             FFP   + I  F P + V +T+L   +P+   +  V+   G  +++ V   H++AF  GY
Sbjct  285   FFPAFTSKIVTFTPLVGVILTTLLCASPIG-QVSDVLKTQGGQLIMPVALLHVAAFALGY  343

Query  372   TLAGAAFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMG  193
              L+  +F ++       RT+S E GMQSS L   LA K F +PLV VP A+SVV M+L G
Sbjct  344   WLSRMSFGESTS-----RTISIECGMQSSALGFLLAQKHFTNPLVAVPSAVSVVCMALGG  398

Query  192   FSLVMFWNKN  163
              +L +FW   
Sbjct  399   SALAVFWRNR  408



>ref|WP_000448527.1| Sodium-dependent transporter [Leptospira interrogans]
 gb|EKR85114.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. UI 08452]
 gb|EMN34079.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Medanensis str. L0448]
 gb|EMN37868.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. L0996]
 gb|EMN97148.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Medanensis str. UT053]
Length=316

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/311 (35%), Positives = 168/311 (54%), Gaps = 11/311 (4%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  FTWFT       LGF M  +G+    +DF   F  P ++  
Sbjct  15    LFPAWVLIGSILSFFFPQWFTWFTGPAITYGLGFTMLGMGITLLPRDFRNIFKTPISVFI  74

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G   Q+ V P+ G+  G +    F LP  LA G+++ SC  G   SN  T+L    +A L
Sbjct  75    GVALQYTVMPVSGWGIGVL----FDLPIPLATGLVVVSCCPGGVASNVITYLAKGDLA-L  129

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+L LIGK + V   G+  +  Q+V+ P+  G+LLN +FP+V
Sbjct  130   SVSMTASSTILSVFMTPLLTLFLIGKGIDVSTSGLFLDTFQVVIFPIVLGVLLNVYFPEV  189

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++VF+ ++ V + L    +  +  S   ++  V++ H+S F  GY ++  
Sbjct  190   SKKIQAVSPLVAVFLITMIVSSILGAG-KEKILQSAGILIFAVLSLHISGFFFGYVISWL  248

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     + + RT+S E GMQ+S L + L+   F DPLV +P AIS ++ SL+G  L +
Sbjct  249   FIRK----QKISRTISIEVGMQNSGLGVVLSRNNFPDPLVAIPAAISSLVHSLIGSLLAV  304

Query  177   FWNK-NKSTNV  148
             FW K  K T +
Sbjct  305   FWRKLEKETTI  315



>ref|WP_004448575.1| sodium Bile acid symporter family protein [Leptospira noguchii]
 gb|EMI72023.1| sodium Bile acid symporter family protein [Leptospira noguchii 
str. Bonito]
 gb|EMS86722.1| sodium Bile acid symporter family protein [Leptospira noguchii 
str. Cascata]
Length=314

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 107/306 (35%), Positives = 167/306 (55%), Gaps = 10/306 (3%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  FTWFT       LGF M  +G+    KDF   F  P  +  
Sbjct  15    LFPAWVLIGSILSFFFPQWFTWFTGSAITYGLGFTMLGMGITLLPKDFRNIFKTPIPVFI  74

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G   Q+ V P+ G+  G +      LPT LA G+++ SC  G   SN  T+L    +A L
Sbjct  75    GVTLQYTVMPVSGWGIGVL----LDLPTPLATGLVVVSCCPGGVASNVITYLARGDLA-L  129

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+L LIGK + V   G+  + +Q+V++PV  G+LLN + P+V
Sbjct  130   SVSMTASSTILSVFMTPLLTLFLIGKGINVSSSGLFLDTLQVVILPVVLGILLNFYLPEV  189

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++VF+ ++ V + L    +  +  S  +++  V++ H+S F  GY ++  
Sbjct  190   SKKIQTVSPLVAVFLITMIVSSILGAG-KEKILQSAGTLMFAVLSLHMSGFFFGYIISWL  248

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     + + RT+S E GMQ+S L + L+   F DPLV +P AIS ++ SL+G  L  
Sbjct  249   FIRK----QKISRTISIEVGMQNSGLGVVLSRNNFSDPLVAIPAAISSLVHSLIGSLLAA  304

Query  177   FWNKNK  160
             FW K++
Sbjct  305   FWRKSE  310



>ref|WP_000448520.1| transporter [Leptospira interrogans]
 gb|EJP03486.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Bulgarica str. Mallika]
 gb|EKO89659.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Grippotyphosa str. Andaman]
 gb|EKP83349.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Grippotyphosa str. 2006006986]
Length=316

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 108/311 (35%), Positives = 168/311 (54%), Gaps = 11/311 (4%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  FTWFT       LGF M  +G+    +DF   F  P  +  
Sbjct  15    LFPAWVLIGSILSFFFPQWFTWFTGPAITYGLGFTMLGMGITLLPRDFRNIFKTPIPVFI  74

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G   Q+ V P+ G+  G +    F LP  LA G+++ SC  G   SN  T+L    +A L
Sbjct  75    GVALQYTVMPVSGWGIGVL----FDLPIPLATGLVVVSCCPGGVASNVITYLAKGDLA-L  129

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+L LIGK + V   G+  +  Q+V++P+  G+LLN +FP+V
Sbjct  130   SVSMTASSTILSVFMTPLLTLFLIGKGIDVSTSGLFLDTFQVVILPIVLGVLLNVYFPEV  189

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++VF+ ++ V + L    +  +  S   ++  V++ H+S F  GY ++  
Sbjct  190   SKKIQAVSPLVAVFLITMIVSSILGAG-KEKILQSAGILIFAVLSLHISGFFFGYVISWL  248

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     + + RT+S E GMQ+S L + L+   F DPLV +P AIS ++ SL+G  L +
Sbjct  249   FIRK----QKISRTISIEVGMQNSGLGVVLSRNNFPDPLVAIPAAISSLVHSLIGSLLAV  304

Query  177   FWNK-NKSTNV  148
             FW K  K T +
Sbjct  305   FWRKLEKETTI  315



>gb|EPG56038.1| sodium Bile acid symporter family protein [Leptospira borgpetersenii 
serovar Javanica str. UI 09931]
Length=313

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 168/305 (55%), Gaps = 11/305 (4%)
 Frame = -1

Query  1077  ILPHVVLGSTILALVYPPSFTWFTSRYYAPALGFLMFAVGVNSSEKDFLEAFNRPGAILA  898
             + P  VL  +IL+  +P  F WFT  +    LGF M  +G+    +DF   F  P  I+ 
Sbjct  16    LFPVWVLTGSILSFFFPEWFIWFTGIWITYGLGFTMLGMGITLLPQDFRNVFQTPIPIVL  75

Query  897   GYIGQFVVKPLLGYLFGTIAIAAFGLPTSLAAGIMLTSCVSGAQLSNYATFLTDPPMAPL  718
             G   Q+ V PL G+  G I    FGL T LAAG+++ SC  G   SN  ++L    +A L
Sbjct  76    GVALQYTVMPLSGWGIGII----FGLSTPLAAGLIVVSCCPGGVASNVISYLAKGDIA-L  130

Query  717   SIVMtslstataaLVTPFLSLLLIGKRLPVDVIGMISNIIQIVVVPVAAGLLLNRFFPQV  538
             S+ MT+ ST  +  +TP L+LLLIGK + V V  +  +  Q+V++P   G+LLN +FP++
Sbjct  131   SVSMTASSTILSVFMTPLLTLLLIGKGVEVSVSRLFLDTFQVVILPTVFGILLNFYFPKI  190

Query  537   CNAIRPFLPPLSVFVTSLCVGAPLAINIQsvvspsglsvlllVIAFHLSAFISGYTLAGA  358
                I+   P ++V + ++ V + L    +  +  S  +++  VI+ H+S F+ GY L+  
Sbjct  191   SKKIQTISPFVAVLLITMIVASILGAG-RDKILQSMGTLIAAVISLHVSGFLFGYFLSWL  249

Query  357   AFRDAPDVKPLQRTLSYETGMQSSLLALALANKFFQDPLVGVPPAISVVIMSLMGFSLVM  178
               R     + + RT+S E GMQ+S  + +  N  FQDPLV +P AIS ++ SL+G  L  
Sbjct  250   FIRK----QKISRTISIEVGMQNSGWSCSFQNN-FQDPLVAIPAAISSLVHSLIGSLLAA  304

Query  177   FWNKN  163
             FW K 
Sbjct  305   FWRKR  309



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4472097506352