BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19292_g1_i1 len=1186 path=[1:0-42 44:43-198 200:199-244 246:245-378
@380@!:379-906 908:907-1185]

Length=1186
                                                                      Score     E

ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like           558   0.0      
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease                558   0.0      
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                557   0.0      
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                556   0.0      
ref|XP_003627323.1|  Cucumisin-like serine protease subtilisin-li...    556   0.0      
ref|XP_004510506.1|  PREDICTED: subtilisin-like protease-like iso...    556   0.0      
ref|XP_007024651.1|  Subtilase family protein                           553   0.0      
emb|CDP20511.1|  unnamed protein product                                553   0.0      
ref|XP_009788688.1|  PREDICTED: subtilisin-like protease                552   0.0      
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like           551   0.0      
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease                550   0.0      
gb|KDO64998.1|  hypothetical protein CISIN_1g045236mg                   543   0.0      
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease                549   0.0      Vitis vinifera
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                     546   0.0      
ref|XP_006369129.1|  subtilase family protein                           545   0.0      
ref|XP_010111996.1|  Subtilisin-like protease                           547   0.0      
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease                546   0.0      
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease                543   0.0      
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like           542   0.0      
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg                542   0.0      
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    541   0.0      
ref|XP_011035735.1|  PREDICTED: subtilisin-like protease                540   0.0      
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease                541   0.0      
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg             540   0.0      
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg             538   0.0      
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like           538   0.0      
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like           535   0.0      
ref|XP_011072593.1|  PREDICTED: subtilisin-like protease                535   0.0      
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease-like           535   0.0      
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease                533   4e-180   
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...    533   8e-180   
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease                531   2e-179   
emb|CAN75239.1|  hypothetical protein VITISV_014205                     530   4e-179   Vitis vinifera
ref|XP_010542387.1|  PREDICTED: subtilisin-like protease                530   9e-179   
emb|CAN75240.1|  hypothetical protein VITISV_014207                     522   1e-178   Vitis vinifera
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g             526   1e-177   
ref|XP_003570496.1|  PREDICTED: subtilisin-like protease                526   2e-177   
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g             526   3e-177   Populus trichocarpa [western balsam poplar]
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease                523   3e-176   
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease                518   1e-174   
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease                518   2e-174   
gb|ADW11233.1|  subtilisin-like protease 2                              519   3e-174   
ref|XP_004954115.1|  PREDICTED: subtilisin-like protease-like           518   3e-174   
gb|EPS74243.1|  subtilase family protein                                517   4e-174   
gb|KDP40686.1|  hypothetical protein JCGZ_24685                         517   4e-174   
dbj|BAH20348.1|  AT3G14067                                              510   1e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg             516   2e-173   
emb|CDY33251.1|  BnaC01g37240D                                          515   4e-173   
emb|CDY39093.1|  BnaA01g29630D                                          514   6e-173   
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease                514   1e-172   
ref|XP_002885009.1|  subtilase family protein                           513   2e-172   
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease                512   4e-172   
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                    511   1e-171   
dbj|BAJ87876.1|  predicted protein                                      511   2e-171   
dbj|BAJ93208.1|  predicted protein                                      510   3e-171   
dbj|BAE98521.1|  putative subtilisin-like serine proteinase             509   6e-171   Arabidopsis thaliana [mouse-ear cress]
gb|AFW73751.1|  putative subtilase family protein                       509   8e-171   
ref|NP_566473.2|  Subtilase family protein                              508   1e-170   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002454656.1|  hypothetical protein SORBIDRAFT_04g034980          508   2e-170   Sorghum bicolor [broomcorn]
gb|AGN03879.1|  senescence-associated subtilisin protease               506   1e-169   
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease                505   4e-169   
ref|NP_001048301.1|  Os02g0779200                                       504   6e-169   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010465286.1|  PREDICTED: subtilisin-like protease                504   1e-168   
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease                503   3e-168   
ref|XP_010917483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    503   3e-168   
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg             512   1e-165   
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease                487   3e-162   
gb|ACB87529.1|  subtilisin protease                                     480   3e-162   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008792869.1|  PREDICTED: subtilisin-like protease                486   6e-162   
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease                481   5e-160   
ref|XP_007047459.1|  Subtilase family protein                           478   5e-159   
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease                475   5e-158   
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                474   2e-157   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                474   3e-157   
ref|XP_003608462.1|  Subtilisin-like protease                           473   4e-157   
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease                472   1e-156   
ref|XP_002533167.1|  Xylem serine proteinase 1 precursor, putative      472   1e-156   Ricinus communis
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease                472   2e-156   
ref|XP_006841997.1|  hypothetical protein AMTR_s00144p00078130          471   2e-156   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                471   3e-156   
ref|XP_009404128.1|  PREDICTED: subtilisin-like protease                471   4e-156   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                471   4e-156   
gb|KDP32042.1|  hypothetical protein JCGZ_12503                         470   5e-156   
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease                470   1e-155   
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease                469   2e-155   
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290          469   3e-155   
ref|NP_569048.1|  subtilisin-like protease                              468   3e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                468   4e-155   
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             468   5e-155   
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like           468   5e-155   
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                   466   3e-154   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           466   3e-154   
ref|XP_004234656.1|  PREDICTED: subtilisin-like protease                466   3e-154   
ref|XP_002283279.2|  PREDICTED: subtilisin-like protease                466   4e-154   Vitis vinifera
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             465   4e-154   
ref|XP_006343203.1|  PREDICTED: subtilisin-like protease-like           466   5e-154   
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             465   5e-154   Musa acuminata [banana]
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                465   5e-154   
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                465   5e-154   
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg             465   9e-154   
ref|XP_004141887.1|  PREDICTED: subtilisin-like protease-like           464   1e-153   
ref|XP_004167070.1|  PREDICTED: subtilisin-like protease-like           464   1e-153   
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                464   2e-153   
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                464   2e-153   
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g             464   2e-153   
gb|AAM10321.1|  AT5g67360/K8K14_8                                       464   2e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006472275.1|  PREDICTED: subtilisin-like protease-like           464   2e-153   
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like           464   2e-153   
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease                463   3e-153   
ref|XP_006433609.1|  hypothetical protein CICLE_v10000363mg             464   3e-153   
emb|CDP02570.1|  unnamed protein product                                464   3e-153   
ref|XP_004509085.1|  PREDICTED: subtilisin-like protease-like           463   4e-153   
ref|XP_001757585.1|  predicted protein                                  462   5e-153   
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                462   6e-153   
ref|XP_010906269.1|  PREDICTED: subtilisin-like protease                462   7e-153   
ref|XP_002284101.1|  PREDICTED: subtilisin-like protease                462   1e-152   Vitis vinifera
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                461   2e-152   
ref|XP_010087293.1|  Subtilisin-like protease                           460   3e-152   
ref|XP_007155854.1|  hypothetical protein PHAVU_003G237300g             462   3e-152   
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease-like           461   3e-152   
tpg|DAA51518.1|  TPA: putative subtilase family protein                 460   6e-152   
ref|XP_010679580.1|  PREDICTED: subtilisin-like protease                460   9e-152   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             459   9e-152   
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease                459   1e-151   
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease                459   1e-151   
ref|NP_001151463.1|  LOC100285096 precursor                             459   2e-151   Zea mays [maize]
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    459   2e-151   
emb|CDY12840.1|  BnaC07g15930D                                          459   2e-151   
emb|CDY57437.1|  BnaAnng14520D                                          457   5e-151   
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease                457   5e-151   
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310          457   1e-150   Sorghum bicolor [broomcorn]
ref|XP_003550312.1|  PREDICTED: subtilisin-like protease-like           457   1e-150   
gb|KHN21060.1|  Subtilisin-like protease                                456   1e-150   
emb|CAA59963.1|  subtilisin-like protease                               456   1e-150   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003550022.1|  PREDICTED: subtilisin-like protease-like           456   1e-150   
ref|XP_003562295.2|  PREDICTED: subtilisin-like protease                456   2e-150   
gb|KDO81559.1|  hypothetical protein CISIN_1g0053341mg                  450   2e-150   
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             455   3e-150   
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like           456   4e-150   
ref|XP_010105478.1|  Subtilisin-like protease                           456   4e-150   
ref|XP_006579930.1|  PREDICTED: subtilisin-like protease-like iso...    455   5e-150   
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease                455   6e-150   
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                454   1e-149   
gb|ACN27710.1|  unknown                                                 452   1e-149   Zea mays [maize]
ref|XP_002982080.1|  hypothetical protein SELMODRAFT_233912             453   2e-149   
ref|XP_003559080.1|  PREDICTED: subtilisin-like protease                453   2e-149   
ref|XP_009803919.1|  PREDICTED: subtilisin-like protease                453   3e-149   
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             452   7e-149   
ref|NP_001051353.1|  Os03g0761500                                       452   1e-148   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA50265.1|  TPA: putative subtilase family protein                 452   1e-148   
ref|XP_009112378.1|  PREDICTED: subtilisin-like protease                447   2e-148   
ref|XP_003544482.1|  PREDICTED: subtilisin-like protease-like           451   3e-148   
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease                450   5e-148   
ref|XP_011028928.1|  PREDICTED: subtilisin-like protease                450   9e-148   
ref|NP_001234282.1|  SBT1 protein precursor                             449   9e-148   
ref|XP_006374838.1|  hypothetical protein POPTR_0014s01910g             450   9e-148   
dbj|BAJ99493.1|  predicted protein                                      449   1e-147   
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease                449   1e-147   
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                449   1e-147   
ref|XP_009615143.1|  PREDICTED: subtilisin-like protease                449   1e-147   
ref|XP_006362066.1|  PREDICTED: subtilisin-like protease-like           449   2e-147   
ref|XP_008679257.1|  PREDICTED: subtilisin-like protease                449   2e-147   
gb|AIX97848.1|  SBT1.5                                                  448   3e-147   
ref|XP_004954112.1|  PREDICTED: subtilisin-like protease-like           449   3e-147   
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like           448   3e-147   
gb|EMT11726.1|  Subtilisin-like protease                                448   4e-147   
gb|KHN45156.1|  Subtilisin-like protease                                446   4e-147   
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative      448   4e-147   Ricinus communis
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1     447   5e-147   
ref|XP_003525925.1|  PREDICTED: subtilisin-like protease-like           447   9e-147   
ref|XP_001755716.1|  predicted protein                                  445   9e-147   
ref|XP_002994398.1|  hypothetical protein SELMODRAFT_236958             446   2e-146   
ref|XP_006828664.1|  hypothetical protein AMTR_s00129p00121180          447   2e-146   
gb|AES59354.2|  subtilisin-like serine protease                         444   3e-146   
gb|ABD33266.1|  Protease-associated PA; Proteinase inhibitor I9, ...    444   7e-146   Medicago truncatula
ref|XP_010693651.1|  PREDICTED: subtilisin-like protease                445   7e-146   
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg             444   7e-146   
dbj|BAJ91400.1|  predicted protein                                      445   8e-146   
gb|EPS65791.1|  hypothetical protein M569_08985                         443   1e-145   
emb|CAN62640.1|  hypothetical protein VITISV_010210                     437   1e-145   Vitis vinifera
ref|NP_565330.1|  Subtilase-like protein                                444   1e-145   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                    443   2e-145   
ref|NP_001151549.1|  subtilisin-like protease precursor                 443   2e-145   Zea mays [maize]
dbj|BAJ97136.1|  predicted protein                                      443   3e-145   
ref|XP_004954113.1|  PREDICTED: subtilisin-like protease-like           443   4e-145   
ref|XP_002301156.2|  hypothetical protein POPTR_0002s12130g             443   4e-145   Populus trichocarpa [western balsam poplar]
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease                442   4e-145   
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease                442   7e-145   
ref|XP_003589103.1|  Subtilisin-like protease                           444   8e-145   
emb|CDY52259.1|  BnaC05g52030D                                          441   9e-145   
ref|XP_002885806.1|  predicted protein                                  441   1e-144   
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease                441   1e-144   
ref|XP_009112375.1|  PREDICTED: subtilisin-like protease isoform X2     441   1e-144   
ref|XP_009112374.1|  PREDICTED: subtilisin-like protease isoform X1     440   2e-144   
gb|EYU25500.1|  hypothetical protein MIMGU_mgv1a001697mg                441   2e-144   
dbj|BAJ86110.1|  predicted protein                                      441   3e-144   
ref|XP_011017137.1|  PREDICTED: subtilisin-like protease                440   4e-144   
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg             439   5e-144   
gb|EYU37942.1|  hypothetical protein MIMGU_mgv1a001727mg                440   5e-144   
ref|XP_010090170.1|  Subtilisin-like protease                           439   5e-144   
gb|KDP41644.1|  hypothetical protein JCGZ_16051                         439   6e-144   
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease                439   6e-144   
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease                439   7e-144   
dbj|BAJ88205.1|  predicted protein                                      440   1e-143   
gb|ADD09584.1|  proteinase inhibitor                                    439   1e-143   Trifolium repens [creeping white clover]
ref|XP_009772256.1|  PREDICTED: subtilisin-like protease                440   1e-143   
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease                439   1e-143   
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease                439   1e-143   
ref|NP_001050634.1|  Os03g0605300                                       438   2e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007143339.1|  hypothetical protein PHAVU_007G064100g             439   2e-143   
ref|XP_003605881.1|  Subtilisin-like protease                           438   2e-143   
ref|XP_002452918.1|  hypothetical protein SORBIDRAFT_04g034950          439   2e-143   Sorghum bicolor [broomcorn]
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease                439   2e-143   
ref|XP_004243704.1|  PREDICTED: subtilisin-like protease                438   2e-143   
dbj|BAJ96698.1|  predicted protein                                      438   2e-143   
ref|XP_003536496.1|  PREDICTED: subtilisin-like protease-like           439   2e-143   
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease                438   3e-143   
gb|KHN31561.1|  Subtilisin-like protease                                434   3e-143   
ref|XP_010089708.1|  Subtilisin-like protease                           438   4e-143   
ref|XP_007038510.1|  Subtilase 1.3                                      437   5e-143   
ref|XP_010519206.1|  PREDICTED: subtilisin-like protease isoform X1     437   6e-143   
ref|XP_010047469.1|  PREDICTED: subtilisin-like protease                437   8e-143   
gb|EYU46755.1|  hypothetical protein MIMGU_mgv1a001548mg                437   1e-142   
gb|KHN15704.1|  Subtilisin-like protease                                436   1e-142   
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease                436   1e-142   
ref|XP_009590448.1|  PREDICTED: subtilisin-like protease                437   1e-142   
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g             436   2e-142   Populus trichocarpa [western balsam poplar]
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease                436   2e-142   
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           436   2e-142   
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease                436   2e-142   
gb|KHN10472.1|  Subtilisin-like protease                                434   2e-142   
ref|XP_007160895.1|  hypothetical protein PHAVU_001G026100g             436   2e-142   
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease                436   2e-142   
gb|ACN39811.1|  unknown                                                 433   3e-142   Picea sitchensis
ref|XP_006490276.1|  PREDICTED: subtilisin-like protease-like           435   4e-142   
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like           435   4e-142   
ref|XP_010261834.1|  PREDICTED: subtilisin-like protease                435   4e-142   
ref|XP_002886065.1|  predicted protein                                  434   5e-142   
ref|XP_011069783.1|  PREDICTED: subtilisin-like protease                434   6e-142   
ref|XP_011001975.1|  PREDICTED: subtilisin-like protease                434   6e-142   
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg            435   6e-142   
ref|XP_011001974.1|  PREDICTED: subtilisin-like protease                434   7e-142   
ref|XP_004142885.1|  PREDICTED: subtilisin-like protease-like iso...    430   7e-142   
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease                436   8e-142   
ref|XP_010686124.1|  PREDICTED: subtilisin-like protease                434   8e-142   
ref|XP_010111995.1|  Subtilisin-like protease                           433   8e-142   
ref|XP_002516266.1|  Xylem serine proteinase 1 precursor, putative      434   8e-142   Ricinus communis
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like           434   9e-142   
gb|EYU40429.1|  hypothetical protein MIMGU_mgv1a001733mg                434   1e-141   
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                     436   1e-141   
gb|KDP33922.1|  hypothetical protein JCGZ_07493                         434   1e-141   
ref|XP_007226995.1|  hypothetical protein PRUPE_ppa001756mg             434   1e-141   
ref|XP_006587373.1|  PREDICTED: subtilisin-like protease-like           434   1e-141   
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like           434   1e-141   
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease                434   2e-141   
ref|XP_003523496.1|  PREDICTED: subtilisin-like protease-like           434   2e-141   
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like           434   2e-141   
ref|XP_004501532.1|  PREDICTED: subtilisin-like protease-like           434   2e-141   
dbj|BAJ87780.1|  predicted protein                                      434   2e-141   
ref|XP_007136744.1|  hypothetical protein PHAVU_009G070500g             433   2e-141   
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050          434   2e-141   
ref|XP_007204263.1|  hypothetical protein PRUPE_ppa001798mg             433   2e-141   
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like           433   2e-141   
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease                433   2e-141   
gb|EPS59495.1|  hypothetical protein M569_15309                         432   3e-141   
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1     432   3e-141   
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease                432   3e-141   
ref|XP_003609994.1|  Subtilisin-like protease                           432   4e-141   
gb|AES92191.2|  subtilisin-like serine protease                         432   4e-141   
ref|XP_006280041.1|  hypothetical protein CARUB_v10025918mg             432   5e-141   
ref|XP_009380035.1|  PREDICTED: subtilisin-like protease                432   5e-141   
gb|AAM60964.1|  subtilisin-like serine protease                         432   6e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease                432   6e-141   
ref|XP_010109072.1|  Subtilisin-like protease                           432   6e-141   
ref|XP_004235537.1|  PREDICTED: subtilisin-like protease                432   6e-141   
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease                434   7e-141   
ref|XP_002885025.1|  hypothetical protein ARALYDRAFT_478841             432   8e-141   
ref|XP_003597117.1|  Subtilisin-like protease                           431   8e-141   
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease                432   9e-141   
ref|XP_010240288.1|  PREDICTED: subtilisin-like protease                432   9e-141   
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease-like           432   1e-140   
ref|XP_006421788.1|  hypothetical protein CICLE_v10004381mg             431   1e-140   
gb|KEH35793.1|  subtilisin-like serine protease                         431   1e-140   
gb|EAZ24824.1|  hypothetical protein OsJ_08603                          430   1e-140   
emb|CDP03080.1|  unnamed protein product                                427   1e-140   
ref|XP_009337216.1|  PREDICTED: subtilisin-like protease                431   1e-140   
ref|XP_008444575.1|  PREDICTED: subtilisin-like protease                431   1e-140   
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2     431   1e-140   
ref|XP_007012625.1|  Subtilase family protein                           431   1e-140   
gb|EPS65938.1|  hypothetical protein M569_08836                         430   1e-140   
ref|XP_007152373.1|  hypothetical protein PHAVU_004G124600g             431   1e-140   
emb|CDO97802.1|  unnamed protein product                                432   2e-140   
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                431   2e-140   
ref|XP_004142884.1|  PREDICTED: subtilisin-like protease-like iso...    431   2e-140   
ref|XP_007041871.1|  Subtilisin-like serine protease 2                  431   2e-140   
emb|CDY29697.1|  BnaA04g17300D                                          430   2e-140   
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease                431   2e-140   
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease                430   2e-140   
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg                431   2e-140   
ref|XP_004499011.1|  PREDICTED: subtilisin-like protease-like           431   2e-140   
ref|XP_010273831.1|  PREDICTED: subtilisin-like protease                431   2e-140   
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease                431   2e-140   
ref|XP_004287641.1|  PREDICTED: subtilisin-like protease-like           430   3e-140   
gb|KFK38784.1|  hypothetical protein AALP_AA3G160100                    430   3e-140   
gb|EPS74284.1|  hypothetical protein M569_00464                         430   3e-140   
ref|XP_008393753.1|  PREDICTED: subtilisin-like protease                430   3e-140   
ref|XP_007137352.1|  hypothetical protein PHAVU_009G120000g             430   4e-140   
ref|NP_001048303.1|  Os02g0780200                                       430   5e-140   
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease                429   5e-140   
ref|XP_006296785.1|  hypothetical protein CARUB_v10016006mg             429   5e-140   
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg                429   5e-140   
ref|XP_011030007.1|  PREDICTED: subtilisin-like protease                430   5e-140   
ref|XP_009389184.1|  PREDICTED: subtilisin-like protease                431   6e-140   
ref|XP_010688373.1|  PREDICTED: subtilisin-like protease                431   6e-140   
ref|XP_006369092.1|  subtilase family protein                           429   7e-140   
emb|CDY67452.1|  BnaCnng55020D                                          428   8e-140   
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g             429   8e-140   
dbj|BAJ93872.1|  predicted protein                                      429   8e-140   
ref|XP_006381615.1|  subtilase family protein                           429   9e-140   
gb|KDP22364.1|  hypothetical protein JCGZ_26195                         429   1e-139   
ref|XP_008220305.1|  PREDICTED: subtilisin-like protease                429   1e-139   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           429   1e-139   
ref|XP_006401917.1|  hypothetical protein EUTSA_v10012740mg             429   1e-139   
ref|XP_003520892.1|  PREDICTED: subtilisin-like protease-like           429   1e-139   
ref|XP_008388846.1|  PREDICTED: subtilisin-like protease                428   2e-139   
ref|XP_009360421.1|  PREDICTED: subtilisin-like protease                428   2e-139   
gb|AAK25839.1|AF360129_1  putative subtilisin serine protease           428   2e-139   
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease                428   2e-139   
ref|XP_008351977.1|  PREDICTED: subtilisin-like protease                428   2e-139   
ref|XP_011092912.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    428   2e-139   
gb|EAY87753.1|  hypothetical protein OsI_09169                          428   2e-139   
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease                428   2e-139   
ref|XP_010501809.1|  PREDICTED: subtilisin-like protease                428   2e-139   
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease                428   3e-139   
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease                427   3e-139   
ref|NP_566483.1|  Subtilase family protein                              428   3e-139   
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like           427   3e-139   
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease                428   3e-139   
ref|XP_010685229.1|  PREDICTED: subtilisin-like protease                428   3e-139   
ref|XP_002864127.1|  subtilase family protein                           427   3e-139   
emb|CDY00497.1|  BnaA10g07760D                                          427   3e-139   
ref|XP_004292752.1|  PREDICTED: subtilisin-like protease-like           427   3e-139   
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                    427   4e-139   
ref|XP_010487224.1|  PREDICTED: subtilisin-like protease                427   4e-139   
gb|KDP29636.1|  hypothetical protein JCGZ_18798                         427   4e-139   
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease                427   4e-139   
ref|XP_003533787.1|  PREDICTED: subtilisin-like protease-like           427   4e-139   
ref|XP_008780995.1|  PREDICTED: subtilisin-like protease                427   4e-139   
emb|CDP15554.1|  unnamed protein product                                428   4e-139   
ref|XP_004290953.1|  PREDICTED: subtilisin-like protease-like           427   5e-139   
gb|KHG16003.1|  Subtilisin-like protease                                427   5e-139   
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    427   6e-139   
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease                426   6e-139   
ref|XP_010090327.1|  Subtilisin-like protease                           427   7e-139   
ref|XP_011041660.1|  PREDICTED: subtilisin-like protease                427   7e-139   
gb|KDO68024.1|  hypothetical protein CISIN_1g004010mg                   422   8e-139   
ref|XP_006298945.1|  hypothetical protein CARUB_v10015070mg             426   9e-139   
gb|KCW56428.1|  hypothetical protein EUGRSUZ_I02156                     430   9e-139   
ref|XP_010489238.1|  PREDICTED: subtilisin-like protease                426   9e-139   
ref|NP_001049524.2|  Os03g0242900                                       427   9e-139   
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease                426   1e-138   
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease                426   1e-138   
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease                426   1e-138   
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease                426   1e-138   
ref|XP_010465317.1|  PREDICTED: subtilisin-like protease isoform X1     426   1e-138   
emb|CDY18654.1|  BnaA09g07410D                                          425   1e-138   
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g             426   2e-138   
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g             426   2e-138   
ref|XP_002510884.1|  Cucumisin precursor, putative                      426   2e-138   
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like           425   2e-138   
emb|CDX99895.1|  BnaC09g28100D                                          426   2e-138   
ref|XP_004148149.1|  PREDICTED: subtilisin-like protease-like           426   2e-138   
emb|CDO96926.1|  unnamed protein product                                426   2e-138   
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                426   2e-138   
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease                425   2e-138   
ref|XP_010482516.1|  PREDICTED: subtilisin-like protease isoform X1     426   3e-138   
ref|XP_007018544.1|  Xylem serine proteinase 1, putative isoform 2      423   3e-138   
ref|NP_568765.1|  subtilase 1.3                                         426   3e-138   
emb|CDX82491.1|  BnaA03g33300D                                          425   3e-138   
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                425   3e-138   
gb|AES62637.2|  subtilisin-like serine protease                         426   3e-138   
gb|KGN57311.1|  hypothetical protein Csa_3G178520                       426   4e-138   
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease                425   4e-138   
emb|CDY18042.1|  BnaC07g04280D                                          424   4e-138   
gb|EPS64737.1|  hypothetical protein M569_10042                         418   4e-138   
ref|NP_001234288.1|  SBT2 protein precursor                             425   4e-138   
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                   424   4e-138   
ref|XP_002270958.1|  PREDICTED: subtilisin-like protease                425   5e-138   
ref|XP_010443668.1|  PREDICTED: subtilisin-like protease isoform X1     424   6e-138   
ref|XP_010443674.1|  PREDICTED: subtilisin-like protease isoform X2     424   6e-138   
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...    424   6e-138   
ref|XP_002321861.2|  subtilase family protein                           424   8e-138   
ref|XP_003592386.1|  Subtilisin-like protease                           426   8e-138   
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg             424   8e-138   
ref|XP_002867098.1|  hypothetical protein ARALYDRAFT_491159             424   8e-138   
ref|XP_007224759.1|  hypothetical protein PRUPE_ppa024174mg             423   9e-138   
ref|XP_002318860.1|  hypothetical protein POPTR_0012s14140g             424   9e-138   
ref|XP_011079622.1|  PREDICTED: subtilisin-like protease                424   1e-137   
ref|NP_567972.1|  subtilisin-like serine protease 2                     423   1e-137   
emb|CAD29822.2|  putative serine protease                               417   1e-137   
ref|XP_007018543.1|  Xylem serine proteinase 1, putative isoform 1      423   1e-137   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             423   2e-137   
emb|CDX97560.1|  BnaA05g25190D                                          423   2e-137   
dbj|BAJ97849.1|  predicted protein                                      420   2e-137   
ref|XP_008782639.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    423   2e-137   
ref|XP_010105479.1|  Subtilisin-like protease                           423   2e-137   
ref|XP_010105482.1|  Subtilisin-like protease                           423   2e-137   
gb|AFW73750.1|  putative subtilase family protein                       423   2e-137   
ref|XP_010432360.1|  PREDICTED: subtilisin-like protease                423   2e-137   
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease                423   2e-137   
ref|XP_006486757.1|  PREDICTED: subtilisin-like protease-like           423   3e-137   
ref|NP_001145849.1|  uncharacterized protein LOC100279360 precursor     423   3e-137   
ref|XP_006412166.1|  hypothetical protein EUTSA_v10026999mg             422   3e-137   
ref|XP_008242250.1|  PREDICTED: subtilisin-like protease                422   3e-137   
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease                422   4e-137   
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease                422   4e-137   
ref|XP_003595292.1|  Subtilisin-like protease                           422   4e-137   
gb|EPS61757.1|  hypothetical protein M569_13035                         422   4e-137   
ref|XP_010920139.1|  PREDICTED: subtilisin-like protease                422   4e-137   
emb|CDY40653.1|  BnaA03g53100D                                          422   4e-137   
ref|XP_008236002.1|  PREDICTED: subtilisin-like protease                422   4e-137   
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like           422   4e-137   
ref|XP_010937330.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    422   5e-137   
ref|XP_007199629.1|  hypothetical protein PRUPE_ppa001754mg             422   5e-137   
ref|XP_006422621.1|  hypothetical protein CICLE_v10027859mg             422   5e-137   
ref|XP_009146389.1|  PREDICTED: subtilisin-like protease                422   5e-137   
gb|KFK30136.1|  hypothetical protein AALP_AA7G221600                    422   5e-137   
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like           422   5e-137   
ref|XP_009135372.1|  PREDICTED: subtilisin-like protease                422   5e-137   
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease                422   6e-137   
ref|XP_010447014.1|  PREDICTED: subtilisin-like protease                422   6e-137   
ref|XP_003570499.1|  PREDICTED: subtilisin-like protease                422   6e-137   
emb|CDY18651.1|  BnaA09g07440D                                          421   7e-137   
ref|XP_008377982.1|  PREDICTED: subtilisin-like protease                421   7e-137   
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520          422   7e-137   
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like           421   8e-137   
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg             422   9e-137   
ref|XP_008392153.1|  PREDICTED: subtilisin-like protease                422   9e-137   
ref|XP_006465816.1|  PREDICTED: subtilisin-like protease-like           421   9e-137   
ref|XP_006426785.1|  hypothetical protein CICLE_v10024934mg             421   9e-137   
ref|XP_011046353.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    421   1e-136   
ref|XP_003558354.1|  PREDICTED: subtilisin-like protease                422   1e-136   
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease                422   1e-136   
ref|XP_009401756.1|  PREDICTED: subtilisin-like protease                421   1e-136   
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease-like           421   1e-136   
ref|XP_007225532.1|  hypothetical protein PRUPE_ppa025871mg             421   1e-136   
emb|CAN71376.1|  hypothetical protein VITISV_001491                     420   1e-136   
ref|XP_006490976.1|  PREDICTED: subtilisin-like protease-like           421   1e-136   
ref|XP_002533857.1|  Cucumisin precursor, putative                      420   2e-136   
ref|XP_004496643.1|  PREDICTED: subtilisin-like protease-like           421   2e-136   
ref|XP_010028715.1|  PREDICTED: subtilisin-like protease                420   2e-136   
ref|XP_009400347.1|  PREDICTED: subtilisin-like protease                421   2e-136   
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810          420   2e-136   
gb|AAL32016.1|AF436834_1  AT3g14240/MLN21_2                             414   2e-136   
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease                420   2e-136   
emb|CDX98438.1|  BnaC05g39370D                                          420   2e-136   
gb|KEH30495.1|  subtilisin-like serine protease                         420   3e-136   
dbj|BAJ87169.1|  predicted protein                                      420   3e-136   
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like           419   4e-136   
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease                419   4e-136   
ref|XP_008457681.1|  PREDICTED: subtilisin-like protease                419   4e-136   
ref|XP_010685296.1|  PREDICTED: subtilisin-like protease                419   4e-136   
ref|XP_008220304.1|  PREDICTED: subtilisin-like protease                420   5e-136   
ref|XP_010552189.1|  PREDICTED: subtilisin-like protease                420   5e-136   
ref|XP_008377749.1|  PREDICTED: subtilisin-like protease                419   6e-136   
emb|CDP05276.1|  unnamed protein product                                419   8e-136   
ref|XP_008788427.1|  PREDICTED: subtilisin-like protease                419   8e-136   
ref|XP_010933329.1|  PREDICTED: subtilisin-like protease                419   9e-136   
gb|EMT01939.1|  Subtilisin-like protease                                416   1e-135   
ref|XP_006841510.1|  hypothetical protein AMTR_s00003p00138760          417   1e-135   
gb|ABR18065.1|  unknown                                                 418   2e-135   
dbj|BAJ91233.1|  predicted protein                                      418   2e-135   
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease                418   2e-135   
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease                419   2e-135   
ref|XP_007217030.1|  hypothetical protein PRUPE_ppa001661mg             418   2e-135   
ref|XP_008367646.1|  PREDICTED: subtilisin-like protease                417   2e-135   
emb|CAH66960.1|  OSIGBa0147H17.8                                        417   2e-135   
ref|XP_009350566.1|  PREDICTED: subtilisin-like protease                417   3e-135   
ref|XP_009628999.1|  PREDICTED: subtilisin-like protease                418   3e-135   
ref|XP_006857965.1|  hypothetical protein AMTR_s00069p00175260          417   3e-135   
gb|ACN40199.1|  unknown                                                 417   4e-135   
ref|XP_002465573.1|  hypothetical protein SORBIDRAFT_01g041350          417   4e-135   
ref|XP_004158378.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    417   5e-135   
gb|KHN12975.1|  Subtilisin-like protease                                416   5e-135   
ref|XP_003538797.2|  PREDICTED: subtilisin-like protease-like           416   7e-135   
ref|XP_006362686.1|  PREDICTED: subtilisin-like protease-like           416   7e-135   
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like           416   7e-135   
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease-like           416   8e-135   
ref|XP_010919193.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    416   8e-135   
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    416   9e-135   
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      415   9e-135   
ref|NP_001053614.1|  Os04g0573300                                       416   1e-134   
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease                416   1e-134   
ref|XP_008377981.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    416   1e-134   
ref|XP_010690381.1|  PREDICTED: subtilisin-like protease                416   1e-134   
ref|XP_007024750.1|  Subtilase family protein isoform 1                 416   1e-134   
ref|XP_003553808.1|  PREDICTED: subtilisin-like protease-like           416   1e-134   
tpg|DAA44340.1|  TPA: putative subtilase family protein                 416   1e-134   
ref|XP_006407103.1|  hypothetical protein EUTSA_v10020111mg             416   1e-134   
ref|XP_002968227.1|  hypothetical protein SELMODRAFT_89194              414   2e-134   



>ref|XP_006342924.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/395 (70%), Positives = 319/395 (81%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGAR FYKGYEA  GSP++ES E KSPRD  GHGTHTAS AAGS+VANAS + YA+GE
Sbjct  178   KIIGARLFYKGYEADRGSPMDESKESKSPRDTEGHGTHTASTAAGSVVANASFYQYAKGE  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA+KARIA YKICW  GC+DSDIL+A DQAV DGVHVISLSV     Y  +Y  DS 
Sbjct  238   ARGMAVKARIAAYKICWKTGCFDSDILAAMDQAVADGVHVISLSVGA-DGYSPEYDVDSI  296

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA EHGVVVS  AGN+GPGA TA NVAPWILTV ASTIDR FPADV+LGDGRIF 
Sbjct  297   AIGAFGATEHGVVVSCSAGNSGPGASTAVNVAPWILTVAASTIDREFPADVILGDGRIFG  356

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+G+PLG+ KL LVY  D  S  CY G+L  SKV GKIV C+RGGN  V+KG AV+
Sbjct  357   GVSLYTGDPLGNAKLQLVYSADCGSQLCYPGKLDPSKVAGKIVLCDRGGNARVEKGSAVK  416

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
             +AGG GM++   A +GE + A AH++PAT V +  GNKI++YI S PSPTA I F+GTVI
Sbjct  417   QAGGAGMVLANLADSGEELVADAHLLPATMVGQKAGNKIRDYIKSVPSPTATITFKGTVI  476

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SPSAPR+A+FS RGPN +  EILKPDV APGVNILAGW+GA+GP+   +D+RRVEFNI
Sbjct  477   GKSPSAPRIAAFSGRGPNYVTPEILKPDVTAPGVNILAGWTGAVGPTDLEIDKRRVEFNI  536

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLRKA+P W+ AAIKSALM
Sbjct  537   ISGTSMSCPHVSGLAALLRKAYPKWTTAAIKSALM  571



>ref|XP_009610930.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=779

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/395 (71%), Positives = 319/395 (81%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGAR FYKGYEA  GSPI+ES E KSPRD  GHGTHTAS AAGS+VANAS F YA+GE
Sbjct  185   KIIGARLFYKGYEADRGSPIDESKESKSPRDTEGHGTHTASTAAGSVVANASFFQYAKGE  244

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA+KARIA YKICW  GC+DSDIL+A DQAV DGVHVISLSV      PE Y  DS 
Sbjct  245   ARGMAVKARIAAYKICWKTGCFDSDILAAMDQAVADGVHVISLSVGADGYAPE-YDVDSI  303

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA EHGVVVS  AGN+GPGA TA NVAPWILTV ASTIDR FPADV+LGDGRIF 
Sbjct  304   AIGAFGASEHGVVVSCSAGNSGPGASTAVNVAPWILTVAASTIDREFPADVILGDGRIFG  363

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSG+PLGD+KLPLVY GD  S  CY G+L  SKV GKIV C+RGGN  V+KG AV+
Sbjct  364   GVSLYSGDPLGDSKLPLVYSGDCGSQLCYPGKLDPSKVAGKIVLCDRGGNARVEKGSAVK  423

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG GM++   A +GE + A +H++PAT V +  G+KI++Y+ S  SPTA IVF+GTVI
Sbjct  424   LAGGAGMVLANLADSGEELVADSHLLPATMVGQKAGDKIRDYVKSDSSPTATIVFKGTVI  483

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G  PSAPR+A+FS RGPN +  EILKPDV APGVNILAGW+G+IGP+   +D RRVEFNI
Sbjct  484   GKPPSAPRIAAFSGRGPNYVTPEILKPDVTAPGVNILAGWTGSIGPTDLEIDTRRVEFNI  543

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLRKA+P W+ AAIKSALM
Sbjct  544   ISGTSMSCPHVSGLAALLRKAYPKWTTAAIKSALM  578



>ref|XP_009758461.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/395 (70%), Positives = 320/395 (81%), Gaps = 2/395 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGA+ FYKGYEA  G P++ES E KSPRD  GHGTHTAS AAGS+VANAS + YA+GE
Sbjct  180   KIIGAQMFYKGYEAKHG-PMDESKESKSPRDTEGHGTHTASTAAGSVVANASFYQYAKGE  238

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMAIKARIA YKICW  GC++SDIL+A DQAV DGVHVISLSV     Y   Y  DS 
Sbjct  239   ARGMAIKARIAAYKICWKNGCFNSDILAAMDQAVDDGVHVISLSVGA-NGYAPHYLYDSI  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA EHGV+VS  AGN+GPGA TA N+APW+LTVGASTIDR FPADV+LGD RIF 
Sbjct  298   AIGAFGASEHGVLVSCSAGNSGPGAYTAVNIAPWMLTVGASTIDREFPADVILGDNRIFG  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSG PL D KLP+VY GD  S YCY G+L   KV GKIV C+RGGN  V+KG AV+
Sbjct  358   GVSLYSGNPLADAKLPVVYSGDCGSKYCYPGKLDPKKVAGKIVLCDRGGNARVEKGSAVK  417

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
             +AGGVGMI+   A +GE + A +H++PAT V +  G+KI+ Y+ S P+PTA IVFRGTVI
Sbjct  418   QAGGVGMILANLADSGEELVADSHLLPATMVGQKAGDKIRHYVKSDPAPTATIVFRGTVI  477

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP+APRVA+FSSRGPN L  EILKPDVIAPGVNILAGW+G++GP+   +D RRVEFNI
Sbjct  478   GKSPAAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSVGPTDLDIDTRRVEFNI  537

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLR+AHP W+PAA+KSALM
Sbjct  538   ISGTSMSCPHVSGLAALLRRAHPKWTPAAVKSALM  572



>ref|XP_009613479.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/395 (70%), Positives = 320/395 (81%), Gaps = 2/395 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGA+ FYKGYEA  G P++ES E KSPRD  GHGTHTAS AAGS+VANAS + YA+GE
Sbjct  180   KIIGAQMFYKGYEASHG-PMDESKESKSPRDTEGHGTHTASTAAGSVVANASFYQYAKGE  238

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMAIKARIA YKICW  GC++SDIL+A DQAV DGVHVISLSV     Y   Y  DS 
Sbjct  239   ARGMAIKARIAAYKICWKNGCFNSDILAAMDQAVNDGVHVISLSVG-ANGYAPHYLLDSI  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA EHGV+VS  AGN+GPGA TA N+APWILTVGASTIDR FPADV+LGD RIF 
Sbjct  298   AIGAFGASEHGVLVSCSAGNSGPGAYTAVNIAPWILTVGASTIDREFPADVILGDNRIFG  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSG+PL D KLP+VY GD  S YCY G+L   KV GKIV C+RGGN  V+KG AV+
Sbjct  358   GVSLYSGDPLTDAKLPVVYSGDCGSKYCYPGKLDHKKVAGKIVLCDRGGNARVEKGSAVK  417

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
             +AGGVGMI+   A +GE + A +H++PAT V +  G+KI+ Y+ S PSPTA IVFRGTVI
Sbjct  418   QAGGVGMILLNLADSGEELVADSHLLPATMVGQKAGDKIRHYVKSDPSPTATIVFRGTVI  477

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP+APRVA+FSSRGPN L  EILKPDVIAPGVNILAGW+G++GP+   +D RRVEFNI
Sbjct  478   GKSPAAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSVGPTDLDIDTRRVEFNI  537

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPH SGLAALL++AHP W+PAA+KSALM
Sbjct  538   ISGTSMSCPHASGLAALLKRAHPKWTPAAVKSALM  572



>ref|XP_003627323.1| Cucumisin-like serine protease subtilisin-like protease [Medicago 
truncatula]
 gb|AET01799.1| subtilisin-like serine protease [Medicago truncatula]
Length=785

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/397 (70%), Positives = 320/397 (81%), Gaps = 3/397 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGA+AFYKGYEA+   PI+E+VE KSPRD  GHGTHTAS AAGS+V NASLFG+A+GE
Sbjct  193   KIIGAKAFYKGYEAYLQRPIDETVESKSPRDTEGHGTHTASTAAGSVVGNASLFGFARGE  252

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A+GMA KARIA YKICW LGC+DSDIL+A D+AV DGVHVISLSV     Y   YYRDS 
Sbjct  253   AKGMATKARIAAYKICWKLGCFDSDILAAMDEAVADGVHVISLSVG-SNGYAPHYYRDSI  311

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA +HGVVVS  AGN+GPG  T+ N+APWILTVGASTIDR FPADVVLGDGR+F 
Sbjct  312   AIGAFGAAQHGVVVSCSAGNSGPGPYTSVNIAPWILTVGASTIDREFPADVVLGDGRVFG  371

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY G+ L DNKLPL+YG D  S YCY G L +SKV GKIV C+RGGN  V+KG AV+
Sbjct  372   GVSLYYGDSLPDNKLPLIYGADCGSRYCYLGSLDSSKVQGKIVVCDRGGNARVEKGSAVK  431

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
             +AGG+GMI+  T   GE + A AH++ AT V E    KI+EYI S+ +PTA I F+GTVI
Sbjct  432   KAGGLGMIMANTEENGEELLADAHLVAATMVGENAAEKIREYIKSSENPTATIKFKGTVI  491

Query  902   G--TSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             G   SPSAP+VASFSSRGPN    EILKPDVIAPGVNILAGW+G +GP+   +D RRVEF
Sbjct  492   GGEGSPSAPQVASFSSRGPNYRTAEILKPDVIAPGVNILAGWTGKVGPTDLEIDPRRVEF  551

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NIISGTSM+CPHVSG+AALLRKA+P WSPAAIKSALM
Sbjct  552   NIISGTSMSCPHVSGIAALLRKAYPEWSPAAIKSALM  588



>ref|XP_004510506.1| PREDICTED: subtilisin-like protease-like isoform X1 [Cicer arietinum]
 ref|XP_004510507.1| PREDICTED: subtilisin-like protease-like isoform X2 [Cicer arietinum]
Length=769

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/395 (70%), Positives = 322/395 (82%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGA+AFYKGYE++   PI+E+VE KSPRD  GHG+HTAS AAGSIV+NASLF +AQGE
Sbjct  179   KIIGAKAFYKGYESYLQRPIDETVESKSPRDTEGHGSHTASTAAGSIVSNASLFSFAQGE  238

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A+GMA KARIA YKICWSLGC+DSDIL+A D+AV DGVHVISLSV     Y   YY DS 
Sbjct  239   AKGMATKARIAAYKICWSLGCFDSDILAAMDEAVSDGVHVISLSVG-ASGYAPQYYHDSI  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA +HGVVVS  AGN+GPG+ T+TN+APWILTVGASTIDR FPADV+LGDGR+F 
Sbjct  298   AIGAFGASQHGVVVSCSAGNSGPGSYTSTNIAPWILTVGASTIDREFPADVILGDGRVFG  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY G+ L D KLPLVYG D  S YC+ G L +SKV GKIV C+RG N  V+KG AV+
Sbjct  358   GVSLYDGDDLPDYKLPLVYGADCGSRYCFIGSLDSSKVQGKIVVCDRGVNARVEKGSAVK  417

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  T G+GE + A AH++ AT V ++  +KI+EYI S+  PTA I F+GTVI
Sbjct  418   LAGGLGMIMANTEGSGEELLADAHLVAATMVGQIAADKIREYIRSSQYPTATIEFKGTVI  477

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP+AP+VASFSSRGPN +  EILKPDVIAPGVNILAGW+G +GP+    D RRVEFNI
Sbjct  478   GGSPAAPQVASFSSRGPNYVTSEILKPDVIAPGVNILAGWTGKVGPTDLDFDTRRVEFNI  537

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+AALLRKA+P WSPAAIKSALM
Sbjct  538   ISGTSMSCPHVSGIAALLRKAYPNWSPAAIKSALM  572



>ref|XP_007024651.1| Subtilase family protein [Theobroma cacao]
 gb|EOY27273.1| Subtilase family protein [Theobroma cacao]
Length=767

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/395 (71%), Positives = 319/395 (81%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARAFYKGYE++   P++E+ E KSPRD  GHGTHTAS AAGS+V+NASLF +A GE
Sbjct  176   KIIGARAFYKGYESYLEGPMDETKESKSPRDTEGHGTHTASTAAGSVVSNASLFEFAYGE  235

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICWSLGC+DSD+L+A DQA+ DGV+VISLSV     Y   Y  DS 
Sbjct  236   ARGMATKARIAAYKICWSLGCFDSDLLAAMDQAIADGVNVISLSVGA-TGYAPQYDHDSI  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA +HG+VVS  AGN+GPG  TA N+APWILTVGASTIDR FPAD +LGDGRIF 
Sbjct  295   AIGAFGAAQHGIVVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADAILGDGRIFG  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSG+PL D KLPLVY GD+ + YCY G L  SKV GKIVFC+RGGN  V+KGFAV+
Sbjct  355   GVSLYSGDPLVDIKLPLVYAGDSGNRYCYMGSLSPSKVQGKIVFCDRGGNARVEKGFAVK  414

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  TA +GE + A AH+IPAT V E  GN+I++YI  +  PTA IVF GTVI
Sbjct  415   LAGGLGMILANTAESGEELIADAHLIPATTVGEKAGNEIRQYIKISQFPTATIVFHGTVI  474

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP AP+VA+FSSRGPN L  EILKPDVIAPGVNILAGW+G IGPS   +D RRV FNI
Sbjct  475   GPSPPAPKVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGFIGPSQLNIDTRRVNFNI  534

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALL KA+P WSPAAIKSALM
Sbjct  535   ISGTSMSCPHVSGLAALLIKAYPNWSPAAIKSALM  569



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/396 (71%), Positives = 319/396 (81%), Gaps = 2/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARA+YKGYEA  G  + E+ E KSPRD  GHGTHTAS AAGS+V NASL+ YA+GE
Sbjct  183   KIIGARAYYKGYEANLGMSLQEAGESKSPRDSEGHGTHTASTAAGSVVKNASLYEYARGE  242

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMAIKAR+A YKICWS GC+DSDIL+A DQA+ DGVHVISLSV     Y   Y  DS 
Sbjct  243   ARGMAIKARVAAYKICWSAGCFDSDILAAMDQAIDDGVHVISLSVGA-NGYAPQYDHDSI  301

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA ++G+V S  AGN+GPG  TA N+APWILTVGASTIDR FPADVVLGDG I+ 
Sbjct  302   AIGAFGAAKYGIVTSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVVLGDGSIYG  361

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGG-NLDVDKGFAV  718
             G+SLY+GEPLGD +LPLVY GD  S+YCY G L +SKV GKIV C+RGG N  + KG AV
Sbjct  362   GVSLYAGEPLGDTQLPLVYAGDCGSSYCYEGRLDSSKVKGKIVICDRGGGNARMAKGTAV  421

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             + AGG GMI+   A +GE + A +H+IPATNV +  G+KIK Y+ S PSPTA IVFRGTV
Sbjct  422   KLAGGGGMILANLADSGEELIADSHLIPATNVGQKAGDKIKSYLRSEPSPTATIVFRGTV  481

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             IG+SPSAPRVA+FSSRGPN L  EILKPDVIAPGVNILAGW+G +GPS   +D RRVEFN
Sbjct  482   IGSSPSAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGLVGPSQLDIDPRRVEFN  541

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             I SGTSM+CPHVSGLAALLRKAHP W+PAAIKSALM
Sbjct  542   IASGTSMSCPHVSGLAALLRKAHPKWTPAAIKSALM  577



>ref|XP_009788688.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=776

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/395 (70%), Positives = 317/395 (80%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGAR FYKGYEA  GSPI+ES E KSPRD  GHGTHTAS AAGS+VANAS F YA+GE
Sbjct  182   KIIGARLFYKGYEADRGSPIDESKESKSPRDTEGHGTHTASTAAGSVVANASFFQYAKGE  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA+KARIA YKICW  GC+DSDIL+A DQAV DGVHVISLSV      PE Y  DS 
Sbjct  242   ARGMAVKARIAAYKICWKTGCFDSDILAAMDQAVADGVHVISLSVGADGYAPE-YDVDSI  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA EHGVVVS  AGN+GPGA TA NVAPWILTV ASTIDR FPA+V+LGDGRIF 
Sbjct  301   AIGAFGASEHGVVVSCSAGNSGPGASTAVNVAPWILTVAASTIDREFPANVILGDGRIFG  360

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSG+PL D KLPLVY GD  S  CY G+L  SKV GKIV C+RGGN  V+KG AV+
Sbjct  361   GVSLYSGDPLNDTKLPLVYSGDCGSQLCYPGKLDPSKVAGKIVLCDRGGNARVEKGSAVK  420

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG GM++   A +GE + A +H++PAT V +  G+KI++Y+ S  SP A IVF+GTVI
Sbjct  421   LAGGAGMVLANLADSGEELVADSHLLPATMVGQKAGDKIRDYVKSDSSPKATIVFKGTVI  480

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP+APR+A+FS RGPN +  EILKPDV APGVNILAGW+G+IGP+   +D RRVEFNI
Sbjct  481   GKSPTAPRIAAFSGRGPNYVTPEILKPDVTAPGVNILAGWTGSIGPTDLEIDTRRVEFNI  540

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLRKA+P W+ AAIKSALM
Sbjct  541   ISGTSMSCPHVSGLAALLRKAYPKWTTAAIKSALM  575



>ref|XP_006357406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=776

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/395 (70%), Positives = 316/395 (80%), Gaps = 2/395 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGAR FYKGYEA  G P++ES E KSPRD  GHGTHTAS AAGS+VANAS + YA+GE
Sbjct  183   KIIGARMFYKGYEASHG-PMDESKEAKSPRDTEGHGTHTASTAAGSLVANASFYQYAKGE  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMAIKARIA YKICW  GC+DSDIL+A DQAV DGVHVISLSV     Y   Y  DS 
Sbjct  242   ARGMAIKARIAAYKICWKDGCFDSDILAAMDQAVADGVHVISLSVG-ANGYAPHYLHDSI  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA EHGV+VS  AGN+GPG  TA N+APWILTVGASTIDR FPADV+LGD R+F 
Sbjct  301   AIGAFGASEHGVLVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVILGDDRVFG  360

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSG PL D+K P+VY GD  S YCY G+L   KV GKIV C+RGGN  V+KG AV+
Sbjct  361   GVSLYSGNPLTDSKFPVVYSGDCGSKYCYPGKLDHKKVAGKIVLCDRGGNARVEKGSAVK  420

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGGVGMI+   A +GE + A +H++PAT V +  G+KI+EY+ S  SPTA IVFRGTVI
Sbjct  421   LAGGVGMILANLAESGEELVADSHLLPATMVGQKAGDKIREYVTSDTSPTATIVFRGTVI  480

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP+APRVA+FSSRGPN L  EILKPDVIAPGVNILAGW+G+ GP+   +D RRVEFNI
Sbjct  481   GNSPAAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSTGPTDLAIDPRRVEFNI  540

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLR+AH  W+PAAIKSALM
Sbjct  541   ISGTSMSCPHVSGLAALLRRAHSKWTPAAIKSALM  575



>ref|XP_010322825.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/395 (70%), Positives = 317/395 (80%), Gaps = 2/395 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGAR FYKGYEA  G P++ES E KSPRD  GHGTHTAS AAGS+VANAS + YA+GE
Sbjct  182   KIIGARMFYKGYEASQG-PMDESKEAKSPRDTEGHGTHTASTAAGSLVANASFYQYAKGE  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMAIKARIA YKICW  GC+DSDIL+A DQAV DGVHVISLSV     Y   Y  DS 
Sbjct  241   ARGMAIKARIAAYKICWKTGCFDSDILAAMDQAVDDGVHVISLSVGA-NGYAPHYLHDSI  299

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA EHGV+VS  AGN+GPG  TA N+APWILTVGASTIDR FPADV+LGD R+F 
Sbjct  300   AIGAFGASEHGVLVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVILGDDRVFG  359

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+G PL D+KLP+VY GD  S YCY G+L   KV GKIV C+RGGN  V+KG AV+
Sbjct  360   GVSLYAGNPLNDSKLPVVYSGDCGSKYCYPGKLDHKKVAGKIVLCDRGGNARVEKGSAVK  419

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGGVGMI+   A +GE + A +H++PAT V +  G++I+EY+ S PSPTA IVF+GTVI
Sbjct  420   LAGGVGMILANLADSGEELVADSHLLPATMVGQKAGDEIREYVISDPSPTATIVFKGTVI  479

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP+APRVA+FSSRGPN L  EILKPDV APGVNILAGW+GA GP+   +D RRVEFNI
Sbjct  480   GNSPAAPRVAAFSSRGPNHLTPEILKPDVTAPGVNILAGWTGANGPTDLEIDPRRVEFNI  539

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLR+AH  W+PAAIKSALM
Sbjct  540   ISGTSMSCPHVSGLAALLRRAHSKWTPAAIKSALM  574



>gb|KDO64998.1| hypothetical protein CISIN_1g045236mg, partial [Citrus sinensis]
Length=604

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/395 (69%), Positives = 317/395 (80%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARAFY+GYE++   PI+E+ E KSPRD  GHGTHTAS AAGS+V+NASLF YA+GE
Sbjct  13    KIIGARAFYRGYESYMERPIDETEESKSPRDTEGHGTHTASTAAGSLVSNASLFDYARGE  72

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA+KARIAVYKICWS GC+DSDIL+A DQA+ DGV VISLSV     Y   Y +DS 
Sbjct  73    ARGMAVKARIAVYKICWSPGCFDSDILAAMDQAIADGVDVISLSVGA-SGYAPQYDQDSI  131

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+FGA +HGVVVS  AGN+GPG  TATN+APWILTVGASTIDR FPAD +LGDGRIF 
Sbjct  132   AIGSFGAAQHGVVVSCSAGNSGPGPFTATNIAPWILTVGASTIDREFPADAILGDGRIFG  191

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+GE L D KL LVYGGD    +CY G L  SKV GKIV C+RGGN  V+KG AV+
Sbjct  192   GVSLYAGESLPDFKLHLVYGGDCGDRFCYMGRLEPSKVQGKIVVCDRGGNARVEKGAAVK  251

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  T  +GE + A +H+IPAT V  + G+KI+EYI  +  PTA IVFRGTVI
Sbjct  252   LAGGLGMILANTDESGEELIADSHLIPATMVGAIAGDKIREYIKLSQYPTATIVFRGTVI  311

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
               SP AP+VA+FSSRGPN L  EILKPDVIAPGVNILA W+G+ GP+   +D RRV+FNI
Sbjct  312   SPSPPAPKVAAFSSRGPNSLTAEILKPDVIAPGVNILAAWTGSTGPTDLEIDPRRVDFNI  371

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLRKA+P WSPAAIKSALM
Sbjct  372   ISGTSMSCPHVSGLAALLRKAYPDWSPAAIKSALM  406



>ref|XP_002272769.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=771

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/395 (69%), Positives = 320/395 (81%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARAF+KGYE   G P++ESVE KSPRD  GHGTHTAS AAGS+V +ASLF +A+GE
Sbjct  178   KIIGARAFFKGYEGALGRPMDESVESKSPRDTEGHGTHTASTAAGSVVQDASLFEFAKGE  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA+KARIA YKICWSLGC+DSDIL+A DQAV DGV +ISLSV      P  Y  DS 
Sbjct  238   ARGMAVKARIAAYKICWSLGCFDSDILAAMDQAVADGVDIISLSVGATGLAPR-YDHDSI  296

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGAM+HGV+VS  AGN+GP   TA N+APWILTVGASTIDR FPADVVLGDGRIF 
Sbjct  297   AIGAFGAMDHGVLVSCSAGNSGPDPLTAVNIAPWILTVGASTIDREFPADVVLGDGRIFG  356

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+S+YSG+PL D  LPLVY GD  S +C++G+L  S+V+GKIV C+RGGN  V+KG AV+
Sbjct  357   GVSIYSGDPLKDTNLPLVYAGDCGSRFCFTGKLNPSQVSGKIVICDRGGNARVEKGTAVK  416

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              A G GMI+  T  +GE + A +H++PAT V ++ G+KIKEY+ S   PTA IVFRGTVI
Sbjct  417   MALGAGMILANTGDSGEELIADSHLLPATMVGQIAGDKIKEYVKSKAFPTATIVFRGTVI  476

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             GTSP AP+VA+FSSRGPN L  EILKPDVIAPGVNILAGW+G+  P+   +D RRVEFNI
Sbjct  477   GTSPPAPKVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSKAPTDLDVDPRRVEFNI  536

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLRKA+P W+PAAIKSALM
Sbjct  537   ISGTSMSCPHVSGLAALLRKAYPKWTPAAIKSALM  571



>gb|KCW53526.1| hypothetical protein EUGRSUZ_J02805 [Eucalyptus grandis]
Length=778

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/395 (70%), Positives = 313/395 (79%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARAFYKGYEA+   PI+E+ E KSPRD  GHGTHT+S A GS+V+NAS + YA GE
Sbjct  190   KIIGARAFYKGYEAYLERPIDETKESKSPRDTEGHGTHTSSTAGGSVVSNASFYEYAVGE  249

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICWSLGC+DSDIL+A DQAV DGVH+ISLSV     Y   Y  DS 
Sbjct  250   ARGMATKARIAAYKICWSLGCFDSDILAAMDQAVSDGVHIISLSVGA-NGYAPQYDHDSI  308

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA++HGV+VS  AGN+GPG  TA N+APWILTVGASTIDR FPADVVLGDGRIF 
Sbjct  309   AIGAFGAVKHGVLVSCSAGNSGPGPFTAVNIAPWILTVGASTIDREFPADVVLGDGRIFK  368

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSGEPLGD KLPLVY GD  S YCY   L ++KV GKIV C+RGGN  V KG AV+
Sbjct  369   GVSLYSGEPLGDAKLPLVYAGDCGSRYCYDDSLDSTKVAGKIVVCDRGGNARVAKGSAVK  428

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGGVGMI+  T  +GE + A +H+IPA  V E  G+KI+EY +S   PTAAI F GTVI
Sbjct  429   LAGGVGMILANTEESGEELIADSHLIPANMVGETAGDKIREYASSDQFPTAAIKFIGTVI  488

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP AP+VA+FSSRGPN L  EILKPDVIAPGVNILA W+G  GP+   +D RRVEFNI
Sbjct  489   GPSPPAPKVAAFSSRGPNHLTAEILKPDVIAPGVNILAAWTGFNGPTDLDIDPRRVEFNI  548

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPH SGLAALLRKA+P WSPAAIKSALM
Sbjct  549   ISGTSMSCPHASGLAALLRKAYPDWSPAAIKSALM  583



>ref|XP_006369129.1| subtilase family protein [Populus trichocarpa]
 gb|ERP65698.1| subtilase family protein [Populus trichocarpa]
Length=772

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/395 (69%), Positives = 317/395 (80%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGARAF+KGY    G PI+ES E  SPRD  GHGTHTA+ AAGS+  NASLF YA GE
Sbjct  180   KLIGARAFHKGYITHKGRPIDESKESASPRDTEGHGTHTATTAAGSLAHNASLFQYATGE  239

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICWS GCYDSDIL+A DQA+ DGVHVISLSV      P+ Y  DS 
Sbjct  240   ARGMASKARIAAYKICWSSGCYDSDILAAMDQAIYDGVHVISLSVGATGHAPQ-YDHDSI  298

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A +HG+VVS  AGN GPG  TA N+APWILTVGASTIDR FPADVVLG+G +F+
Sbjct  299   AIGAFSASQHGIVVSCSAGNAGPGPYTAVNIAPWILTVGASTIDREFPADVVLGNGWVFS  358

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSG+PL D+KLPLVY GD  S YCY G +  SKV GKIV C+RGGN  V+KG AV+
Sbjct  359   GVSLYSGDPLVDHKLPLVYAGDVGSRYCYMGSISPSKVQGKIVVCDRGGNARVEKGAAVK  418

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  TA +GE + A +H++PAT V E+  NKI++YI S  SPTA I+FRGT+I
Sbjct  419   LAGGLGMILANTADSGEELIADSHLLPATEVGEIAANKIRQYIKSDQSPTATILFRGTII  478

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             GTSP+AP+VA+FSSRGPN L  EILKPDVIAPGVNILAGW+G +GP+   +D RRVEFNI
Sbjct  479   GTSPAAPKVAAFSSRGPNYLTPEILKPDVIAPGVNILAGWTGFVGPTDLELDPRRVEFNI  538

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+AALLRKA+P WSPAAIKSAL+
Sbjct  539   ISGTSMSCPHVSGIAALLRKAYPDWSPAAIKSALV  573



>ref|XP_010111996.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32307.1| Subtilisin-like protease [Morus notabilis]
Length=826

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/395 (68%), Positives = 320/395 (81%), Gaps = 2/395 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGAR+FYKGY A  G PI+ES E  SPRD  GHGTHT+S AAG++V+NAS   YA GE
Sbjct  233   KIIGARSFYKGYLAALGKPIDESKESLSPRDTEGHGTHTSSTAAGAVVSNASFLHYAPGE  292

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICWSLGCYDSDIL+A DQA+ DGVH+ISLSV    A P  Y+ DS 
Sbjct  293   ARGMATKARIAAYKICWSLGCYDSDILAAMDQAISDGVHIISLSVGSSHASP--YFLDSI  350

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+FGA +HGV+VS  AGN+GP A TATN+APWILTVGASTIDR FPADV+LGD RIF 
Sbjct  351   AIGSFGAAQHGVLVSCSAGNSGPDAYTATNIAPWILTVGASTIDREFPADVILGDDRIFN  410

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+G+ LG +KLPLVY  +A   YC+ G+LI  KV G IV C+RGGN  V+KG AV+
Sbjct  411   GVSLYAGDSLGASKLPLVYAREAGDRYCHEGKLIPKKVEGTIVVCDRGGNARVEKGSAVK  470

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG GM++     +GE + A +H++PAT V +++G+KIKEYI S  +PTA IVFRGTVI
Sbjct  471   HAGGFGMVLANLEDSGEELLADSHLLPATMVGQINGDKIKEYIKSTENPTATIVFRGTVI  530

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G+SP+AP+VA+FSSRGPN L  EILKPDVIAPGVNILAGW+G IGP+   +D RRVEFNI
Sbjct  531   GSSPAAPKVAAFSSRGPNILNPEILKPDVIAPGVNILAGWTGFIGPTDLEIDPRRVEFNI  590

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+AALLRKA+P+WSPAAIKSAL+
Sbjct  591   ISGTSMSCPHVSGIAALLRKAYPSWSPAAIKSALI  625



>ref|XP_010033727.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=829

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/395 (70%), Positives = 313/395 (79%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARAFYKGYEA+   PI+E+ E KSPRD  GHGTHT+S A GS+V+NAS + YA GE
Sbjct  241   KIIGARAFYKGYEAYLERPIDETKESKSPRDTEGHGTHTSSTAGGSVVSNASFYEYAVGE  300

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICWSLGC+DSDIL+A DQAV DGVH+ISLSV     Y   Y  DS 
Sbjct  301   ARGMATKARIAAYKICWSLGCFDSDILAAMDQAVSDGVHIISLSVGA-NGYAPQYDHDSI  359

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA++HGV+VS  AGN+GPG  TA N+APWILTVGASTIDR FPADVVLGDGRIF 
Sbjct  360   AIGAFGAVKHGVLVSCSAGNSGPGPFTAVNIAPWILTVGASTIDREFPADVVLGDGRIFK  419

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSGEPLGD KLPLVY GD  S YCY   L ++KV GKIV C+RGGN  V KG AV+
Sbjct  420   GVSLYSGEPLGDAKLPLVYAGDCGSRYCYDDSLDSTKVAGKIVVCDRGGNARVAKGSAVK  479

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGGVGMI+  T  +GE + A +H+IPA  V E  G+KI+EY +S   PTAAI F GTVI
Sbjct  480   LAGGVGMILANTEESGEELIADSHLIPANMVGETAGDKIREYASSDQFPTAAIKFIGTVI  539

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP AP+VA+FSSRGPN L  EILKPDVIAPGVNILA W+G  GP+   +D RRVEFNI
Sbjct  540   GPSPPAPKVAAFSSRGPNHLTAEILKPDVIAPGVNILAAWTGFNGPTDLDIDPRRVEFNI  599

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPH SGLAALLRKA+P WSPAAIKSALM
Sbjct  600   ISGTSMSCPHASGLAALLRKAYPDWSPAAIKSALM  634



>ref|XP_008391410.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/395 (69%), Positives = 319/395 (81%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARA++ GYEA+ G  ++ES E KSPRD  GHGTHTAS AAGS VANASLF YA+GE
Sbjct  182   KIIGARAYFDGYEAYIGRLMDESNESKSPRDTEGHGTHTASTAAGSPVANASLFSYARGE  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIAVYKICWS GC+DSDIL+A DQA+ DGV +ISLSV      P  Y RDS 
Sbjct  242   ARGMATKARIAVYKICWSFGCFDSDILAAMDQAIADGVDIISLSVGASGRSPA-YDRDSI  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+FGA +HGV+VS  AGN+GP   TATN+APWILTVGAST+DR FPADV+LGD R+F 
Sbjct  301   AIGSFGAAQHGVLVSASAGNSGPNPFTATNIAPWILTVGASTVDREFPADVILGDNRVFG  360

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSGEPL D++LPL+YGGDA S YCY+G L  SKV GKIV C+RGGN  V KG AV+
Sbjct  361   GVSLYSGEPLVDHQLPLIYGGDAGSRYCYAGALKPSKVQGKIVVCDRGGNARVGKGSAVK  420

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+G I+  TA +GE + A AH+IPAT V E+  ++I+EYI  +  PTA IVFRGTV+
Sbjct  421   LAGGLGFILANTADSGEELLADAHLIPATEVGEIAADQIREYIRLSQYPTATIVFRGTVV  480

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             GTSP+AP+VA+FSSRGPN L  EILKPDVIAPGVNILAGW+GA  P+   +D RR EFNI
Sbjct  481   GTSPAAPKVAAFSSRGPNSLTPEILKPDVIAPGVNILAGWTGASAPTDLDIDPRRTEFNI  540

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+AALLRKA+P WS AAIKSAL+
Sbjct  541   ISGTSMSCPHVSGIAALLRKAYPNWSIAAIKSALI  575



>ref|XP_006465903.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=776

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/395 (69%), Positives = 317/395 (80%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARAFY+GYE++   PI+E+ E KSPRD  GHGTHTAS AAGS+V+NASLF YA+GE
Sbjct  185   KIIGARAFYRGYESYMERPIDETDESKSPRDTEGHGTHTASTAAGSLVSNASLFDYARGE  244

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA+KARIAVYKICWS GC+DSDIL+A DQA+ DGV VISLSV     Y   Y +DS 
Sbjct  245   ARGMAVKARIAVYKICWSPGCFDSDILAAMDQAIADGVDVISLSVGA-SGYAPQYDQDSI  303

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+FGA +HGVVVS  AGN+GPG  TATN+APWILTVGASTIDR FPAD +LGDGRIF 
Sbjct  304   AIGSFGAAQHGVVVSCSAGNSGPGPFTATNIAPWILTVGASTIDREFPADAILGDGRIFG  363

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+GE L D KL LVYGGD    +CY G L  SKV GKIV C+RGGN  V+KG AV+
Sbjct  364   GVSLYAGESLPDFKLHLVYGGDCGDRFCYMGRLEPSKVQGKIVVCDRGGNARVEKGAAVK  423

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  T  +GE + A +H+IPAT V  + G+KI+EYI  +  PTA IVFRGTVI
Sbjct  424   LAGGLGMILANTDESGEELIADSHLIPATMVGAIAGDKIREYIKLSQYPTATIVFRGTVI  483

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
               SP AP+VA+FSSRGPN L  EILKPDVIAPGVNILA W+G+ GP+   +D RRV+FNI
Sbjct  484   SPSPPAPKVAAFSSRGPNSLTAEILKPDVIAPGVNILAAWTGSTGPTDLEIDPRRVDFNI  543

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLRKA+P WSPAAIKSALM
Sbjct  544   ISGTSMSCPHVSGLAALLRKAYPDWSPAAIKSALM  578



>gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata]
Length=777

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/395 (70%), Positives = 308/395 (78%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IG +AFY GYEA  G+ + ES E KSPRD  GHGTHTAS AAGSIVANASL GYA+GE
Sbjct  180   KLIGTKAFYLGYEASRGTTMEESNESKSPRDTEGHGTHTASTAAGSIVANASLLGYAEGE  239

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMAIKARIAVYKICW+ GCYDSDIL+AF+QAV DGV VISLSV      P+ Y  DS 
Sbjct  240   ARGMAIKARIAVYKICWTFGCYDSDILAAFEQAVIDGVDVISLSVGANGHAPQ-YDYDSI  298

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A EHG+VVS  AGN+GP   TA N+APWILTVGAST+DR FPA V LGD   +T
Sbjct  299   AIGAFAAAEHGIVVSCSAGNSGPDPYTAVNIAPWILTVGASTLDRDFPAVVTLGDNTTYT  358

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+GEPLGD  LPLVY  D  + YCYSG L +SKV GKIV C+RGGN   +KG AV 
Sbjct  359   GVSLYAGEPLGDKLLPLVYAADCGNRYCYSGSLDSSKVAGKIVICDRGGNARAEKGNAVH  418

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
             +AGG GMI+   A + E + A AH IPAT V E+ GNKI+ Y+ S P+PTA I F+GTVI
Sbjct  419   QAGGAGMILANLADSAEELLADAHFIPATMVGEIAGNKIRAYVKSDPNPTATITFKGTVI  478

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
              TSP APRVASFSSRGPN    EILKPDVIAPGVNILAGW+G +GP+    D RRV FNI
Sbjct  479   STSPPAPRVASFSSRGPNYRTAEILKPDVIAPGVNILAGWTGYVGPTDLESDSRRVAFNI  538

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLRKAHP WSPAAIKSALM
Sbjct  539   ISGTSMSCPHVSGLAALLRKAHPKWSPAAIKSALM  573



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/395 (69%), Positives = 315/395 (80%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARAF+ GYE+     +  S + KS RD +GHGTHTAS AAGS V NAS F YA+GE
Sbjct  183   KIIGARAFFXGYESNLRGSLKGSSDFKSARDTDGHGTHTASTAAGSFVKNASFFQYARGE  242

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIA YKICW  GCYDSDIL+A DQA+ DGV VISLSV      P  YYRDS 
Sbjct  243   ARGMASRARIAAYKICWEFGCYDSDILAAMDQAISDGVDVISLSVGSSGRAPA-YYRDSI  301

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGAM+HG+VVS  AGN+GPG  TA N+APWI+TVGASTIDR F ADV+LGD R+F+
Sbjct  302   AIGAFGAMQHGIVVSCSAGNSGPGPYTAVNIAPWIVTVGASTIDREFLADVILGDNRVFS  361

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSG+PLGD+KLPLVYGGD  S YCYSG L +SKV G+IV C+RGGN  V KG AV+
Sbjct  362   GVSLYSGDPLGDSKLPLVYGGDCGSRYCYSGSLDSSKVAGRIVVCDRGGNARVAKGGAVK  421

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GM++  T   GE + A +H+IP T V E+ GNK+++YI++ P+PTA IVFRGTVI
Sbjct  422   SAGGLGMVLANTEENGEELLADSHLIPGTMVGEIAGNKLRDYIHTDPNPTATIVFRGTVI  481

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP AP+VASFSSRGPN    EILKPDVIAPGVNILAGWSG   P+G  +D RRVEFNI
Sbjct  482   GDSPPAPKVASFSSRGPNYRTAEILKPDVIAPGVNILAGWSGYSSPTGLNIDPRRVEFNI  541

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+AALLRKA PTWSPAAIKSAL+
Sbjct  542   ISGTSMSCPHVSGVAALLRKAFPTWSPAAIKSALI  576



>ref|XP_011035735.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/395 (69%), Positives = 314/395 (79%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGARAFYKGY    G PI+ES E  SPRD  GHGTHTA+ AAGS+  NASLF YA GE
Sbjct  182   KLIGARAFYKGYITHKGRPIDESKESASPRDTEGHGTHTATTAAGSLAHNASLFQYATGE  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICWS GCYDSDIL+A DQA+ DGVHVISLSV      P+ Y  DS 
Sbjct  242   ARGMASKARIAAYKICWSSGCYDSDILAAMDQAIYDGVHVISLSVGATGHAPQ-YDHDSI  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A +HG+VVS  AGN GPG  TA N+APWILTVGASTIDR FPADVVLG+G + +
Sbjct  301   AIGAFSASQHGIVVSCSAGNAGPGPYTAVNIAPWILTVGASTIDREFPADVVLGNGWVLS  360

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSG+PL D KLPLVY GD  S YCY G +  SKV GKIV C+RGGN  V+KG AV+
Sbjct  361   GVSLYSGDPLVDYKLPLVYAGDVGSRYCYMGSISPSKVQGKIVVCDRGGNARVEKGAAVK  420

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  TA +GE + A +H++PAT V E+  NKI++YI S  SPTA I+FRGT+I
Sbjct  421   LAGGLGMILANTADSGEELIADSHLLPATEVGEIAANKIRQYIKSDQSPTATILFRGTII  480

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G+SP+AP+VA+FSSRGPN L  EILKPDVIAPGVNILAGW+G +GP+   +D RRVEFNI
Sbjct  481   GSSPAAPKVAAFSSRGPNYLTPEILKPDVIAPGVNILAGWTGFVGPTDLELDPRRVEFNI  540

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+ ALLRKA+P WSPAAIKSAL+
Sbjct  541   ISGTSMSCPHVSGIVALLRKAYPDWSPAAIKSALV  575



>ref|XP_008228179.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=810

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/396 (70%), Positives = 318/396 (80%), Gaps = 3/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARA++ GYE+  G  ++E+ E KSPRD  GHGTHTAS AAG++VANAS F YAQGE
Sbjct  220   KIIGARAYFNGYESHIGRLMDETAEAKSPRDTEGHGTHTASTAAGAVVANASFFSYAQGE  279

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV-AIPRAYPEDYYRDS  358
             ARGMA KARIAVYKICWS GC+DSDIL+A DQA+ DGV +ISLSV A  RA P D  RDS
Sbjct  280   ARGMATKARIAVYKICWSSGCFDSDILAAMDQAIADGVDIISLSVGAGGRAPPYD--RDS  337

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAFGA +HGV+VS  AGN+GP   TATN+APWILTVGASTIDR FPADVVLGD R+ 
Sbjct  338   IAIGAFGAAQHGVLVSASAGNSGPNPFTATNIAPWILTVGASTIDREFPADVVLGDNRVI  397

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             +G+SLYSGEPL D KLPLV+GGD  S YCY G L  SKV GKIV C+RGGN  V KG AV
Sbjct  398   SGVSLYSGEPLVDYKLPLVHGGDCGSRYCYEGALQPSKVQGKIVVCDRGGNARVAKGGAV  457

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             + AGG+GMI+  T  +GE + A  H+IPAT V E+  N+I+EYI  +  PTA IVFRGTV
Sbjct  458   KLAGGLGMILANTEESGEELLADGHLIPATEVGEIAANQIREYIRLSQYPTATIVFRGTV  517

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             IG+SPS+PRVA+FSSRGPN L  EILKPDVIAPGVNILAGW+GA  P+   +D RRVEFN
Sbjct  518   IGSSPSSPRVAAFSSRGPNSLTPEILKPDVIAPGVNILAGWTGATAPTDLDIDPRRVEFN  577

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSG+AALLRKA+P WS AAIKSAL+
Sbjct  578   IISGTSMSCPHVSGIAALLRKAYPNWSIAAIKSALI  613



>ref|XP_007217156.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
 gb|EMJ18355.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
Length=772

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/395 (69%), Positives = 314/395 (79%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARA++ GYE+  G  ++E+ E KSPRD  GHGTHTAS AAG++VANAS F YAQG+
Sbjct  182   KIIGARAYFNGYESHIGRLMDETTEAKSPRDTEGHGTHTASTAAGAVVANASFFSYAQGD  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIAVYKICWS GC+DSDIL+A DQA+ DGV +ISLSV      P  Y RDS 
Sbjct  242   ARGMATKARIAVYKICWSFGCFDSDILAAMDQAIADGVDIISLSVGASGNAPP-YDRDSI  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA +HGV+VS  AGN+GP   TATN+APWILTVGASTIDR FPADVVLGD R+ +
Sbjct  301   AIGAFGAAQHGVLVSASAGNSGPNPFTATNIAPWILTVGASTIDREFPADVVLGDNRVIS  360

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSGEPL D KLPLVYGGD  S YCY G L  SKV GKIV C+RGGN  V KG AV+
Sbjct  361   GVSLYSGEPLVDYKLPLVYGGDCGSRYCYEGALQPSKVQGKIVVCDRGGNARVAKGGAVK  420

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  T  +GE + A  H+IPAT V E+  N+I+EYI  +  PTA IVFRGTVI
Sbjct  421   LAGGLGMILANTEESGEELLADGHLIPATEVGEIAANQIREYIRLSQYPTATIVFRGTVI  480

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G+SPS+P+VA+FSSRGPN L  EILKPDVIAPGVNILAGW+GA  P+   +D RRVEFNI
Sbjct  481   GSSPSSPQVAAFSSRGPNSLTPEILKPDVIAPGVNILAGWTGATAPTDLDIDPRRVEFNI  540

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+AALLRKA P WS AAIKSAL+
Sbjct  541   ISGTSMSCPHVSGIAALLRKAFPNWSIAAIKSALI  575



>ref|XP_006426684.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
 gb|ESR39924.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
Length=776

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/395 (69%), Positives = 315/395 (80%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARAFY+GYE++   PI+E+ E KSPRD  GHGTHTAS AAGS+V+NASLF YA+GE
Sbjct  185   KIIGARAFYRGYESYMERPIDETEESKSPRDTEGHGTHTASTAAGSLVSNASLFDYARGE  244

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA+KARIAVYKICWS GC+DSDIL+A DQA+ DGV VISLSV     Y   Y +DS 
Sbjct  245   ARGMAVKARIAVYKICWSPGCFDSDILAAMDQAIADGVDVISLSVGA-SGYAPQYDQDSI  303

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+FGA +HGVVVS  AGN+GPG  TATN+APWILTVGASTIDR FPAD +LGDGR F 
Sbjct  304   AIGSFGAAQHGVVVSCSAGNSGPGPFTATNIAPWILTVGASTIDREFPADAILGDGRSFG  363

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+GE L D KL LVYGGD    +CY G L  SKV GKIV C+RGGN  V+KG AV+
Sbjct  364   GVSLYAGESLPDFKLRLVYGGDCGDRFCYMGRLEPSKVQGKIVVCDRGGNARVEKGAAVK  423

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  T  +GE + A +H+IPAT V  + G+KI+EYI  +  PTA IVFRGTVI
Sbjct  424   LAGGLGMILANTDESGEELIADSHLIPATMVGAIAGDKIREYIKLSQYPTATIVFRGTVI  483

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
               SP AP+VA+FSSRGPN L  EILKPDVIAPGVNILA W+G+ GP+   +D RRV+FNI
Sbjct  484   SPSPPAPKVAAFSSRGPNSLTAEILKPDVIAPGVNILAAWTGSTGPTDLEIDCRRVDFNI  543

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLRKA+P WSPA IKSALM
Sbjct  544   ISGTSMSCPHVSGLAALLRKAYPDWSPAVIKSALM  578



>ref|XP_004141706.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004155913.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45480.1| Subtilase family protein [Cucumis sativus]
Length=771

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/395 (69%), Positives = 313/395 (79%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARA++ GYE+     +  S + KS RD  GHGTHTAS AAGS V NAS F YA+GE
Sbjct  183   KIIGARAYFYGYESNLRGSLKVSSDFKSARDTEGHGTHTASTAAGSFVNNASFFQYARGE  242

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIA YKICW  GCYDSDIL+A DQA+ DGV VISLSV      P  YYRDS 
Sbjct  243   ARGMASRARIAAYKICWEFGCYDSDILAAMDQAISDGVDVISLSVGSSGRAPA-YYRDSI  301

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGAM+HGVVVS  AGN+GPG  TA N+APWILTVGASTIDR F ADV+LGDGR+F+
Sbjct  302   AIGAFGAMQHGVVVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFLADVILGDGRVFS  361

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSG+PLGD+KL LVYGGD  S YCYSG L +SKV GKIV C+RGGN  V KG AV+
Sbjct  362   GVSLYSGDPLGDSKLQLVYGGDCGSRYCYSGSLDSSKVAGKIVVCDRGGNARVAKGGAVK  421

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GM++  T   GE + A +H+IP T V  + GNK+++YI++ P+PTA IVFRGTVI
Sbjct  422   SAGGLGMVLANTEENGEELLADSHLIPGTMVGAIAGNKLRDYIHTDPNPTATIVFRGTVI  481

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP APRVA+FSSRGPN    EILKPDVIAPGVNILAGWSG   P+G  +D RRVEFNI
Sbjct  482   GDSPPAPRVAAFSSRGPNYRTAEILKPDVIAPGVNILAGWSGYSSPTGLNIDPRRVEFNI  541

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+AALLRKA PTWSPAAIKSAL+
Sbjct  542   ISGTSMSCPHVSGVAALLRKAFPTWSPAAIKSALI  576



>ref|XP_003547763.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/395 (69%), Positives = 314/395 (79%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGA+AFYKGYE++   PI+ES E KSPRD  GHGTHTAS AAG++V+NASLF YA+GE
Sbjct  180   KIIGAKAFYKGYESYLERPIDESQESKSPRDTEGHGTHTASTAAGAVVSNASLFHYARGE  239

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICW LGC+DSDIL+A D+AV DGVHVISLSV     Y   YYRDS 
Sbjct  240   ARGMATKARIAAYKICWKLGCFDSDILAAMDEAVSDGVHVISLSVG-SSGYAPQYYRDSI  298

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAFGA +H V+VS  AGN+GPG  TA N+APWILTVGAST+DR FPADV+LGDGR+F 
Sbjct  299   AVGAFGAAKHNVLVSCSAGNSGPGPSTAVNIAPWILTVGASTVDREFPADVILGDGRVFG  358

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY GE L D KLPLVY  D  S YCY G L +SKV GKIV C+RGGN  V+KG AV+
Sbjct  359   GVSLYYGESLPDFKLPLVYAKDCGSRYCYIGSLESSKVQGKIVVCDRGGNARVEKGSAVK  418

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
               GG+GMI+  T   GE + A AH++ AT V +  G+KIKEYI  +  PTA I FRGTVI
Sbjct  419   LTGGLGMIMANTEANGEELLADAHLLAATMVGQTAGDKIKEYIKLSQYPTATIEFRGTVI  478

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SPSAP+VASFSSRGPN L  +ILKPDVIAPGVNILAGW+G +GP+   +D RRVEFNI
Sbjct  479   GGSPSAPQVASFSSRGPNHLTSQILKPDVIAPGVNILAGWTGRVGPTDLDIDPRRVEFNI  538

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPH SG+AALLRKA+P WSPAAIKSALM
Sbjct  539   ISGTSMSCPHASGIAALLRKAYPEWSPAAIKSALM  573



>ref|XP_011072593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=774

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/395 (69%), Positives = 308/395 (78%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGA+ FY GYEA  G  + ES E KSPRD  GHGTHTAS AAGS V NASLFGYA+GE
Sbjct  179   KIIGAKTFYLGYEASRGKTMEESNESKSPRDTEGHGTHTASTAAGSRVVNASLFGYAKGE  238

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA+KARIAVYKICW+ GCYDSDIL+A + A++DGV VISLSV     Y   Y  DS 
Sbjct  239   ARGMAVKARIAVYKICWAFGCYDSDILAAMEHAIEDGVDVISLSVGA-NGYAPQYDFDSI  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA EHG+VVS  AGN+GP + TA N+APWILTVGAST+DR FPADV+LGDGR F 
Sbjct  298   AIGAFGAAEHGIVVSCSAGNSGPDSYTAVNIAPWILTVGASTLDREFPADVILGDGRTFG  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY G+ LG+  LPLVYG D  S YCY+G+L  +KV GKIV C+RGGN  V+KG AV 
Sbjct  358   GVSLYHGDSLGEKLLPLVYGADCGSRYCYTGQLDPAKVAGKIVICDRGGNARVEKGNAVH  417

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG G+I+   A +GE + A AH IPAT V +  G+KI+ Y  S P+PTA I FRGTVI
Sbjct  418   VAGGAGLIMANLADSGEELLADAHFIPATMVGQTAGDKIRAYARSDPNPTATIAFRGTVI  477

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
              TSP APRVASFSSRGP+    EILKPDVIAPGVNILAGW+G IGP+    D R+VEFNI
Sbjct  478   STSPPAPRVASFSSRGPSYRTAEILKPDVIAPGVNILAGWTGYIGPTDLESDTRKVEFNI  537

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLRKAHP WSPAAIKSALM
Sbjct  538   ISGTSMSCPHVSGLAALLRKAHPKWSPAAIKSALM  572



>ref|XP_004305758.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=773

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/395 (68%), Positives = 313/395 (79%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARA++ GYE+  G P++ES E +SPRD  GHGTHTAS A GS V+NAS + YA GE
Sbjct  183   KIIGARAYFNGYESHLGKPMDESNESRSPRDTEGHGTHTASTAGGSRVSNASFYEYASGE  242

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICW+ GC+DSDIL+A DQA+ DGVH+ISLSV      P  Y RDS 
Sbjct  243   ARGMASKARIAAYKICWTFGCFDSDILAAMDQAIADGVHIISLSVGASGGAPP-YDRDSI  301

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA +HGV+VS  AGN+GPG  TATN+APWILTVGAST+DR FPADVVLGDGR+F 
Sbjct  302   AIGAFGAAQHGVLVSASAGNSGPGKFTATNIAPWILTVGASTLDREFPADVVLGDGRVFN  361

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSGE L D KLPLVYGGD  S  CYSG L  SKV GKIV C+RGGN  V KG AV+
Sbjct  362   GVSLYSGEGLMDYKLPLVYGGDCGSRLCYSGALQPSKVQGKIVVCDRGGNARVAKGSAVK  421

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  T  +GE + A +H+IPAT V +M  ++I+ YI +  + TA I FRGTVI
Sbjct  422   LAGGIGMIMANTEESGEELLADSHLIPATMVGQMAADQIRSYIKTGHNATATIKFRGTVI  481

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             GTSP +P+VASFSSRGPN L  EILKPDVIAPGVNILAGW+GA  P+   +D RRVEFNI
Sbjct  482   GTSPPSPKVASFSSRGPNSLTPEILKPDVIAPGVNILAGWTGASSPTDLDIDPRRVEFNI  541

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+AALLRKA+P WSPAAIKSAL+
Sbjct  542   ISGTSMSCPHVSGIAALLRKAYPKWSPAAIKSALV  576



>ref|XP_010261833.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=783

 Score =   533 bits (1373),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 267/397 (67%), Positives = 314/397 (79%), Gaps = 3/397 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGARAFY+GYEA  G P+N++VE KSPRD  GHGTHTAS AAG+ V  A  + +A GE
Sbjct  183   KIIGARAFYRGYEAALGRPMNDTVESKSPRDTEGHGTHTASTAAGAAVREAGFYKFAVGE  242

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIA YK+CW LGC+DSDIL+A D A+ DGVH+ISLSV     Y   YY DS 
Sbjct  243   ARGMATRARIAAYKVCWKLGCFDSDILAAMDHAIADGVHIISLSVGA-TGYAPPYYHDSI  301

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA++ GV+VS  AGN+GP   TA N+APWI+TVGASTIDR FPADVVLGDGR+F 
Sbjct  302   AIGAFGAIQKGVLVSCSAGNSGPEPYTAVNIAPWIITVGASTIDREFPADVVLGDGRVFN  361

Query  542   GMSLYSGEPLGD--NKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFA  715
             G+SLYSG+PLGD  + LPLVY  D  S  CY G+L  +KV GKIV C+RGGN  V+KG A
Sbjct  362   GVSLYSGDPLGDSGHLLPLVYAADCGSRLCYPGKLDPTKVAGKIVVCDRGGNARVEKGSA  421

Query  716   VREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGT  895
             ++ +GG GMI+  TA +GE + A +H++PAT V +  G+KI++YI S PSPTA IVFRGT
Sbjct  422   IKISGGAGMIMANTAESGEELIADSHLLPATMVGQTSGDKIRDYIRSDPSPTATIVFRGT  481

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             VIG SPSAP+VASFSSRGPN    EILKPDVIAPGVNILAGW+G  GP+   +D RRVEF
Sbjct  482   VIGASPSAPKVASFSSRGPNYQTAEILKPDVIAPGVNILAGWTGYNGPTDLDIDPRRVEF  541

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NIISGTSMACPHVSGLAALLRKA+P W+PAA+KSALM
Sbjct  542   NIISGTSMACPHVSGLAALLRKAYPKWTPAALKSALM  578



>ref|XP_006583162.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=817

 Score =   533 bits (1374),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 275/396 (69%), Positives = 314/396 (79%), Gaps = 2/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGA+AFYKGYE++   PI+ES E KSPRD  GHGTHTAS AAG++V+NASLF YAQGE
Sbjct  223   KIIGAKAFYKGYESYLERPIDESQESKSPRDTEGHGTHTASTAAGAVVSNASLFHYAQGE  282

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICW LGC+DSDIL+A D+AV DGVHVISLSV     Y   YYRDS 
Sbjct  283   ARGMATKARIAAYKICWKLGCFDSDILAAMDEAVSDGVHVISLSVGA-SGYAPQYYRDSI  341

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAFGA  H V+VS  AGN+GPG  TA N+APWILTVGAST+DR FPADV+LGDGR+F 
Sbjct  342   AVGAFGAARHNVLVSCSAGNSGPGPSTAVNIAPWILTVGASTVDREFPADVILGDGRVFG  401

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY GE L D KLPLVY  D  S YCY G L +SKV GKIV C+RGGN  V+KG AV+
Sbjct  402   GVSLYYGEKLPDFKLPLVYAKDCGSRYCYMGSLESSKVQGKIVVCDRGGNARVEKGSAVK  461

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  T   GE + A AH++ AT V +  G+KIKEYI  +  PTA I FRGTVI
Sbjct  462   LAGGLGMIMANTEANGEELLADAHLLAATMVGQAAGDKIKEYIKLSQYPTATIEFRGTVI  521

Query  902   GTS-PSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             G S PSAP+VASFSSRGPN L  +ILKPDVIAPGVNILAGW+G +GP+   +D RRVEFN
Sbjct  522   GGSEPSAPQVASFSSRGPNHLTSQILKPDVIAPGVNILAGWTGRVGPTDLDIDPRRVEFN  581

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPH SG+AALLRKA+P WSPAAIKSALM
Sbjct  582   IISGTSMSCPHASGIAALLRKAYPEWSPAAIKSALM  617



>ref|XP_010654422.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=788

 Score =   531 bits (1369),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 271/395 (69%), Positives = 309/395 (78%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGAR F++GYE+  G  I+ES E KSPRD  GHGTHTAS AAGS+V NAS+F YA GE
Sbjct  197   KIIGARTFHRGYESALGRQIDESEESKSPRDTEGHGTHTASTAAGSVVQNASMFEYANGE  256

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIAVYKICW+ GC DSDIL+A DQA+ DGVHVISLSV      P+ Y RDS 
Sbjct  257   ARGMATKARIAVYKICWNQGCLDSDILAAMDQAIADGVHVISLSVGAKGLAPK-YDRDSI  315

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGAMEHGV+VS   GN+GP   TA N+APWILTVGASTIDR FPADVVLG+GRIF 
Sbjct  316   AIGAFGAMEHGVIVSCSVGNSGPKPFTAVNIAPWILTVGASTIDREFPADVVLGNGRIFR  375

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+G+PL    LPLV   +  S  C +G+L  S V+GKIV C+RGG   V+KG AV+
Sbjct  376   GVSLYTGDPLNATHLPLVLADECGSRLCVAGKLNPSLVSGKIVVCDRGGGKRVEKGRAVK  435

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG GMI+  T  TGE + A +H+IPAT V +  G++IK Y +S  SPTA I FRGTV+
Sbjct  436   LAGGAGMILANTKTTGEELVADSHLIPATMVGKTAGDEIKRYADSKSSPTATIAFRGTVM  495

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G S  AP+VASFSSRGPN L  EILKPDVIAPGVNILAGW+G+  P+G  MD+RRVEFNI
Sbjct  496   GNSLLAPKVASFSSRGPNRLTPEILKPDVIAPGVNILAGWTGSNSPTGLDMDERRVEFNI  555

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSMACPHVSGLAALLRKAHP WSPAAIKSALM
Sbjct  556   ISGTSMACPHVSGLAALLRKAHPDWSPAAIKSALM  590



>emb|CAN75239.1| hypothetical protein VITISV_014205 [Vitis vinifera]
Length=768

 Score =   530 bits (1365),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 271/395 (69%), Positives = 309/395 (78%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGAR F++GYE+  G  I+ES E KSPRD  GHGTHTAS AAGS+V NAS+F YA GE
Sbjct  177   KIIGARTFHRGYESALGRQIDESEESKSPRDTEGHGTHTASTAAGSVVQNASMFEYANGE  236

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIAVYKICW+ GC DSDIL+A DQA+ DGVHVISLSV      P+ Y RDS 
Sbjct  237   ARGMATKARIAVYKICWNQGCLDSDILAAMDQAIADGVHVISLSVGAKGLAPK-YDRDSI  295

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGAMEHGV+VS   GN+GP   TA N+APWILTVGASTIDR FPADVVLG+GRIF 
Sbjct  296   AIGAFGAMEHGVIVSCSVGNSGPKPFTAVNIAPWILTVGASTIDREFPADVVLGNGRIFR  355

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+G+PL    LPLV   +  S  C +G+L  S V+GKIV C+RGG   V+KG AV+
Sbjct  356   GVSLYTGDPLNAPHLPLVLADECGSRLCVAGKLNPSLVSGKIVVCDRGGGKRVEKGRAVK  415

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG GMI+  T  TGE + A +H+IPAT V +  G++IK Y +S  SPTA I FRGTV+
Sbjct  416   LAGGAGMILANTKTTGEELVADSHLIPATMVGKTAGDEIKRYADSKSSPTATIAFRGTVM  475

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G S  AP+VASFSSRGPN L  EILKPDVIAPGVNILAGW+G+  P+G  MD+RRVEFNI
Sbjct  476   GNSLLAPKVASFSSRGPNRLTPEILKPDVIAPGVNILAGWTGSNSPTGLDMDERRVEFNI  535

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSMACPHVSGLAALLRKAHP WSPAAIKSALM
Sbjct  536   ISGTSMACPHVSGLAALLRKAHPDWSPAAIKSALM  570



>ref|XP_010542387.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=781

 Score =   530 bits (1364),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 271/397 (68%), Positives = 315/397 (79%), Gaps = 3/397 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGARAFYKGYE+     +++S E KSPRD  GHGTHTAS AAGS+VANASL+ YA+GE
Sbjct  185   KLIGARAFYKGYESHLNGSMDDSKESKSPRDTEGHGTHTASTAAGSVVANASLYQYARGE  244

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICWS GCYDSDIL+A DQAV DGV VISLSV      P  Y+ DS 
Sbjct  245   ARGMASKARIAAYKICWSSGCYDSDILAAMDQAVSDGVQVISLSVGANGLAPA-YHEDSI  303

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA +HGVVVS  AGN+GPG  TA N+APWILTVGASTIDR FPAD V+GDGR+F 
Sbjct  304   AIGAFGAAQHGVVVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADAVIGDGRVFY  363

Query  542   GMSLYSGE-PLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             G SLY+GE  L D+++PLVY GD  S  CY G+L +S V GKIV C+RGGN  V+KG AV
Sbjct  364   GTSLYAGEDSLSDSQIPLVYSGDCGSRLCYPGKLNSSLVKGKIVLCDRGGNARVEKGSAV  423

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYIN-SAPSPTAAIVFRGT  895
             ++AGG+GMI+  T  +GE + A +H+IPAT V    GN+I++YI  S+ SPTA I F GT
Sbjct  424   KQAGGLGMILANTDESGEELTADSHLIPATMVGSAAGNQIRDYIKISSESPTATIRFEGT  483

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             VIG SPSAPRVA+FSSRGPN L  +ILKPDVIAPGVNILAGW+G++GP+   +D RRV F
Sbjct  484   VIGPSPSAPRVAAFSSRGPNHLTPQILKPDVIAPGVNILAGWTGSVGPTDLDIDPRRVTF  543

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NIISGTSM+CPHVSGLAALLRKAHP WSPA IKSAL+
Sbjct  544   NIISGTSMSCPHVSGLAALLRKAHPNWSPAMIKSALV  580



>emb|CAN75240.1| hypothetical protein VITISV_014207 [Vitis vinifera]
Length=579

 Score =   522 bits (1345),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 260/379 (69%), Positives = 305/379 (80%), Gaps = 1/379 (0%)
 Frame = +2

Query  50    GSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGEARGMAIKARIAVYKIC  229
             G P++ES E KSPRD  GHGTHTAS AAGS+V +ASLF +A+GEARGMA+KARIA YKIC
Sbjct  2     GRPMDESAESKSPRDTEGHGTHTASTAAGSVVQDASLFEFAKGEARGMAVKARIAAYKIC  61

Query  230   WSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDSTAIGAFGAMEHGVVVST  409
             WSLGC+DSDIL+A DQAV DGV +ISLSV      P  Y  DS AIGAFGAM+HGV+VS 
Sbjct  62    WSLGCFDSDILAAMDQAVADGVDIISLSVGATGLAPR-YDHDSIAIGAFGAMDHGVLVSC  120

Query  410   VAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFTGMSLYSGEPLGDNKLP  589
              AGN+GP   TA N+APWILTVGASTIDR FPADVVLGDGRIF G+S+YSG+PL D  LP
Sbjct  121   SAGNSGPDPLTAVNIAPWILTVGASTIDREFPADVVLGDGRIFGGVSIYSGDPLKDTNLP  180

Query  590   LVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVREAGGVGMIVDGTAGTG  769
             LVY GD  S +C++G+L  S+V+GKIV C+RGGN  V+KG AV+ A G GMI+  T  +G
Sbjct  181   LVYAGDCGSRFCFTGKLNPSQVSGKIVICDRGGNARVEKGTAVKMALGAGMILANTGDSG  240

Query  770   ELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVIGTSPSAPRVASFSSRG  949
             E + A +H++PAT V ++ G+KIKEY+ S   PTA I FRGTVIGTSP AP+VA+FSSRG
Sbjct  241   EELIADSHLLPATMVGQIAGDKIKEYVKSKAFPTATIAFRGTVIGTSPPAPKVAAFSSRG  300

Query  950   PNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNIISGTSMACPHVSGLAA  1129
             PN L  EILKPDVIAPGVNILAGW+G+  P+   +D RRVEFNIISGTSM+CPHVSGLAA
Sbjct  301   PNHLTPEILKPDVIAPGVNILAGWTGSKAPTDLDVDPRRVEFNIISGTSMSCPHVSGLAA  360

Query  1130  LLRKAHPTWSPAAIKSALM  1186
             LLRKA+P W+PAAIKSALM
Sbjct  361   LLRKAYPKWTPAAIKSALM  379



>ref|XP_007135429.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
 gb|ESW07423.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
Length=778

 Score =   526 bits (1356),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 271/395 (69%), Positives = 314/395 (79%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGA+AFYKGYEA+   PI+ES E KSPRD  GHGTHT+S AAG +V+NASLF YAQGE
Sbjct  185   KIIGAKAFYKGYEAYLDGPIDESAESKSPRDTEGHGTHTSSTAAGGVVSNASLFHYAQGE  244

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICW  GC+DSDIL+A D+AV DGVHVISLSV     Y   Y+RDS 
Sbjct  245   ARGMATKARIAAYKICWKYGCFDSDILAAMDEAVADGVHVISLSVG-SSGYAPQYFRDSI  303

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAFGA  H V+VS  AGN+GPG  TA N+APWILTVGASTIDR FPADV+LGDGR+F 
Sbjct  304   ALGAFGAARHNVLVSCSAGNSGPGPFTAVNIAPWILTVGASTIDREFPADVILGDGRVFG  363

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY GE L D +L LVY  D  + YCY G L ASKV GKIV C+RGGN  V+KG AV+
Sbjct  364   GVSLYYGESLPDFQLRLVYAKDCGNRYCYLGSLEASKVQGKIVVCDRGGNARVEKGSAVK  423

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  TA +GE + A AH++ AT V ++ G++IK+YI  +  PTA I F+GTVI
Sbjct  424   LAGGLGMIMANTAESGEELLADAHLLAATMVGQIAGDEIKKYIRLSQYPTATIEFKGTVI  483

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SPSAP+VASFSSRGPN L  EILKPDVIAPGVNILAGW+G +GP+   +D RRVEFNI
Sbjct  484   GGSPSAPQVASFSSRGPNHLTSEILKPDVIAPGVNILAGWTGRVGPTDLDIDPRRVEFNI  543

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPH SG+AALLRKA+P WSPAAIKSALM
Sbjct  544   ISGTSMSCPHASGIAALLRKAYPEWSPAAIKSALM  578



>ref|XP_003570496.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=785

 Score =   526 bits (1355),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 263/395 (67%), Positives = 310/395 (78%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GA+ +YKGYE   G  ++E+ E KSP D  GHG+HTAS AAGS VA ASLF YA+G+
Sbjct  190   KLVGAKFYYKGYEEGLGRAMDEAEESKSPLDTEGHGSHTASTAAGSPVAGASLFDYARGQ  249

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A GMA  ARIA YKICW+ GCYDSDIL+AFD+AV DGV VISLSV      P  ++RDS 
Sbjct  250   AVGMAPGARIAAYKICWANGCYDSDILAAFDEAVYDGVDVISLSVGAGSLAPP-FFRDSI  308

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGAM+ G+VVS  AGN+GPG  TATN+APWILTVGAST+DR FPADV+LGDG+++ 
Sbjct  309   AIGAFGAMKKGIVVSASAGNSGPGEYTATNIAPWILTVGASTVDREFPADVLLGDGKVYG  368

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+GEPLG  KLP+VY  D  S YCY G L  SKV GKIV C+RGGN  V+KG AV+
Sbjct  369   GVSLYAGEPLGSRKLPVVYAADCGSAYCYRGSLDESKVAGKIVICDRGGNARVEKGAAVK  428

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  T  +GE + A AH++PAT V +  G+KIK+Y+ S PSPTA I FRGTVI
Sbjct  429   LAGGIGMILANTEDSGEELIADAHLVPATMVGQTFGDKIKQYVKSDPSPTATIAFRGTVI  488

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
               SPSAPRVA+FSSRGPN    EILKPDVIAPGVNILA W+G   P+   +D RRVEFNI
Sbjct  489   AGSPSAPRVAAFSSRGPNYRAREILKPDVIAPGVNILAAWTGESAPTDLAIDPRRVEFNI  548

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLR+AHP WSPAA+KSALM
Sbjct  549   ISGTSMSCPHVSGLAALLRQAHPDWSPAAVKSALM  583



>ref|XP_002304129.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
 gb|EEE79108.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
Length=774

 Score =   526 bits (1354),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 266/395 (67%), Positives = 311/395 (79%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGARAF KGY +  G  I+ES E  SPRD  GHGTHT++ AAGS V NASLF YA GE
Sbjct  182   KLIGARAFNKGYISHKGRHIDESKESASPRDTEGHGTHTSTTAAGSSVHNASLFEYASGE  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICWS GCYDSDIL+A DQA+ DGVHVISLSV      P+ Y  DS 
Sbjct  242   ARGMASKARIAAYKICWSSGCYDSDILAAMDQAIYDGVHVISLSVGATGHAPQ-YDHDSI  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A +HG+VVS  AGN+GP   TA N+APWILTVGASTIDR FPADVVLG+G +F 
Sbjct  301   AIGAFSASQHGIVVSCSAGNSGPDPYTAVNIAPWILTVGASTIDREFPADVVLGNGWVFG  360

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSG+PL D KLPLVY GD  + YCY G +  SKV GKIV C+RGGN  V+KG AV+
Sbjct  361   GVSLYSGDPLVDFKLPLVYAGDVGNRYCYMGSISPSKVQGKIVVCDRGGNARVEKGAAVK  420

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  TA +GE + A +H++PAT V E+  +KI+EY+  +  PTA I FRGT+I
Sbjct  421   LAGGLGMILANTADSGEELIADSHLLPATEVGEIAADKIREYVKLSQYPTATINFRGTII  480

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             GTSPSAP+VA+FSSRGPN L  EILKPDVIAPGVNILAGW+G +GP+   +D RRVEFNI
Sbjct  481   GTSPSAPKVAAFSSRGPNYLTPEILKPDVIAPGVNILAGWTGFVGPTDLEIDPRRVEFNI  540

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+ ALLRKA+P WSPAAIKS+L+
Sbjct  541   ISGTSMSCPHVSGIVALLRKAYPDWSPAAIKSSLV  575



>ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score =   523 bits (1347),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 265/395 (67%), Positives = 311/395 (79%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGARAF KGY +  G  I++S E  SPRD  GHGTHT++ AAGS V NASLF YA GE
Sbjct  182   KLIGARAFNKGYISHRGRHIDDSKESASPRDTEGHGTHTSTTAAGSSVHNASLFEYASGE  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICWS GCYDSDIL+A DQA+ DGVHVISLSV      P+ Y  DS 
Sbjct  242   ARGMASKARIAAYKICWSSGCYDSDILAAMDQAIYDGVHVISLSVGATGHAPQ-YDHDSI  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A +HG+VVS  AGN+GP   TA N+APWILTVGASTIDR FPADVVLG+G +F+
Sbjct  301   AIGAFSASQHGIVVSCSAGNSGPDPYTAVNIAPWILTVGASTIDREFPADVVLGNGWVFS  360

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSG+PL   KLPLVY GD  + YCY G +  SKV GKIV C+RGGN  V+KG AV+
Sbjct  361   GVSLYSGDPLVGFKLPLVYAGDVGNRYCYMGSISPSKVQGKIVVCDRGGNARVEKGAAVK  420

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  TA +GE + A +H++PAT V E+  NKI+EY+  +  PTA I FRGT+I
Sbjct  421   LAGGLGMILANTADSGEELIADSHLLPATEVGEIAANKIREYVKLSQYPTATINFRGTII  480

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             GTSP+AP+VA+FSSRGPN L  EILKPDVIAPGVNILAGW+G +GP+   +D RRVEFNI
Sbjct  481   GTSPAAPKVAAFSSRGPNYLTPEILKPDVIAPGVNILAGWTGFVGPTDLEIDPRRVEFNI  540

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+ ALLRKA+P WSPAAIKSAL+
Sbjct  541   ISGTSMSCPHVSGIVALLRKAYPDWSPAAIKSALV  575



>ref|XP_009403290.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=773

 Score =   518 bits (1335),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 264/395 (67%), Positives = 304/395 (77%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR FY+GYEA  G PI+E+ E KSP D  GHGTHTAS AAG++V++A  + YA+GE
Sbjct  183   KLIGARFFYQGYEAAMGHPIDETKESKSPLDTEGHGTHTASTAAGAVVSDAGFYQYARGE  242

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICW+ GCYDSDIL+A D A+ DGV VISLSV     Y   +YRDS 
Sbjct  243   ARGMATKARIAAYKICWAGGCYDSDILAAMDAAIADGVDVISLSVGA-GGYAPSFYRDSI  301

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA  HGVVVS  AGN+GPG RTA N+APWILTVGASTIDR FPADVVLGDG  + 
Sbjct  302   AIGAFGAARHGVVVSCSAGNSGPGQRTAVNIAPWILTVGASTIDREFPADVVLGDGNTYG  361

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G SLY+G+P+    LPLVY GD+ S  C  G L A+ V GKIV CERG N  V+KG AV+
Sbjct  362   GASLYAGDPINSTYLPLVYAGDSGSRLCIPGFLDAAVVAGKIVLCERGTNARVEKGSAVK  421

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG GMI+   A +G  + A +H+IPAT V    G+KI +YI S PSPTA IVFRGT I
Sbjct  422   LAGGAGMILANDAASGGELVADSHLIPATMVSHTSGSKITDYIKSQPSPTATIVFRGTAI  481

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP+AP+VA+FSSRGPN    EILKPDVIAPGVNILAGW+G  GP+   +D RRVEFNI
Sbjct  482   GASPAAPKVAAFSSRGPNFRVAEILKPDVIAPGVNILAGWTGMNGPTDLDIDPRRVEFNI  541

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSMACPHVSG+AALLR+A+P WSPAAIKSALM
Sbjct  542   ISGTSMACPHVSGIAALLRRAYPDWSPAAIKSALM  576



>ref|XP_009146419.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=776

 Score =   518 bits (1334),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 261/395 (66%), Positives = 309/395 (78%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGARAFYKGY       +  + E +SPRD  GHGTHTAS AAGS+VANASL+ YA+G 
Sbjct  181   KLIGARAFYKGYLTHRNGTVKAAKESRSPRDTEGHGTHTASTAAGSVVANASLYQYARGV  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICW+ GCYDSDIL+A DQAV DGVHVISLSV     Y  +Y+ DS 
Sbjct  241   ARGMASKARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVGA-NGYAPEYHMDSI  299

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA  HG+VVS  AGN+GPG +TATN+APWILTVGASTIDR F A+ + G+G++FT
Sbjct  300   AIGAFGATRHGIVVSCSAGNSGPGPQTATNIAPWILTVGASTIDREFSANAITGNGKVFT  359

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G SLY+GEPL D++L LVY GD  S  CY G+L AS V GKIV C+RGGN  V+KG AV+
Sbjct  360   GTSLYAGEPLPDSQLSLVYSGDCGSRLCYPGKLNASLVEGKIVLCDRGGNARVEKGSAVK  419

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG GMI+  TA +GE + A +H++PAT V    G++I+EYI  + SPTA I F GT+I
Sbjct  420   IAGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIREYIQKSDSPTATISFLGTLI  479

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP +PRVA+FSSRGPN +   ILKPDVIAPGVNILAGW+G +GP+   +D RRV+FNI
Sbjct  480   GPSPPSPRVAAFSSRGPNHITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNI  539

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLRKAHP WSPAAIKSAL+
Sbjct  540   ISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALV  574



>gb|ADW11233.1| subtilisin-like protease 2 [Phaseolus vulgaris]
Length=810

 Score =   519 bits (1336),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 270/397 (68%), Positives = 314/397 (79%), Gaps = 3/397 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGA+AFYKGYEA+   PI+ES E KSPRD  GHGTHT+S AAG +V+NASLF YAQGE
Sbjct  215   KIIGAKAFYKGYEAYLDGPIDESAESKSPRDTEGHGTHTSSTAAGGVVSNASLFHYAQGE  274

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICW  GC+DSDIL+A D+AV DGVHVISLSV     Y   Y+RDS 
Sbjct  275   ARGMATKARIAAYKICWKYGCFDSDILAAMDEAVADGVHVISLSVG-SSGYAPQYFRDSI  333

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAFGA  H V+VS  AGN+GPG  TA N+APWILTVGASTIDR FPADV+LGDGR+F 
Sbjct  334   ALGAFGAARHNVLVSCSAGNSGPGPFTAVNIAPWILTVGASTIDREFPADVILGDGRVFG  393

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY GE L D +L LVY  D  + YCY G L ASKV GKIV C+RGGN  V+KG AV+
Sbjct  394   GVSLYYGESLPDFQLRLVYAKDCGNRYCYLGSLEASKVQGKIVVCDRGGNARVEKGSAVK  453

Query  722   EAG--GVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGT  895
              AG  G+G+I+  TA +GE + A AH++ AT V ++ G++IK+YI  +  PTA I F+GT
Sbjct  454   LAGAGGLGVIMANTAESGEELLADAHLLAATMVGQIAGDEIKKYIRLSQYPTATIEFKGT  513

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             VIG SPSAP+VASFSSRGPN L  EILKPDVIAPGVNILAGW+G +GP+   +D RRVEF
Sbjct  514   VIGGSPSAPQVASFSSRGPNHLTSEILKPDVIAPGVNILAGWTGRVGPTDLDIDPRRVEF  573

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NIISGTSM+CPH SG+AALLRKA+P WSPAAIKSALM
Sbjct  574   NIISGTSMSCPHASGIAALLRKAYPEWSPAAIKSALM  610



>ref|XP_004954115.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=783

 Score =   518 bits (1334),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 263/395 (67%), Positives = 302/395 (76%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA+ FY+GYEA  G PI+E+ E KSP D  GHGTHTAS AAGS VA A  F YA+G+
Sbjct  192   KLIGAKVFYQGYEAALGHPIDETKESKSPLDTEGHGTHTASTAAGSPVAGAGFFDYAKGQ  251

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A GM   ARIA YKICW  GCYDSDIL+A D+AV DGV VISLSV     Y   +++DS 
Sbjct  252   AVGMDAGARIAAYKICWKSGCYDSDILAAMDEAVADGVDVISLSVGA-GGYAPSFFQDSI  310

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A+  G+VVS  AGN+GPG  TATN+APWILTVGASTIDR FPADVVLGDGR+F 
Sbjct  311   AIGAFHAVSKGIVVSCSAGNSGPGEYTATNIAPWILTVGASTIDREFPADVVLGDGRVFG  370

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+G+PL   +LPLV+ GD  S  C  GEL   KV GKIV CERG    V+KG AV+
Sbjct  371   GVSLYAGDPLNSTQLPLVFAGDCGSRLCLLGELDPKKVAGKIVLCERGKTARVEKGAAVK  430

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG GMI+  T  +GE + A +H++PAT V +  G+KIK Y+ + PSPTA IVFRGTVI
Sbjct  431   LAGGAGMILANTEASGEELVADSHLVPATMVGQKFGDKIKYYVQTDPSPTATIVFRGTVI  490

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SPSAPRVASFSSRGPN    EILKPDVIAPGVNILA W+GA  P+   +D RRVEFNI
Sbjct  491   GKSPSAPRVASFSSRGPNYRAREILKPDVIAPGVNILAAWTGAASPTDLDIDSRRVEFNI  550

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLR+AHP WSPAAIKSALM
Sbjct  551   ISGTSMSCPHVSGLAALLRQAHPDWSPAAIKSALM  585



>gb|EPS74243.1| subtilase family protein, partial [Genlisea aurea]
Length=751

 Score =   517 bits (1331),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 264/395 (67%), Positives = 306/395 (77%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIG +A++ GYEA  G  + ES E  SPRD  GHGTHTAS AAGS+V+NASLFGYA GE
Sbjct  157   KIIGTKAYFLGYEATRGKTMEESNESNSPRDTEGHGTHTASTAAGSVVSNASLFGYAPGE  216

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIAVYKICWS GCYDSDIL+AF+QAV DGV VISLSV      P  YY DS 
Sbjct  217   ARGMASRARIAVYKICWSFGCYDSDILAAFEQAVVDGVDVISLSVGSSGHAPP-YYLDSI  275

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A+E+G+VVS  AGN+GP + +A N+APWILTVGAST+DR FPADV+LGDG  + 
Sbjct  276   AIGAFAAVENGIVVSCSAGNSGPSSYSAVNIAPWILTVGASTLDREFPADVILGDGTTYG  335

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+GE LG  +  LVY  DA + YCYSG L  + V GKIV C+RGGN  V KG +V 
Sbjct  336   GVSLYAGESLGGQQYSLVYAADAGNRYCYSGRLSPALVAGKIVICDRGGNARVAKGNSVH  395

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGGVG+I+   A +GE + A AH IPAT V +  G+KI+ Y  S P+PTA I FRGTVI
Sbjct  396   LAGGVGVILANLADSGEELLADAHFIPATMVGQTAGDKIRSYARSDPNPTATIAFRGTVI  455

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             GTSP APRVASFSSRGPN    EILKPDVIAPGVNILAGW+G +GP+    D R+VEFNI
Sbjct  456   GTSPPAPRVASFSSRGPNYRTAEILKPDVIAPGVNILAGWTGEVGPTDLDSDTRKVEFNI  515

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALL+KAHP W+PAAIKSAL+
Sbjct  516   ISGTSMSCPHVSGLAALLKKAHPDWTPAAIKSALV  550



>gb|KDP40686.1| hypothetical protein JCGZ_24685 [Jatropha curcas]
Length=773

 Score =   517 bits (1332),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 261/395 (66%), Positives = 308/395 (78%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGARAFYKG+ ++ G PI+ES +  SPRD  GHGTHTAS A GS V NAS + +A+GE
Sbjct  181   KLIGARAFYKGFVSYHGKPIDESRDSASPRDTEGHGTHTASTAGGSFVQNASFYQFARGE  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICWS+GC+DSDIL+A DQA+ DGVHVISLSV     Y   Y  DS 
Sbjct  241   ARGMASKARIAAYKICWSIGCFDSDILAAMDQAIADGVHVISLSVG-ATGYAPQYDHDSI  299

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAFGA ++G+VVS  AGN+GP   TA N+APWILTVGASTIDR FPADVVLG+G  F 
Sbjct  300   AVGAFGATQNGIVVSCSAGNSGPDPFTAVNIAPWILTVGASTIDREFPADVVLGNGMTFG  359

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSGEPL D KLPL+Y GD  + YC  G +  SKV GKIV C+RG N  V+KG AV+
Sbjct  360   GVSLYSGEPLVDYKLPLIYAGDCGNRYCLIGGISPSKVQGKIVVCDRGVNARVEKGAAVK  419

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG+GMI+  TA +GE + A +H++PAT V E+ GN+IK+YI     PTA IVF GTVI
Sbjct  420   LAGGLGMILANTADSGEELIADSHLLPATMVGEIAGNQIKQYIKFGQYPTATIVFEGTVI  479

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP AP+VA+FSSRGPN L  EILKPDVIAPGVNILAGW+GA  P+   +D RRV+FNI
Sbjct  480   GNSPPAPKVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGAASPTDLDIDPRRVQFNI  539

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+AALLRKA+  WSPAAIKSAL+
Sbjct  540   ISGTSMSCPHVSGIAALLRKAYTDWSPAAIKSALI  574



>dbj|BAH20348.1| AT3G14067 [Arabidopsis thaliana]
Length=601

 Score =   510 bits (1313),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 258/396 (65%), Positives = 309/396 (78%), Gaps = 2/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGY-EAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGARAFY+GY     G+  + + E +SPRD  GHGTHTAS AAGS+VANASL+ YA+G
Sbjct  6     KLIGARAFYRGYLTQRNGTKKHAAKESRSPRDTEGHGTHTASTAAGSVVANASLYQYARG  65

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              A GMA KARIA YKICW+ GCYDSDIL+A DQAV DGVHVISLSV    + PE Y+ DS
Sbjct  66    TATGMASKARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVGASGSAPE-YHTDS  124

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAFGA  HG+VVS  AGN+GP   TATN+APWILTVGAST+DR F A+ + GDG++F
Sbjct  125   IAIGAFGATRHGIVVSCSAGNSGPNPETATNIAPWILTVGASTVDREFAANAITGDGKVF  184

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG SLY+GE L D++L LVY GD  S  CY G+L +S V GKIV C+RGGN  V+KG AV
Sbjct  185   TGTSLYAGESLPDSQLSLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNARVEKGSAV  244

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             + AGG GMI+  TA +GE + A +H++PAT V    G++I++YI ++ SPTA I F GT+
Sbjct  245   KLAGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTAKISFLGTL  304

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             IG SP +PRVA+FSSRGPN L   ILKPDVIAPGVNILAGW+G +GP+   +D RRV+FN
Sbjct  305   IGPSPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFN  364

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSGLAALLRKAHP WSPAAIKSAL+
Sbjct  365   IISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALV  400



>ref|XP_006298979.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
 gb|EOA31877.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
Length=784

 Score =   516 bits (1329),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 261/396 (66%), Positives = 313/396 (79%), Gaps = 2/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGY-EAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             KIIGARA+YKGY     G+ ++ + E +SPRD  GHGTHTAS AAGS+VANASL+ YAQG
Sbjct  188   KIIGARAYYKGYLTRRNGTKLHAAKESRSPRDTEGHGTHTASTAAGSVVANASLYHYAQG  247

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA KARIA YKICWS GCYDSDIL+A +QAV DGVHVISLSV    + PE Y+RDS
Sbjct  248   TARGMASKARIAAYKICWSSGCYDSDILAALEQAVADGVHVISLSVGASGSAPE-YHRDS  306

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAFGA  HG+VVS  AGN+GPG  TATN+APWILTVGAST+DR F A+V+ GDG++F
Sbjct  307   IAIGAFGATRHGIVVSCSAGNSGPGPETATNIAPWILTVGASTVDREFSANVITGDGKVF  366

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG SLY+GE L D+++ LVY GD  S  C  GEL +S V GKIV C+RGG+  V+KG AV
Sbjct  367   TGTSLYAGESLPDSQISLVYSGDCGSRLCSVGELNSSLVEGKIVLCDRGGSARVEKGRAV  426

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             + AGG GMI+  TA +GE + A +H++PAT V    G++I++YI ++ SPTA I F GT+
Sbjct  427   KLAGGAGMILANTASSGEELTADSHLVPATMVGAKAGDQIRDYIKTSNSPTATISFLGTL  486

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             IG SP +PRVA+FSSRGPN L   ILKPD+IAPGVNILAGW+G +GP+   +D RRV+FN
Sbjct  487   IGPSPPSPRVAAFSSRGPNHLTPVILKPDMIAPGVNILAGWTGMVGPTDLDIDPRRVQFN  546

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSGLAALLRKAHP WSPAAIKSAL+
Sbjct  547   IISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALV  582



>emb|CDY33251.1| BnaC01g37240D [Brassica napus]
Length=775

 Score =   515 bits (1326),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 264/396 (67%), Positives = 312/396 (79%), Gaps = 4/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAF-TGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGARAFYKGY     GS   E  E KSPRD  GHGTHTAS AAGS+V NASL+ YAQG
Sbjct  182   KLIGARAFYKGYLTHRNGSKHAE--ESKSPRDTAGHGTHTASTAAGSVVVNASLYQYAQG  239

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA KARIA YKICW+ GCYDSDIL+A DQAV DGVHVISLSV      PE Y++DS
Sbjct  240   VARGMASKARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVGANGFAPE-YHKDS  298

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAFGAM HG+VVS  AGN+GPG +TATN+APWILTVGAST+DR F A+ + GDG++F
Sbjct  299   IAIGAFGAMRHGIVVSCSAGNSGPGPQTATNIAPWILTVGASTVDREFTANAITGDGKVF  358

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG SLY+GEPL D+++ LVY GD  S  CY G+L +S V GKIV C+RGGN  V+KG AV
Sbjct  359   TGTSLYAGEPLPDSQISLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNARVEKGSAV  418

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             + AGG GMI+  TA +GE + A +H++PAT V    G++I++YI ++ SPTA I F GT+
Sbjct  419   KIAGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKNSDSPTATISFLGTL  478

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             IG SP +PRVA+FSSRGPN +   ILKPDVIAPGVNILAGW+G +GP+   +D RRV+FN
Sbjct  479   IGPSPPSPRVAAFSSRGPNHITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVKFN  538

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSGLAALLRKAHP WSPAAIKSAL+
Sbjct  539   IISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALV  574



>emb|CDY39093.1| BnaA01g29630D [Brassica napus]
Length=775

 Score =   514 bits (1324),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 263/396 (66%), Positives = 312/396 (79%), Gaps = 4/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAF-TGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGARAFYKGY     GS   E  E KSPRD  GHGTHTAS AAGS+V NASL+ YA+G
Sbjct  182   KLIGARAFYKGYLTHRNGSKHAE--ESKSPRDTAGHGTHTASTAAGSVVVNASLYQYARG  239

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA KARIA YKICW+ GCYDSDIL+A DQAV DGVHVISLSV      PE Y++DS
Sbjct  240   VARGMASKARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVGANGFAPE-YHKDS  298

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAFGAM HG+VVS  AGN+GPG +TATN+APWILTVGAST+DR F A+ + GDG++F
Sbjct  299   IAIGAFGAMRHGIVVSCSAGNSGPGPQTATNIAPWILTVGASTVDREFTANAITGDGKVF  358

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG SLY+GEPL D+++PLVY GD  S  CY G+L +S V GKIV C+RGGN  V+KG AV
Sbjct  359   TGTSLYAGEPLPDSQIPLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNARVEKGSAV  418

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             +  GG GMI+  TA +GE + A +H++PAT V    G++I++YI ++ SPTA I F GT+
Sbjct  419   KIGGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKNSNSPTATISFLGTL  478

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             IG SP +PRVA+FSSRGPN +   ILKPDVIAPGVNILAGW+G +GP+   +D RRV+FN
Sbjct  479   IGPSPPSPRVAAFSSRGPNHITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVKFN  538

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSGLAALLRKAHP WSPAAIKSAL+
Sbjct  539   IISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALV  574



>ref|XP_010685295.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=808

 Score =   514 bits (1325),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 262/396 (66%), Positives = 314/396 (79%), Gaps = 3/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KI+GARAFYKGYEA  G P+NE+ E KSPRD  GHGTHTAS AAGS+V +A LF YA+GE
Sbjct  207   KIVGARAFYKGYEAAKG-PMNETKESKSPRDTEGHGTHTASTAAGSVVPDAGLFDYARGE  265

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICWS GCYDSDIL+A DQA++DGVHVISLSV      P+ + +D  
Sbjct  266   ARGMATKARIAAYKICWSTGCYDSDILAAMDQAIEDGVHVISLSVGSSGLAPQ-FDKDGI  324

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGA  A++ GV+VS  AGN+GP A TATN+APWILTVGASTIDR FPADVVLGDGR F 
Sbjct  325   AIGALHAVQSGVLVSCSAGNSGPDAFTATNIAPWILTVGASTIDREFPADVVLGDGRTFK  384

Query  542   GMSLYSGEPLGDN-KLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             G+SLY G+ L D+  L LV G D  S  C +G+L  SK  GK+V C+RG    V KG AV
Sbjct  385   GVSLYYGDGLNDSVYLELVRGADCGSRLCKAGDLDTSKAAGKMVICDRGDTARVAKGDAV  444

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             ++AGGVGMI+  TA +GE + A +H+IPAT V ++ G++I++Y+++ P+PTA I F+GTV
Sbjct  445   KQAGGVGMILANTAESGEELIADSHLIPATMVGQIAGDQIRDYVSAVPNPTATIRFKGTV  504

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             IG SPSAPRVA+FSSRGPN L  EILKPDVIAPGVNILAGW+G+  P+   +D RRV+FN
Sbjct  505   IGPSPSAPRVAAFSSRGPNHLTPEILKPDVIAPGVNILAGWTGSAAPTDLEIDPRRVQFN  564

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSGLAALLR A+P+WSPAA+KSALM
Sbjct  565   IISGTSMSCPHVSGLAALLRNAYPSWSPAAVKSALM  600



>ref|XP_002885009.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61268.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=777

 Score =   513 bits (1321),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 261/396 (66%), Positives = 309/396 (78%), Gaps = 2/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGY-EAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGARA+YKGY     G+  + + E +SPRD  GHGTHTAS AAGS+VANASLF YA G
Sbjct  182   KLIGARAYYKGYLTQRNGTKKHAAKESRSPRDTEGHGTHTASTAAGSVVANASLFQYAPG  241

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA KARIA YKICWS GCYDSDIL+A DQAV DGVHVISLSV     Y  +Y+ DS
Sbjct  242   TARGMASKARIAAYKICWSSGCYDSDILAAMDQAVADGVHVISLSVGA-SGYAPEYHTDS  300

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAFGA  HG+VVS  AGN+GPG  TATN+APWILTVGAST+DR F A+ + GDG++F
Sbjct  301   IAIGAFGATRHGIVVSCSAGNSGPGPETATNIAPWILTVGASTVDREFSANAITGDGKVF  360

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG SLY+GE L D++L LVY GD  S  CY G+L +S V GKIV C+RGGN  V+KG AV
Sbjct  361   TGTSLYAGESLPDSQLSLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNARVEKGSAV  420

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             + AGG GMI+  TA +GE + A +H++PAT V    G++I++YI ++ SPTA I F GT+
Sbjct  421   KIAGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTAKISFLGTL  480

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             IG SP +PRVA+FSSRGPN L   ILKPDVIAPGVNILAGW+G +GP+   +D RRV+FN
Sbjct  481   IGPSPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFN  540

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSGLAALLRKAHP WSPAAIKSAL+
Sbjct  541   IISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALV  576



>ref|XP_009117189.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score =   512 bits (1319),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 262/396 (66%), Positives = 312/396 (79%), Gaps = 4/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAF-TGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGARAFYKGY     GS   E  E KSPRD  GHGTHTAS AAGS+V NASL+ YA+G
Sbjct  182   KLIGARAFYKGYLTHRNGSKHAE--ESKSPRDTAGHGTHTASTAAGSVVVNASLYQYARG  239

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARG+A KARIA YKICW+ GCYDSDIL+A DQAV DGVHVISLSV      PE Y++DS
Sbjct  240   VARGVASKARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVGANGFAPE-YHKDS  298

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAFGAM HG+VVS  AGN+GPG +TATN+APWILTVGAST+DR F A+ + GDG++F
Sbjct  299   IAIGAFGAMRHGIVVSCSAGNSGPGPQTATNIAPWILTVGASTVDREFTANAITGDGKVF  358

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG SLY+GEPL D+++PLVY GD  S  CY G+L +S V GKIV C+RGGN  V+KG AV
Sbjct  359   TGTSLYAGEPLPDSQIPLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNARVEKGSAV  418

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             +  GG GMI+  TA +GE + A +H++PAT V    G++I++YI ++ SPTA I F GT+
Sbjct  419   KIGGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKNSNSPTATISFLGTL  478

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             IG SP +PRVA+FSSRGPN +   ILKPDVIAPGVNILAGW+G +GP+   +D RRV+FN
Sbjct  479   IGPSPPSPRVAAFSSRGPNHITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVKFN  538

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSGLAALLRKAHP WSPAAIKSAL+
Sbjct  539   IISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALV  574



>gb|KFK38761.1| hypothetical protein AALP_AA3G157200 [Arabis alpina]
Length=775

 Score =   511 bits (1315),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 257/397 (65%), Positives = 311/397 (78%), Gaps = 3/397 (1%)
 Frame = +2

Query  2     KIIGARAFYKGY--EAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQ  175
             K+IGARAFY+GY       S  + + E +SPRD  GHGTHTAS AAGS+VANASLF YAQ
Sbjct  179   KLIGARAFYRGYLTSKKNASSTHTAKESRSPRDTEGHGTHTASTAAGSVVANASLFHYAQ  238

Query  176   GEARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRD  355
             G ARGMA KARIA YKICW+ GCYDSDI++A DQA+ DGVHVISLSV     +  +Y+ D
Sbjct  239   GIARGMASKARIAAYKICWTGGCYDSDIMAAMDQAIADGVHVISLSVG-SSGFASEYHMD  297

Query  356   STAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRI  535
             S AIGAFGA  HG+VVS  AGN+GPG+ TATN+APWILTVGAST+DR F A+ + GDG++
Sbjct  298   SIAIGAFGATRHGIVVSCSAGNSGPGSETATNIAPWILTVGASTVDREFSANAITGDGKV  357

Query  536   FTGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFA  715
             FTG SLY+GEPL ++++ LVY GD  S  CYSG+L +S V GKIV C+RGGN  V+KG A
Sbjct  358   FTGTSLYAGEPLPNSQISLVYSGDCGSRLCYSGKLNSSLVEGKIVLCDRGGNARVEKGSA  417

Query  716   VREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGT  895
             V+ AGG GMI+  TA +GE + A +H++PAT V    G++I++YI S+ SPTA I F GT
Sbjct  418   VKLAGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKSSESPTATISFLGT  477

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             +IG SP +PRVA+FSSRGPN +   ILKPDVIAPGVNILAGW+G +GP+   +D RRV+F
Sbjct  478   LIGPSPPSPRVAAFSSRGPNHVTPIILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQF  537

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NIISGTSM+CPHVSGLAALLRKAH  WSPAAIKSAL+
Sbjct  538   NIISGTSMSCPHVSGLAALLRKAHLDWSPAAIKSALV  574



>dbj|BAJ87876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score =   511 bits (1315),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 256/395 (65%), Positives = 301/395 (76%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GA+ FYKGYEA  G PINE++E KSP D  GHGTHTAS AAGS V  A  + YA+G 
Sbjct  193   KLVGAKFFYKGYEAGLGHPINENLESKSPLDTEGHGTHTASTAAGSPVDGAGFYNYARGR  252

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A GMA  ARIA YKICW  GCYDSDIL+AFD+AV DGV+VISLSV     Y   +Y DS 
Sbjct  253   AVGMAPTARIAAYKICWKSGCYDSDILAAFDEAVGDGVNVISLSVG-SSGYASAFYEDSI  311

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA++ G+VVS  AGN+GPG  TA+N+APWILTV AS+IDR FPAD +LGDG ++ 
Sbjct  312   AIGAFGAVKKGIVVSASAGNSGPGEYTASNIAPWILTVAASSIDREFPADAILGDGSVYG  371

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+G+PL   KLP+VY  D  S  C  GEL   KV GKIV CERGGN  V KG AV+
Sbjct  372   GVSLYAGDPLNSTKLPVVYAADCGSRLCGRGELDKDKVAGKIVLCERGGNARVAKGAAVQ  431

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
             EAGG+GMI+  T  +GE + A +H+IPAT V +  G+KI++Y+ + PSPTA IVF GTVI
Sbjct  432   EAGGIGMILANTEESGEELIADSHLIPATMVGQKFGDKIRQYVTTDPSPTATIVFHGTVI  491

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SPSAPRVA+FSSRGPN    EILKPDV APGVNILA W+G   P+   +D RRV FNI
Sbjct  492   GKSPSAPRVAAFSSRGPNYRAAEILKPDVTAPGVNILAAWTGEASPTDLEIDPRRVPFNI  551

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLR+AHP WSPAA+KSALM
Sbjct  552   ISGTSMSCPHVSGLAALLRQAHPDWSPAAVKSALM  586



>dbj|BAJ93208.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score =   510 bits (1314),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 256/395 (65%), Positives = 301/395 (76%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GA+ FYKGYEA  G PINE++E KSP D  GHGTHTAS AAGS V  A  + YA+G 
Sbjct  193   KLVGAKFFYKGYEAGLGHPINENLESKSPLDTEGHGTHTASTAAGSPVDGAGFYNYARGR  252

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A GMA  ARIA YKICW  GCYDSDIL+AFD+AV DGV+VISLSV     Y   +Y DS 
Sbjct  253   AVGMAPTARIAAYKICWKSGCYDSDILAAFDEAVGDGVNVISLSVG-SSGYASAFYEDSI  311

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA++ G+VVS  AGN+GPG  TA+N+APWILTV AS+IDR FPAD +LGDG ++ 
Sbjct  312   AIGAFGAVKKGIVVSASAGNSGPGEYTASNIAPWILTVAASSIDREFPADAILGDGSVYG  371

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+G+PL   KLP+VY  D  S  C  GEL   KV GKIV CERGGN  V KG AV+
Sbjct  372   GVSLYAGDPLNSTKLPVVYAADCGSRLCGRGELDKDKVAGKIVLCERGGNARVAKGAAVQ  431

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
             EAGG+GMI+  T  +GE + A +H+IPAT V +  G+KI++Y+ + PSPTA IVF GTVI
Sbjct  432   EAGGIGMILANTEESGEELIADSHLIPATMVGQKFGDKIRQYVTTDPSPTATIVFHGTVI  491

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SPSAPRVA+FSSRGPN    EILKPDV APGVNILA W+G   P+   +D RRV FNI
Sbjct  492   GKSPSAPRVAAFSSRGPNYRAAEILKPDVTAPGVNILAAWTGEASPTDLEIDPRRVPFNI  551

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLR+AHP WSPAA+KSALM
Sbjct  552   ISGTSMSCPHVSGLAALLRQAHPDWSPAAVKSALM  586



>dbj|BAE98521.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
Length=777

 Score =   509 bits (1311),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 258/396 (65%), Positives = 310/396 (78%), Gaps = 2/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGY-EAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGARAFY+GY     G+  + ++E +SPRD  GHGTHTAS AAGS+VANASL+ YA+G
Sbjct  182   KLIGARAFYRGYLTQRNGTKKHAAMESRSPRDTEGHGTHTASTAAGSVVANASLYQYARG  241

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              A GMA KARIA YKICW+ GCYDSDIL+A DQAV DGVHVISLSV    + PE Y+ DS
Sbjct  242   TATGMASKARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVGASGSAPE-YHTDS  300

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAFGA  HG+VVS  AGN+GP   TATN+APWILTVGAST+DR F A+ + GDG++F
Sbjct  301   IAIGAFGATRHGIVVSCSAGNSGPNPETATNIAPWILTVGASTVDREFAANAITGDGKVF  360

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG SLY+GE L D++L LVY GD  S  CY G+L +S V GKIV C+RGGN  V+KG AV
Sbjct  361   TGTSLYAGESLPDSQLSLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNARVEKGSAV  420

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             + AGG GMI+  TA +GE + A +H++PAT V    G++I++YI ++ SPTA I F GT+
Sbjct  421   KLAGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTAKISFLGTL  480

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             IG SP +PRVA+FSSRGPN L   ILKPDVIAPGVNILAGW+G +GP+   +D RRV+FN
Sbjct  481   IGPSPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFN  540

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSGLAALLRKAHP WSPAAIKSAL+
Sbjct  541   IISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALV  576



>gb|AFW73751.1| putative subtilase family protein [Zea mays]
Length=783

 Score =   509 bits (1311),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 259/395 (66%), Positives = 302/395 (76%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA+ FY+GYEA  G PI+E+ E KSP D  GHGTHTAS AAGS VA A  F YA+G+
Sbjct  192   KLIGAKFFYQGYEAALGHPIDETKESKSPLDTEGHGTHTASTAAGSPVAGAGFFDYAEGQ  251

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A GM   ARIA YKICW+ GCYDSDIL+A D+AV DGV VISLSV     Y   ++ DS 
Sbjct  252   AVGMDPGARIAAYKICWTSGCYDSDILAAMDEAVADGVDVISLSVGA-NGYAPSFFTDSI  310

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A+  G+VVS  AGN+GPG  TA N+APWILTVGASTIDR FPADVVLGDGR+F 
Sbjct  311   AIGAFHAVSKGIVVSCSAGNSGPGEYTAVNIAPWILTVGASTIDREFPADVVLGDGRVFG  370

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+G+PL   +LPLV+ GD  S  C  GEL + KV GK+V C RG N  V+KG AV+
Sbjct  371   GVSLYAGDPLDSTQLPLVFAGDCGSPLCLMGELDSKKVAGKMVLCLRGNNARVEKGAAVK  430

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGGVGMI+  T  +GE + A +H++PAT V +  G+KI+ Y+ + PSPTA IVFRGTVI
Sbjct  431   LAGGVGMILANTEESGEELIADSHLVPATMVGQKFGDKIRYYVQTDPSPTATIVFRGTVI  490

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G S SAPRVA+FSSRGPN    EILKPDVIAPGVNILA W+GA  P+   +D RRVEFNI
Sbjct  491   GKSRSAPRVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGAASPTDLDIDSRRVEFNI  550

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLR+AHP WSPAAIKSALM
Sbjct  551   ISGTSMSCPHVSGLAALLRQAHPEWSPAAIKSALM  585



>ref|NP_566473.2| Subtilase family protein [Arabidopsis thaliana]
 dbj|BAB02339.1| cucumisin-like serine protease; subtilisin-like protease [Arabidopsis 
thaliana]
 gb|AAS49055.1| At3g14067 [Arabidopsis thaliana]
 gb|AAS76762.1| At3g14067 [Arabidopsis thaliana]
 dbj|BAF00939.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
 gb|AEE75461.1| Subtilase family protein [Arabidopsis thaliana]
Length=777

 Score =   508 bits (1309),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 258/396 (65%), Positives = 309/396 (78%), Gaps = 2/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGY-EAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGARAFY+GY     G+  + + E +SPRD  GHGTHTAS AAGS+VANASL+ YA+G
Sbjct  182   KLIGARAFYRGYLTQRNGTKKHAAKESRSPRDTEGHGTHTASTAAGSVVANASLYQYARG  241

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              A GMA KARIA YKICW+ GCYDSDIL+A DQAV DGVHVISLSV    + PE Y+ DS
Sbjct  242   TATGMASKARIAAYKICWTGGCYDSDILAAMDQAVADGVHVISLSVGASGSAPE-YHTDS  300

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAFGA  HG+VVS  AGN+GP   TATN+APWILTVGAST+DR F A+ + GDG++F
Sbjct  301   IAIGAFGATRHGIVVSCSAGNSGPNPETATNIAPWILTVGASTVDREFAANAITGDGKVF  360

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG SLY+GE L D++L LVY GD  S  CY G+L +S V GKIV C+RGGN  V+KG AV
Sbjct  361   TGTSLYAGESLPDSQLSLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNARVEKGSAV  420

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             + AGG GMI+  TA +GE + A +H++PAT V    G++I++YI ++ SPTA I F GT+
Sbjct  421   KLAGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTAKISFLGTL  480

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             IG SP +PRVA+FSSRGPN L   ILKPDVIAPGVNILAGW+G +GP+   +D RRV+FN
Sbjct  481   IGPSPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFN  540

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSGLAALLRKAHP WSPAAIKSAL+
Sbjct  541   IISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALV  576



>ref|XP_002454656.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
 gb|EES07632.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
Length=787

 Score =   508 bits (1309),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 260/395 (66%), Positives = 302/395 (76%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA+ FY+GYEA  G PI+E+ E KSP D  GHGTHTAS AAGS V  A  F YA+G+
Sbjct  196   KLIGAKFFYQGYEAGLGHPIDETKESKSPLDTEGHGTHTASTAAGSPVPGAGFFDYAKGQ  255

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A GM   ARIAVYKICW+ GCYDSDIL+A D+AV DGV VISLSV     Y   +Y DS 
Sbjct  256   AVGMDPGARIAVYKICWASGCYDSDILAAMDEAVADGVDVISLSVGA-NGYAPRFYTDSI  314

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A+  G+VVS  AGN+GPG  TA N+APWILTVGASTIDR FPADVVLGDGR+F 
Sbjct  315   AIGAFHAVRKGIVVSCSAGNSGPGEYTAVNIAPWILTVGASTIDREFPADVVLGDGRVFG  374

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+G+PL   +LPLV+ GD  S  C  GEL   KV GKIV C RG N  V+KG AV+
Sbjct  375   GVSLYAGDPLDSTQLPLVFAGDCGSRLCLIGELDPKKVAGKIVLCLRGNNARVEKGAAVK  434

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGGVGMI+  T  +GE + A +H++PAT V +  G+KI+ Y+ + PSPTA I+FRGTVI
Sbjct  435   LAGGVGMILANTEESGEELIADSHLVPATMVGQKFGDKIRYYVQTDPSPTATIMFRGTVI  494

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SPSAP+VA+FSSRGPN    EILKPDVIAPGVNILA W+GA  P+   +D RRVEFNI
Sbjct  495   GKSPSAPQVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGAASPTDLDIDTRRVEFNI  554

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLR+AHP WSPAAIKSALM
Sbjct  555   ISGTSMSCPHVSGLAALLRQAHPEWSPAAIKSALM  589



>gb|AGN03879.1| senescence-associated subtilisin protease [Triticum aestivum]
Length=786

 Score =   506 bits (1303),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 255/395 (65%), Positives = 297/395 (75%), Gaps = 2/395 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA+ FYKGYE   G PINE++E KSP D  GHGTHTAS AAGS V  A  + YA+G 
Sbjct  196   KLIGAKFFYKGYEEGLGHPINETLESKSPLDTEGHGTHTASTAAGSPVDGAGFYQYARGR  255

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A GMA  ARIA YKICW  GC+DSDIL+AFD+AV DGV+VISLSV     Y  D+Y DS 
Sbjct  256   AVGMAPTARIAAYKICWKSGCFDSDILAAFDEAVGDGVNVISLSVG--STYAADFYEDSI  313

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA++ G+VVS  AGN+GPG  TA+N+APWILTVGAST+DR FPAD VLGDG ++ 
Sbjct  314   AIGAFGAVKKGIVVSASAGNSGPGEYTASNIAPWILTVGASTVDREFPADAVLGDGSVYG  373

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+G+PL   KLPLVY  D  S  C  GEL   KV GKIV CERG N  V+KG AV 
Sbjct  374   GVSLYAGDPLNSTKLPLVYAADCGSRLCLIGELDKDKVAGKIVLCERGVNARVEKGAAVG  433

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
             +AGG+GMI+  T  +GE + A  H+IP+T V +  G+KI+ Y+ + PSPTA IVF GTVI
Sbjct  434   KAGGIGMILANTEESGEELIADPHLIPSTMVGQKFGDKIRHYVKTDPSPTATIVFHGTVI  493

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SPSAPRVASFSSRGPN    EILKPDV APGVNILA W+G   P+   +D RRV FNI
Sbjct  494   GKSPSAPRVASFSSRGPNSRAPEILKPDVTAPGVNILADWTGEASPTDLDIDPRRVPFNI  553

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLR+AHP WSP  +KSALM
Sbjct  554   ISGTSMSCPHVSGLAALLRQAHPDWSPTVVKSALM  588



>ref|XP_010487192.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=786

 Score =   505 bits (1300),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 256/404 (63%), Positives = 312/404 (77%), Gaps = 10/404 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEA--FTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQ  175
             K+IGAR +Y+GY A    G+ ++ + + +SPRD  GHGTHTAS AAGS+VANASL+ YAQ
Sbjct  182   KLIGARGYYRGYFAGQVNGTKLHAAKDSRSPRDTEGHGTHTASTAAGSVVANASLYHYAQ  241

Query  176   GEARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRD  355
             G ARGMA KARIA YKICWS+GCYDSDIL+  DQAV DGVHVISLSV     Y  D+ +D
Sbjct  242   GTARGMASKARIAAYKICWSVGCYDSDILAGMDQAVADGVHVISLSVG-SSGYARDFSKD  300

Query  356   STAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRI  535
             S AIGAFGA  HGVVVS  AGN+GPG  TATN+APW+LTVGAST+DR F A+VV GDG++
Sbjct  301   SIAIGAFGATRHGVVVSCSAGNSGPGPETATNIAPWMLTVGASTVDREFSANVVTGDGKV  360

Query  536   FTGMSLYSGEPLGDNKLPL-------VYGGDANSTYCYSGELIASKVTGKIVFCERGGNL  694
             FTG SLY+GE L D+++ L       VY GD  S  C +GEL +S V GKIV C+RGG+ 
Sbjct  361   FTGTSLYAGESLPDSQMSLPDSQISLVYSGDCGSKLCTTGELNSSLVQGKIVLCDRGGSA  420

Query  695   DVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTA  874
              V+KG AV+ AGG GMI+  TA +GE + A +H++PAT V    G++I++YI ++ SPTA
Sbjct  421   RVEKGRAVKLAGGAGMILANTASSGEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTA  480

Query  875   AIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVM  1054
              I F GT+IG SP +PRVA+FSSRGPN L   ILKPDVIAPGVNILAGW+G +GP+   +
Sbjct  481   TINFLGTLIGPSPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGLVGPTDLDI  540

Query  1055  DQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             D RRV+FNIISGTSM+CPHVSGLAALLR+AHP WSPAA+KSAL+
Sbjct  541   DPRRVQFNIISGTSMSCPHVSGLAALLRRAHPNWSPAAVKSALV  584



>ref|NP_001048301.1| Os02g0779200 [Oryza sativa Japonica Group]
 dbj|BAD19517.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF10215.1| Os02g0779200 [Oryza sativa Japonica Group]
 gb|EAZ24820.1| hypothetical protein OsJ_08598 [Oryza sativa Japonica Group]
Length=782

 Score =   504 bits (1299),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 260/395 (66%), Positives = 300/395 (76%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA+ FYKGYEA  G  I+E+ E KSP D  GHGTHTAS AAGS V  A  F YA+G+
Sbjct  191   KLIGAKFFYKGYEAALGHAIDETEESKSPLDTEGHGTHTASTAAGSPVTGAGFFDYARGQ  250

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A GM+  A IA YKICW  GCYDSDIL+A D+AV DGV VISLSV     Y   ++RDS 
Sbjct  251   AVGMSPAAHIAAYKICWKSGCYDSDILAAMDEAVADGVDVISLSVGA-GGYAPSFFRDSI  309

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+F A+  G+VVS  AGN+GPG  TATN+APWILTVGASTIDR FPADVVLG+G+++ 
Sbjct  310   AIGSFHAVSKGIVVSASAGNSGPGEYTATNIAPWILTVGASTIDREFPADVVLGNGQVYG  369

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLYSGEPL    LP+VY GD  S  C  GEL  +KV+GKIV CERG N  V KG AV+
Sbjct  370   GVSLYSGEPLNSTLLPVVYAGDCGSRLCIIGELDPAKVSGKIVLCERGSNARVAKGGAVK  429

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG GMI+  TA +GE + A +H++PAT V +  G+KIK Y+ S PSPTA IVFRGTVI
Sbjct  430   VAGGAGMILVNTAESGEELVADSHLVPATMVGQKFGDKIKYYVQSDPSPTATIVFRGTVI  489

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SPSAPRVA+FSSRGPN    EILKPDVIAPGVNILA W+G   P+   +D RRVEFNI
Sbjct  490   GKSPSAPRVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGESAPTDLDIDPRRVEFNI  549

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLR+A P WSPAAIKSALM
Sbjct  550   ISGTSMSCPHVSGLAALLRQAQPDWSPAAIKSALM  584



>ref|XP_010465286.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=789

 Score =   504 bits (1297),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 256/404 (63%), Positives = 312/404 (77%), Gaps = 10/404 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEA--FTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQ  175
             K+IGARA+Y+GY A    G+ ++ + + +SPRD  GHGTHTAS AAGS+VANASL+ YAQ
Sbjct  184   KLIGARAYYRGYYAGQVNGTKLHAAKDSRSPRDTEGHGTHTASTAAGSVVANASLYHYAQ  243

Query  176   GEARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRD  355
             G ARGMA KARIA YKICWS+GCYDSDIL+  DQAV DGVHVISLSV     Y  ++ +D
Sbjct  244   GTARGMASKARIAAYKICWSVGCYDSDILAGMDQAVADGVHVISLSVG-SSGYAREFSKD  302

Query  356   STAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRI  535
             S AIGAFGA  HGVVVS  AGN+GPG  TATN+APW+LTVGAST+DR F A+VV GDG++
Sbjct  303   SIAIGAFGATRHGVVVSCSAGNSGPGPETATNIAPWMLTVGASTVDREFSANVVTGDGKV  362

Query  536   FTGMSLYSGEPLGDN-------KLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNL  694
             FTG SLY+GE L D+       ++ LVY GD  S  C +GEL +S V GKIV C+RGG+ 
Sbjct  363   FTGTSLYAGESLPDSPMSLPESQISLVYSGDCGSKLCTTGELNSSLVQGKIVLCDRGGSA  422

Query  695   DVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTA  874
              V+KG AV+ AGG GMI+  TA +GE + A +H++PAT V    G++I++YI +  SPTA
Sbjct  423   RVEKGRAVKLAGGAGMILANTASSGEELTADSHLVPATMVGAKAGDQIRDYIKTTDSPTA  482

Query  875   AIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVM  1054
              I F GT+IG +P +PRVA+FSSRGPN L   ILKPDVIAPGVNILAGW+G +GP+   +
Sbjct  483   TINFLGTLIGPTPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGLVGPTDLDI  542

Query  1055  DQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             D RRV+FNIISGTSM+CPHVSGLAALLRKAHP WSPAA+KSAL+
Sbjct  543   DPRRVQFNIISGTSMSCPHVSGLAALLRKAHPDWSPAAVKSALV  586



>ref|XP_010501588.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=788

 Score =   503 bits (1295),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 253/404 (63%), Positives = 313/404 (77%), Gaps = 10/404 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEA--FTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQ  175
             K+IGARA+Y+GY A    G+ ++ + + +SPRD  GHGTHTAS AAGS+VANASL+ YAQ
Sbjct  183   KLIGARAYYRGYFAGQVNGTKLHAAKDSRSPRDTEGHGTHTASTAAGSVVANASLYHYAQ  242

Query  176   GEARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRD  355
             G ARGMA KARIA YKICWS+GCYDSDIL+  DQAV DGVHVISLSV     Y  D+ +D
Sbjct  243   GTARGMASKARIAAYKICWSVGCYDSDILAGMDQAVADGVHVISLSVG-SSGYARDFSKD  301

Query  356   STAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRI  535
             S AIG+FGA  HG+VVS  AGN+GPG  TATN+APW+LTVGAST+DR F A+V+ GDG++
Sbjct  302   SIAIGSFGATRHGIVVSCSAGNSGPGPETATNIAPWMLTVGASTVDREFSANVITGDGKV  361

Query  536   FTGMSLYSGEPLGDNKLPL-------VYGGDANSTYCYSGELIASKVTGKIVFCERGGNL  694
             +TG SLY+GE L D+++ L       VY GD  S  C +GEL +S V GKIV C+RGG+ 
Sbjct  362   YTGTSLYAGESLPDSQMSLPESQISLVYSGDCGSKLCTTGELNSSLVQGKIVLCDRGGSA  421

Query  695   DVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTA  874
              V+KG AV+ AGG GMI+  TA +GE + A +H++PAT V    G++I++YI ++ SPTA
Sbjct  422   RVEKGRAVKLAGGAGMILANTASSGEELTADSHLVPATMVGAKAGDQIRDYIKTSDSPTA  481

Query  875   AIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVM  1054
              I F GT+IG SP +PRVA+FSSRGPN L   ILKPDVIAPGVNILAGW+G +GP+   +
Sbjct  482   TINFLGTMIGPSPPSPRVAAFSSRGPNHLTPVILKPDVIAPGVNILAGWTGLVGPTDLDI  541

Query  1055  DQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             D RRV+FNIISGTSM+CPHVSGLAALLR+AHP WSPAA+KSAL+
Sbjct  542   DPRRVQFNIISGTSMSCPHVSGLAALLRRAHPDWSPAAVKSALV  585



>ref|XP_010917483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=778

 Score =   503 bits (1294),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 256/395 (65%), Positives = 297/395 (75%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR FYKGYE+  G PI+ES E KSP D  GHGTHTAS AAG+ V +A  + YA+GE
Sbjct  188   KLIGARFFYKGYESAMGHPIDESRESKSPLDTEGHGTHTASTAAGAAVEDAGFYQYARGE  247

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICW+ GC+DSDIL+A D A+ DG  VISLSV     +   +YRDS 
Sbjct  248   ARGMATKARIAAYKICWAAGCFDSDILAAMDAAIDDGADVISLSVGA-TGFAPSFYRDSI  306

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA  HGV VS  AGN+GPG  TA N+APWILTVGASTIDR FPADV+LGDG  + 
Sbjct  307   AIGAFGAARHGVTVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVILGDGTTYG  366

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+GE L    LPLVY GD  S  C SG L ++KV GKIV C+RG N  V+KG AV+
Sbjct  367   GVSLYAGELLNSTDLPLVYAGDCGSRLCISGYLDSAKVAGKIVLCDRGANARVEKGSAVK  426

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG GMI+  TA  GE + A +H+IPAT V E  G+KI++YI S  SPTA +VFRGTVI
Sbjct  427   LAGGAGMILANTAENGEELIADSHLIPATMVGESAGDKIRDYIKSQSSPTATVVFRGTVI  486

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
              +SP AP+VA+FSSRGPN    EILKPDVIAPGVNILA W+G   P+   +D RRV FNI
Sbjct  487   SSSPPAPKVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGISSPTDLDIDPRRVLFNI  546

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+AALL K +P WSPAAIKSALM
Sbjct  547   ISGTSMSCPHVSGIAALLHKTYPDWSPAAIKSALM  581



>ref|XP_006407132.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
 gb|ESQ48585.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
Length=1359

 Score =   512 bits (1318),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 259/396 (65%), Positives = 310/396 (78%), Gaps = 2/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAF-TGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGARAFYKGY     GS  + + E +SPRD  GHGTHTAS AAGS+VANAS + YA G
Sbjct  785   KLIGARAFYKGYLTHRNGSTTHTAKESRSPRDTEGHGTHTASTAAGSVVANASFYQYASG  844

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA KARIA YKICW+ GCYDSDIL+A DQAV DGVHVISLSV     Y  +Y++DS
Sbjct  845   LARGMASKARIAAYKICWTGGCYDSDILAAMDQAVSDGVHVISLSVG-ANGYAPEYHKDS  903

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAFGA  HG+VVS  AGN+GPG +TATN+APWILTVGASTIDR F A+ + GDG++F
Sbjct  904   IAIGAFGATRHGIVVSCSAGNSGPGPQTATNIAPWILTVGASTIDREFTANAITGDGKVF  963

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG SLY+GE L D+++ LVY GD  S  CY G+L +S V GKIV C+RGGN  V+KG AV
Sbjct  964   TGTSLYAGESLPDSQISLVYSGDCGSRLCYPGKLNSSLVEGKIVLCDRGGNARVEKGSAV  1023

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             + AGG GMI+  TA +GE + A +H++PAT V    G++I++YI ++ SPTA I F GT+
Sbjct  1024  KIAGGAGMILANTAESGEELTADSHLVPATMVGAKAGDQIRDYIKNSDSPTATISFLGTL  1083

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             IG SP +PRVA+FSSRGPN +   ILKPDVIAPGVNILAGW+G +GP+   +D RRV+FN
Sbjct  1084  IGPSPPSPRVAAFSSRGPNHITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFN  1143

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSGLAALLRKAHP WSPAAIKSAL+
Sbjct  1144  IISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALV  1179



>ref|XP_010277120.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score =   487 bits (1253),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 248/399 (62%), Positives = 303/399 (76%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+E+ E KSPRD +GHGTHT++ AAGS+V  ASLFGYA G 
Sbjct  182   KLIGARFFSKGYEATLG-PIDETKESKSPRDDDGHGTHTSTTAAGSVVDGASLFGYAAGA  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ +DIL+A ++A+ DGV+VIS+S+    A   DYY+D+ 
Sbjct  241   ARGMATRARVAVYKVCWIGGCFSADILAAMEKAIDDGVNVISMSLGGGMA---DYYKDTV  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA V LG+G+ F+
Sbjct  298   AVGAFAAMERGILVSCSAGNAGPNSYSLSNVAPWITTVGAGTLDRDFPAYVNLGNGKNFS  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL D+ +  VY G+A    N   C  G LI  KV GKIV C+RG N  V KG
Sbjct  358   GVSLYSGKPLPDSLIEFVYAGNATNVTNGNLCMVGTLIPEKVAGKIVLCDRGINARVQKG  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F V++AGGVGMI+  TA  GE + A AH++PAT V E  G+ IK Y+ S PSPTA I+F 
Sbjct  418   FVVKQAGGVGMILANTAANGEELVADAHLLPATAVGEKTGDMIKNYLFSDPSPTATILFG  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNI+AGWSGA+GP+G  MD RRV
Sbjct  478   GTKVGIQPS-PVVAAFSSRGPNAITPEILKPDLIAPGVNIIAGWSGAVGPTGLSMDSRRV  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAIKSALM
Sbjct  537   NFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIKSALM  575



>gb|ACB87529.1| subtilisin protease [Triticum aestivum]
Length=571

 Score =   480 bits (1235),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 242/375 (65%), Positives = 284/375 (76%), Gaps = 2/375 (1%)
 Frame = +2

Query  62    NESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGEARGMAIKARIAVYKICWSLG  241
             +E++E KSP D  GHGTHTAS AAGS V  A  + YA+G A GMA  ARIA YKICW  G
Sbjct  1     DETLESKSPLDTEGHGTHTASTAAGSPVDGAGFYQYARGRAVGMAPTARIAAYKICWKSG  60

Query  242   CYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDSTAIGAFGAMEHGVVVSTVAGN  421
             C+DSDIL+AFD+AV DGV+VISLSV     Y  D+Y DS AIGAFGA++ G+VVS  AGN
Sbjct  61    CFDSDILAAFDEAVGDGVNVISLSVG--STYAADFYEDSIAIGAFGAVKKGIVVSASAGN  118

Query  422   TGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFTGMSLYSGEPLGDNKLPLVYG  601
             +GPG  TA+N+APWILTVGAST+DR FPAD VLGDG ++ G+SLY+G+PL   KLPLVY 
Sbjct  119   SGPGEYTASNIAPWILTVGASTVDRGFPADAVLGDGSVYGGVSLYAGDPLNSTKLPLVYA  178

Query  602   GDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVREAGGVGMIVDGTAGTGELIY  781
              D  S  C  GEL   KV GK+V CERG N  V+KG AV +AGG+GMI+  T  +GE + 
Sbjct  179   ADCGSRLCLIGELDKDKVAGKMVLCERGVNARVEKGAAVGKAGGIGMILANTEESGEELI  238

Query  782   ASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVIGTSPSAPRVASFSSRGPNPL  961
             A  H+IP+T V +  G+KI+ Y+ + PSPTA IVF GTVIG SPSAPRVASFSSRGPN  
Sbjct  239   ADPHLIPSTMVGQKFGDKIRHYVKTDPSPTATIVFHGTVIGKSPSAPRVASFSSRGPNSR  298

Query  962   QFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNIISGTSMACPHVSGLAALLRK  1141
               EILKPDV APGVNILA W+G   P+   +D RRV FNIISGTSM+CPHVSGLAALLR+
Sbjct  299   AAEILKPDVTAPGVNILAAWTGEASPTDLDIDPRRVPFNIISGTSMSCPHVSGLAALLRQ  358

Query  1142  AHPTWSPAAIKSALM  1186
             AHP WSPAA+KSALM
Sbjct  359   AHPEWSPAAVKSALM  373



>ref|XP_008792869.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=781

 Score =   486 bits (1252),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 255/395 (65%), Positives = 296/395 (75%), Gaps = 1/395 (0%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR FYKGYEA  G PI+ES E KSP D  GHGTHTAS AAG+ V +A  + YA+GE
Sbjct  191   KLIGARFFYKGYEAAMGHPIDESRESKSPLDTEGHGTHTASTAAGAAVDDAGFYQYARGE  250

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA YKICW+ GC+DSDIL+A D A+ DG  VISLSV     +   + RDS 
Sbjct  251   ARGMATKARIAAYKICWASGCFDSDILAAMDAAIDDGADVISLSVGA-NGFAPSFDRDSI  309

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA  HGV+VS  AGN+GPG  TA N+APWILTVGASTIDR FPADV+LGDG  + 
Sbjct  310   AIGAFGAARHGVIVSCSAGNSGPGPYTAVNIAPWILTVGASTIDREFPADVILGDGTTYG  369

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+GE      LPLV  GD  S  C +G L ++KV GKIV C+RG N  V+KG AV+
Sbjct  370   GVSLYAGELSNSTDLPLVDAGDCGSRLCITGYLDSAKVAGKIVLCDRGANARVEKGSAVK  429

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG GMI+  TA  GE + A +H+IPAT V E  G+KI+ YI S  SPTA IVF+GTVI
Sbjct  430   LAGGAGMILANTAENGEELIADSHLIPATMVGESAGDKIRGYIKSQSSPTATIVFKGTVI  489

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
              +SP AP+VA+FSSRGPN    EILKPDVIAPGVNILA W+GA  P+   +D RRVEFNI
Sbjct  490   SSSPPAPKVAAFSSRGPNYRAPEILKPDVIAPGVNILAAWTGASSPTDLDIDPRRVEFNI  549

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+AALL K +P WSPAAIKSALM
Sbjct  550   ISGTSMSCPHVSGIAALLHKTYPDWSPAAIKSALM  584



>ref|XP_009407416.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=769

 Score =   481 bits (1238),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 245/399 (61%), Positives = 296/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F KGYEA  G PI+E+ E +SPRD +GHGTHT+S AAGS+V +A+L GYA G 
Sbjct  182   KLVGARFFSKGYEASMG-PIDETKESRSPRDNDGHGTHTSSTAAGSVVPDANLLGYAAGT  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGM+ +AR+AVYK+CW  GC+ SDIL+A D+A++DG  V+SLS+        DYYRDS 
Sbjct  241   ARGMSTRARVAVYKVCWLGGCFSSDILAAMDKAIEDGCGVLSLSLG---GGMSDYYRDSV  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AM  GVVVS  AGN GPG  T +NVAPWI TVGA TIDR FPA VVLGDG+ +T
Sbjct  298   AIGAFNAMAKGVVVSCSAGNAGPGTSTLSNVAPWITTVGAGTIDRDFPAYVVLGDGKNYT  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL  + LPL+Y G+A    N   C  G L+  KV+GKIV C+RG N  V KG
Sbjct  358   GVSLYSGKPLPSSSLPLIYAGNATNATNGNLCMVGTLLPDKVSGKIVLCDRGINARVQKG  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F VR+AGG GMI+  TA  GE + A AH++PAT V E  G+ IK Y+ S P+P A + F 
Sbjct  418   FVVRDAGGAGMILANTAANGEELVADAHLLPATAVGEKAGDAIKSYLFSDPNPKATVAFG  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  +ILKPD++APGVNILA WSG++GP+G   D RR 
Sbjct  478   GTKVGVMPS-PVVAAFSSRGPNAVTPDILKPDLVAPGVNILAAWSGSVGPTGQAADPRRT  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAA LR AHP WSP AIKSALM
Sbjct  537   EFNIISGTSMSCPHVSGLAAFLRGAHPDWSPGAIKSALM  575



>ref|XP_007047459.1| Subtilase family protein [Theobroma cacao]
 gb|EOX91616.1| Subtilase family protein [Theobroma cacao]
Length=760

 Score =   478 bits (1231),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 245/399 (61%), Positives = 293/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+E+ E KSPRD +GHG+HTAS AAGS+V  ASLFGYA+G 
Sbjct  179   KLIGARYFAKGYEATLG-PIDETKESKSPRDDDGHGSHTASTAAGSVVEGASLFGYAEGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A+YK+CW  GC+ SDIL+A ++A+ D V+V+S+S+        DYYRDS 
Sbjct  238   ARGMATRARVAIYKVCWIGGCFSSDILAAMEKAIDDNVNVLSMSLG---GGMSDYYRDSV  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP   + +NVAPWI TVGA T+DR FPA V LG+GR ++
Sbjct  295   AIGAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVTLGNGRNYS  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G PL    LP VY G+A    N   C  G LI  KV GKIV C+RG N  V KG
Sbjct  355   GVSLYRGSPLPGKLLPFVYAGNASNATNGNLCMMGTLIPEKVAGKIVLCDRGMNARVQKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AG VGMI+  TA  GE + A AH++PAT V +  G+ IK Y+ S P+PT  I F 
Sbjct  415   AVVKAAGAVGMILANTAANGEELVADAHLLPATAVGQKSGDAIKGYLFSNPNPTVTIFFE  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD IAPGVNILAGWSGA+GP+G V D RRV
Sbjct  475   GTKVGIEPS-PVVAAFSSRGPNSITPEILKPDFIAPGVNILAGWSGAVGPTGLVTDTRRV  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  534   EFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALM  572



>ref|XP_010271938.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=752

 Score =   475 bits (1223),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 243/399 (61%), Positives = 299/399 (75%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G PI+E+ E +SPRD +GHGTHT++ AAGS+V  ASLFGYA G 
Sbjct  173   KLIGARFFSRGYEATLG-PIDETKESRSPRDDDGHGTHTSTTAAGSVVDGASLFGYAAGA  231

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+AVYK+CW  GC+ +DIL+A D+AV DGV+V+S+S+        DY+RDS 
Sbjct  232   ARGMATHARVAVYKVCWIGGCFSADILAAMDKAVDDGVNVLSMSLG---GGMSDYFRDSV  288

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA V LG+G+ F+
Sbjct  289   AIGAFTAMERGILVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPAYVTLGNGKNFS  348

Query  542   GMSLYSGEPLGDNKLPLVYGGDANS----TYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+PL D++L  VY G+A +      C  G LI  KV GKIV C+RG N  V KG
Sbjct  349   GVSLYGGKPLPDSQLTFVYAGNATNVTSGNLCMIGTLIPEKVAGKIVLCDRGVNARVQKG  408

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V++AGG GMI+  TA  GE + A AH++PAT V +  G+ IK Y+ S P+PTA I+F 
Sbjct  409   SVVKQAGGAGMILANTAANGEELVADAHLLPATAVGQKTGDMIKNYLFSDPNPTATIIFG  468

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGWSGA+GP+G  +D RRV
Sbjct  469   GTKLGIQPS-PVVAAFSSRGPNSITPEILKPDLIAPGVNILAGWSGAVGPTGLAVDSRRV  527

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAIKSALM
Sbjct  528   GFNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIKSALM  566



>ref|XP_008780900.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=769

 Score =   474 bits (1220),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 245/399 (61%), Positives = 300/399 (75%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+E+ E +SPRD +GHGTHT++ AAGS V +ASL G+A G 
Sbjct  181   KLIGARFFSKGYEASMG-PIDETRELRSPRDSDGHGTHTSTTAAGSAVTDASLLGFAAGT  239

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+A D+AV DG HV+SLS+        DYYRDS 
Sbjct  240   ARGMATRARVAAYKVCWVGGCFSSDILAAIDRAVDDGCHVLSLSLG---GGMSDYYRDSV  296

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME GV+VS  AGN+GP A + +NVAPWI TVGA T+DR FPA VVLG+G+ ++
Sbjct  297   AIGAFNAMEKGVLVSCSAGNSGPSASSLSNVAPWITTVGAGTLDRDFPAYVVLGNGKNYS  356

Query  542   GMSLYSGEPLGDNKLPLVYGGDANS----TYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL  + LP+VY G+A++      C  G L+  KV GKIV CERG +  V KG
Sbjct  357   GVSLYSGKPLPSSPLPIVYAGNASNATGGNLCMPGTLMPEKVAGKIVLCERGISPRVQKG  416

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             + VR+AGG GMI+  T   GE + A AH++PA  V E  G+ IK Y+ S  SPTA IVF 
Sbjct  417   YVVRDAGGAGMILANTDANGEELVADAHLLPANGVGEKAGDAIKRYLLSEMSPTATIVFG  476

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+GA+GP+G  +D RRV
Sbjct  477   GTKVGVRPS-PVVAAFSSRGPNVVTPEILKPDLIAPGVNILAGWTGAVGPTGLSVDSRRV  535

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EF+IISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  536   EFSIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALM  574



>ref|XP_010939822.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=769

 Score =   474 bits (1220),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 246/399 (62%), Positives = 300/399 (75%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+ES E +SPRD +GHGTHT++ AAGS V +ASL G+A G 
Sbjct  182   KLIGARFFSKGYEASMG-PIDESRESRSPRDIDGHGTHTSTTAAGSAVTDASLLGFATGT  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGM+ +AR+A YK+CW+ GC+ SDIL+A D AV DG HV+SLS+        DYYRDS 
Sbjct  241   ARGMSTRARVAAYKVCWAGGCFSSDILAAMDAAVDDGCHVLSLSLG---GGMSDYYRDSV  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME GV+VS  AGN GP   + +NVAPWI TVGA T+DR FPA VVLG+G+ +T
Sbjct  298   AIGAFNAMEKGVLVSCSAGNAGPTDSSLSNVAPWITTVGAGTLDRDFPAYVVLGNGKNYT  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDA-NST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL    LP+VY G+A NST    C  G LI  KV GKIV C+RG +  V KG
Sbjct  358   GVSLYSGKPLPSTPLPIVYAGNASNSTSGNLCMPGTLIPEKVAGKIVLCDRGISPRVQKG  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             + VREAGG GM++  T   GE + A AH++PA+ V E  G+ I+ Y+ S  SPTA++VF 
Sbjct  418   YVVREAGGAGMVLANTDANGEELVADAHLLPASGVGEKAGDAIRAYLLSETSPTASVVFG  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+GA+GP+G  +D RRV
Sbjct  478   GTKVGVRPS-PVVAAFSSRGPNAVTPEILKPDLIAPGVNILAGWTGAVGPTGLSVDSRRV  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EF+IISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  537   EFSIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALM  575



>ref|XP_003608462.1| Subtilisin-like protease [Medicago truncatula]
 gb|AES90659.1| subtilisin-like serine protease [Medicago truncatula]
Length=757

 Score =   473 bits (1218),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 296/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KG EA  G PI+E+ E KSPRD +GHGTHT+S AAGS+V +ASLFGYA G 
Sbjct  177   KLIGARFFSKGVEAMLG-PIDETTESKSPRDDDGHGTHTSSTAAGSVVPDASLFGYASGT  235

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+SLS+        DY+RDS 
Sbjct  236   ARGMATRARVAVYKVCWKGGCFSSDILAAIDKAISDNVNVLSLSLG---GGMSDYFRDSV  292

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP A + +NVAPWI TVGA T+DR FPA V LG+G  ++
Sbjct  293   AIGAFSAMEKGILVSCSAGNAGPSAYSLSNVAPWITTVGAGTLDRDFPASVSLGNGLNYS  352

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G  L ++ LPL+Y G+A    N   C +G L    V GKIV C+RG N  V KG
Sbjct  353   GVSLYRGNALPESPLPLIYAGNATNATNGNLCMTGTLSPELVAGKIVLCDRGMNARVQKG  412

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GM++  TA  GE + A  H++PAT V E +GN IK+Y+ S   PT  IVF+
Sbjct  413   AVVKAAGGLGMVLSNTAANGEELVADTHLLPATAVGEREGNAIKKYLFSEAKPTVKIVFQ  472

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  +ILKPD+IAPGVNILAGWS A+GP+G  +D+RRV
Sbjct  473   GTKVGVEPS-PVVAAFSSRGPNSITPQILKPDLIAPGVNILAGWSKAVGPTGLAVDERRV  531

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +FNIISGTSM+CPHVSGLAAL++ AHP WSPAA++SALM
Sbjct  532   DFNIISGTSMSCPHVSGLAALIKSAHPDWSPAAVRSALM  570



>ref|XP_010547540.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=764

 Score =   472 bits (1215),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 240/399 (60%), Positives = 297/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G PI+ES E KS RD +GHGTHT+S AAGSIV  ASL GYA G 
Sbjct  182   KLIGARFFARGYEATMG-PIDESKESKSARDDDGHGTHTSSTAAGSIVEGASLLGYAAGT  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A++DGV+V+S+S+        DYYRDS 
Sbjct  241   ARGMAPRARVAVYKVCWLGGCFSSDILAAIDRAIEDGVNVLSMSLG---GGMSDYYRDSV  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA V  G+G+ ++
Sbjct  298   AIGAFAAMEKGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPAQVTFGNGKNYS  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ G+ L    LP VY G+A    N   C +G LI  +V GKIV C+RG N  V KG
Sbjct  358   GVSLFKGDALPAKLLPFVYAGNASNATNGNLCMTGTLIPERVKGKIVMCDRGVNARVQKG  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V++AGG+GMI+  TA  GE + A AH++PAT V E  G++I+EY+ + P+PTA IVF 
Sbjct  418   QVVKDAGGIGMILANTAANGEELVADAHLLPATAVGEKSGDEIREYVLTNPNPTATIVFE  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILA W+G  GP+G   D+RRV
Sbjct  478   GTVVGIQPS-PVVAAFSSRGPNSITPEILKPDLIAPGVNILAAWTGEAGPTGLAADERRV  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  537   GFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALM  575



>ref|XP_002533167.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF29226.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=760

 Score =   472 bits (1214),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 296/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYEA  G P++ES E KSPRD +GHGTHTAS AAGS+V  ASL GYA G 
Sbjct  180   KLIGARFFANGYEATLG-PVDESKESKSPRDDDGHGTHTASTAAGSLVEGASLLGYASGT  238

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL A D+A++DGV+V+S+S+    +   DY++DS 
Sbjct  239   ARGMATRARVAVYKVCWIGGCFSSDILKAMDKAIEDGVNVLSMSLGGGMS---DYFKDSV  295

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA V LG+GR ++
Sbjct  296   AIGAFAAMEKGILVSCSAGNAGPTSYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGRNYS  355

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ G  L    LP +Y G+A    N   C    LI  KV GKIV C+RG N  V KG
Sbjct  356   GVSLFKGSSLPGKLLPFIYAGNASNSTNGNLCMMDSLIPEKVAGKIVLCDRGVNARVQKG  415

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+EAGG+GM++  T   GE + A AH++PAT+V E +GN IK Y++S P+PT  I+F 
Sbjct  416   AVVKEAGGLGMVLANTPANGEELVADAHLLPATSVGEKNGNAIKSYLSSDPNPTVTILFE  475

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  ++LKPD+IAPGVNILAGWSGA+GP+G   D RRV
Sbjct  476   GTKVGIQPS-PVVAAFSSRGPNSITPQVLKPDMIAPGVNILAGWSGAVGPTGLSTDTRRV  534

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +FNIISGTSM+CPHVSGLAALL+ AHP W+PAAI+SALM
Sbjct  535   DFNIISGTSMSCPHVSGLAALLKAAHPDWTPAAIRSALM  573



>ref|XP_009770992.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
 gb|ABQ58080.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score =   472 bits (1215),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 242/399 (61%), Positives = 295/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYE   G P++ S E KS RD +GHGTHTA+ AAGSIV  ASLFGYA G 
Sbjct  181   KLIGARYFSKGYETTLG-PVDVSKESKSARDDDGHGTHTATTAAGSIVQGASLFGYASGT  239

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+SLS+    +   DYYRDS 
Sbjct  240   ARGMATRARVAVYKVCWIGGCFSSDILAAMDKAIDDNVNVLSLSLGGGNS---DYYRDSV  296

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GPG  + +NVAPWI TVGA T+DR FPA V LG+G+ F+
Sbjct  297   AIGAFAAMEKGILVSCSAGNAGPGPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFS  356

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+      LP VY G+A++T     C +G LI  KV GKIV C+RG N  V KG
Sbjct  357   GVSLYKGDLSLSKMLPFVYAGNASNTTNGNLCMTGTLIPEKVKGKIVLCDRGINPRVQKG  416

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+EAGGVGM++  TA  G+ + A AH++PAT V +  G  IK+Y+ S P+PTA I+F 
Sbjct  417   SVVKEAGGVGMVLANTAANGDELVADAHLLPATTVGQTTGEAIKKYLTSDPNPTATILFE  476

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+G +GP+G   D RRV
Sbjct  477   GTKVGIKPS-PVVAAFSSRGPNSITQEILKPDIIAPGVNILAGWTGGVGPTGLAEDTRRV  535

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  536   GFNIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALM  574



>ref|XP_006841997.1| hypothetical protein AMTR_s00144p00078130 [Amborella trichopoda]
 gb|ERN03672.1| hypothetical protein AMTR_s00144p00078130 [Amborella trichopoda]
Length=753

 Score =   471 bits (1213),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 240/399 (60%), Positives = 296/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA+ F KGYEA  G PI+E+ E KSP+D +GHGTHT++ AAG+ V +ASLFGYA+G 
Sbjct  171   KLIGAQFFSKGYEAVMG-PIDETKESKSPKDDDGHGTHTSTTAAGAYVEHASLFGYAEGT  229

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIA YK+CW+ GC+ SDI++A D+AV DGVH++SLS+        DY RDS 
Sbjct  230   ARGMATRARIAAYKVCWAGGCFSSDIIAAMDRAVADGVHILSLSLG---GGSIDYDRDSI  286

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAFGAMEHGV VS  AGN+G    + +NVAPWI T+GA T+DR FPA V LG+G+ F+
Sbjct  287   AVGAFGAMEHGVFVSCSAGNSGSDTYSVSNVAPWIATIGAGTLDRDFPAYVALGNGQNFS  346

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL  + LP +Y  +A++T     C  G L+  KV GKIV C+RG    V KG
Sbjct  347   GVSLYSGKPLSQSPLPFIYAANASNTTNGNLCLDGTLVEEKVAGKIVLCDRGVTARVAKG  406

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               VR+AGGVGM++  TA  GE + A AH++PAT V E  G +IK Y+ S  +PTA IVF 
Sbjct  407   AVVRKAGGVGMVLANTASNGEELVADAHLLPATGVGEKSGEEIKSYLLSDKNPTANIVFL  466

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPNPL   ILKPD+IAPGVNILAGWS  IGP+G   D RRV
Sbjct  467   GTKVNIRPS-PVVAAFSSRGPNPLTSAILKPDMIAPGVNILAGWSDTIGPTGLPSDTRRV  525

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             E+NIISGTSM+CPH+SGLAALL+ AHP WSPA IKSALM
Sbjct  526   EYNIISGTSMSCPHISGLAALLKAAHPEWSPATIKSALM  564



>ref|XP_009758000.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score =   471 bits (1213),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 240/399 (60%), Positives = 293/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYE   G PI+ES E KSPRD +GHGTHT++ A GS+V  ASLFGYA G 
Sbjct  185   KLIGARYFSRGYETTLG-PIDESKESKSPRDDDGHGTHTSTTAGGSVVQGASLFGYAPGT  243

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+SLS+        DYYRDS 
Sbjct  244   ARGMATRARVAVYKVCWVGGCFSSDILAAMDKAIDDNVNVLSLSLG---GGISDYYRDSV  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP   + +NVAPWI TVGA T+DR FPA V LG+G+ F+
Sbjct  301   AIGAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFS  360

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G  L +  LP VY G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  361   GVSLYKGNSLPNKMLPFVYAGNASNVTNGNLCMTGTLIPEKVKGKIVLCDRGINARVQKG  420

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGM++  TA  GE + A AH++PAT V +  G+ I++Y+ S  +PTA I+F 
Sbjct  421   SVVKAAGGVGMVLTNTAANGEELVADAHLLPATAVGQKTGDAIRDYLTSDSNPTATILFE  480

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+GA+GP+G   D RRV
Sbjct  481   GTKVGIEPS-PVVAAFSSRGPNSITPEILKPDIIAPGVNILAGWTGAVGPTGLEEDDRRV  539

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  540   GFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALM  578



>ref|XP_009404128.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=767

 Score =   471 bits (1212),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 242/399 (61%), Positives = 294/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR+FY+GYEA  G P++ES E +SPRD +GHGTHT++  AGS V +ASL GYA G 
Sbjct  176   KLVGARSFYRGYEASMG-PMDESKEARSPRDNDGHGTHTSTTVAGSAVPDASLLGYAAGT  234

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGM+ +AR+AVYK+CW  GC+ SDIL+  D+AV+DG  V+SLS+    A   DYYRD  
Sbjct  235   ARGMSSRARVAVYKVCWVGGCFSSDILAGMDKAVEDGCGVLSLSLGGRVA---DYYRDGI  291

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME GV VS  AGN GP   + +NVAPWI TVGA T+DR FPA VVLG+G  +T
Sbjct  292   AIGAFTAMEKGVFVSCSAGNAGPVPTSLSNVAPWITTVGAGTLDRDFPAYVVLGNGENYT  351

Query  542   GMSLYSGEPLGDNKLPLVYGGD----ANSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G +LY G+PL  + L LVY G+     N   C  G L+  KV GKIV C+RG N  V KG
Sbjct  352   GATLYGGDPLPSSPLELVYAGNVTNTTNGNLCMLGTLLPEKVAGKIVLCDRGINSRVQKG  411

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             + V EAGG GM++  +AG GE + A AH++PAT V E  GN I+ Y+ S PSPTA IVFR
Sbjct  412   YVVSEAGGAGMVLANSAGNGEELVADAHLLPATGVGEKAGNAIRSYLFSDPSPTATIVFR  471

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +   ILKPD+IAPGVNILAGW+GA+GP+G  MD RR 
Sbjct  472   GTKVGVRPS-PVVAAFSSRGPNTITRAILKPDLIAPGVNILAGWTGAVGPTGLGMDARRT  530

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFN+ISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  531   EFNVISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALM  569



>ref|XP_009613609.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
 gb|ABQ58079.1| subtilisin-like protease [Nicotiana tabacum]
Length=768

 Score =   471 bits (1212),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 241/399 (60%), Positives = 295/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYE   G P++ S E KS RD +GHGTHTA+ AAGS+V  ASLFGYA G 
Sbjct  181   KLIGARYFSKGYETTLG-PVDVSKESKSARDDDGHGTHTATTAAGSVVQGASLFGYASGT  239

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+SLS+    +   DYYRDS 
Sbjct  240   ARGMATRARVAVYKVCWIGGCFSSDILAAMDKAIDDNVNVLSLSLGGGNS---DYYRDSV  296

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP   + +NVAPWI TVGA T+DR FPA V LG+G+ F+
Sbjct  297   AIGAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFS  356

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+      LP VY G+A++T     C +G LI  KV GKIV C+RG N  V KG
Sbjct  357   GVSLYKGDLSLSKMLPFVYAGNASNTTNGNLCMTGTLIPEKVKGKIVLCDRGINPRVQKG  416

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+EAGGVGM++  TA  G+ + A AH++PAT V +  G  IK+Y+ S P+PTA I+F 
Sbjct  417   SVVKEAGGVGMVLANTAANGDELVADAHLLPATTVGQTTGEAIKKYLTSDPNPTATILFE  476

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+GA+GP+G   D RRV
Sbjct  477   GTKVGIKPS-PVVAAFSSRGPNSITQEILKPDIIAPGVNILAGWTGAVGPTGLAEDTRRV  535

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  536   GFNIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALM  574



>gb|KDP32042.1| hypothetical protein JCGZ_12503 [Jatropha curcas]
Length=742

 Score =   470 bits (1209),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 240/399 (60%), Positives = 295/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYEA  G PI+ES E KSPRD +GHGTHTAS A GS+V  ASLFGYA G 
Sbjct  158   KLIGARFFGNGYEATLG-PIDESKESKSPRDDDGHGTHTASAAGGSVVEGASLFGYAAGT  216

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+AVYK+CW  GC+ SDIL+A D+A+ DGV+V+S+S+        DYY+DS 
Sbjct  217   ARGMATHARVAVYKVCWLGGCFSSDILAAMDKAIADGVNVLSMSLG---GGMSDYYKDSV  273

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA V LG+GR ++
Sbjct  274   AIGAFAAMEKGILVSCSAGNAGPTSYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGRNYS  333

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ G  L    LP VY G+A    N   C    LI  KV GK+V C+RG N  V KG
Sbjct  334   GVSLFKGSNLPGKLLPFVYAGNASNSTNGNLCMMDSLIPEKVAGKLVLCDRGVNARVQKG  393

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+EAGG+GM++  TA  GE + A AH++PAT+V + +G+ IK Y++S  +PTA I+F 
Sbjct  394   AVVKEAGGLGMVLANTAANGEELVADAHLLPATSVGQKNGDLIKSYLSSDSNPTATILFE  453

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  +ILKPD+IAPGVNILAGWSG++GP+G   D RRV
Sbjct  454   GTKVGIQPS-PVVAAFSSRGPNSITPDILKPDLIAPGVNILAGWSGSVGPTGLSTDPRRV  512

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  513   EFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALM  551



>ref|XP_011099335.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=768

 Score =   470 bits (1209),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 239/399 (60%), Positives = 294/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F +GYEA  G PI+ES E +SPRD +GHGTHT+S AAGS+V+ ASLFGYA G 
Sbjct  178   KLVGARYFARGYEATLG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVSGASLFGYAAGT  236

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA ++R+AVYK+CW  GC+ SDIL+A D+A+ D  +V+SLS+        DYYRDS 
Sbjct  237   ARGMAPRSRVAVYKVCWIGGCFSSDILAAMDKAIDDNANVLSLSLG---GGMSDYYRDSV  293

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP A + +NVAPWI TVGA T+DR FPA V LG+G+ F+
Sbjct  294   AIGAFAAMEKGILVSCSAGNAGPSAYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFS  353

Query  542   GMSLYSGEPLGDNKLPLVYGGD----ANSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+ L    LP VY G+     N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  354   GVSLYRGDSLPGKLLPFVYAGNVSNVTNGNLCMTGTLIPEKVKGKIVLCDRGVNPRVQKG  413

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GM++  TA  GE + A AH++PAT V +  G  IK+Y+ S  +PTA ++F 
Sbjct  414   SVVKAAGGIGMVLTNTAANGEELVADAHLLPATAVGQSTGEAIKQYLFSDSNPTATVLFE  473

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGWSGA+GP+G   D RRV
Sbjct  474   GTKVGIEPS-PVVAAFSSRGPNSITAEILKPDLIAPGVNILAGWSGAVGPTGLAEDDRRV  532

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  533   AFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALM  571



>ref|XP_009416811.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=757

 Score =   469 bits (1207),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 294/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F KGYEA  G PIN + E +SPRD +GHGTHT+S  AGS V +    GYA G 
Sbjct  179   KLVGARFFSKGYEARMG-PINLTKESRSPRDNDGHGTHTSSTVAGSAVPDVDFLGYAAGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGM+ +ARIAVYK+CW  GC+ SDIL+A D+A++DG  V+SLS+        DYYRD+ 
Sbjct  238   ARGMSTRARIAVYKVCWLGGCFGSDILAAMDKAIEDGCGVLSLSLG---GGMSDYYRDNI  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF AM  GVVVS  AGN GPGA T +NVAPWI TVGA T+DR FPA+V+L +G+ +T
Sbjct  295   AVGAFSAMAMGVVVSCSAGNAGPGASTLSNVAPWITTVGAGTLDRDFPANVLLSNGKNYT  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL  + LP +Y G+A +T     C +G L+  KV GKIV C+RG N  V KG
Sbjct  355   GVSLYSGKPLPSSPLPFIYAGNATNTTNGNLCITGTLLPDKVAGKIVLCDRGINARVQKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               VR+AGG GMI+  TA  GE + A AH++PAT V E+ G+ IK Y+ S P+PTA I FR
Sbjct  415   LVVRDAGGAGMILANTAANGEELVADAHLLPATAVGEIAGDAIKSYLFSDPNPTATIAFR  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGP+ +  +ILKPD+IAPGVNILA W+G++GP+G  +D RR 
Sbjct  475   GTKVGVKPS-PVVAAFSSRGPSAITPDILKPDLIAPGVNILAAWTGSVGPTGQAVDPRRT  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGL ALL+ AHP WSP AIKSALM
Sbjct  534   EFNIISGTSMSCPHVSGLLALLKGAHPDWSPGAIKSALM  572



>ref|XP_006841679.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
 gb|ERN03354.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
Length=765

 Score =   469 bits (1206),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 246/396 (62%), Positives = 292/396 (74%), Gaps = 4/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGAR F KGYEA  G  INE+ E  SP D  GHGTHTAS AAG++V+ A  +GYA GE
Sbjct  179   KIIGARWFAKGYEAVNGK-INETEESPSPLDTEGHGTHTASTAAGALVSGADFYGYAAGE  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  ARIAVYKICW  GCYDSDIL+A DQAV DGV VISLSV      PE +  DS 
Sbjct  238   ARGMATNARIAVYKICWKTGCYDSDILAAMDQAVGDGVDVISLSVGSSHLAPE-FDDDSI  296

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA  HGVVVS  AGN+GPG  TATN+APWILTVGASTIDR FPADV+LGDG I  
Sbjct  297   AIGAFGAARHGVVVSCSAGNSGPGPHTATNIAPWILTVGASTIDRDFPADVILGDGTILA  356

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G+SLY+G    +N   +V   D+    C  G LI +KV GK V CERG    V KG +V+
Sbjct  357   GVSLYTGNRSPEN-FSVVLAADSGDRLCRKGRLIPAKVAGKTVVCERGITARVAKGLSVK  415

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
             ++GG  M++  T  +GE + A AH++PAT V +++G+KI++Y+ SA +P+A I+FRGTV 
Sbjct  416   DSGGAAMVLTNTEESGEELVADAHLLPATMVGQINGDKIRKYVRSANNPSAGILFRGTVT  475

Query  902   GT-SPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             G  + +AP VA+FSSRGPN    EI+KPDVIAPGVNILAGW+GA GP+G   D RR  FN
Sbjct  476   GKYATAAPMVAAFSSRGPNYRSPEIVKPDVIAPGVNILAGWTGATGPTGLETDGRRWNFN  535

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +ISGTSM+CPHVSGLAALL+ A P WSPAA+KSALM
Sbjct  536   VISGTSMSCPHVSGLAALLKNAFPHWSPAAVKSALM  571



>ref|NP_569048.1| subtilisin-like protease [Arabidopsis thaliana]
 sp|O65351.1|SUBL_ARATH RecName: Full=Subtilisin-like protease; AltName: Full=Cucumisin-like 
serine protease; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK25995.1|AF360285_1 putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AAC18851.1| cucumisin-like serine protease [Arabidopsis thaliana]
 dbj|BAB09021.1| cucumisin-like serine protease [Arabidopsis thaliana]
 gb|AAN13181.1| putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AED98332.1| subtilisin-like protease [Arabidopsis thaliana]
 dbj|BAP16469.1| cucumisin-like serine protease [Cloning vector pTACAtg1]
Length=757

 Score =   468 bits (1205),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 292/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYE+  G PI+ES E +SPRD +GHGTHT+S AAGS+V  ASL GYA G 
Sbjct  179   KLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+S+S+        DYYRD  
Sbjct  238   ARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG---GGMSDYYRDGV  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA  +LG+G+ FT
Sbjct  295   AIGAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFT  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ GE L D  LP +Y G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  355   GVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGINARVQKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+  TA  GE + A AH++PAT V E  G+ I+ Y+ + P+PTA+I   
Sbjct  415   DVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPNPTASISIL  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+G  PS P VA+FSSRGPN +   ILKPD+IAPGVNILA W+GA GP+G   D RRV
Sbjct  475   GTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRV  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+  HP WSPAAI+SALM
Sbjct  534   EFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALM  572



>ref|XP_004231903.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=754

 Score =   468 bits (1204),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 294/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F +GYE   G PI+ES E KSPRD +GHGTHTAS AAGS+V  ASLFGYA G 
Sbjct  173   KLVGARYFSRGYETTLG-PIDESKESKSPRDDDGHGTHTASTAAGSVVQGASLFGYASGT  231

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A+YK+CW  GC++SDIL+  D+A+ D V V+SLS+        DYY+DS 
Sbjct  232   ARGMAYRARVAMYKVCWLGGCFNSDILAGMDKAIDDKVDVLSLSLG---GSTPDYYKDSI  288

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP   +  N APWI TVGA TIDR FPA V LG+G+ F+
Sbjct  289   AIGAFAAMEKGILVSCSAGNAGPNQFSLANQAPWITTVGAGTIDRDFPAYVSLGNGKNFS  348

Query  542   GMSLYSGEPLGDNKLPLVYGGDANS----TYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY+G+ L +  LPLVY G+A++      C  G LI  KV GKIV C+RG +  V KG
Sbjct  349   GVSLYAGDSLLNKMLPLVYAGNASNVTSGNLCMMGTLIPEKVKGKIVLCDRGISARVQKG  408

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F V+EAGG GM++  TA  GE + A AH++PA  V +  G+ IK+Y+ S P+PTA I+F 
Sbjct  409   FVVKEAGGAGMVLANTAANGEELVADAHLLPAAAVGQKAGDVIKKYLFSDPNPTAEILFG  468

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+GA+GP+G   D RRV
Sbjct  469   GTKVDIEPS-PVVAAFSSRGPNSITPEILKPDIIAPGVNILAGWTGAVGPTGMAEDDRRV  527

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAAL++  HP WSPAAI+SALM
Sbjct  528   EFNIISGTSMSCPHVSGLAALIKGVHPEWSPAAIRSALM  566



>ref|XP_006280051.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
 gb|EOA12949.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
Length=764

 Score =   468 bits (1204),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 291/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYE+  G PI+ES E +SPRD +GHGTHT+S AAGS+V  ASL GYA G 
Sbjct  186   KLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGT  244

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+S+S+        DYYRD  
Sbjct  245   ARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG---GGMSDYYRDGV  301

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA  +LG+G+ FT
Sbjct  302   AIGAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFT  361

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ GE L D  LP +Y G+A    N   C SG LI  KV GKIV C+RG N  V KG
Sbjct  362   GVSLFKGEALPDKLLPFIYAGNASNATNGNLCMSGTLIPEKVKGKIVMCDRGVNARVQKG  421

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GMI+  TA  GE + A AH++PAT V E  G+ I+ Y+ + P PTA+I   
Sbjct  422   DVVKAAGGLGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPHPTASISIL  481

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+G  PS P VA+FSSRGPN +   ILKPD+IAPGVNILA W+GA GP+G   D RRV
Sbjct  482   GTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRV  540

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+  HP WSPAAI+SALM
Sbjct  541   EFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALM  579



>ref|XP_006466502.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=762

 Score =   468 bits (1204),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 239/399 (60%), Positives = 291/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G PI+ES E KSPRD +GHGTHTAS AAGS+V  ASLFGYA G 
Sbjct  178   KLIGARYFARGYEATLG-PIDESKESKSPRDDDGHGTHTASTAAGSVVEGASLFGYAAGT  236

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+A +QA+ D V+V+S+S+        DYY+DS 
Sbjct  237   ARGMATRARVAAYKVCWVGGCFSSDILAAIEQAIDDNVNVLSMSLG---GGTSDYYKDSI  293

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA V LG+G+ ++
Sbjct  294   AIGAFAAMEKGILVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGQNYS  353

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+ L    LP VY G+A    N   C    LI  KV GKIV C+RG N  V KG
Sbjct  354   GVSLYKGDGLPGKLLPFVYAGNASNATNGNLCMMDTLIPEKVAGKIVMCDRGVNARVQKG  413

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GM++  T G GE + A AH++PAT V +  G+ IK Y+ S P PT  I+F 
Sbjct  414   AVVKAAGGLGMVLANTEGNGEELVADAHLLPATAVGQKFGDAIKSYLVSDPKPTVTILFE  473

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  E+LKPD+IAPGVNILAGWSGA+GP+G   D RRV
Sbjct  474   GTKVGVEPS-PVVAAFSSRGPNSITPELLKPDMIAPGVNILAGWSGAVGPTGLATDSRRV  532

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  533   SFNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALM  571



>gb|KDO79000.1| hypothetical protein CISIN_1g004301mg [Citrus sinensis]
Length=762

 Score =   466 bits (1199),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 290/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G PI+ES E KSPRD +GHGTHTAS AAGS+V  ASLFGYA G 
Sbjct  178   KLIGARYFARGYEATLG-PIDESKESKSPRDDDGHGTHTASTAAGSVVEGASLFGYAAGT  236

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+A +QA+ D V+V+S+S+        DYY+DS 
Sbjct  237   ARGMATRARVAAYKVCWVGGCFSSDILAAIEQAIDDNVNVLSMSLG---GGTSDYYKDSV  293

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA V LG+G+ ++
Sbjct  294   AIGAFAAMEKGILVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGQNYS  353

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+ L    LP VY G+A    N   C    LI  KV GKIV C+RG N  V KG
Sbjct  354   GVSLYKGDGLPGKLLPFVYAGNASNATNGNLCMMDTLIPEKVAGKIVMCDRGVNARVQKG  413

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GM++  T   GE + A AH++PAT V +  G+ IK Y+ S P PT  I+F 
Sbjct  414   AVVKAAGGLGMVLANTESNGEELVADAHLLPATAVGQKFGDAIKSYLVSDPKPTVTILFE  473

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  E+LKPD+IAPGVNILAGWSGA+GP+G   D RRV
Sbjct  474   GTKVGVEPS-PVVAAFSSRGPNSITPELLKPDMIAPGVNILAGWSGAVGPTGLATDSRRV  532

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  533   SFNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALM  571



>ref|XP_006339823.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score =   466 bits (1200),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 293/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F +GYE   G PI+ES E KSPRD +GHGTHTAS AAGS+V  ASLFGYA G 
Sbjct  186   KLVGARYFSRGYETTLG-PIDESKESKSPRDDDGHGTHTASTAAGSVVQGASLFGYASGT  244

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+AVYK+CW  GC++SDIL+  D+A+ D V V+SLS+        DYY+DS 
Sbjct  245   ARGMAYHARVAVYKVCWLGGCFNSDILAGMDKAIDDKVDVLSLSLG---GSTPDYYKDSI  301

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP   + +N APWI TVGA TIDR FPA V LG+G+ F+
Sbjct  302   AIGAFAAMEKGILVSCSAGNAGPNQFSLSNQAPWITTVGAGTIDRDFPAYVSLGNGKNFS  361

Query  542   GMSLYSGEPLGDNKLPLVYGGDANS----TYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY+G+ L +  LPLVY G+A++      C  G LI  KV GKIV C+RG N  V KG
Sbjct  362   GVSLYAGDSLLNKMLPLVYAGNASNVTSGNLCMMGTLIPEKVKGKIVLCDRGINARVQKG  421

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F V+ AGG GM++  TA  GE + A AH++PA  V  + G+ +K+Y+ S P+PTA I+  
Sbjct  422   FVVKAAGGAGMVLANTAANGEELVADAHLLPAAAVGLIAGDAVKKYLFSDPNPTAEILIG  481

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+GA+GP+G   D RRV
Sbjct  482   GTKVGIQPS-PVVAAFSSRGPNSITPEILKPDIIAPGVNILAGWTGAVGPTGMAEDDRRV  540

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAAL++  HP WSPAAI+SALM
Sbjct  541   EFNIISGTSMSCPHVSGLAALVKGVHPEWSPAAIRSALM  579



>ref|XP_004234656.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=771

 Score =   466 bits (1200),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 240/399 (60%), Positives = 289/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYE+  G PI+ S E KSPRD +GHGTHT++ A GS+V  ASL GYA G 
Sbjct  185   KLIGARYFAKGYESTLG-PIDVSKESKSPRDDDGHGTHTSTTATGSVVQGASLLGYASGN  243

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+SLS+    +   DYYRDS 
Sbjct  244   ARGMATHARVAVYKVCWVGGCFSSDILAALDKAIDDNVNVLSLSLGGGNS---DYYRDSV  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP   + +NVAPWI TVGA T+DR FPA V LG+G+ F+
Sbjct  301   AIGAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFS  360

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G       LP VY G+A    N   C SG LI  +V GKIV C+RG N  V KG
Sbjct  361   GVSLYKGASSLSKMLPFVYAGNASNMTNGNLCMSGTLIPEEVKGKIVLCDRGINPRVQKG  420

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG GM++  TA  G+ + A AH+IPAT+V +  G  IK Y+ S P+PTA I+F 
Sbjct  421   SVVKAAGGAGMVLANTAANGDELIADAHLIPATSVGQTTGEAIKNYLTSNPNPTATILFE  480

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+GA GP+G   D RRV
Sbjct  481   GTKVGIKPS-PVVAAFSSRGPNSITQEILKPDIIAPGVNILAGWTGAAGPTGLAEDDRRV  539

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  540   EFNIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALM  578



>ref|XP_002283279.2| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=765

 Score =   466 bits (1198),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 294/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYE   G P+NE++E +SPRD +GHG+HT++ A GS V  ASLFG+A G 
Sbjct  178   KLIGARFFSRGYEVAFG-PVNETIESRSPRDDDGHGSHTSTTAVGSAVEGASLFGFAAGT  236

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+A YK+CW  GCY SDI++A D+AV+DGV V+S+S+        DY +DS 
Sbjct  237   ARGMATHARVAAYKVCWLGGCYGSDIVAAMDKAVQDGVDVLSMSIG---GGLSDYTKDSV  293

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP   + +NVAPWI TVGA T+DR FPA V+LGDG+ F+
Sbjct  294   AIGAFRAMEQGILVSCSAGNGGPAPSSLSNVAPWITTVGAGTLDRDFPAFVMLGDGKKFS  353

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL D+ +PLVY G+A+S+     C    LI  KV GKIV C+RG N  V KG
Sbjct  354   GVSLYSGKPLSDSLIPLVYAGNASSSPNGNLCIPDNLIPGKVAGKIVLCDRGSNARVQKG  413

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+EAGGVGMI+  T   GE + A AH++P   V +  G+ IK YI+S P+P A I   
Sbjct  414   IVVKEAGGVGMILTNTDLYGEELVADAHLLPTAAVGQKAGDSIKSYISSDPNPMATIAPG  473

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VASFSSRGPNP+  EILKPD+IAPGVNILAGW+GA+GP+G  +D R+V
Sbjct  474   GTQVGVQPS-PVVASFSSRGPNPVTPEILKPDIIAPGVNILAGWTGAVGPTGLQVDTRKV  532

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP W PAAIKSALM
Sbjct  533   SFNIISGTSMSCPHVSGLAALLKAAHPEWRPAAIKSALM  571



>ref|XP_002865008.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41267.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
Length=753

 Score =   465 bits (1197),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 291/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYE+  G PI+ES E +SPRD +GHGTHT+S AAGS+V  ASL GYA G 
Sbjct  175   KLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGT  233

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+S+S+        DYYRD  
Sbjct  234   ARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG---GGMSDYYRDGV  290

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA  +LG+G+ FT
Sbjct  291   AIGAFAAMERGILVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFT  350

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ GE L D  LP +Y G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  351   GVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGVNARVQKG  410

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+  TA  GE + A AH++PAT V E  G+ I+ Y+ + P+PTA+I   
Sbjct  411   DVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPNPTASISIL  470

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+G  PS P VA+FSSRGPN +   ILKPD+IAPGVNILA W+ A GP+G   D RRV
Sbjct  471   GTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTTAAGPTGLASDSRRV  529

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+  HP WSPAAI+SALM
Sbjct  530   EFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALM  568



>ref|XP_006343203.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=770

 Score =   466 bits (1198),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 239/399 (60%), Positives = 291/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYE+  G PI+ S E KSPRD +GHGTHT++ AAGS+V  ASL GYA G 
Sbjct  184   KLIGARYFAKGYESTLG-PIDVSKESKSPRDDDGHGTHTSTTAAGSVVQGASLLGYASGN  242

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+AVYK+CW  GC+ SDIL+  D+A+ D V+V+SLS+    +   DYYRDS 
Sbjct  243   ARGMATHARVAVYKVCWVGGCFSSDILAGLDKAIDDNVNVLSLSLGGGNS---DYYRDSI  299

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP   + +NVAPWI TVGA T+DR FPA V LG+G+ F+
Sbjct  300   AIGAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFS  359

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+      LP VY G+A    N   C +G LI  +V GKIV C+RG N  V KG
Sbjct  360   GVSLYKGDSSLSKMLPFVYAGNASNMTNGNLCMTGTLIPEEVKGKIVLCDRGINPRVQKG  419

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG GM++  TA  G+ + A AH+IPAT+V +  G  IK+Y+ S P+PTA I+F 
Sbjct  420   SVVKAAGGAGMVLANTAANGDELIADAHLIPATSVGQTTGEAIKKYLTSDPNPTATILFE  479

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+GA GP+G   D RRV
Sbjct  480   GTKVGIKPS-PVVAAFSSRGPNSITQEILKPDIIAPGVNILAGWTGAAGPTGLAEDDRRV  538

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  539   EFNIISGTSMSCPHVSGLAALLKGAHPDWSPAAIRSALM  577



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score =   465 bits (1197),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 236/399 (59%), Positives = 293/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F +GYEA  G PIN + E +SPRD +GHGTHT+S  AGS V +    GYA G 
Sbjct  179   KLVGARFFSQGYEARMG-PINLTRESRSPRDNDGHGTHTSSTVAGSAVPDVDFLGYAAGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGM+ +ARIAVYK+CW  GC+ SDIL+A D+A++DG  V+SLS+        DYYRD+ 
Sbjct  238   ARGMSTRARIAVYKVCWLGGCFGSDILAAMDKAIEDGCGVLSLSLG---GGMSDYYRDNI  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF AM  GVVVS  AGN GPGA T +NVAPWI TVGA T+DR FPA+V+L +G+ +T
Sbjct  295   AVGAFSAMAMGVVVSCSAGNAGPGASTLSNVAPWITTVGAGTLDRDFPANVLLSNGKNYT  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL  + LP +Y G+A +T     C +G L+  KV GKIV C+RG N  V KG
Sbjct  355   GVSLYSGKPLPSSPLPFIYAGNATNTTNGNLCMTGTLLPDKVAGKIVLCDRGINARVQKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               VR+AGG GMI+  TA  GE + A AH++PAT V E+ G+ IK Y+ S P+PTA I FR
Sbjct  415   SVVRDAGGAGMILANTAANGEELVADAHLLPATAVGEIAGDAIKSYLFSDPNPTATIAFR  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGP+ +  +ILKPD+IAPGVNILA W+G++GP+G   D RR 
Sbjct  475   GTKVGVKPS-PVVAAFSSRGPSAITPDILKPDLIAPGVNILAAWTGSVGPTGQAADPRRT  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGL ALL+ AHP WSP AIKSALM
Sbjct  534   EFNIISGTSMSCPHVSGLLALLKGAHPDWSPGAIKSALM  572



>ref|XP_010484513.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   465 bits (1197),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 236/399 (59%), Positives = 290/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYE+  G PI+ES E +SPRD +GHGTHT+S AAGS+V  ASL GYA G 
Sbjct  181   KLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGT  239

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+S+S+        +YYRD  
Sbjct  240   ARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG---GGTSEYYRDGV  296

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA  +LG+G+ FT
Sbjct  297   AIGAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFT  356

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ GE L D  LP +Y G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  357   GVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVLCDRGVNARVQKG  416

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+  TA  GE + A AH++PAT V E  G+ I+ Y+ + P PTA +   
Sbjct  417   DVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDLIRHYVTTDPHPTATVSIL  476

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+G  PS P VA+FSSRGPN +   ILKPD+IAPGVNILA W+GA GP+G   D RRV
Sbjct  477   GTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRV  535

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+  HP WSPAAI+SALM
Sbjct  536   EFNIISGTSMSCPHVSGLAALLKAVHPEWSPAAIRSALM  574



>ref|XP_010464171.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=758

 Score =   465 bits (1197),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 289/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYE+  G PI+ES E +SPRD +GHGTHT+S AAGS+V  ASL GYA G 
Sbjct  180   KLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGT  238

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+S+S+        +YYRD  
Sbjct  239   ARGMAPHARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG---GGTSEYYRDGV  295

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA  +LG+G+ FT
Sbjct  296   AIGAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFT  355

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ GE L D  LP +Y G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  356   GVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGINARVQKG  415

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+  TA  GE + A AH++PAT V E  G+ I+ Y+ + P PTA I   
Sbjct  416   DVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDLIRHYVTTDPHPTATISIL  475

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+G  PS P VA+FSSRGPN +   ILKPD+IAPGVNILA W+GA GP+G   D RRV
Sbjct  476   GTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRV  534

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+  HP WSPAAI+SALM
Sbjct  535   EFNIISGTSMSCPHVSGLAALLKAVHPEWSPAAIRSALM  573



>ref|XP_006426043.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
 gb|ESR39283.1| hypothetical protein CICLE_v10024951mg [Citrus clementina]
Length=763

 Score =   465 bits (1196),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 290/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G PI+ES E KSPRD +GHGTHTAS AAGS+V  ASLFGYA G 
Sbjct  179   KLIGARYFARGYEATLG-PIDESKESKSPRDDDGHGTHTASTAAGSVVEGASLFGYAAGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+A +QA+ D V+V+S+S+        DYY+DS 
Sbjct  238   ARGMATRARVAAYKVCWVGGCFSSDILAAIEQAIDDNVNVLSMSLG---GGTSDYYKDSV  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA V LG+G+ ++
Sbjct  295   AIGAFAAMEKGILVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGQNYS  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+ L    LP VY G+A    N   C    LI  KV GKIV C+RG N  V KG
Sbjct  355   GVSLYKGDGLPGKLLPFVYAGNASNATNGNLCMMDTLIPEKVAGKIVMCDRGVNARVQKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GM++  T   GE + A AH++PAT V +  G+ IK Y+ S P PT  I+F 
Sbjct  415   AVVKAAGGLGMVLANTESNGEELVADAHLLPATAVGQKFGDAIKSYLVSDPKPTVTILFE  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  E+LKPD+IAPGVNILAGWSGA+GP+G   D RRV
Sbjct  475   GTKVGVEPS-PVVAAFSSRGPNSITPELLKPDMIAPGVNILAGWSGAVGPTGLATDSRRV  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  534   GFNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALM  572



>ref|XP_004141887.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN48584.1| hypothetical protein Csa_6G493920 [Cucumis sativus]
Length=761

 Score =   464 bits (1194),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 294/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F KGYEA  G PI+ES E +SPRD +GHGTHTAS AAGS+V NASLFGYA G 
Sbjct  173   KLVGARFFSKGYEATLG-PIDESKESRSPRDDDGHGTHTASTAAGSVVENASLFGYASGT  231

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW+ GC+ SDI++A D+AV D V+V+S+S+        DYY+DS 
Sbjct  232   ARGMAARARVAAYKVCWAGGCFSSDIVAAIDKAVDDNVNVLSMSLG---GGVSDYYKDSV  288

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A GAF AME G++VS  AGN GP   + +N +PWI TVGA T+DR FPA V LGD + F+
Sbjct  289   ATGAFAAMEKGILVSCSAGNAGPSPFSLSNTSPWITTVGAGTLDRDFPAYVSLGDAKNFS  348

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+ L    LP +Y  +A    N   C +G LI  KV GK+VFC+RG N  V KG
Sbjct  349   GVSLYRGKSLPGTLLPFIYAANASNSGNGNLCMTGTLIPEKVAGKVVFCDRGVNPRVQKG  408

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GM++  TA  GE + A +H++PAT V +  G+ I++Y+ S PSPT  I+F 
Sbjct  409   AVVKAAGGIGMVLANTAANGEELVADSHLLPATAVGQKSGDTIRKYLVSDPSPTVTILFE  468

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  ++LKPD+IAPGVNILAGWS ++GPSG  +D RRV
Sbjct  469   GTKLGIEPS-PVVAAFSSRGPNSITPQLLKPDIIAPGVNILAGWSKSVGPSGLAIDDRRV  527

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +FNIISGTSM+CPHVSGLAAL++ AHP WSPAAI+SALM
Sbjct  528   DFNIISGTSMSCPHVSGLAALIKGAHPDWSPAAIRSALM  566



>ref|XP_004167070.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=761

 Score =   464 bits (1194),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 294/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F KGYEA  G PI+ES E +SPRD +GHGTHTAS AAGS+V NASLFGYA G 
Sbjct  173   KLVGARFFSKGYEATLG-PIDESKESRSPRDDDGHGTHTASTAAGSVVENASLFGYASGT  231

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW+ GC+ SDI++A D+AV D V+V+S+S+        DYY+DS 
Sbjct  232   ARGMAARARVAAYKVCWAGGCFSSDIVAAIDKAVDDNVNVLSMSLG---GGVSDYYKDSV  288

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A GAF AME G++VS  AGN GP   + +N +PWI TVGA T+DR FPA V LGD + F+
Sbjct  289   ATGAFAAMEKGILVSCSAGNAGPSPFSLSNTSPWITTVGAGTLDRDFPAYVSLGDAKNFS  348

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+ L    LP +Y  +A    N   C +G LI  KV GK+VFC+RG N  V KG
Sbjct  349   GVSLYRGKSLPGTLLPFIYAANASNSGNGNLCMTGTLIPEKVAGKVVFCDRGVNPRVQKG  408

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GM++  TA  GE + A +H++PAT V +  G+ I++Y+ S PSPT  I+F 
Sbjct  409   AVVKAAGGIGMVLANTAANGEELVADSHLLPATAVGQKSGDTIRKYLVSDPSPTVTILFE  468

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  ++LKPD+IAPGVNILAGWS ++GPSG  +D RRV
Sbjct  469   GTKLGIEPS-PVVAAFSSRGPNSITPQLLKPDIIAPGVNILAGWSKSVGPSGLAIDDRRV  527

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +FNIISGTSM+CPHVSGLAAL++ AHP WSPAAI+SALM
Sbjct  528   DFNIISGTSMSCPHVSGLAALIKGAHPDWSPAAIRSALM  566



>ref|XP_009599383.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=773

 Score =   464 bits (1195),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 236/399 (59%), Positives = 290/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYE   G PI+ES E KS RD +GHGTHT++ A GS+V  ASLFGYA G 
Sbjct  185   KLIGARYFSRGYETTLG-PIDESRESKSARDDDGHGTHTSTTAGGSVVQGASLFGYAPGT  243

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+SLS+        DYYRDS 
Sbjct  244   ARGMATRARVAVYKVCWVGGCFSSDILAAMDKAIDDNVNVLSLSLG---GGISDYYRDSV  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP   + +NVAPWI TVGA T+DR FPA V LG+G+ F+
Sbjct  301   AIGAFAAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNFS  360

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G  L +  LP V+ G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  361   GVSLYKGNSLSNKMLPFVFAGNASNVTNGNLCMTGTLIPEKVKGKIVLCDRGINARVQKG  420

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG GM++  TA  GE + A AH++PAT V +  G+ I++Y+ S  +P A I+F 
Sbjct  421   SVVKAAGGAGMVLTNTAANGEELVADAHLLPATAVGQKTGDAIRDYLTSDSNPMATILFE  480

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+GA+GP+G   D RRV
Sbjct  481   GTKVGIEPS-PVVAAFSSRGPNSITPEILKPDIIAPGVNILAGWTGAVGPTGLEEDDRRV  539

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  540   GFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALM  578



>ref|XP_010444660.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   464 bits (1194),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 235/399 (59%), Positives = 290/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYE+  G PI+ES E +SPRD +GHGTHT+S AAGS+V  ASL G+A G 
Sbjct  181   KLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGFASGT  239

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGM+ +AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+S+S+        +YYRD  
Sbjct  240   ARGMSPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG---GGTSEYYRDGV  296

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA  +LG+G+ FT
Sbjct  297   AIGAFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFT  356

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ GE L D  LP +Y G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  357   GVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGVNARVQKG  416

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+EAGGVGMI+  TA  GE + A AH++PAT V E  G+ I+ Y+ + P PTA I   
Sbjct  417   DVVKEAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDLIRHYVTTDPHPTATISIL  476

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+G  PS P VA+FSSRGPN +   ILKPD+IAPGVNILA W+ A GP+G   D RRV
Sbjct  477   GTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTRAAGPTGLASDSRRV  535

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+  HP WSPAAI+SALM
Sbjct  536   EFNIISGTSMSCPHVSGLAALLKAVHPEWSPAAIRSALM  574



>ref|XP_006383545.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
 gb|ERP61342.1| hypothetical protein POPTR_0005s18880g [Populus trichocarpa]
Length=766

 Score =   464 bits (1194),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 239/400 (60%), Positives = 295/400 (74%), Gaps = 10/400 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G P++ES E KSPRD +GHGTHT+S A GS VA+ASLFGYA G 
Sbjct  185   KLIGARFFARGYEATLG-PVDESKESKSPRDDDGHGTHTSSTAGGSSVADASLFGYAAGT  243

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ DGV+V+S+S+    +Y   YYRDS 
Sbjct  244   ARGMAARARVAVYKVCWVGGCFSSDILAAMDKAIDDGVNVLSMSLGGSMSY---YYRDSV  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+ VS  AGN GP + + +NVAPWI TVGA T+DR FPA V LG+G+ ++
Sbjct  301   AIGAFAAMEKGIFVSCSAGNAGPSSYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGKNYS  360

Query  542   GMSLYSGEPLGDNKL-PLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDK  706
             G+SLY G+ +   KL P VY G+A    N   C  G LI  +V GKIV C+RG N  V K
Sbjct  361   GVSLYKGDAILPGKLLPFVYAGNASNATNGNLCMMGTLIPEQVAGKIVLCDRGVNPRVQK  420

Query  707   GFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVF  886
             G  V+ AGG+GM++  T   GE + A AH++PAT V +  G++IK Y+ S P PTA I+F
Sbjct  421   GAVVKAAGGIGMVLSNTDANGEELVADAHLLPATAVGKKGGDEIKNYLFSDPKPTATILF  480

Query  887   RGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRR  1066
              GT +G  PS P VA+FSSRGPN +  +ILKPD+IAPGVNILAGW G+ GP+G   D RR
Sbjct  481   EGTKVGIQPS-PVVAAFSSRGPNSITPDILKPDMIAPGVNILAGWVGSAGPTGLATDGRR  539

Query  1067  VEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             VEFNIISGTSM+CPHVSGLAAL++ AHP WSPAAIKSALM
Sbjct  540   VEFNIISGTSMSCPHVSGLAALIKAAHPDWSPAAIKSALM  579



>gb|AAM10321.1| AT5g67360/K8K14_8 [Arabidopsis thaliana]
 gb|AAN46863.1| At5g67360/K8K14_8 [Arabidopsis thaliana]
Length=757

 Score =   464 bits (1193),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 291/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYE+  G PI+ES E +SPRD +GHGTHT+S AAGS+V  ASL GYA G 
Sbjct  179   KLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+S+S+        DYYRD  
Sbjct  238   ARGMAPRARVAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG---GGMSDYYRDGV  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA  +LG+G+ FT
Sbjct  295   AIGAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFT  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ GE L D  LP +Y G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  355   GVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGINARVQKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+  TA  GE + A AH++PAT V E  G+ I+ Y+ + P+PTA+I   
Sbjct  415   DVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPNPTASISIL  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+G  PS P VA+FSSRGPN +   ILKPD+IAPGVNILA W+GA GP+G   D RRV
Sbjct  475   GTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRV  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+  HP  SPAAI+SALM
Sbjct  534   EFNIISGTSMSCPHVSGLAALLKSVHPECSPAAIRSALM  572



>ref|XP_006472275.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=766

 Score =   464 bits (1194),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 234/399 (59%), Positives = 296/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR+F +GYE   G PI+E+ E KSPRD +GHGTHT++ AAGS+V  ASLFG+A G 
Sbjct  179   KLIGARSFSRGYEEAVG-PIDETAESKSPRDDDGHGTHTSTTAAGSVVNGASLFGFASGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+  D+A++DGV+V+S+S+        DYYRD+ 
Sbjct  238   ARGMAAQARVATYKVCWLAGCFGSDILAGMDKAIEDGVNVMSMSIG---GGLTDYYRDTV  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AM  G+ VS  AGN GP A + +NVAPWI TVGA T+DR FP  V LG+G+ F+
Sbjct  295   AIGAFTAMAQGIFVSCSAGNGGPYANSISNVAPWITTVGAGTLDRNFPTYVSLGNGKSFS  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYS  PL  + +P+V   + +ST     C +G LI +KV GKIV C+RGGN  V+KG
Sbjct  355   GVSLYSRRPLSGSMVPIVDAANVSSTSSGNLCMTGSLIPAKVAGKIVVCDRGGNSRVEKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V++AGGVGMI+  T   GE + A A ++P+ NV E  G+ IK YI+S P P A I+ R
Sbjct  415   VEVKDAGGVGMILTNTDSYGEELVADAQLLPSANVGEKAGDAIKNYISSDPGPMATIISR  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPNP+  EILKPD+IAPGVNILAGW+GA+GP+G   D+R V
Sbjct  475   GTQLGIQPS-PVVAAFSSRGPNPITPEILKPDLIAPGVNILAGWTGAVGPTGLENDKRHV  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSP+AI+SALM
Sbjct  534   SFNIISGTSMSCPHVSGLAALLKAAHPEWSPSAIRSALM  572



>ref|XP_004981675.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=760

 Score =   464 bits (1193),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 240/399 (60%), Positives = 288/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYEA  G P++ S E +SPRD +GHGTHT+S AAG  V  A L GYA G 
Sbjct  179   KLIGARFFLTGYEAAKG-PVDTSKESRSPRDNDGHGTHTSSTAAGGAVQGADLLGYAAGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A+GMA +AR+A YK+CW+ GC+ SDIL A + AV DGV V+SLS+    A   DYYRDS 
Sbjct  238   AKGMAPRARVATYKVCWTGGCFSSDILKAMEAAVTDGVDVLSLSLGGGTA---DYYRDSI  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF AME G+ VS  AGN GPGA T +N APWI TVGA TIDR FPA V LG+G+ +T
Sbjct  295   AVGAFSAMEKGIFVSCSAGNAGPGAATLSNGAPWITTVGAGTIDRDFPAHVTLGNGKNYT  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL    +PL+Y G+A+++     C SG LI  KV GKIV C+RG N  V KG
Sbjct  355   GVSLYSGKPLSTTPVPLIYAGNASNSSMGQLCMSGSLIPEKVAGKIVLCDRGTNARVQKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F V++ GG GMI+  TA  GE + A AH++P + V E  GN I++Y  S P  TA IVF 
Sbjct  415   FIVKDVGGAGMILANTAANGEELVADAHILPGSGVGEKAGNAIRDYAMSDPKATATIVFA  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +   +LKPD+IAPGVNILA WSG++GPSG   D RRV
Sbjct  475   GTKVGIQPS-PVVAAFSSRGPNTVTPSVLKPDIIAPGVNILAAWSGSVGPSGIPGDSRRV  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AHP WSPAAI+SALM
Sbjct  534   GFNIISGTSMSCPHVSGLAALLRAAHPEWSPAAIRSALM  572



>ref|XP_008440346.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=761

 Score =   463 bits (1192),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 294/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+ES E +SPRD +GHGTHTAS AAGS+V NASLFGYA G 
Sbjct  174   KLIGARFFSKGYEATLG-PIDESKESRSPRDDDGHGTHTASTAAGSVVENASLFGYASGT  232

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW+ GC+ SDI++A D+AV+D V+V+S+S+        DYY+DS 
Sbjct  233   ARGMAARARVAAYKVCWAGGCFSSDIVAAMDKAVEDNVNVMSMSLG---GGVSDYYKDSV  289

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A GAF AME G++VS  AGN GP   + +N +PWI TVGA T+DR FPA V LGD + F+
Sbjct  290   ATGAFAAMEKGILVSCSAGNAGPSPFSLSNTSPWITTVGAGTLDRDFPAYVSLGDAKNFS  349

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+ L    LP +Y  +A    N   C +G LI  KV GK+VFC+RG N  V KG
Sbjct  350   GVSLYRGKSLPGTLLPFIYAANASNSGNGNLCMTGTLIPEKVAGKVVFCDRGVNPRVQKG  409

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GM++  TA  GE + A +H++PAT V +  G+ I++Y+ S P PT  I+F 
Sbjct  410   AVVKAAGGIGMVLANTAANGEELVADSHLLPATAVGQKSGDIIRKYLVSDPKPTVTILFE  469

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  ++LKPD+IAPGVNILAGWS ++GPSG  +D RRV
Sbjct  470   GTKLGIEPS-PVVAAFSSRGPNSITPQLLKPDIIAPGVNILAGWSKSVGPSGLAIDDRRV  528

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +FNIISGTSM+CPHVSGLAAL++ AHP WSPAAI+SALM
Sbjct  529   DFNIISGTSMSCPHVSGLAALIKGAHPDWSPAAIRSALM  567



>ref|XP_006433609.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
 gb|ESR46849.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
Length=766

 Score =   464 bits (1193),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 236/399 (59%), Positives = 295/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR+F +GYE   G PI+E+ E KSPRD +GHGTHT++ AAGS+V  ASLFG+A G 
Sbjct  179   KLIGARSFSRGYEEAVG-PIDETAESKSPRDDDGHGTHTSTTAAGSVVNGASLFGFASGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+  D+AV+DGV+V+S+S+        DYYRD+ 
Sbjct  238   ARGMAAQARVATYKVCWLAGCFGSDILAGMDKAVEDGVNVLSMSIG---GGLTDYYRDTV  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AM  G+ VS  AGN GP A + +NVAPWI TVGA T+DR FP  V LG+G+ F+
Sbjct  295   AIGAFTAMAQGIFVSCSAGNGGPYADSISNVAPWITTVGAGTLDRDFPTYVRLGNGKNFS  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYS  P   + +P+V   D +ST     C +G LI +KV GKIV C+RGGN  V+KG
Sbjct  355   GVSLYSRRPSSGSMVPIVDAADVSSTSSGNLCMTGSLIPAKVAGKIVVCDRGGNSRVEKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V++AGGVGMI+  T   GE + A A ++P+ NV E  G+ IK YI+S P P A I+ R
Sbjct  415   VEVKDAGGVGMILTNTDSYGEELVADAQLLPSANVGEKAGDAIKNYISSDPGPMATIISR  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPNP+  EILKPD+IAPGVNILAGW+GA+GP+G   D+R V
Sbjct  475   GTQLGIQPS-PVVAAFSSRGPNPITPEILKPDLIAPGVNILAGWTGAVGPTGLESDKRHV  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSP+AIKSALM
Sbjct  534   SFNIISGTSMSCPHVSGLAALLKAAHPEWSPSAIKSALM  572



>emb|CDP02570.1| unnamed protein product [Coffea canephora]
Length=780

 Score =   464 bits (1193),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 294/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYEA  G PI+ + E KSPRD +GHGTHT++ AAG+IV  ASLFGYA G 
Sbjct  184   KLIGARYFSTGYEATLG-PIDVTKESKSPRDDDGHGTHTSTTAAGAIVGGASLFGYASGS  242

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A++D V+V+SLS+    A   DYYRDS 
Sbjct  243   ARGMAYRARVAVYKVCWIGGCFSSDILAAIDRAIEDSVNVLSLSLGGGTA---DYYRDSV  299

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+ VS  AGN GP A T +N+APWI TVGA T+DR FPA V LG+G+ F+
Sbjct  300   AIGAFSAMEKGIFVSCSAGNAGPSAYTLSNLAPWITTVGAGTLDRDFPAYVSLGNGKNFS  359

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+ L    LP VY G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  360   GVSLYKGDSLPAKLLPFVYAGNASNSTNGNLCMTGTLIPEKVKGKIVLCDRGINPRVQKG  419

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG GM++  TA  GE + A AH++PA+ V +  G+ I++Y+ S  +PTA I+F 
Sbjct  420   AVVKGAGGAGMVLANTAANGEELVADAHLLPASTVGQKSGDAIRDYVLSDANPTATILFE  479

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNI+AGW+GA+GP+G   D RRV
Sbjct  480   GTKVGIEPS-PVVAAFSSRGPNAITPEILKPDLIAPGVNIIAGWTGAVGPTGLAEDPRRV  538

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAA ++ AHP WSPAAI+SALM
Sbjct  539   EFNIISGTSMSCPHVSGLAAFVKGAHPDWSPAAIRSALM  577



>ref|XP_004509085.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=758

 Score =   463 bits (1191),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 234/399 (59%), Positives = 290/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KG EA  G PI+E+ E KSPRD +GHGTHT+S AAGS+V  ASLFGYA G 
Sbjct  178   KLIGARYFSKGVEAMLG-PIDETTESKSPRDDDGHGTHTSSTAAGSVVTGASLFGYASGT  236

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+SLS+        DYYRDS 
Sbjct  237   ARGMATRARVAVYKVCWKGGCFSSDILAAIDKAISDNVNVLSLSLG---GGMSDYYRDSV  293

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP A + +NVAPWI TVGA T+DR FPA V LG+G  ++
Sbjct  294   AIGAFAAMEKGILVSCSAGNAGPSAYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGLNYS  353

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G  L D+ LP +Y G+A    N   C +G L    V GKIV C+RG +  V KG
Sbjct  354   GVSLYRGNALPDSPLPFIYAGNATNATNGNLCMTGSLSPDMVAGKIVLCDRGMSARVQKG  413

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GM++  TA  GE + A  H++PAT V E  G+ IK+Y+ S   PT  I+F 
Sbjct  414   AVVKAAGGLGMVLSNTAANGEELVADTHLLPATAVGEKAGDAIKKYVFSDAKPTVKILFE  473

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +   ILKPD+IAPGVNILAGWS A+GP+G  +D+RRV
Sbjct  474   GTKVGVQPS-PVVAAFSSRGPNSITPSILKPDLIAPGVNILAGWSKAVGPTGLSVDERRV  532

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +FNIISGTSM+CPHVSGLAA ++ AHP WSPAA++SALM
Sbjct  533   DFNIISGTSMSCPHVSGLAAFIKSAHPEWSPAAVRSALM  571



>ref|XP_001757585.1| predicted protein [Physcomitrella patens]
 gb|EDQ77642.1| predicted protein [Physcomitrella patens]
Length=749

 Score =   462 bits (1190),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 243/408 (60%), Positives = 295/408 (72%), Gaps = 21/408 (5%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR+F KGYEA TG PINE++EP+SPRD +GHGTHTAS AAG  V  ASL GYA+G 
Sbjct  156   KLIGARSFSKGYEAMTG-PINETMEPRSPRDTDGHGTHTASTAAGHYVYKASLLGYAEGT  214

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV---AIPRAYPEDYYR  352
             ARGMA +ARIA YK+CW+ GC+DSDIL+AFDQAV DGV VISLSV    +P      YY 
Sbjct  215   ARGMAPRARIAAYKVCWTQGCFDSDILAAFDQAVADGVDVISLSVGGGVVP------YYL  268

Query  353   DSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGR  532
             DS AIGAFGAM+ G+ V+  AGN+GP   T  NVAPWI TVGAST+DR FPA+VVL +G 
Sbjct  269   DSIAIGAFGAMKKGIFVACSAGNSGPDPITVANVAPWITTVGASTLDRDFPANVVLDNGD  328

Query  533   IFTGMSLYSGEPLGDNKLPLVYGGDA----------NSTYCYSGELIASKVTGKIVFCER  682
                G+SLYSG+ LG    PL+Y  DA          +++ C +G L  + V GKIV C+R
Sbjct  329   TIKGVSLYSGKGLGTTPYPLIYAQDAGFKNNGSDTYSASLCLAGSLDPNLVKGKIVLCDR  388

Query  683   GGNLDVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAP  862
             G N  V KG  ++ AGGVGMI+  TA  GE + A +HV+PAT V  ++GN IK +I ++ 
Sbjct  389   GNNPRVAKGGVIQAAGGVGMILANTATDGEGLIADSHVLPATAVGALEGNLIKAHIRNSK  448

Query  863   SPTAAIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPS  1042
             +PTA + F GT   T  + P VASFSSRGPN    EILKPD++ PGVNILA W+G +GP+
Sbjct  449   NPTATVTFGGTQFNTR-ATPVVASFSSRGPNSETPEILKPDLLGPGVNILAAWTGDMGPT  507

Query  1043  GSVMDQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             G  +D RRV FNIISGTSM+CPHVSGL AL++ AHPTWSPAAIKSALM
Sbjct  508   GLPLDTRRVRFNIISGTSMSCPHVSGLGALVKDAHPTWSPAAIKSALM  555



>ref|XP_004231902.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=763

 Score =   462 bits (1190),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 240/399 (60%), Positives = 290/399 (73%), Gaps = 11/399 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYEA  G PI+ES E KSPRD  GHGTHTAS AAGS+V  ASLFGYA G 
Sbjct  185   KLIGARYFSSGYEATLG-PIDESKESKSPRDNEGHGTHTASTAAGSVVQGASLFGYASGT  243

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW   C+  DIL+  D+A+ D V+V+SLS+        D+Y D  
Sbjct  244   ARGMAYRARVAVYKVCWLGKCFGPDILAGMDKAIDDNVNVLSLSLGGEHF---DFYSDDV  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP   +  N APWI TVGA T+DR FPA V LG+G+ F+
Sbjct  301   AIGAFAAMEKGIMVSCSAGNAGPNQFSLANQAPWITTVGAGTVDRDFPAYVSLGNGKNFS  360

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY+G+PL    LPLVY G+A    N   C  G LI  KV GKIV C+ G N+  +KG
Sbjct  361   GVSLYAGDPLPSGMLPLVYAGNASNATNGNLCIMGTLIPEKVKGKIVLCDGGVNVRAEKG  420

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             + V+ AGG GMI   T G G L  A AH++PA  V ++DG++IK+YI S P+PTA I+F 
Sbjct  421   YVVKSAGGAGMIFANTNGLGLL--ADAHLLPAAAVGQLDGDEIKKYITSDPNPTATILFG  478

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT++G  P AP +A+FSSRGPN +  EILKPD+IAPGVNILAGWSGA+GP+G   D RRV
Sbjct  479   GTMVGVQP-APILAAFSSRGPNSITPEILKPDIIAPGVNILAGWSGAVGPTGLPEDDRRV  537

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+  HP WSPAAI+SALM
Sbjct  538   EFNIISGTSMSCPHVSGLAALLKGVHPEWSPAAIRSALM  576



>ref|XP_010906269.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=764

 Score =   462 bits (1190),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 240/399 (60%), Positives = 292/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F K YEA  G PIN + E +SPRD  GHGTHTA+ AAGS V +ASLFG+A G 
Sbjct  176   KLIGARFFSKSYEATVG-PINGTTESRSPRDDEGHGTHTATTAAGSAVTDASLFGFANGT  234

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW+ GC+ SDIL+A D+AV DG HV+SLS+        +YY DS 
Sbjct  235   ARGMATRARVAAYKVCWAAGCFSSDILAAMDRAVDDGCHVLSLSLG---GEMTEYYEDSI  291

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+++S  AGN GP A + TNVAPWI+TVGA TIDR FPA VVLG+G+ +T
Sbjct  292   AIGAFNAMEKGLLISCSAGNGGPIASSVTNVAPWIITVGAGTIDRDFPAYVVLGNGKNYT  351

Query  542   GMSLYSGEPLGDNKLPLVYGGDANS----TYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+ L  + LP VY G+A++      C  G LI  KV GKIV C+RG N  V KG
Sbjct  352   GVSLYSGKLLPKSPLPFVYAGNASNATDGNLCIPGTLIPEKVAGKIVLCDRGINWRVQKG  411

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             + VREAGG GM++      GE + A AH++PAT V +  G+ I+ Y+ S  +P A IVF 
Sbjct  412   YVVREAGGAGMVLANADTYGEEVVADAHLLPATAVGQKAGDAIRAYLRSNKNPKATIVFG  471

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT IG  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+GA GP+G   D RRV
Sbjct  472   GTKIGVRPS-PVVAAFSSRGPNLVTSEILKPDLIAPGVNILAGWTGAAGPTGLSGDSRRV  530

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSG+AALL+ AHP WSPAA++SALM
Sbjct  531   VFNIISGTSMSCPHVSGIAALLKAAHPDWSPAAVRSALM  569



>ref|XP_002284101.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=767

 Score =   462 bits (1188),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 234/399 (59%), Positives = 293/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+ES E KSPRD +GHGTHTA+ AAGS+V  ASLFG+A+G 
Sbjct  181   KLIGARFFSKGYEATLG-PIDESKESKSPRDDDGHGTHTATTAAGSVVEGASLFGFAEGT  239

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIA YK+CW  GC+ +DIL+A D+AV+D V+++SLS+        DYYRDS 
Sbjct  240   ARGMATRARIAAYKVCWIGGCFSTDILAALDKAVEDNVNILSLSLG---GGMSDYYRDSV  296

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAFGAME G++VS  AGN+GP   + +NVAPWI TVGA T+DR FPA V LG+G+ ++
Sbjct  297   AMGAFGAMEKGILVSCSAGNSGPSPYSLSNVAPWITTVGAGTLDRDFPAFVSLGNGKNYS  356

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+PL    LP VY G+A    N   C +  LI  KV GK+V C+RG N  V KG
Sbjct  357   GVSLYRGDPLPGTLLPFVYAGNASNAPNGNLCMTNTLIPEKVAGKMVMCDRGVNPRVQKG  416

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GM++  T   GE + A AH++PAT V +  G+ IK Y+ S    T  I+F 
Sbjct  417   SVVKAAGGIGMVLANTGTNGEELVADAHLLPATAVGQKSGDAIKSYLFSDHDATVTILFE  476

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  +ILKPD+IAPGVNILAGWSGA+GP+G   D+R V
Sbjct  477   GTKVGIQPS-PVVAAFSSRGPNSITPDILKPDLIAPGVNILAGWSGAVGPTGLPTDKRHV  535

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +FNIISGTSM+CPH+SGLA LL+ AHP WSPAAI+SALM
Sbjct  536   DFNIISGTSMSCPHISGLAGLLKAAHPEWSPAAIRSALM  574



>ref|XP_011010186.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=766

 Score =   461 bits (1187),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 236/400 (59%), Positives = 295/400 (74%), Gaps = 10/400 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G P++ES E KSPRD +GHGTHT+S A GS VA+ASLFGYA G 
Sbjct  185   KLIGARFFARGYEATLG-PVDESKESKSPRDDDGHGTHTSSTAGGSFVADASLFGYAAGT  243

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ DGV+V+S+S+    +Y   YYRDS 
Sbjct  244   ARGMAARARVAVYKVCWVGGCFSSDILAAMDKAIDDGVNVLSMSLGGSMSY---YYRDSV  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+ VS  AGN+GP + + +NVAPWI TVGA T+DR FPA   LG+G+ ++
Sbjct  301   AIGAFAAMEKGIFVSCSAGNSGPSSYSLSNVAPWITTVGAGTLDRDFPAFASLGNGKNYS  360

Query  542   GMSLYSGEPLGDNKL-PLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDK  706
             G+SLY G+ +   KL P VY G+A    N   C  G LI  +V GKIV C+RG N  V K
Sbjct  361   GVSLYKGDAILPGKLLPFVYAGNASNATNGNLCMMGALIPEQVAGKIVLCDRGVNPRVQK  420

Query  707   GFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVF  886
             G  V+ AGG+GM++  T   GE + A AH++PAT V +  G++IK+Y+ S   PT  I+F
Sbjct  421   GAVVKAAGGLGMVLSNTDANGEELVADAHLLPATAVGQKGGDEIKKYLFSDSKPTVNILF  480

Query  887   RGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRR  1066
              GT +G  PS P VA+FSSRGPN +  +ILKPD+IAPGVNILAGW G++GP+G   D RR
Sbjct  481   EGTKVGIQPS-PVVAAFSSRGPNSITPDILKPDMIAPGVNILAGWVGSVGPTGLATDGRR  539

Query  1067  VEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             VEFNIISGTSM+CPHVSGLAAL++ AHP WSPAAIKSALM
Sbjct  540   VEFNIISGTSMSCPHVSGLAALIKAAHPDWSPAAIKSALM  579



>ref|XP_010087293.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB28740.1| Subtilisin-like protease [Morus notabilis]
Length=743

 Score =   460 bits (1184),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 234/399 (59%), Positives = 292/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G PI+ S E KSPRD +GHGTHTAS AAGS+V  ASLFG+A G 
Sbjct  162   KLIGARFFSRGYEATLG-PIDASRESKSPRDDDGHGTHTASTAAGSVVEGASLFGFAAGT  220

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL   DQAV+D V+V+S+S+    +   +YYRDS 
Sbjct  221   ARGMATRARVAVYKVCWLGGCFSSDILKGLDQAVEDNVNVLSMSLGGGMS---EYYRDSV  277

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF AM+ G+ +S+ AGN GP   + +NVAPWI TVGA T+DR FPA V LG G+ ++
Sbjct  278   AVGAFAAMQKGIFISSSAGNAGPSDFSLSNVAPWITTVGAGTLDRDFPAYVSLGSGQNYS  337

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G+ L    LPL+Y G+A    N   C  G LI  KV GK+V C+RG N  V KG
Sbjct  338   GVSLYKGDALPHGMLPLIYAGNASNATNGNLCMMGTLIPEKVAGKMVLCDRGLNARVQKG  397

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GM++  TA  GE + A AH++PA+ V E  GN IK+Y+ S  +PT  I+F 
Sbjct  398   AVVKAAGGLGMVLANTASNGEELVADAHLLPASCVGEKSGNAIKKYLFSDTNPTVTILFE  457

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  +ILKPD+IAPGVNI+AGWSG +GP+G  +D RRV
Sbjct  458   GTKVGVQPS-PVVAAFSSRGPNLITPQILKPDIIAPGVNIIAGWSGKLGPTGLAIDSRRV  516

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  517   AFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALM  555



>ref|XP_007155854.1| hypothetical protein PHAVU_003G237300g [Phaseolus vulgaris]
 gb|ESW27848.1| hypothetical protein PHAVU_003G237300g [Phaseolus vulgaris]
Length=794

 Score =   462 bits (1188),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 235/399 (59%), Positives = 291/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KG EA  G PINE+ E +SPRD +GHGTHTAS AAGS+V+ ASLFGYA G 
Sbjct  214   KLIGARFFAKGCEAMLG-PINETEESRSPRDDDGHGTHTASTAAGSVVSGASLFGYASGT  272

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIA YK+CW  GC+ SDIL+A + A++D V+V+SLS+    A   DYYRDS 
Sbjct  273   ARGMATRARIAAYKVCWKGGCFSSDILAAIESAIQDNVNVLSLSLGGGMA---DYYRDSV  329

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP   + +NVAPWI TVGA T+DR FPA V LG+G  F+
Sbjct  330   AIGAFSAMEKGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVSLGNGLNFS  389

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G  L D+ LP VY G+A    N   C +G L   KV GKIV C+RG    V KG
Sbjct  390   GVSLYRGNALPDSPLPFVYAGNASNATNGNLCVTGTLSPEKVAGKIVLCDRGLTARVQKG  449

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AG +GM++  TA  GE + A AH++PA+ V E  G+ IK+Y+ +   PT +I+F 
Sbjct  450   SVVKSAGALGMVLSNTAANGEELVADAHLLPASAVGEKAGDAIKKYLFTEAKPTVSILFE  509

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  +ILKPD+IAPGVNILAGWS A+GP+G  +D RRV
Sbjct  510   GTKVGIQPS-PVVAAFSSRGPNSITPQILKPDLIAPGVNILAGWSKAVGPTGLPVDNRRV  568

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +FNIISGTSM+CPHVSGLAAL++  HP WSPAA++SALM
Sbjct  569   DFNIISGTSMSCPHVSGLAALIKSVHPEWSPAAVRSALM  607



>ref|XP_004287970.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=761

 Score =   461 bits (1186),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 239/401 (60%), Positives = 292/401 (73%), Gaps = 11/401 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+ S E KSPRD +GHGTHT++ AAGS+V  ASLFGYA G 
Sbjct  175   KLIGARYFSKGYEATLG-PIDTSKESKSPRDDDGHGTHTSTTAAGSVVTGASLFGYAPGT  233

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIA YK+CW  GC+ SDIL A DQA+ D V+V+S+S+        DY+RDS 
Sbjct  234   ARGMATRARIAAYKVCWLGGCFSSDILMAIDQAIDDNVNVLSMSLG---GGMSDYFRDSV  290

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+++S  AGN GP A + +N APWI TVGA T+DR FPA + LG+G+ F+
Sbjct  291   AIGAFSAMEKGILISCSAGNAGPSAYSLSNSAPWITTVGAGTLDRDFPAFLSLGNGKNFS  350

Query  542   GMSLYSG--EPLGDNKLPLVYGGDA-NST---YCYSGELIASKVTGKIVFCERGGNLDVD  703
             G+SLY G  E       P +Y G+A NST    C  G LI  KV GKIV C+RG N  V 
Sbjct  351   GVSLYRGNSEATALEMTPFIYAGNASNSTSGNLCMMGSLIPEKVKGKIVMCDRGVNARVQ  410

Query  704   KGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIV  883
             KG  V+ AGGVGM++  T   GE + A AH++PAT V + + + IK Y+ S P+PTAAI+
Sbjct  411   KGTVVKAAGGVGMVLSNTGANGEELVADAHLLPATAVGQKNADLIKSYLFSDPNPTAAIL  470

Query  884   FRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQR  1063
             F GT +G  PS P VA+FSSRGPN +  +ILKPD++APGVNILAGWSGA+GP+G  +D R
Sbjct  471   FEGTKVGIEPS-PVVAAFSSRGPNSITPDILKPDMVAPGVNILAGWSGAVGPTGLAVDSR  529

Query  1064  RVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             RV FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  530   RVAFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALM  570



>tpg|DAA51518.1| TPA: putative subtilase family protein [Zea mays]
Length=765

 Score =   460 bits (1184),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 287/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYEA  G P++ S E +SPRD +GHGTHT+S AAG  V  A L GYA G 
Sbjct  182   KLIGARFFLTGYEAAKG-PVDTSKESRSPRDNDGHGTHTSSTAAGGAVQGADLLGYAAGT  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A+GMA +AR+A YK+CW  GC+ SDIL A + AV DGV V+SLS+    A   +YYRDS 
Sbjct  241   AKGMAPRARVATYKVCWVGGCFSSDILKAMEVAVTDGVDVLSLSLGGGTA---EYYRDSI  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF AME G+ VS  AGN GPGA T +N APWI TVGA TIDR FPA V LG+G+ +T
Sbjct  298   AVGAFSAMEKGIFVSCSAGNAGPGAATLSNGAPWITTVGAGTIDRDFPAYVTLGNGKNYT  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL    +P +Y G+A+++     C SG LI  KV GKIV C+RG N  V KG
Sbjct  358   GVSLYSGKPLPTTPMPFIYAGNASNSSMGQLCMSGSLIPEKVAGKIVLCDRGTNARVQKG  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F V++AGG GM++  TA  GE + A AHV+P + V E  GN +++Y  S P  TA IVF 
Sbjct  418   FVVKDAGGAGMVLANTAANGEELVADAHVLPGSGVGEKAGNAMRDYAMSDPKATATIVFA  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +   +LKPD+IAPGVNILA WSG++GPSG   D RRV
Sbjct  478   GTKVGVKPS-PVVAAFSSRGPNTVTSSVLKPDIIAPGVNILAAWSGSVGPSGLPGDGRRV  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AHP WSPAAI+SALM
Sbjct  537   GFNIISGTSMSCPHVSGLAALLRAAHPEWSPAAIRSALM  575



>ref|XP_010679580.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=768

 Score =   460 bits (1183),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 293/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA+ F +GYEA  GS  +ES E KSPRD +GHGTHTAS AAGS V  ASLFGYA G 
Sbjct  178   KLIGAQYFSQGYEAVVGS-FDESRESKSPRDDDGHGTHTASTAAGSPVEGASLFGYAPGT  236

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW+ GC+ SDIL A D+A++D V+V+SLS+        +YYRDS 
Sbjct  237   ARGMAPRARVAVYKVCWTGGCFSSDILKAIDKAIEDNVNVLSLSLG---GGTSEYYRDSV  293

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AMEHG++VS  AGN GP A + +NVAPWI TVGA T+DR FPA   + +G+ + 
Sbjct  294   AIGAFAAMEHGILVSCSAGNAGPTAFSLSNVAPWITTVGAGTLDRDFPAVASVSNGKKYA  353

Query  542   GMSLYSGEPLGDNKLPLVYGGDANS----TYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ GE L    LP VY G+A++    + C +G LI  KV GKIV C+RG N  V KG
Sbjct  354   GVSLFRGESLPHGMLPAVYAGNASNATSGSLCMTGTLIPEKVKGKIVLCDRGVNPRVQKG  413

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GMI+  T   GE + A AH++PAT V +  G+ I++Y+ S  +PTA I+F 
Sbjct  414   AVVKAAGGLGMILANTEANGEELVADAHLLPATAVGQKSGDAIRDYVISDSNPTATILFE  473

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGWSGA+GP+    D RRV
Sbjct  474   GTKVGVQPS-PVVAAFSSRGPNAITPEILKPDMIAPGVNILAGWSGALGPTAVATDMRRV  532

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLA L++ AHP WSPAAIKSALM
Sbjct  533   EFNIISGTSMSCPHVSGLAGLVKGAHPDWSPAAIKSALM  571



>ref|XP_006393933.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
 gb|ESQ31219.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
Length=758

 Score =   459 bits (1182),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 292/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G P++ES E +SPRD +GHGTHT+S AAGS+V  ASL G+A G 
Sbjct  180   KLIGARFFARGYEATMG-PVDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGFANGT  238

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+S+S+        DYYRD  
Sbjct  239   ARGMAPRARVAVYKVCWQGGCFSSDILAAIDKAIDDNVNVLSMSLG---GGMSDYYRDGV  295

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+F AME G++VS  AGN GP + + +NVAPWI TVGA TIDR FPA  +LG+G+ ++
Sbjct  296   AIGSFAAMERGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTIDRDFPALAILGNGKNYS  355

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ G+ L    LP VY G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  356   GVSLFKGDALPAKLLPFVYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGVNARVQKG  415

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GMI+  TA  GE + A AH++PAT V E  G+ I+ Y+ + P+PTA I+ +
Sbjct  416   DVVKAAGGLGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVLTDPNPTATILIQ  475

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+   PS P VA+FSSRGPN +   ILKPD+IAPGVNILAGW+GA GP+G   D RRV
Sbjct  476   GTVVNVQPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAGWTGAEGPTGLASDSRRV  534

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAAL++  HP WSPAAI+SALM
Sbjct  535   EFNIISGTSMSCPHVSGLAALIKSVHPEWSPAAIRSALM  573



>ref|XP_010059854.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66296.1| hypothetical protein EUGRSUZ_F00121 [Eucalyptus grandis]
Length=765

 Score =   459 bits (1182),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 231/399 (58%), Positives = 302/399 (76%), Gaps = 10/399 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G PI+ES E +SPRD +GHGTHT++ AAGS+V  A+LFG+A G 
Sbjct  179   KLIGARFFSRGYEAALG-PIDESKESRSPRDDDGHGTHTSTTAAGSVVPEANLFGFASGI  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KAR+A+YK+CW  GC+ SDI++A D+AV+DGV+VIS+S+        DYYRD+ 
Sbjct  238   ARGMATKARLAIYKVCWLSGCFGSDIMAAMDKAVEDGVNVISMSIG---GGITDYYRDTI  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             ++GAF AM HG++VS  AGN+GP + +  N+APWI TVGAST+DR FPA V LG+G+ + 
Sbjct  295   SMGAFNAMAHGILVSCSAGNSGPSSMSVANIAPWITTVGASTLDRDFPAYVTLGNGKKYR  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY+G+ L    +PLV+ G+A+S+     C++G L+ASKV GKIV C+RGGN    K 
Sbjct  355   GVSLYNGKSL-SGPVPLVFAGNASSSSSGEVCFTGSLVASKVAGKIVICDRGGNSRAQKS  413

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+  T   GE + A A+++P+  + +  G +IK+YI+S P+PTA I   
Sbjct  414   MVVKNAGGVGMILTNTESYGEELVADAYLLPSAALGQKAGIEIKKYISSDPTPTATIASG  473

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VASFSSRGPNPL  +ILKPD+IAPGVN+LAGW+GA+GP+G   D+R+V
Sbjct  474   GTELDVQPS-PVVASFSSRGPNPLNQQILKPDLIAPGVNVLAGWTGAVGPTGLDKDKRQV  532

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AH  WSPAAI+SALM
Sbjct  533   NFNIISGTSMSCPHVSGLAALLKAAHQDWSPAAIRSALM  571



>ref|XP_008792659.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score =   459 bits (1182),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 291/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PIN++ E +SPRD  GHGTHTA+ AAGS V + SL G+A G 
Sbjct  181   KLIGARFFSKGYEASAG-PINDTRESRSPRDNEGHGTHTATTAAGSAVTDVSLNGFAAGT  239

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW+ GC+ SDIL+A D+AV+DG  V+SLS+        DYY+D  
Sbjct  240   ARGMATRARVAAYKVCWAGGCFSSDILAAMDRAVEDGCQVLSLSLGGGMV---DYYKDIV  296

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME GV+ S  AGN GP A + +NVAPW+ TVGA TIDR FPA VVLG+G+ ++
Sbjct  297   AIGAFNAMEKGVLTSFSAGNAGPFASSLSNVAPWMTTVGAGTIDRDFPAYVVLGNGKNYS  356

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL  + LP VY G+A    N   C  G L+  KV GKI+ C+RG    V KG
Sbjct  357   GVSLYSGKPLPSSPLPFVYAGNASNASNGNLCMPGTLMPKKVAGKIILCDRGIIARVQKG  416

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             + VREAGG GM++  T   GE + A AH++PA  V +  G+ ++ Y+ S  SPTA IVF 
Sbjct  417   YVVREAGGAGMVLANTDANGEELVADAHLLPAAGVGQKVGDAVRAYLRSDKSPTATIVFG  476

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT IG  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+G  GP+G  +D RRV
Sbjct  477   GTKIGVRPS-PVVAAFSSRGPNAVTPEILKPDLIAPGVNILAGWTGVAGPTGLSVDSRRV  535

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+ AHP WSPAA++SALM
Sbjct  536   EFNIISGTSMSCPHVSGLAALLKGAHPDWSPAAVRSALM  574



>ref|NP_001151463.1| LOC100285096 precursor [Zea mays]
 gb|ACG42951.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score =   459 bits (1181),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 287/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYEA  G P++ S E +SPRD +GHGTHT++ AAG  V  A L GYA G 
Sbjct  182   KLIGARFFLTGYEAAKG-PVDTSKESRSPRDNDGHGTHTSTTAAGGAVQGADLLGYAAGT  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A+GMA +AR+A YK+CW  GC+ SDIL A + AV DGV V+SLS+    A   +YYRDS 
Sbjct  241   AKGMAPRARVATYKVCWVGGCFSSDILKAMEVAVTDGVDVLSLSLGGGTA---EYYRDSI  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF AME G+ VS  AGN GPGA T +N APWI TVGA TIDR FPA V LG+G+ +T
Sbjct  298   AVGAFSAMEKGIFVSCSAGNAGPGAATLSNGAPWITTVGAGTIDRDFPAYVTLGNGKNYT  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL    +P +Y G+A+++     C SG LI  KV GKIV C+RG N  V KG
Sbjct  358   GVSLYSGKPLPTTPMPFIYAGNASNSSMGQLCMSGSLIPEKVAGKIVLCDRGTNARVQKG  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F V++AGG GM++  TA  GE + A AHV+P + V E  GN +++Y  S P  TA IVF 
Sbjct  418   FVVKDAGGAGMVLANTAANGEELVADAHVLPGSGVGEQAGNAMRDYAMSDPKATATIVFA  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +   +LKPD+IAPGVNILA WSG++GPSG   D RRV
Sbjct  478   GTKVGVKPS-PVVAAFSSRGPNTVTSSVLKPDIIAPGVNILAAWSGSVGPSGLPGDGRRV  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AHP WSPAAI+SALM
Sbjct  537   GFNIISGTSMSCPHVSGLAALLRAAHPEWSPAAIRSALM  575



>gb|KFK28394.1| hypothetical protein AALP_AA8G509300 [Arabis alpina]
Length=754

 Score =   459 bits (1180),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 234/399 (59%), Positives = 290/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+ES E +SPRD +GHGTHT+S AAGS V  ASL G+A G 
Sbjct  176   KLIGARFFSKGYEATMG-PIDESKESRSPRDDDGHGTHTSSTAAGSFVEGASLLGFANGT  234

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KAR+AVYK+CW  GC+ SDIL+A D+A+ D V+V+S+S+        DYYRDS 
Sbjct  235   ARGMAPKARVAVYKVCWVGGCFSSDILAAIDKAIDDNVNVLSMSLG---GGMSDYYRDSV  291

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+F AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA  VLG+G+ ++
Sbjct  292   AIGSFAAMEKGILVSCSAGNAGPSSFSLSNVAPWITTVGAGTLDRDFPALAVLGNGKNYS  351

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ G+ L    LP VY G+A    N   C SG LI   V GKIV C+RG N  V KG
Sbjct  352   GVSLFKGDSLPSKLLPFVYAGNASNATNGNLCMSGTLIPELVKGKIVMCDRGVNARVQKG  411

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+  TA  GE + A AH++P T V +  G+ I+ Y+ + P+PTA+++ +
Sbjct  412   EVVKAAGGVGMILANTAANGEELVADAHLLPTTAVGQKAGDLIRHYVLTEPNPTASVLIQ  471

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+   PS P VA+FSSRGPN +   ILKPD+IAPGVNILA W+GA GP+G   D RRV
Sbjct  472   GTVVNIKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAQGPTGLASDSRRV  530

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+  HP WSPAAI+SALM
Sbjct  531   EFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALM  569



>emb|CDY12840.1| BnaC07g15930D [Brassica napus]
Length=760

 Score =   459 bits (1180),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 233/399 (58%), Positives = 291/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G P++ES E +SPRD +GHGTHT+S AAGS+V  ASL G+A G 
Sbjct  182   KLIGARFFARGYEATMG-PVDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGFASGT  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGM  +AR+AVYK+CW  GC+ SDIL+A D+A++D V+V+S+S+        DYYRD  
Sbjct  241   ARGMDPRARVAVYKVCWLGGCFSSDILAAIDKAIEDNVNVLSMSLG---GGMSDYYRDGV  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+ VS  AGN GP   + +NVAPWI TVGA T+DR FPA  +LG+G+ F+
Sbjct  298   AIGAFAAMERGIFVSCSAGNAGPSPFSLSNVAPWITTVGAGTLDRDFPAIAILGNGKNFS  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ G  L D  LP +Y G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  358   GVSLFKGVALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGVNARVQKG  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+  TA  GE + A AH++PAT V E  G+ I+ Y+ + P+PTA+++ +
Sbjct  418   DVVKAAGGVGMILANTAANGEELVADAHMLPATTVGEKAGDIIRRYVLTDPNPTASVLIQ  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+   PS P VA+FSSRGPN +   ILKPD+IAPGVNILA W+GA GP+G   D RRV
Sbjct  478   GTVVNVQPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLPSDPRRV  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  537   EFNIISGTSMSCPHVSGLAALLKSAHPEWSPAAIRSALM  575



>emb|CDY57437.1| BnaAnng14520D [Brassica napus]
Length=760

 Score =   457 bits (1177),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 291/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G P++ES E +SPRD +GHGTHT+S AAGS+V  ASL G+A G 
Sbjct  183   KLIGARFFARGYEATMG-PVDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGFASGT  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGM  +AR+AVYK+CW  GC+ SDIL+A DQA++D V+V+S+S+        DYYRD  
Sbjct  242   ARGMDPRARVAVYKVCWLGGCFSSDILAAIDQAIEDNVNVLSMSLG---GGMSDYYRDGV  298

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+ VS  AGN GP   + +NVAPWI TVGA T+DR FPA  +LG+G+ ++
Sbjct  299   AIGAFAAMERGIFVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAIAILGNGKNYS  358

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ G+ L D  LP +Y G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  359   GVSLFKGDALPDKLLPFIYAGNASNATNGNLCMTGSLIPEKVKGKIVMCDRGVNARVQKG  418

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+  TA  GE + A AH++PAT V E  G+ I+ Y+ + P+PTA+++ +
Sbjct  419   DVVKAAGGVGMILANTAANGEELVADAHMLPATTVGEKAGDIIRRYVLTDPNPTASVLIQ  478

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+   PS P VA+FSSRGPN +   ILKPD+IAPGVNILA W+GA GP+G   D RRV
Sbjct  479   GTVVNVQPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLPSDPRRV  537

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  538   GFNIISGTSMSCPHVSGLAALLKSAHPEWSPAAIRSALM  576



>ref|XP_009103426.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=760

 Score =   457 bits (1177),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 291/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G P++ES E +SPRD +GHGTHT+S AAGS+V  ASL G+A G 
Sbjct  183   KLIGARFFARGYEATMG-PVDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGFASGT  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGM  +AR+AVYK+CW  GC+ SDIL+A DQA++D V+V+S+S+        DYYRD  
Sbjct  242   ARGMDPRARVAVYKVCWLGGCFSSDILAAIDQAIEDNVNVLSMSLG---GGMSDYYRDGV  298

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+ VS  AGN GP   + +NVAPWI TVGA T+DR FPA  +LG+G+ ++
Sbjct  299   AIGAFAAMERGIFVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAIAILGNGKNYS  358

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ G+ L D  LP +Y G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  359   GVSLFKGDALPDKLLPFIYAGNASNATNGNLCMTGSLIPEKVKGKIVMCDRGVNARVQKG  418

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+  TA  GE + A AH++PAT V E  G+ I+ Y+ + P+PTA+++ +
Sbjct  419   DVVKAAGGVGMILANTAANGEELVADAHMLPATTVGEKAGDIIRRYVLTDPNPTASVLIQ  478

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+   PS P VA+FSSRGPN +   ILKPD+IAPGVNILA W+GA GP+G   D RRV
Sbjct  479   GTVVNVQPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLPSDPRRV  537

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  538   GFNIISGTSMSCPHVSGLAALLKSAHPEWSPAAIRSALM  576



>ref|XP_002463844.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 ref|XP_002464198.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
 gb|EER90842.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 gb|EER91196.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
Length=764

 Score =   457 bits (1176),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 239/399 (60%), Positives = 287/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYEA  G P++ S E +SPRD +GHGTHT+S AAG  V  A L GYA G 
Sbjct  182   KLIGARFFLTGYEAAKG-PVDTSKESRSPRDNDGHGTHTSSTAAGGAVQGADLLGYAAGT  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A+GMA +AR+A YK+CW  GC+ SDIL A + AV DGV V+SLS+    A   +YYRDS 
Sbjct  241   AKGMAPRARVATYKVCWVGGCFSSDILKAMEVAVTDGVDVLSLSLGGGTA---EYYRDSI  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF AME G+ VS  AGN GPGA T +N APWI TVGA TIDR FPA V+LG+G+ +T
Sbjct  298   AVGAFSAMEKGIFVSCSAGNAGPGAATLSNGAPWITTVGAGTIDRDFPAYVMLGNGKNYT  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+ L    +P +Y G+A+++     C SG LI  KV GKIV C+RG N  V KG
Sbjct  358   GVSLYSGKLLPTTPVPFIYAGNASNSSMGQLCMSGSLIPEKVAGKIVLCDRGTNARVQKG  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F V++AGG GM++  TA  GE + A AHV+P + V E  GN +++Y  S P  TA IVF 
Sbjct  418   FVVKDAGGAGMVLANTAANGEELVADAHVLPGSGVGEKAGNAMRDYAMSDPKATATIVFA  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +   ILKPDVIAPGVNILA WSG++GPSG   D RRV
Sbjct  478   GTKVGIKPS-PVVAAFSSRGPNTVTSSILKPDVIAPGVNILAAWSGSVGPSGLPGDSRRV  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AHP WSPAAI+SALM
Sbjct  537   GFNIISGTSMSCPHVSGLAALLRAAHPEWSPAAIRSALM  575



>ref|XP_003550312.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=777

 Score =   457 bits (1176),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 229/399 (57%), Positives = 293/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F KGYEA  G PI+ + E KS RD +GHG+HT + AAGS+V  ASLFG A G 
Sbjct  189   KLVGARFFSKGYEAALG-PIDTTTESKSARDDDGHGSHTLTTAAGSVVPEASLFGLASGT  247

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDI +  D+A++DGV+V+S+S+        +YYRD  
Sbjct  248   ARGMATQARVAVYKVCWLGGCFTSDIAAGIDKAIEDGVNVLSMSIG---GSLMEYYRDII  304

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+F AM HG++VST AGN GP   + +NVAPWI TVGA TIDR FPA + LG G+ +T
Sbjct  305   AIGSFTAMSHGILVSTSAGNGGPSQGSLSNVAPWITTVGAGTIDRDFPAYITLGTGKTYT  364

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G SLYSG+PL D+ LPLVY G+A+++     C    LI  KV+GKIV CERGGN  V+KG
Sbjct  365   GASLYSGKPLSDSPLPLVYAGNASNSSVGYLCLQDSLIPEKVSGKIVICERGGNPRVEKG  424

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG GMI+  +   GE + A +H++PA ++ +     +K Y++S+P+PTA I F 
Sbjct  425   LVVKLAGGAGMILANSEAYGEELVADSHLLPAASLGQKSSEILKNYVSSSPNPTAKIAFL  484

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPN L  +ILKPD+IAPGVNILAGW+GA+GP+G  +D R V
Sbjct  485   GTHLQVQPS-PVVAAFSSRGPNALTPKILKPDLIAPGVNILAGWTGAVGPTGLTVDTRHV  543

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAA+L+ AHP WSPAAI+SALM
Sbjct  544   SFNIISGTSMSCPHVSGLAAILKGAHPQWSPAAIRSALM  582



>gb|KHN21060.1| Subtilisin-like protease [Glycine soja]
Length=726

 Score =   456 bits (1172),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 229/399 (57%), Positives = 293/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F KGYEA  G PI+ + E KS RD +GHG+HT + AAGS+V  ASLFG A G 
Sbjct  138   KLVGARFFSKGYEAALG-PIDTTTESKSARDDDGHGSHTLTTAAGSVVPEASLFGLASGT  196

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDI +  D+A++DGV+V+S+S+        +YYRD  
Sbjct  197   ARGMATQARVAVYKVCWLGGCFTSDIAAGIDKAIEDGVNVLSMSIG---GSLMEYYRDII  253

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+F AM HG++VST AGN GP   + +NVAPWI TVGA TIDR FPA + LG G+ +T
Sbjct  254   AIGSFTAMSHGILVSTSAGNGGPSQGSLSNVAPWITTVGAGTIDRDFPAYITLGTGKTYT  313

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G SLYSG+PL D+ LPLVY G+A+++     C    LI  KV+GKIV CERGGN  V+KG
Sbjct  314   GASLYSGKPLSDSPLPLVYAGNASNSSVGYLCLQDSLIPEKVSGKIVICERGGNPRVEKG  373

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG GMI+  +   GE + A +H++PA ++ +     +K Y++S+P+PTA I F 
Sbjct  374   LVVKLAGGAGMILANSEAYGEELVADSHLLPAASLGQKSSEILKNYVSSSPNPTAKIAFL  433

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPN L  +ILKPD+IAPGVNILAGW+GA+GP+G  +D R V
Sbjct  434   GTHLQVQPS-PVVAAFSSRGPNALTPKILKPDLIAPGVNILAGWTGAVGPTGLTVDTRHV  492

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAA+L+ AHP WSPAAI+SALM
Sbjct  493   SFNIISGTSMSCPHVSGLAAILKGAHPQWSPAAIRSALM  531



>emb|CAA59963.1| subtilisin-like protease [Arabidopsis thaliana]
Length=746

 Score =   456 bits (1173),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 235/399 (59%), Positives = 288/399 (72%), Gaps = 11/399 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYE+  G PI+ES E +SPRD +GHGTHT+S AAGS+V  ASL GYA G 
Sbjct  170   KLIGARFFARGYESTMG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGT  228

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGM     +AVYK+CW  GC+ SDIL+A D+A+ D V+V+S+S+        DYYRD  
Sbjct  229   ARGML--HALAVYKVCWLGGCFSSDILAAIDKAIADNVNVLSMSLG---GGMSDYYRDGV  283

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP + + +NVAPWI TVGA T+DR FPA  +LG+G+ FT
Sbjct  284   AIGAFAAMERGILVSCSAGNAGPSSSSLSNVAPWITTVGAGTLDRDFPALAILGNGKNFT  343

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL+ GE L D  LP +Y G+A    N   C +G LI  KV GKIV C+RG N  V KG
Sbjct  344   GVSLFKGEALPDKLLPFIYAGNASNATNGNLCMTGTLIPEKVKGKIVMCDRGINARVQKG  403

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+  TA  GE + A AH++PAT V E  G+ I+ Y+ + P+PTA+I   
Sbjct  404   DVVKAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPNPTASISIL  463

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+G  PS P VA+FSSRGPN +   ILKPD+IAPGVNILA W+GA GP+G   D RRV
Sbjct  464   GTVVGVKPS-PVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRV  522

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+  HP WSPAAI+SALM
Sbjct  523   EFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALM  561



>ref|XP_003550022.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=760

 Score =   456 bits (1174),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 233/400 (58%), Positives = 289/400 (72%), Gaps = 10/400 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KG EA  G PINE+ E +S RD +GHGTHT+S AAGS+V+ ASL GYA G 
Sbjct  181   KLIGARFFAKGVEAMLG-PINETEESRSARDDDGHGTHTSSTAAGSVVSGASLLGYASGT  239

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+A ++A+ D V+V+SLS+        DYYRDS 
Sbjct  240   ARGMATRARVAAYKVCWKGGCFSSDILAAIERAILDNVNVLSLSLG---GGISDYYRDSV  296

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN+GPG  + +NVAPWI TVGA T+DR FPA V LG+G  F+
Sbjct  297   AIGAFSAMEKGILVSCSAGNSGPGPYSLSNVAPWITTVGAGTLDRDFPAYVALGNGLNFS  356

Query  542   GMSLYSGEPLGDNKLPLVYGGDA-----NSTYCYSGELIASKVTGKIVFCERGGNLDVDK  706
             G+SLY G  L D+ LPLVY G+      N   C +G L   KV GKIV C+RG    V K
Sbjct  357   GVSLYRGNALPDSSLPLVYAGNVSNGAMNGNLCITGTLSPEKVAGKIVLCDRGLTARVQK  416

Query  707   GFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVF  886
             G  V+ AG +GM++  TA  GE + A AH++PAT V +  G+ IK+Y+ S   PT  I F
Sbjct  417   GSVVKSAGALGMVLSNTAANGEELVADAHLLPATAVGQKAGDAIKKYLVSDAKPTVKIFF  476

Query  887   RGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRR  1066
              GT +G  PS P VA+FSSRGPN +  +ILKPD+IAPGVNILAGWS A+GP+G  +D RR
Sbjct  477   EGTKVGIQPS-PVVAAFSSRGPNSITPQILKPDLIAPGVNILAGWSKAVGPTGLPVDNRR  535

Query  1067  VEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             V+FNIISGTSM+CPHVSGLAAL++ AHP WSPAA++SALM
Sbjct  536   VDFNIISGTSMSCPHVSGLAALIKSAHPDWSPAAVRSALM  575



>ref|XP_003562295.2| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=773

 Score =   456 bits (1174),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 239/399 (60%), Positives = 292/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G P++ S E +SPRD +GHGTHT+S AAG+ VA A+LFG+A G 
Sbjct  183   KLIGARFFNRGYEAAMG-PMDSSRESRSPRDDDGHGTHTSSTAAGAPVAGANLFGFASGT  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+  + AV DG  V+SLS+    A   DY RDS 
Sbjct  242   ARGMAPRARVAVYKVCWLGGCFSSDILAGMEAAVADGCGVLSLSLGGGSA---DYSRDSV  298

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME  V+VS  AGN GPG+ T +NVAPWI TVGA T+DR FPA VVLG+G+ +T
Sbjct  299   AIGAFAAMERDVLVSCSAGNAGPGSATLSNVAPWITTVGAGTLDRDFPAYVVLGNGKNYT  358

Query  542   GMSLYSGEPLGDNKLPLVYGGDA-NST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY+G+PL    +P+VY  +A NST    C  G L+  KV+GKIV C+RG +  V KG
Sbjct  359   GVSLYAGKPLPSTPIPIVYAANASNSTSGNLCMPGTLLPEKVSGKIVVCDRGISARVQKG  418

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F VR+AGG GM++  TA  G+ + A AH++PA  V E +G+ IK Y+ S P PTA IV  
Sbjct  419   FVVRDAGGAGMVLANTAANGQELVADAHLLPAAGVGEKEGSAIKSYVASDPKPTATIVVA  478

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPN +  EILKPDVIAPGVNILA W+G  GP+G   D RRV
Sbjct  479   GTQVDVHPS-PLVAAFSSRGPNTVTPEILKPDVIAPGVNILAAWTGKAGPTGLAADTRRV  537

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALLR A P WSPAA++SALM
Sbjct  538   EFNIISGTSMSCPHVSGLAALLRGARPEWSPAAVRSALM  576



>gb|KDO81559.1| hypothetical protein CISIN_1g0053341mg, partial [Citrus sinensis]
Length=577

 Score =   450 bits (1157),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 228/388 (59%), Positives = 286/388 (74%), Gaps = 9/388 (2%)
 Frame = +2

Query  35    YEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGEARGMAIKARIA  214
             YE   G PI+E+ E KSPRD +GHGTHT++ AAGS+V  ASLFG+A G ARGMA +AR+A
Sbjct  1     YEEAVG-PIDETAESKSPRDDDGHGTHTSTTAAGSVVNGASLFGFASGTARGMAAQARVA  59

Query  215   VYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDSTAIGAFGAMEHG  394
              YK+CW  GC+ SDIL+  D+A++DGV+V+S+S+        DYYRD+ AIGAF AM  G
Sbjct  60    TYKVCWLAGCFGSDILAGMDKAIEDGVNVMSMSIG---GGLTDYYRDTVAIGAFTAMAQG  116

Query  395   VVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFTGMSLYSGEPLG  574
             + VS  AGN GP A + +NVAPWI TVGA T+DR FP  V LG+G+ F+G+SLYS  PL 
Sbjct  117   IFVSCSAGNGGPYANSISNVAPWITTVGAGTLDRNFPTYVSLGNGKSFSGVSLYSRRPLS  176

Query  575   DNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKGFAVREAGGVGM  742
              + +P+V   + +ST     C +G LI +KV GKIV C+RGGN  V+KG  V++AGGVGM
Sbjct  177   GSMVPIVDAANVSSTSSGNLCMTGSLIPAKVAGKIVVCDRGGNSRVEKGVEVKDAGGVGM  236

Query  743   IVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVIGTSPSAP  922
             I+  T   GE + A A ++P+ NV E  G+ IK YI+S P P A I+ RGT +G  PS P
Sbjct  237   ILTNTDSYGEELVADAQLLPSANVGEKAGDAIKNYISSDPGPMATIISRGTQLGIQPS-P  295

Query  923   RVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNIISGTSMA  1102
              VA+FSSRGPNP+  EILKPD+IAPGVNILAGW+GA+GP+G   D+R V FNIISGTSM+
Sbjct  296   VVAAFSSRGPNPITPEILKPDLIAPGVNILAGWTGAVGPTGLESDKRHVSFNIISGTSMS  355

Query  1103  CPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             CPHVSGLAALL+ AHP WSP+AIKSALM
Sbjct  356   CPHVSGLAALLKAAHPEWSPSAIKSALM  383



>ref|XP_002966443.1| hypothetical protein SELMODRAFT_143697 [Selaginella moellendorffii]
 gb|EFJ32470.1| hypothetical protein SELMODRAFT_143697 [Selaginella moellendorffii]
Length=752

 Score =   455 bits (1171),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 247/409 (60%), Positives = 288/409 (70%), Gaps = 22/409 (5%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F++GYEA +G PIN S E KSPRD +GHGTHTAS A G  V  A + G+A G 
Sbjct  158   KLIGARYFFRGYEAMSG-PINGSTEFKSPRDSDGHGTHTASTAGGRYVYRADMLGFASGT  216

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV---AIPRAYPEDYYR  352
             A GMA KARIAVYK+CW+ GC+DSDIL+AFD AV DGV VISLSV    +P      Y  
Sbjct  217   AEGMAPKARIAVYKVCWTSGCFDSDILAAFDTAVADGVDVISLSVGGGVMP------YRM  270

Query  353   DSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGR  532
             DS A+GAFGAM  GV V+T  GN GPG  + TNVAPWI T+GAST+DR FPA V LG+G 
Sbjct  271   DSIALGAFGAMTRGVFVATSGGNQGPGQLSVTNVAPWIATIGASTMDRAFPATVKLGNGE  330

Query  533   IFTGMSLYSGEPLG-DNKLPLVYGGDAN----------STYCYSGELIASKVTGKIVFCE  679
              F G+SLYSG+      ++PLVY  DA+          ++ C +G L    V GKIV C+
Sbjct  331   SFQGVSLYSGKGFAAGEEIPLVYSADASVGKNGSDSYSASLCLAGSLDPKLVRGKIVLCD  390

Query  680   RGGNLDVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSA  859
             RG N  V+KG  V  AGG GMI+  +   GE + A +H++PAT V    G+ IK YI SA
Sbjct  391   RGNNARVEKGGVVLAAGGRGMILSNSPTDGEGLIADSHLLPATAVGNAAGSSIKNYIKSA  450

Query  860   PSPTAAIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGP  1039
              SP A+I F GTV+GTSP AP VASFSSRGPNP   EILKPD+IAPGVNILA W+GA GP
Sbjct  451   KSPVASIKFLGTVLGTSP-APVVASFSSRGPNPETPEILKPDMIAPGVNILAAWTGAAGP  509

Query  1040  SGSVMDQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +G   D R+V FNIISGTSMACPHVSGLAALLR AHP WSPAAIKSALM
Sbjct  510   TGLASDTRKVRFNIISGTSMACPHVSGLAALLRGAHPDWSPAAIKSALM  558



>ref|XP_004982450.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=775

 Score =   456 bits (1172),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 239/399 (60%), Positives = 288/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F +GYEA  G P++   E +SPRD +GHGTHT+S AAG+ V  ASLFG+A G 
Sbjct  183   KLVGARFFNRGYEAAMG-PMDTDRESRSPRDDDGHGTHTSSTAAGAAVPGASLFGFASGT  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+  D AV DG  V+SLS+    A   DY RDS 
Sbjct  242   ARGMAPRARVAVYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLGGGAA---DYSRDSV  298

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME  V+VS  AGN GPG+ T +NVAPWI TVGA T+DR FPA V LG+G+ +T
Sbjct  299   AIGAFSAMEQNVLVSCSAGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVALGNGKNYT  358

Query  542   GMSLYSGEPLGDNKLPLVYGGDA-NST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+ L    LP++Y  +A NST    C  G L   KV GKIV C+RG +  V KG
Sbjct  359   GVSLYSGKALPSTPLPIIYAANASNSTAGNLCMPGTLTPEKVAGKIVVCDRGVSARVQKG  418

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F VR+AGG GM++  TA  G+ + A AH++PAT V E +G  IK Y+ S PSPTA IV  
Sbjct  419   FVVRDAGGAGMVLSNTAANGQELVADAHLLPATGVGEREGVAIKSYVASDPSPTATIVVA  478

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILA W+G  GP+G   D RRV
Sbjct  479   GTQVGVHPS-PVVAAFSSRGPNMVTPEILKPDIIAPGVNILAAWTGKAGPTGLAADTRRV  537

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AHP WSPAA++SALM
Sbjct  538   GFNIISGTSMSCPHVSGLAALLRSAHPDWSPAAVRSALM  576



>ref|XP_010105478.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04834.1| Subtilisin-like protease [Morus notabilis]
Length=768

 Score =   456 bits (1172),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 233/399 (58%), Positives = 288/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYE   G PI+E VE KSPRD +GHGTHT++ AAGS V  ASLFG+A G 
Sbjct  182   KLIGARYFSAGYEEAFG-PIDEKVESKSPRDDDGHGTHTSTTAAGSTVVEASLFGFASGT  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+A YK+CW  GC+ SDIL+  D+A+ DGV V+SLS+        DYYRD+ 
Sbjct  241   ARGMATTARVATYKVCWLGGCFGSDILAGIDKAIDDGVDVLSLSIG---GGLNDYYRDTV  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG F A+ HG+VVS  AGN GPG+ + +NVAPW+ TVGA T+DR FPA V LG+G+ + 
Sbjct  298   AIGTFAAVAHGIVVSVSAGNGGPGSGSLSNVAPWLTTVGAGTLDRDFPAYVSLGNGQKYK  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL +  + +VYG  AN++     C  G L ++KVTGK+V C+RGGN    KG
Sbjct  358   GVSLYSGKPLSEELVQIVYGRTANNSTNGNLCLPGSLDSAKVTGKLVVCDRGGNPRAQKG  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V++AGGVGMI+  T   GE + A AH++PA  V +  GN IK Y+ S  +PTA I   
Sbjct  418   QVVKDAGGVGMILSNTESYGEELVADAHLLPAVTVGQRTGNLIKTYLRSDANPTATITQG  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
              T +G  PS P VA+FSSRGPNP+  EILKPD+IAPGVNILAGW+G  GP+G   D RRV
Sbjct  478   STQLGIQPS-PVVAAFSSRGPNPITPEILKPDLIAPGVNILAGWTGRAGPTGLDTDNRRV  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNI+SGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  537   SFNIVSGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALM  575



>ref|XP_006579930.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006579931.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
 ref|XP_006579932.1| PREDICTED: subtilisin-like protease-like isoform X3 [Glycine 
max]
Length=755

 Score =   455 bits (1170),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 232/400 (58%), Positives = 290/400 (73%), Gaps = 10/400 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KG EA  G PINE+ E +S RD +GHGTHTAS AAGS+V++ASLFGYA G 
Sbjct  177   KLIGARFFSKGVEAILG-PINETEESRSARDDDGHGTHTASTAAGSVVSDASLFGYASGT  235

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+A ++A+ D V+V+SLS+        DYYRDS 
Sbjct  236   ARGMATRARVAAYKVCWKGGCFSSDILAAIERAILDNVNVLSLSLG---GGMSDYYRDSV  292

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME+G++VS  AGN GP   + +NVAPWI TVGA T+DR FPA V LG+G  F+
Sbjct  293   AIGAFSAMENGILVSCSAGNAGPSPYSLSNVAPWITTVGAGTLDRDFPAYVALGNGLNFS  352

Query  542   GMSLYSGEPLGDNKLPLVYGGDA-----NSTYCYSGELIASKVTGKIVFCERGGNLDVDK  706
             G+SLY G  + D+ LP VY G+      N   C +G L   KV GKIV C+RG    V K
Sbjct  353   GVSLYRGNAVPDSPLPFVYAGNVSNGAMNGNLCITGTLSPEKVAGKIVLCDRGLTARVQK  412

Query  707   GFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVF  886
             G  V+ AG +GM++  TA  GE + A AH++PAT V +  G+ IK+Y+ S   PT  I+F
Sbjct  413   GSVVKSAGALGMVLSNTAANGEELVADAHLLPATAVGQKAGDAIKKYLFSDAKPTVKILF  472

Query  887   RGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRR  1066
              GT +G  PS P VA+FSSRGPN +  +ILKPD+IAPGVNILAGWS A+GP+G  +D RR
Sbjct  473   EGTKLGIQPS-PVVAAFSSRGPNSITPQILKPDLIAPGVNILAGWSKAVGPTGLPVDNRR  531

Query  1067  VEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             V+FNIISGTSM+CPHVSGLAAL++ AHP WSPAA++SALM
Sbjct  532   VDFNIISGTSMSCPHVSGLAALIKSAHPDWSPAAVRSALM  571



>ref|XP_010070634.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW59525.1| hypothetical protein EUGRSUZ_H02279 [Eucalyptus grandis]
Length=767

 Score =   455 bits (1170),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 240/399 (60%), Positives = 287/399 (72%), Gaps = 10/399 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+ S E KS RD +GHGTHTAS AAGS V  ASLFGYA G 
Sbjct  186   KLIGARFFSKGYEATMG-PIDVSKESKSARDDDGHGTHTASTAAGSAVDGASLFGYAPGT  244

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+A ++AV DGV+V+SLS+        D+YRDS 
Sbjct  245   ARGMATRARVAAYKVCWLGGCFSSDILAAMEKAVVDGVNVLSLSLG---GGSPDFYRDSV  301

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A E G+ VS  AGN GP + + +NVAPWI TVGA T+DR FPA V LG+G+ F+
Sbjct  302   AIGAFAAAEKGIFVSCSAGNAGPSSMSLSNVAPWIATVGAGTLDRDFPAYVTLGNGKNFS  361

Query  542   GMSLYSGEPLGDNKLPLVYGGD----ANSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG   G   LP VY G+     N   C  G L  +KV GKIV C+RG N  V KG
Sbjct  362   GVSLYSGNSKG-TLLPFVYAGNVSNATNGNLCMMGTLDPAKVKGKIVLCDRGVNARVQKG  420

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG GM++  TA  GE + A AH++PAT V E  G+ IK Y+ S P+PTA I+F 
Sbjct  421   SVVQLAGGAGMVLANTAANGEELVADAHLLPATAVGEKSGDAIKSYLFSDPNPTATILFE  480

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +   +LKPD+IAPGVNILAGW+G IGP+G  +D RRV
Sbjct  481   GTKVGIQPS-PVVAAFSSRGPNSITPAVLKPDMIAPGVNILAGWTGGIGPTGLAVDDRRV  539

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  540   AFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALM  578



>ref|XP_008238402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=776

 Score =   454 bits (1169),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 236/401 (59%), Positives = 290/401 (72%), Gaps = 11/401 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI  S E KSPRD +GHGTHTAS AAGS V+ ASLFGYA G 
Sbjct  187   KLIGARYFAKGYEATVG-PIETSKESKSPRDDDGHGTHTASTAAGSAVSGASLFGYAPGT  245

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIA YK+CW  GC+ SDI++A DQA+ D V+V+S+S+        DY+RDS 
Sbjct  246   ARGMAPRARIAAYKVCWVGGCFSSDIVAAIDQAIADNVNVLSMSLG---GGMSDYFRDSV  302

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+++S  AGN GP A + +N APWI TVGA T+DR FPA V LG+G+ F+
Sbjct  303   AIGAFSAMEKGILISCSAGNAGPSAYSLSNSAPWITTVGAGTLDRDFPAFVSLGNGKNFS  362

Query  542   GMSLYSGEPLG--DNKLPLVYGGDANS----TYCYSGELIASKVTGKIVFCERGGNLDVD  703
             G+SLY G          P VY G+A++      C  G LI  +V GKIV C+RG N  V 
Sbjct  363   GVSLYRGNSNAAPTALTPFVYAGNASNATSGNLCMMGTLIPERVKGKIVMCDRGVNARVQ  422

Query  704   KGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIV  883
             KG  V+ AGGVGMI+  TA  GE + A +H++PAT+V + + + IK Y+   P+PTA I+
Sbjct  423   KGAVVKAAGGVGMILANTAANGEELVADSHLLPATSVGQQNADVIKSYLLKDPNPTATIL  482

Query  884   FRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQR  1063
             F GT +G  PS P VA+FSSRGPN +  ++LKPD++APGVNILAGWSGAIGP+G  +D R
Sbjct  483   FEGTKVGVQPS-PVVAAFSSRGPNSVTPDVLKPDIVAPGVNILAGWSGAIGPTGLAIDAR  541

Query  1064  RVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             RV FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  542   RVAFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALM  582



>gb|ACN27710.1| unknown [Zea mays]
Length=701

 Score =   452 bits (1163),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 236/399 (59%), Positives = 287/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F KGYEA  G P++   E +SP D +GHGTHT+S AAG+ V  ASLFG+A G 
Sbjct  114   KLVGARFFSKGYEAAMG-PMDTDRESRSPLDDDGHGTHTSSTAAGAAVPGASLFGFAAGT  172

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+  D AV DG  V+SLS+    A   DY RDS 
Sbjct  173   ARGMAPRARVAAYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLGGGAA---DYSRDSV  229

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A E  V+VS  AGN GPG+ T +NVAPWI TVGA T+DR FPA VVLGDG+ +T
Sbjct  230   AIGAFAATEQNVLVSCSAGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVVLGDGKNYT  289

Query  542   GMSLYSGEPLGDNKLPLVYGGDA-NST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY+G+PL    +P+VY  +A NST    C  G L+  KV GKIV C+RG +  V KG
Sbjct  290   GVSLYAGKPLPSAPIPIVYAANASNSTAGNLCMPGTLVPEKVAGKIVVCDRGVSARVQKG  349

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               VR+AGG GM++  TA  G+ + A AH++PA  V E +G  IK Y+ SAP+PTA +V  
Sbjct  350   LVVRDAGGAGMVLSNTAANGQELVADAHLLPAAGVGETEGTAIKSYVASAPNPTATVVVA  409

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILA W+G  GP+G   D RRV
Sbjct  410   GTEVGVRPS-PVVAAFSSRGPNMVTPEILKPDMIAPGVNILASWTGKAGPTGLAADTRRV  468

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AHP WSPAA++SALM
Sbjct  469   GFNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALM  507



>ref|XP_002982080.1| hypothetical protein SELMODRAFT_233912 [Selaginella moellendorffii]
 gb|EFJ16748.1| hypothetical protein SELMODRAFT_233912 [Selaginella moellendorffii]
Length=752

 Score =   453 bits (1166),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 246/409 (60%), Positives = 288/409 (70%), Gaps = 22/409 (5%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F++GYEA +G PIN S E KSPRD +GHGTHTAS A G  V  A + G+A G 
Sbjct  158   KLIGARYFFRGYEAMSG-PINGSTEFKSPRDSDGHGTHTASTAGGRYVYRADMLGFASGT  216

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV---AIPRAYPEDYYR  352
             A GMA KARIAVYK+CW+ GC+DSDIL+AFD AV DGV VISLSV    +P      Y  
Sbjct  217   AEGMAPKARIAVYKVCWTSGCFDSDILAAFDTAVADGVDVISLSVGGGVMP------YRM  270

Query  353   DSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGR  532
             DS A+GAFGAM  GV V+T  GN GPG  + TNVAPWI T+GAST+DR FPA V LG+G 
Sbjct  271   DSIALGAFGAMTRGVFVATSGGNQGPGQLSVTNVAPWIATIGASTMDRAFPATVKLGNGE  330

Query  533   IFTGMSLYSGEPLG-DNKLPLVYGGDAN----------STYCYSGELIASKVTGKIVFCE  679
              + G+SLYSG+      ++PLVY  DA+          ++ C +G L    V GKIV C+
Sbjct  331   SYKGVSLYSGKGFAAGEEIPLVYSADASVGKNGSDSYSASLCLAGSLDPKLVRGKIVLCD  390

Query  680   RGGNLDVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSA  859
             RG N  V+KG  V  AGG GMI+  +   GE + A +H++PAT V    G+ IK YI SA
Sbjct  391   RGNNARVEKGGVVLAAGGRGMILSNSPTDGEGLIADSHLLPATAVGNAAGSSIKNYIKSA  450

Query  860   PSPTAAIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGP  1039
              SP A+I F GTV+GTSP AP VASFSSRGPNP   EILKPD+IAPGVNILA W+GA GP
Sbjct  451   KSPVASIKFLGTVLGTSP-APVVASFSSRGPNPETPEILKPDMIAPGVNILAAWTGAAGP  509

Query  1040  SGSVMDQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +G   D R+V FNIISGTSMACPHVSGLAALLR AHP WSPAAIKSALM
Sbjct  510   TGLASDTRKVRFNIISGTSMACPHVSGLAALLRGAHPDWSPAAIKSALM  558



>ref|XP_003559080.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=766

 Score =   453 bits (1166),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 234/399 (59%), Positives = 285/399 (71%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYEA  G P++ S E +SPRD +GHGTHT+S AAGS V  A L GYA G 
Sbjct  181   KLIGARFFLTGYEASKG-PVDVSKESRSPRDNDGHGTHTSSTAAGSAVRGADLLGYASGT  239

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A+GMA +AR+A YK+CW  GC+ SDIL   + AV DGV V+SLS+        DYYRDS 
Sbjct  240   AKGMAPRARVATYKVCWVGGCFSSDILKGMEVAVADGVDVLSLSLG---GGTSDYYRDSI  296

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF AME G+ VS  AGN GPGA + TN APWI TVGA T+DR FPA V LG+G+ +T
Sbjct  297   AVGAFSAMEKGIFVSCSAGNAGPGAASLTNGAPWITTVGAGTLDRDFPAHVTLGNGKNYT  356

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+ L    +P VY G+A+++     C +G LI  KV GKIV C+RG N  V KG
Sbjct  357   GVSLYSGKQLPTTPVPFVYAGNASNSSMGALCMTGSLIPEKVAGKIVLCDRGTNARVQKG  416

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F V++AGG GM++  TA  GE + A AH++P + V E  GN ++ Y +S P+PTA IVF 
Sbjct  417   FVVKDAGGAGMVLANTAANGEELVADAHILPGSGVGEKAGNAMRTYASSDPNPTANIVFA  476

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +   +LKPD+IAPGVNILA WSG+IGPSG   D RR 
Sbjct  477   GTKVGIQPS-PVVAAFSSRGPNTVTPGVLKPDLIAPGVNILAAWSGSIGPSGIAGDNRRS  535

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AH  W+PAAI+SALM
Sbjct  536   SFNIISGTSMSCPHVSGLAALLRSAHQDWTPAAIRSALM  574



>ref|XP_009803919.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=766

 Score =   453 bits (1166),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 234/399 (59%), Positives = 287/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G+ I+E+ E KSPRD +GHGTHTA+ AAGS+V  ASLFGYA G 
Sbjct  179   KLIGARFFSQGYEAAFGA-IDETTESKSPRDDDGHGTHTATTAAGSVVTGASLFGYAAGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+A YK+CW+ GC+ SDIL+  DQAV DGV+V+SLS+        DYYRD  
Sbjct  238   ARGMASHARVAAYKVCWAGGCFSSDILAGMDQAVIDGVNVLSLSLG---GTISDYYRDIV  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A   G+ +S  AGN GPG+ + +NVAPWI TVGA T+DR FPA + +G+G+ F 
Sbjct  295   AIGAFSAASQGIFISCSAGNGGPGSGSLSNVAPWITTVGAGTMDREFPAYISIGNGKKFN  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+ L  + +PLVY G+A    N   C SG LI  KV GKIV C+RG N    KG
Sbjct  355   GVSLYSGKALPSSVMPLVYAGNASQASNGNLCTSGSLIPEKVAGKIVVCDRGMNARAQKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V++AGG+GMI+  T   G+ + A AH+IP   V +  G+ IK YI S  +PT  I F 
Sbjct  415   LVVKDAGGIGMILANTDSYGDELVADAHLIPTAAVGQTAGDLIKRYIASDSNPTTTIAFG  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPNP+  EILKPD+IAPGVNILAGW+G +GP+G   D R V
Sbjct  475   GTKLGVQPS-PVVAAFSSRGPNPITPEILKPDLIAPGVNILAGWTGKVGPTGLPEDTRNV  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAAL++ AHP WSPAAI+SALM
Sbjct  534   GFNIISGTSMSCPHVSGLAALMKAAHPEWSPAAIRSALM  572



>ref|XP_007208070.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
 gb|EMJ09269.1| hypothetical protein PRUPE_ppa001701mg [Prunus persica]
Length=777

 Score =   452 bits (1164),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 235/401 (59%), Positives = 289/401 (72%), Gaps = 11/401 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI  S E KSPRD +GHGTHTAS AAGS+V+ ASLFGYA G 
Sbjct  188   KLIGARYFAKGYEATRG-PIETSKESKSPRDDDGHGTHTASTAAGSVVSGASLFGYALGT  246

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIA YK+CW  GC+ SDI++A DQA+ D V+V+S+S+        DY+RDS 
Sbjct  247   ARGMAPRARIAAYKVCWVGGCFSSDIVAAIDQAIADNVNVLSMSLG---GGMSDYFRDSV  303

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+++S  AGN GP A + +N APWI TVGA T+DR FPA V LG+G+ F+
Sbjct  304   AIGAFSAMEKGILISCSAGNAGPSAYSLSNSAPWITTVGAGTLDRDFPAFVSLGNGKNFS  363

Query  542   GMSLYSGEPLG--DNKLPLVYGGDANS----TYCYSGELIASKVTGKIVFCERGGNLDVD  703
             G+SLY G          P VY  +A++      C  G LI  +V GKIV C+RG N  V 
Sbjct  364   GVSLYRGNSNAAPTALTPFVYAANASNATSGNLCMMGTLIPEQVKGKIVMCDRGVNARVQ  423

Query  704   KGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIV  883
             KG  V+ AGGVGM++  TA  GE + A AH++PAT+V   + + IK Y+   P+PTA I+
Sbjct  424   KGAVVKAAGGVGMVLANTAANGEELVADAHLLPATSVGLQNADVIKSYLFKDPNPTATIL  483

Query  884   FRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQR  1063
             F GT +G  PS P VA+FSSRGPN +  ++LKPD++APGVNILAGWSGAIGP+G  +D R
Sbjct  484   FEGTKVGVQPS-PVVAAFSSRGPNSVTPDVLKPDIVAPGVNILAGWSGAIGPTGLAIDAR  542

Query  1064  RVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             RV FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  543   RVAFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALM  583



>ref|NP_001051353.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|AAK63927.1|AC084282_8 putative serine protease [Oryza sativa Japonica Group]
 gb|ABF99010.1| cucumisin-like serine protease, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13267.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|EAZ28668.1| hypothetical protein OsJ_12679 [Oryza sativa Japonica Group]
 dbj|BAG95169.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95978.1| unnamed protein product [Oryza sativa Japonica Group]
Length=764

 Score =   452 bits (1162),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 235/399 (59%), Positives = 287/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYEA  G P++ S E +SPRD +GHGTHT+S AAGS V  A L GYA G 
Sbjct  183   KLIGARFFLTGYEAAKG-PVDTSKESRSPRDNDGHGTHTSSTAAGSAVRGADLLGYAAGT  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A+GMA  AR+A YK+CW  GC+ SDIL A + AV DGV V+SLS+    A   DYYRDS 
Sbjct  242   AKGMAPHARVATYKVCWVGGCFSSDILKAMEVAVNDGVDVLSLSLGGGTA---DYYRDSI  298

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GA+ AME G+ VS  AGN GPG+ T +N APWI TVGA T+DR FPA VVLG+G+ ++
Sbjct  299   AVGAYSAMERGIFVSCSAGNAGPGSATLSNGAPWITTVGAGTLDRDFPAHVVLGNGKNYS  358

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+ L    +P +Y G+A+++     C SG LI  KV GKIV C+RG N  V KG
Sbjct  359   GVSLYSGKQLPTTPVPFIYAGNASNSSMGALCMSGSLIPEKVAGKIVLCDRGTNARVQKG  418

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F V++AGG GM++  TA  GE + A AHV+P   V +  G+ ++ Y  S P+PTA+IVF 
Sbjct  419   FVVKDAGGAGMVLANTAANGEELVADAHVLPGAGVGQKAGDTMRAYALSDPNPTASIVFA  478

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +   ILKPD+IAPGVNILA WSG++GPSG   D RRV
Sbjct  479   GTQVGIQPS-PVVAAFSSRGPNTVTPGILKPDLIAPGVNILAAWSGSVGPSGLAGDSRRV  537

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AH  WSPAAI+SALM
Sbjct  538   GFNIISGTSMSCPHVSGLAALLRAAHQDWSPAAIRSALM  576



>tpg|DAA50265.1| TPA: putative subtilase family protein [Zea mays]
Length=764

 Score =   452 bits (1162),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 236/399 (59%), Positives = 287/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F KGYEA  G P++   E +SP D +GHGTHT+S AAG+ V  ASLFG+A G 
Sbjct  177   KLVGARFFSKGYEAAMG-PMDTDRESRSPLDDDGHGTHTSSTAAGAAVPGASLFGFAAGT  235

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+  D AV DG  V+SLS+    A   DY RDS 
Sbjct  236   ARGMAPRARVAAYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLGGGAA---DYSRDSV  292

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A E  V+VS  AGN GPG+ T +NVAPWI TVGA T+DR FPA VVLGDG+ +T
Sbjct  293   AIGAFAATEQNVLVSCSAGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVVLGDGKNYT  352

Query  542   GMSLYSGEPLGDNKLPLVYGGDA-NST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY+G+PL    +P+VY  +A NST    C  G L+  KV GKIV C+RG +  V KG
Sbjct  353   GVSLYAGKPLPSAPIPIVYAANASNSTAGNLCMPGTLVPEKVAGKIVVCDRGVSARVQKG  412

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               VR+AGG GM++  TA  G+ + A AH++PA  V E +G  IK Y+ SAP+PTA +V  
Sbjct  413   LVVRDAGGAGMVLSNTAANGQELVADAHLLPAAGVGETEGTAIKSYVASAPNPTATVVVA  472

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILA W+G  GP+G   D RRV
Sbjct  473   GTEVGVRPS-PVVAAFSSRGPNMVTPEILKPDMIAPGVNILASWTGKAGPTGLAADTRRV  531

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AHP WSPAA++SALM
Sbjct  532   GFNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALM  570



>ref|XP_009112378.1| PREDICTED: subtilisin-like protease, partial [Brassica rapa]
Length=619

 Score =   447 bits (1149),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 230/400 (58%), Positives = 291/400 (73%), Gaps = 11/400 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYE   G P++ES E +SPRD +GHGTHTAS AAGS+V  A+L G+A G 
Sbjct  41    KLIGARFFVTGYEKING-PVDESKESRSPRDDDGHGTHTASTAAGSVVEGANLLGFANGT  99

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW   C+ SD+L+  D+A++D V+V+S+S+   R    DY  +  
Sbjct  100   ARGMAYRARVAVYKVCWKPTCFGSDVLAGIDKAIEDNVNVLSISLGRRR---RDY-NNEI  155

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+ VS  AGN GP   + +NVAPWI TVGA T+DR FPA V LG+G+ +T
Sbjct  156   AIGAFSAMERGIFVSCSAGNDGPNPFSLSNVAPWITTVGAGTLDRDFPALVTLGNGKYYT  215

Query  542   GMSLYSGEPLGDNKLPLVYGGDA--NSTY---CYSGELIASKVTGKIVFCERGGNLDVDK  706
             G+SL+ G+ L    LP VY G+A  N+TY   C+ G LI  KV GKIV CE+G N+ V+K
Sbjct  216   GVSLFKGDALSSKLLPFVYAGNASNNATYGNFCFPGTLIPEKVKGKIVMCEKGVNVRVEK  275

Query  707   GFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVF  886
             G  V+ AGG+GMI+  TA  GE   A+A ++PAT V E   + I+ Y  + P+PTA+IVF
Sbjct  276   GEVVKAAGGLGMILANTAYEGEERTANAFLLPATTVGEKASDIIRHYAFTDPNPTASIVF  335

Query  887   RGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRR  1066
             +GTV+   PS P +A+FSSRGPNP+   ILKPD+IAPGVNILA W+GA+GPSG   D RR
Sbjct  336   QGTVVNVQPS-PVLAAFSSRGPNPITPNILKPDLIAPGVNILAAWTGAVGPSGLASDTRR  394

Query  1067  VEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             VEFNIISGTSM+CPHVSGLAALL+  +P WSPAAI+SALM
Sbjct  395   VEFNIISGTSMSCPHVSGLAALLKSVYPEWSPAAIRSALM  434



>ref|XP_003544482.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=774

 Score =   451 bits (1160),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 226/399 (57%), Positives = 291/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F KGYEA  G PI+ + E KS RD +GHG+HT + AAGS+V  ASLFG A G 
Sbjct  186   KLVGARFFSKGYEAALG-PIDTTTESKSARDDDGHGSHTLTTAAGSVVPEASLFGLASGT  244

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDI +  D+A++DGV+V+S+S+        +YYRD  
Sbjct  245   ARGMATQARVAVYKVCWLGGCFTSDIAAGIDKAIEDGVNVLSMSIG---GSLMEYYRDII  301

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+F A  HG++VST AGN GP   + +NVAPWI TVGA TIDR FPA + LG G+ +T
Sbjct  302   AIGSFTATSHGILVSTSAGNGGPSQGSLSNVAPWITTVGAGTIDRDFPAYITLGTGKTYT  361

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G SLY G+PL D+ LPLVY G+A+++     C    LI  KV+GKIV CERGGN  V+KG
Sbjct  362   GASLYRGKPLSDSPLPLVYAGNASNSSVGYLCLQDSLIPEKVSGKIVICERGGNPRVEKG  421

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG GMI+  +   GE + A +H++PA ++ +     +K Y++S+P+PTA I F 
Sbjct  422   LVVKLAGGAGMILANSEAYGEELVADSHLLPAASLGQKSSEILKNYVSSSPNPTAKIAFL  481

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPN L  +ILKPD+IAPGVNILAGW+GA+GP+G  +D R +
Sbjct  482   GTHLQVQPS-PVVAAFSSRGPNALTPKILKPDLIAPGVNILAGWTGAVGPTGLTVDSRHI  540

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAA+L+ AHP WSPAAI+SALM
Sbjct  541   SFNIISGTSMSCPHVSGLAAILKGAHPQWSPAAIRSALM  579



>ref|XP_010070627.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW59522.1| hypothetical protein EUGRSUZ_H02274 [Eucalyptus grandis]
Length=768

 Score =   450 bits (1158),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 288/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+ S E KSPRD +GHGTHTAS AAGS V  ASLFGYA G 
Sbjct  186   KLIGARFFSKGYEATMG-PIDVSKESKSPRDDDGHGTHTASTAAGSAVEGASLFGYAPGT  244

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CWS GC+ SDIL+A ++AV DGV+V  LSV++       +Y DS 
Sbjct  245   ARGMATRARVAAYKVCWSGGCFSSDILAAMEKAVDDGVNV--LSVSLDGEMETHFYGDSV  302

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A E G+ VS  AGN GP + + +NVAPWI TVGA T+DR FPA V LG+G+ F 
Sbjct  303   AIGAFAAAEKGIFVSCSAGNDGPSSYSLSNVAPWIATVGAGTLDRDFPAYVTLGNGKNFP  362

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G   G   LP VY G+ ++T     C  G L  +KV GKIV C+RG N  V KG
Sbjct  363   GVSLYGGNSKG-TLLPFVYAGNVSNTTNGNLCRKGTLDPAKVKGKIVLCDRGKNARVQKG  421

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG GM++  TA  G+ +   AH++PAT V +  G+ IK Y+ S P+PTA I+F 
Sbjct  422   SVVKLAGGAGMVLANTAADGDELVPEAHLLPATAVGKKSGDAIKSYLFSDPNPTATILFE  481

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+GA+GP+G  +D RRV
Sbjct  482   GTKVGIQPS-PVVAAFSSRGPNSITPEILKPDIIAPGVNILAGWTGAVGPTGLPVDDRRV  540

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  541   AFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIRSALM  579



>ref|XP_011028928.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=779

 Score =   450 bits (1157),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 236/399 (59%), Positives = 293/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA+ F KGYEA  G PI+E++E KSPRD +GHGTHTA+ AAGS V+ ASLFGYA G 
Sbjct  192   KLIGAQYFSKGYEAAFG-PIDETMESKSPRDDDGHGTHTATTAAGSAVSGASLFGYAFGT  250

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+A ++AV DGV+VIS+S+        DY RD+ 
Sbjct  251   ARGMATQARVAAYKVCWLGGCFSSDILAAMEKAVADGVNVISMSIG---GGISDYNRDTV  307

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A+  G++VS  AGN GP A + TNVAPWI TVGA T+DR FPA V LG+G+ ++
Sbjct  308   AIGAFRAVAQGILVSCSAGNGGPSAGSLTNVAPWITTVGAGTLDRDFPAYVNLGNGKNYS  367

Query  542   GMSLYSGEPLGDNKLPLVYGGDA-NST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL D+ LPLVY G+A NST    C +G LI S V GKIV C+RG N  V KG
Sbjct  368   GISLYSGKPLSDSLLPLVYAGNASNSTSGNLCMTGTLIPSHVAGKIVICDRGLNSRVQKG  427

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               VR++GG+GMI+  T   GE + A AH++P + V +   + IK Y  S   P A I   
Sbjct  428   MVVRDSGGLGMILANTELYGEELVADAHLLPTSTVGQRTADAIKNYAFSDAKPMATIASG  487

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P +A+FSSRGPN +  E+LKPD+IAPGVNILAGW+GA+GP+G   D+R V
Sbjct  488   GTKLGVEPS-PVLAAFSSRGPNLVTPEVLKPDLIAPGVNILAGWTGAVGPTGLTSDKRHV  546

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAAL++ AH  WSPAAIKSALM
Sbjct  547   SFNIISGTSMSCPHVSGLAALIKAAHQDWSPAAIKSALM  585



>ref|NP_001234282.1| SBT1 protein precursor [Solanum lycopersicum]
 emb|CAA67429.1| SBT1 [Solanum lycopersicum]
 emb|CAA06999.1| subtilisin-like protease [Solanum lycopersicum]
Length=766

 Score =   449 bits (1156),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 286/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G+ I+E++E KSPRD  GHGTHTA+ AAGS+V  ASL GYA G 
Sbjct  179   KLIGARFFSQGYEAAFGA-IDETIESKSPRDDEGHGTHTATTAAGSVVTGASLLGYATGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+A YK+CW+ GC+ SDIL+  DQAV DGV+V+SLS+        DY+RD  
Sbjct  238   ARGMASHARVAAYKVCWTGGCFSSDILAGMDQAVIDGVNVLSLSLG---GTISDYHRDIV  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A   G+ VS  AGN GP + T +NVAPWI TVGA T+DR FPA + +G+G+   
Sbjct  295   AIGAFSAASQGIFVSCSAGNGGPSSGTLSNVAPWITTVGAGTMDREFPAYIGIGNGKKLN  354

Query  542   GMSLYSGEPLGDNKLPLVYGGD----ANSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+ L  + +PLVY G+    +N   C SG LI  KV GKIV C+RG N    KG
Sbjct  355   GVSLYSGKALPSSVMPLVYAGNVSQSSNGNLCTSGSLIPEKVAGKIVVCDRGMNARAQKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V++AGG+GMI+  T   G+ + A AH+IP   V +  GN IK+YI S  +PTA I F 
Sbjct  415   LVVKDAGGIGMILANTDTYGDELVADAHLIPTAAVGQTAGNLIKQYIASNSNPTATIAFG  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPNP+  ++LKPD+IAPGVNILAGW+G +GP+G   D R V
Sbjct  475   GTKLGVQPS-PVVAAFSSRGPNPITPDVLKPDLIAPGVNILAGWTGKVGPTGLQEDTRNV  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  534   GFNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALM  572



>ref|XP_006374838.1| hypothetical protein POPTR_0014s01910g [Populus trichocarpa]
 gb|ERP52635.1| hypothetical protein POPTR_0014s01910g [Populus trichocarpa]
Length=779

 Score =   450 bits (1157),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 234/399 (59%), Positives = 294/399 (74%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA+ F KGYEA  G PI+E++E KSPRD +GHGTHTA+ AAGS V+ ASLFGYA G 
Sbjct  192   KLIGAQYFSKGYEAAFG-PIDETMESKSPRDDDGHGTHTATTAAGSAVSGASLFGYAFGT  250

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+A ++AV DGV+VIS+S+        DY RD+ 
Sbjct  251   ARGMATQARVAAYKVCWLGGCFSSDILAAMEKAVADGVNVISMSIG---GGISDYNRDTV  307

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A+  G++VS  AGN GP   + TNVAPWI TVGA T+DR FPA V LG+G+ ++
Sbjct  308   AIGAFRAVAQGILVSCSAGNGGPSPGSLTNVAPWITTVGAGTLDRDFPAYVSLGNGKNYS  367

Query  542   GMSLYSGEPLGDNKLPLVYGGD-ANST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL D+ LPLVY G+ +NST    C +G L+ S+V GKIV C+RG N  V KG
Sbjct  368   GISLYSGKPLSDSLLPLVYAGNVSNSTSGNLCMTGTLVPSQVAGKIVICDRGLNSRVQKG  427

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               VR++GG+GMI+  T   GE + A AH++P + V +   + IK Y  S P P A I   
Sbjct  428   MVVRDSGGLGMILANTELYGEELVADAHLLPTSTVGQRTADAIKNYAFSDPKPMATIASG  487

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P +A+FSSRGPN +  E+LKPD+IAPGVNILAGW+GA+GP+G   D+R V
Sbjct  488   GTKLGVEPS-PVLAAFSSRGPNLVTPEVLKPDLIAPGVNILAGWTGAVGPTGLTSDKRHV  546

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAAL++ AH  WSPAAIKSALM
Sbjct  547   SFNIISGTSMSCPHVSGLAALVKAAHQDWSPAAIKSALM  585



>dbj|BAJ99493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=764

 Score =   449 bits (1156),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 281/399 (70%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYEA  G P++ S E +SPRD +GHGTHT+S AAGS V  A L GYA G 
Sbjct  183   KLIGARFFLAGYEASKG-PVDTSKESRSPRDNDGHGTHTSSTAAGSAVHGADLLGYASGT  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A+GMA +AR+A YK+CW  GC+ SDIL   + AV DGV V+SLS+        DYYRDS 
Sbjct  242   AKGMAPRARVATYKVCWVGGCFSSDILKGMEVAVADGVDVLSLSLG---GGTSDYYRDSI  298

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GA+ AME G+ VS  AGN GPGA + TN APWI TVGA T+DR FPA V LG+G  + 
Sbjct  299   AVGAYSAMEKGIFVSCSAGNAGPGAASLTNGAPWITTVGAGTLDRDFPAYVTLGNGNKYD  358

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+ L    +P +Y G+A+++     C +G LI +KV GKIV C+RG N  V KG
Sbjct  359   GVSLYSGKQLPTTPVPFIYAGNASNSSMGALCMTGTLIPAKVAGKIVLCDRGTNARVQKG  418

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F VR+AGG GM++  TA  GE + A AH++P   V E  GN ++ Y +S P PTA IVF 
Sbjct  419   FVVRDAGGAGMVLANTAANGEELVADAHILPGAGVGEKAGNAMRTYASSDPKPTANIVFA  478

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +   ILKPD+IAPGVNILA WSG++GPSG   D RR 
Sbjct  479   GTKVGVQPS-PVVAAFSSRGPNTVTPGILKPDLIAPGVNILAAWSGSVGPSGIADDHRRT  537

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAA LR AH  WSPAAI+SALM
Sbjct  538   SFNIISGTSMSCPHVSGLAAFLRSAHQDWSPAAIRSALM  576



>ref|XP_009141044.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=757

 Score =   449 bits (1155),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 231/399 (58%), Positives = 289/399 (72%), Gaps = 10/399 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G PI+ES E +SPRD +GHGTHT+S AAGS+V  A+  G+A G 
Sbjct  180   KLIGARFFARGYEAEKG-PIDESKESRSPRDDDGHGTHTSSTAAGSVVEGANFLGFANGT  238

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+AVYK+CW  GC+DSD+L+A D+A+ D V+V+S+S+        DYYR+  
Sbjct  239   ARGMAPGARLAVYKVCWKGGCFDSDVLAAIDKAIDDNVNVLSISM---DDLTLDYYRNDI  295

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN+GP +   +NVAPWI TVGA TIDR FPA V+LG+G  ++
Sbjct  296   AIGAFAAMERGILVSCSAGNSGPRSSDISNVAPWITTVGAGTIDRDFPALVILGNGNNYS  355

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SL  G+ L +  LP VY G+A    N  +C SG LI  KV GKIV C+RG N  V+KG
Sbjct  356   GVSLIKGDALPE-LLPFVYAGNASNATNGNFCVSGTLIPEKVKGKIVMCDRGVNFRVEKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+  GG+GMI+  TA  GE + A AH++PAT V E  G  I+ Y+ + P+PTA+I+ +
Sbjct  415   EVVKAVGGLGMILANTAENGEELVADAHLLPATAVGEKAGEIIRHYVITHPNPTASILTQ  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTV+   PS P VA+FS RGPNP    ILKPD+IAPGVNILA W+GA GP+    D RRV
Sbjct  475   GTVVNVQPS-PVVAAFSLRGPNPTTPNILKPDLIAPGVNILAAWTGAKGPTELASDTRRV  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAALL+  HP WSPAAI+SALM
Sbjct  534   EFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALM  572



>ref|XP_009336065.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=771

 Score =   449 bits (1156),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 233/401 (58%), Positives = 289/401 (72%), Gaps = 11/401 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI ES E KSPRD +GHGTHTA+ AAGS V  ASL GYA G 
Sbjct  187   KLIGARYFAKGYEATLG-PIEESKESKSPRDDDGHGTHTATTAAGSFVPGASLLGYAPGT  245

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  ARIA YK+CW  GC+ SDIL+A D+A+ D V+V+S+S+    +   DY+RDS 
Sbjct  246   ARGMAPHARIAAYKVCWVGGCFSSDILAAMDKAIDDNVNVLSMSLGGGNS---DYFRDSV  302

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF AME G+++S  AGN GP A + +N APWI TVGA T+DR FPA V LG+G+ F+
Sbjct  303   AMGAFSAMEKGILISCSAGNAGPSAYSLSNSAPWITTVGAGTLDRDFPAFVSLGNGKNFS  362

Query  542   GMSLYSGEP--LGDNKLPLVYGGDANS----TYCYSGELIASKVTGKIVFCERGGNLDVD  703
             G+SLY G    +     P +Y G+A++      C  G L   +V GKIV C+RG N  V 
Sbjct  363   GVSLYRGNSNSMPSALTPFIYAGNASNATSGNLCMMGTLSPDQVKGKIVMCDRGVNARVQ  422

Query  704   KGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIV  883
             KG  V+ AGG+GMI+  TA  GE + A AH++PAT+V + + + IK Y+ S P+PTA I+
Sbjct  423   KGAVVKAAGGLGMILANTAANGEELVADAHLLPATSVGQRNSDVIKSYLFSDPNPTATIL  482

Query  884   FRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQR  1063
             F GT +G  PS P VA+FSSRGPN +  +ILKPD++APGVNILAGWSGA GP+G  +D R
Sbjct  483   FEGTKVGVQPS-PVVAAFSSRGPNSITADILKPDIVAPGVNILAGWSGAAGPTGLAIDAR  541

Query  1064  RVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             RV FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  542   RVAFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALM  582



>ref|XP_009615143.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=766

 Score =   449 bits (1155),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 233/399 (58%), Positives = 285/399 (71%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA  F +GYEA  G+ I+E+ E KSPRD +GHGTHTA+ AAGS+V  ASLFGYA G 
Sbjct  179   KLIGASFFSQGYEAAFGA-IDETTESKSPRDDDGHGTHTATTAAGSVVTGASLFGYAAGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+A YK+CW+ GC+ SDIL+  DQA+ DGV+V+SLS+        DYYRD  
Sbjct  238   ARGMASHARVAAYKVCWAGGCFSSDILAGMDQAIIDGVNVLSLSLG---GTISDYYRDIV  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A   G+ VS  AGN GPG+ + +NVAPWI TVGA T+DR FPA + +G+G+ F 
Sbjct  295   AIGAFSAASQGIFVSCSAGNGGPGSGSLSNVAPWITTVGAGTMDREFPAYISIGNGKKFN  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+ L  + +PLVY G+A    N   C SG LI  KV GKIV C+RG N    KG
Sbjct  355   GVSLYSGKALPSSVMPLVYAGNASQASNGNLCTSGSLIPEKVAGKIVVCDRGMNARAQKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V++AGG+GMI+  T   G+ + A AH+IP   V +  G+ IK YI S  +PT  I F 
Sbjct  415   LVVKDAGGIGMILANTDSYGDELVADAHLIPTAAVGQTAGDMIKRYIASDSNPTTTIAFG  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+G +GP+G   D R V
Sbjct  475   GTKLGVQPS-PVVAAFSSRGPNSITPEILKPDLIAPGVNILAGWTGKVGPTGLPEDTRNV  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  534   GFNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALM  572



>ref|XP_006362066.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score =   449 bits (1154),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 233/399 (58%), Positives = 285/399 (71%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G+ I+E++E KSPRD  GHGTHTA+ AAGS+V  ASL GYA G 
Sbjct  179   KLIGARFFSQGYEAAFGA-IDETIESKSPRDDEGHGTHTATTAAGSVVTGASLLGYATGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+A YK+CW+ GC+ SDIL+  DQAV DGV+V+SLS+        DY+RD  
Sbjct  238   ARGMASHARVAAYKVCWTGGCFSSDILAGMDQAVIDGVNVLSLSLG---GTISDYHRDIV  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A   G+ VS  AGN GP + T +NVAPWI TVGA T+DR FPA + +G+G    
Sbjct  295   AIGAFSAASQGIFVSCSAGNGGPSSGTLSNVAPWITTVGAGTMDREFPAYIGIGNGEKLN  354

Query  542   GMSLYSGEPLGDNKLPLVYGGD----ANSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+ L  + +PLVY G+    +N   C SG LI  KV GKIV C+RG N    KG
Sbjct  355   GVSLYSGKALLSSVMPLVYAGNVSQSSNGNLCTSGSLIPEKVAGKIVVCDRGMNARAQKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V++AGG+GMI+  T   G+ + A AH+IP   V +  GN IK+YI S  +PTA I F 
Sbjct  415   LVVKDAGGIGMILANTDTYGDELVADAHLIPTAAVGQTAGNLIKQYIASNSNPTATIAFG  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPNP+  +ILKPD+IAPGVNILAGW+G +GP+G   D R V
Sbjct  475   GTKLGVQPS-PVVAAFSSRGPNPITPDILKPDLIAPGVNILAGWTGKVGPTGLQEDTRNV  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  534   GFNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALM  572



>ref|XP_008679257.1| PREDICTED: subtilisin-like protease [Zea mays]
 gb|AFW64267.1| putative subtilase family protein [Zea mays]
Length=780

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 237/396 (60%), Positives = 288/396 (73%), Gaps = 3/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GA+ F  GYEA  G    +  + +SP D NGHGTHT+S AAGS V NA+ F YA+G 
Sbjct  192   KLVGAKFFGLGYEAAHGGGAVDETDSRSPLDTNGHGTHTSSTAAGSAVPNAAFFDYAKGT  251

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV-AIPRAYPEDYYRDS  358
             A GMA +ARIA YK CW+ GC  SDIL AFD+A+KDGV+V+S+S+ A+ +A P  +Y DS
Sbjct  252   AIGMAPRARIAAYKACWARGCTSSDILMAFDEAIKDGVNVLSVSLGAVGQAPP--FYSDS  309

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
             TA+GAF A+  G+VVS  AGN+GPG  TA NVAPWILTVGAST++R F A+VVLG G  F
Sbjct  310   TAVGAFSAVRRGIVVSASAGNSGPGEFTAVNVAPWILTVGASTVNRRFSANVVLGSGDTF  369

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
              G SLY+G PLG +K+PLVYGGD  S+ C +G+LIASKV GKIV C+ G N    KG AV
Sbjct  370   AGTSLYAGTPLGPSKIPLVYGGDVGSSVCEAGKLIASKVAGKIVVCDPGVNGRAAKGEAV  429

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             + AGG G I+      GE    + H+ PAT V      KIK YI ++ SP A IVF GTV
Sbjct  430   KLAGGAGAILVSAKAFGEQPITTPHIHPATAVTFAVAEKIKRYIRTSASPVATIVFLGTV  489

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             +G +PS+PR+ASFSSRGPN L  EILKPDV APGV+ILA W+G   PS    D RRV+FN
Sbjct  490   VGGTPSSPRMASFSSRGPNLLAPEILKPDVTAPGVDILAAWTGENSPSELDSDTRRVKFN  549

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSG+AA+LR+A P WSPAAIKSALM
Sbjct  550   IISGTSMSCPHVSGIAAMLRQARPGWSPAAIKSALM  585



>gb|AIX97848.1| SBT1.5 [Nicotiana tabacum]
Length=766

 Score =   448 bits (1153),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 285/399 (71%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA  F +GYEA  G+ I+E+ E KSPRD +GHGTHTA+ AAGS+V  ASLFGYA G 
Sbjct  179   KLIGASFFSQGYEAAFGA-IDETTESKSPRDDDGHGTHTATTAAGSVVTGASLFGYAAGT  237

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+A YK+CW+ GC+ SDIL+  DQA+ DGV+V+SLS+        DYYRD  
Sbjct  238   ARGMASHARVAAYKVCWAGGCFSSDILAGMDQAIIDGVNVLSLSLG---GTISDYYRDIV  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A   G+ +S  AGN GPG+ + +NVAPWI TVGA T+DR FPA + +G+G+ F 
Sbjct  295   AIGAFSAASQGIFISCSAGNGGPGSGSLSNVAPWITTVGAGTMDREFPAYISIGNGKKFN  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+ L  + +PLVY G+A    N   C SG LI  KV GKIV C+RG N    KG
Sbjct  355   GVSLYSGKALPSSVMPLVYAGNASQASNGNLCTSGSLIPEKVAGKIVVCDRGMNARAQKG  414

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V++AGG+GMI+  T   G+ + A AH+IP   V +  G+ IK YI S  +PT  I F 
Sbjct  415   LVVKDAGGIGMILANTDSYGDELVADAHLIPTAAVGQTAGDMIKRYIASDSNPTTTIAFG  474

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+G +GP+G   D R V
Sbjct  475   GTKLGVQPS-PVVAAFSSRGPNSITPEILKPDLIAPGVNILAGWTGKVGPTGLPEDTRNV  533

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  534   GFNIISGTSMSCPHVSGLAALLKAAHPEWSPAAIRSALM  572



>ref|XP_004954112.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=780

 Score =   449 bits (1154),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 237/396 (60%), Positives = 292/396 (74%), Gaps = 2/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GA+ F++GYEA  G+ ++E+ +P+SP D NGHGTHTAS AAGS VA A+ + YA+G+
Sbjct  188   KLVGAKFFHEGYEAAYGNRLDETEDPRSPLDSNGHGTHTASTAAGSAVAGAAFYNYAKGK  247

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A GMA  ARIA YK+CW+ GC DSDIL AFD+A+KDGV VISLS+      P +++ D  
Sbjct  248   AVGMAPGARIAAYKVCWTNGCADSDILKAFDEAIKDGVDVISLSLGA-VGEPPNFHEDQI  306

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A+  G+VVS  AGN+GPG  TA N+APW +TVGASTI+R FPA VVLG+G  FT
Sbjct  307   AIGAFNAVRKGIVVSASAGNSGPGEYTAKNIAPWFITVGASTINRRFPATVVLGNGETFT  366

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G SLY+G PL + K+PLVYGGD  S  C +G+L AS V GKIV C+ G N  V+KG  VR
Sbjct  367   GFSLYAGAPLSEAKIPLVYGGDVGSEVCEAGKLNASLVAGKIVVCDPGVNGRVEKGEVVR  426

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSA-PSPTAAIVFRGTV  898
              AGG G I+ G    GE +  S H++PAT V      KIK+Y+ +   SP A IVF+GTV
Sbjct  427   LAGGAGAILVGNEVFGEQVITSPHILPATAVTFAAAEKIKKYMRTKNASPVATIVFQGTV  486

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             +G  PS+PR+ASFSSRGPN     ILKPDV APGV+ILA W+GA  P+    D+RRV FN
Sbjct  487   VGRKPSSPRMASFSSRGPNFRAPVILKPDVTAPGVDILAAWTGANSPTELDSDKRRVHFN  546

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSG+AALLR+AHP WSPAAIKSALM
Sbjct  547   IISGTSMSCPHVSGIAALLRQAHPDWSPAAIKSALM  582



>ref|XP_003523991.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN04450.1| Subtilisin-like protease [Glycine soja]
Length=770

 Score =   448 bits (1153),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 221/398 (56%), Positives = 291/398 (73%), Gaps = 8/398 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F +GYEA  G PI+E  E KSPRD +GHG+HT++ AAGS V  ASLFG+A G 
Sbjct  185   KLVGARFFSRGYEAAFG-PIDEKTESKSPRDDDGHGSHTSTTAAGSAVVGASLFGFANGT  243

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDI +  D+A++DGV+++S+S+        DYY+D+ 
Sbjct  244   ARGMATQARLATYKVCWLGGCFTSDIAAGIDKAIEDGVNILSMSIG---GGLMDYYKDTI  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG F A  HG++VS  AGN GP   T +NVAPW+ TVGA TIDR FPA + LG+G+++T
Sbjct  301   AIGTFAATAHGILVSNSAGNGGPSQATLSNVAPWLTTVGAGTIDRDFPAYITLGNGKMYT  360

Query  542   GMSLYSGEPLGDNKLPLVYGG---DANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGF  712
             G+SLY+G+   ++ LP+VY     D +   C  G LIA KV GKIV C+RGGN  V+KG 
Sbjct  361   GVSLYNGKLPPNSPLPIVYAANVSDESQNLCTRGTLIAEKVAGKIVICDRGGNARVEKGL  420

Query  713   AVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRG  892
              V+ AGG+GMI+      GE + A ++++PA  + +   N++K+Y+ S+P+PTA + F G
Sbjct  421   VVKSAGGIGMILSNNEDYGEELVADSYLLPAAALGQKSSNELKKYVFSSPNPTAKLGFGG  480

Query  893   TVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVE  1072
             T +G  PS P VA+FSSRGPN L  +ILKPD+IAPGVNILAGW+GA+GP+G   D R VE
Sbjct  481   TQLGVQPS-PVVAAFSSRGPNVLTPKILKPDLIAPGVNILAGWTGAVGPTGLTEDTRHVE  539

Query  1073  FNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             FNIISGTSM+CPHV+GLAALL+  HP WSPAAI+SALM
Sbjct  540   FNIISGTSMSCPHVTGLAALLKGTHPEWSPAAIRSALM  577



>gb|EMT11726.1| Subtilisin-like protease [Aegilops tauschii]
Length=781

 Score =   448 bits (1153),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 232/395 (59%), Positives = 281/395 (71%), Gaps = 3/395 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GA+ F+ G EA  G  + E  +  SP D NGHGTHT+S A GS  A+A  F YA G+
Sbjct  194   KLVGAKFFHMGLEAARGRALGE--DSLSPLDTNGHGTHTSSTAGGSPAADAGFFDYAGGK  251

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A GMA  ARIAVYK CW  GC  SDIL+AFD+A+ D V VIS+S+       +++Y D+T
Sbjct  252   AVGMAPGARIAVYKACWDEGCASSDILAAFDEAITDRVDVISVSLG-DTGLADNFYSDTT  310

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF A+  G+VVS  AGN+GPG  TA N+APW LTVGAST++R FP DV+LG+G  FT
Sbjct  311   AVGAFRAVNKGIVVSASAGNSGPGDSTAVNIAPWFLTVGASTLNRRFPGDVILGNGETFT  370

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G +LY+GEPLG  KLPLVYGGD  S  C  G+L  +KV GKIVFCE G      KG AV+
Sbjct  371   GTTLYAGEPLGATKLPLVYGGDVGSKVCEEGKLKPTKVAGKIVFCELGVTAQAAKGQAVK  430

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG G I+ G    GE +  S HV PAT+V      KIK+YI +  SPTA IVFRGTV+
Sbjct  431   LAGGAGAILTGAKEDGEQVITSPHVHPATDVPFAAAEKIKKYIRTQTSPTATIVFRGTVV  490

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G++P +PR+ASFSSRGPN    EILKPDV APGV+ILA W+GA  PS    D RRV++NI
Sbjct  491   GSTPPSPRMASFSSRGPNFRAPEILKPDVTAPGVDILAAWTGANSPSELDFDTRRVKYNI  550

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+ ALLR+A P WSPAAIKSALM
Sbjct  551   ISGTSMSCPHVSGIVALLRQARPEWSPAAIKSALM  585



>gb|KHN45156.1| Subtilisin-like protease [Glycine soja]
Length=722

 Score =   446 bits (1148),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/398 (56%), Positives = 292/398 (73%), Gaps = 8/398 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F +GYEA  G PI+E  E KSPRD +GHG+HT++ AAGS V  ASLFG+A G 
Sbjct  138   KLVGARFFSRGYEAAFG-PIDEKTESKSPRDDDGHGSHTSTTAAGSAVFGASLFGFANGT  196

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDI +  D+A++DGV+++S+S+        DYY+D+ 
Sbjct  197   ARGMATQARVATYKVCWLGGCFTSDIAAGIDKAIEDGVNILSMSIG---GGLMDYYKDTI  253

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG F A  HG++VS  AGN GP   T +NVAPW+ TVGA TIDR FPA + LG+G+I+T
Sbjct  254   AIGTFAATAHGILVSNSAGNGGPSQATLSNVAPWLTTVGAGTIDRDFPAYITLGNGKIYT  313

Query  542   GMSLYSGEPLGDNKLPLVYGGDAN---STYCYSGELIASKVTGKIVFCERGGNLDVDKGF  712
             G+SLY+G+   ++ LP+VY G+A+      C  G LIA KV GKIV C+RGGN  V+KG 
Sbjct  314   GVSLYNGKLPLNSPLPIVYAGNASEESQNLCTRGSLIAKKVAGKIVICDRGGNARVEKGL  373

Query  713   AVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRG  892
              V+ AGG+GMI+      GE + A ++++PA  + +   N++K+Y+ S P+PTA + F G
Sbjct  374   VVKSAGGIGMILSNNEDYGEELVADSYLLPAAALGQKSSNELKKYVFSFPNPTAKLGFGG  433

Query  893   TVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVE  1072
             T +G  PS P VA+FSSRGPN L  +ILKPD+IAPGVNILAGW+GA+GP+G   D R V+
Sbjct  434   TQLGVQPS-PVVAAFSSRGPNVLTPKILKPDLIAPGVNILAGWTGAVGPTGLAEDTRHVD  492

Query  1073  FNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             FNIISGTSM+CPHV+GLAALL+  HP WSPAAI+SALM
Sbjct  493   FNIISGTSMSCPHVTGLAALLKGIHPEWSPAAIRSALM  530



>ref|XP_002510119.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF52306.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=769

 Score =   448 bits (1152),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 233/399 (58%), Positives = 290/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G P++E+VE +SPRD +GHGTHT++ AAGS V+ ASLFG+A G 
Sbjct  182   KLIGARFFSKGYEAAFG-PVDETVESRSPRDDDGHGTHTSTTAAGSAVSGASLFGFATGI  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDI++A D+AV+DGV+VIS+S+        DYYRD  
Sbjct  241   ARGMATQARVAAYKVCWLGGCFGSDIVAAMDKAVEDGVNVISMSIG---GGLSDYYRDIV  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A   G++VS  AGN GP   + +N+APWI TVGA T+DR FPA V LG+G+ F+
Sbjct  298   AIGAFTATAQGILVSCSAGNGGPSQGSLSNIAPWITTVGAGTLDRDFPAYVRLGNGKNFS  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDANS----TYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G SLYSG+PL D+ +PLV  G+A++    + C SG LI +KV GKIV C+RGGN  V KG
Sbjct  358   GASLYSGKPLSDSLVPLVSAGNASNATSGSLCMSGTLIPTKVAGKIVICDRGGNSRVQKG  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GMI+  T   G+ + A AH++P   V +   + IK Y  S   PTA I F 
Sbjct  418   LEVKNAGGIGMILANTELYGDELVADAHLLPTAAVGQTSADVIKRYAFSDLKPTATIAFG  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT IG  PS P VA+FSSRGPN +  EILKPD+IAPGVNILAGW+GA GP+G   D RRV
Sbjct  478   GTHIGVEPS-PVVAAFSSRGPNLVTPEILKPDIIAPGVNILAGWTGAAGPTGLTDDTRRV  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAA ++ AH  WSPAAI+SALM
Sbjct  537   SFNIISGTSMSCPHVSGLAAFIKAAHQDWSPAAIRSALM  575



>ref|XP_010557668.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557669.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557670.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010557671.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=772

 Score =   447 bits (1151),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 231/397 (58%), Positives = 286/397 (72%), Gaps = 6/397 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR+F KG++  +G   +   E  SPRD +GHGTHT+S AAGS V NAS  GYA G 
Sbjct  192   KLIGARSFSKGFQMASGGGFSNKRESVSPRDVDGHGTHTSSTAAGSAVRNASFLGYATGT  251

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CWS GC+ SDIL+  D+A+ DGV V+SLS+    A    YYRD+ 
Sbjct  252   ARGMATRARVATYKVCWSTGCFGSDILAGMDRAILDGVDVLSLSLGGGSA---PYYRDTI  308

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+ VS  AGN+GP   +  NVAPWI+TVGA T+DR FPA   LG+G  FT
Sbjct  309   AIGAFSAMEKGIFVSCSAGNSGPTKASIANVAPWIMTVGAGTLDRDFPAYAALGNGDRFT  368

Query  542   GMSLYSGEPLGDNKLPLVY--GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFA  715
             G+SLYSGE +G   L LVY  G  ++S  C  G L  + V GKIV C+RG N  V+KG  
Sbjct  369   GVSLYSGEGMGTKPLALVYNKGNSSSSNLCLPGSLDPAIVRGKIVVCDRGVNARVEKGAV  428

Query  716   VREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGT  895
             VR+AGG GMI+  TA +GE + A +H++PA  V    G+ I+EY+ S  +PTA +VFRGT
Sbjct  429   VRDAGGAGMILANTAASGEELVADSHMLPAMAVGRKTGDLIREYVKSDKNPTAVLVFRGT  488

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             V+G  PS P VA+FSSRGPN +  +ILKPDVI PGVNILAGWS A+GP+G   D RR +F
Sbjct  489   VLGVRPS-PVVAAFSSRGPNTVTPQILKPDVIGPGVNILAGWSEAVGPTGLEKDPRRTQF  547

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NI+SGTSM+CPH+SGLAALL+ AHP WSP+AIKSALM
Sbjct  548   NIMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALM  584



>ref|XP_003525925.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=769

 Score =   447 bits (1149),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 222/398 (56%), Positives = 292/398 (73%), Gaps = 8/398 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F +GYEA  G PI+E  E KSPRD +GHG+HT++ AAGS V  ASLFG+A G 
Sbjct  185   KLVGARFFSRGYEAAFG-PIDEKTESKSPRDDDGHGSHTSTTAAGSAVFGASLFGFANGT  243

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDI +  D+A++DGV+++S+S+        DYY+D+ 
Sbjct  244   ARGMATQARVATYKVCWLGGCFTSDIAAGIDKAIEDGVNILSMSIG---GGLTDYYKDTI  300

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG F A  HG++VS  AGN GP   T +NVAPW+ TVGA TIDR FPA + LG+G+I+T
Sbjct  301   AIGTFAATAHGILVSNSAGNGGPSQATLSNVAPWLTTVGAGTIDRDFPAYITLGNGKIYT  360

Query  542   GMSLYSGEPLGDNKLPLVYGGDAN---STYCYSGELIASKVTGKIVFCERGGNLDVDKGF  712
             G+SLY+G+   ++ LP+VY G+A+      C  G LIA KV GKIV C+RGGN  V+KG 
Sbjct  361   GVSLYNGKLPLNSPLPIVYAGNASEESQNLCTRGSLIAKKVAGKIVICDRGGNARVEKGL  420

Query  713   AVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRG  892
              V+ AGG+GMI+      GE + A ++++PA  + +   N++K+Y+ S P+PTA + F G
Sbjct  421   VVKSAGGIGMILSNNEDYGEELVADSYLLPAAALGQKSSNELKKYVFSFPNPTAKLGFGG  480

Query  893   TVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVE  1072
             T +G  PS P VA+FSSRGPN L  +ILKPD+IAPGVNILAGW+GA+GP+G   D R V+
Sbjct  481   TQLGVQPS-PVVAAFSSRGPNVLTPKILKPDLIAPGVNILAGWTGAVGPTGLAEDTRHVD  539

Query  1073  FNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             FNIISGTSM+CPHV+GLAALL+  HP WSPAAI+SALM
Sbjct  540   FNIISGTSMSCPHVTGLAALLKGIHPEWSPAAIRSALM  577



>ref|XP_001755716.1| predicted protein [Physcomitrella patens]
 gb|EDQ79389.1| predicted protein [Physcomitrella patens]
Length=720

 Score =   445 bits (1145),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 241/404 (60%), Positives = 281/404 (70%), Gaps = 17/404 (4%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGAR F  GYEA TG P+N+++E +SPRD  GHGTHTAS AAGS V  ASL   A+G 
Sbjct  131   KIIGARYFSAGYEAATG-PMNDTIESRSPRDTEGHGTHTASTAAGSPVEKASLNELAEGT  189

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV---AIPRAYPEDYYR  352
             ARGMA KARIAVYKICW  GCYDSDI +AFDQAV DGV VISLSV    +P      YY+
Sbjct  190   ARGMASKARIAVYKICWERGCYDSDIAAAFDQAVADGVDVISLSVGGGVVP------YYQ  243

Query  353   DSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGR  532
             DS AIGAFGAM+ G+ VS  AGN+GPG  T +N+APW++TV AST+DR FPA V LG+ +
Sbjct  244   DSIAIGAFGAMKKGIFVSCSAGNSGPGRMTVSNIAPWVVTVAASTLDRKFPAGVELGNNQ  303

Query  533   IFTGMSLYSGEPLGDNKLPLVYGGDANST------YCYSGELIASKVTGKIVFCERGGNL  694
               +G+SLY G    +    LVYGGD  ST       C  G L  S V GKIV C+RGGN 
Sbjct  304   TISGVSLYRGSASDEEFTGLVYGGDVASTNVTYGSQCLEGSLDPSLVKGKIVLCDRGGNG  363

Query  695   DVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTA  874
              V KG  V  AGG GMI+  T   GE + A +H++PAT V    G  IK YI S+ SP A
Sbjct  364   RVAKGAVVMGAGGFGMILTNTPVDGEGLLADSHILPATLVGATGGATIKSYIKSSNSPVA  423

Query  875   AIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVM  1054
                F GT +   P AP VASFSSRGPN L  ++LKPD+  PGVNILA W+G +GPSG   
Sbjct  424   KFKFGGTQLDVKP-APVVASFSSRGPNSLTPKVLKPDITGPGVNILAAWTGRVGPSGLAF  482

Query  1055  DQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             D RRV+FNIISGTSM+CPH+SGL ALLR AHPTWSP+AIKSA+M
Sbjct  483   DNRRVKFNIISGTSMSCPHISGLGALLRGAHPTWSPSAIKSAIM  526



>ref|XP_002994398.1| hypothetical protein SELMODRAFT_236958 [Selaginella moellendorffii]
 gb|EFJ04532.1| hypothetical protein SELMODRAFT_236958 [Selaginella moellendorffii]
Length=749

 Score =   446 bits (1146),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 237/405 (59%), Positives = 288/405 (71%), Gaps = 18/405 (4%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR FY+GYEA +G PIN++ E KSPRD +GHGTHTAS AAG  V  A L G+A G 
Sbjct  153   KLIGARFFYRGYEAMSG-PINDTTEFKSPRDSDGHGTHTASTAAGRDVYRADLLGFAAGT  211

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV---AIPRAYPEDYYR  352
             ARGMA KARIA YK+CW  GC+DSDIL+AFD+AV DGV VISLSV    +P      YY 
Sbjct  212   ARGMAPKARIAAYKVCWQSGCFDSDILAAFDRAVSDGVDVISLSVGGGVMP------YYL  265

Query  353   DSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGR  532
             DS AIG+F AME G+ V+   GN GP   + TN+APWI TVGAST+DR+FPA+V LG+G 
Sbjct  266   DSIAIGSFAAMERGIFVACSGGNEGPTDMSVTNIAPWITTVGASTMDRSFPANVKLGNGM  325

Query  533   IFTGMSLYSGEPL-GDNKLPLVYG--GDANSTY----CYSGELIASKVTGKIVFCERGGN  691
             +  G+SLYSG+ L    +L LV+      N +Y    C    L      GKIVFCERG N
Sbjct  326   VIQGVSLYSGKGLPHHQQLKLVFPKPNTKNDSYSASLCMKNTLDPKAAKGKIVFCERGSN  385

Query  692   LDVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPT  871
               V+KG+ V +AGG GMI+      GE + A +H++PAT V    G+ I++Y++S  +PT
Sbjct  386   PRVEKGYNVLQAGGAGMILANAVADGEGLVADSHLLPATAVGARSGSVIRKYMHSTRNPT  445

Query  872   AAIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSV  1051
             A I F GTV G S +AP +ASFSSRGPNP   EILKPD++APGVNILA W+G  GP+G  
Sbjct  446   ATIEFLGTVYG-SGNAPVIASFSSRGPNPETPEILKPDLVAPGVNILASWTGDAGPTGLS  504

Query  1052  MDQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              D RRV+FNI+SGTSMACPHVSGLAALL+ AHPTWSPAAI+SALM
Sbjct  505   ADTRRVKFNILSGTSMACPHVSGLAALLKSAHPTWSPAAIRSALM  549



>ref|XP_006828664.1| hypothetical protein AMTR_s00129p00121180 [Amborella trichopoda]
 gb|ERM96080.1| hypothetical protein AMTR_s00129p00121180 [Amborella trichopoda]
Length=799

 Score =   447 bits (1149),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 233/407 (57%), Positives = 289/407 (71%), Gaps = 20/407 (5%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F  GYEA +G P+NE+ E +SPRD +GHGTHTASIAAG  V  A + GYA G 
Sbjct  205   KLVGARYFSGGYEAMSG-PMNETAEYRSPRDSDGHGTHTASIAAGRYVYPADMLGYAHGV  263

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV---AIPRAYPEDYYR  352
             A GMA KAR+A YK+CW+ GC+DSDIL+AFD+AV DGV+VISLSV    +P      +Y 
Sbjct  264   AAGMAPKARLAAYKVCWTSGCFDSDILAAFDRAVLDGVNVISLSVGGGVVP------FYL  317

Query  353   DSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGR  532
             DS AIGAF A +H + VS  AGN GP   T TNVAPWI TVGA T+DR FPA++ LG+G 
Sbjct  318   DSIAIGAFAAAQHNIFVSASAGNEGPAESTVTNVAPWITTVGAGTLDRNFPAEISLGNGV  377

Query  533   IFTGMSLYSGEPLGDN-KLPLVYGGDA--------NSTYCYSGELIASKVTGKIVFCERG  685
              F+G+SLYSG  L    ++PLVY G+A        +S+ C    L    V GKIV C+RG
Sbjct  378   KFSGVSLYSGPHLSQKPEIPLVYAGNAPATGGDGYSSSLCMENSLDPEMVRGKIVLCDRG  437

Query  686   GNLDVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPS  865
              N  V+KG  V+EAGGVGMI+   AG GE + A +HV+PA  +    G+ ++ Y+NS  +
Sbjct  438   SNARVNKGIVVKEAGGVGMILANGAGDGEGLVADSHVLPAAAIGANAGDLVRSYVNSVKN  497

Query  866   PTAAIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSG  1045
             PTA I F+GT +G  P AP VASFS+RGPNP+  EILKPDVIAPGVNILA W+  +GP+G
Sbjct  498   PTATIRFQGTQLGVRP-APVVASFSARGPNPVAPEILKPDVIAPGVNILAAWTDDVGPAG  556

Query  1046  SVMDQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
                D+R+ EFNI+SGTSMACPHVSGLAALL  AHP W+P+ I+SALM
Sbjct  557   VTSDRRKTEFNILSGTSMACPHVSGLAALLMGAHPDWTPSMIRSALM  603



>gb|AES59354.2| subtilisin-like serine protease [Medicago truncatula]
Length=728

 Score =   444 bits (1143),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 222/399 (56%), Positives = 290/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+E+ E KS RD +GHG+HT + AAGS+VA ASLFG A G 
Sbjct  138   KLIGARFFLKGYEAALG-PIDETTESKSARDDDGHGSHTLTTAAGSVVAEASLFGLASGT  196

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDI +  D+A++DGV+++S+S+        DYYRD  
Sbjct  197   ARGMATEARVAAYKVCWLSGCFTSDIAAGMDKAIEDGVNILSMSIG---GSIMDYYRDII  253

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AM HG++VS+ AGN GP A + +NVAPWI TVGA TIDR FP+ + LG+G+ +T
Sbjct  254   AIGAFTAMSHGILVSSSAGNGGPSAESLSNVAPWITTVGAGTIDRDFPSYITLGNGKTYT  313

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G SLY+G+P  D+ LP+VY G+ + +     C    L +SKV GKIV CERGGN  V+KG
Sbjct  314   GASLYNGKPSSDSLLPVVYAGNVSESSVGYLCIPDSLTSSKVLGKIVICERGGNSRVEKG  373

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+      GE + A +H++PA  + +     +K+Y+ +  +P A +VF 
Sbjct  374   LVVKNAGGVGMILVNNEAYGEELIADSHLLPAAALGQKSSTVLKDYVFTTKNPRAKLVFG  433

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPN L  +ILKPD+IAPGVNILAGW+GA+GP+G  +D+R V
Sbjct  434   GTHLQVQPS-PVVAAFSSRGPNSLTPKILKPDLIAPGVNILAGWTGAVGPTGLALDKRHV  492

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPH SGLAA+++ A+P WSPAAI+SALM
Sbjct  493   NFNIISGTSMSCPHASGLAAIVKGAYPEWSPAAIRSALM  531



>gb|ABD33266.1| Protease-associated PA; Proteinase inhibitor I9, subtilisin propeptide 
[Medicago truncatula]
Length=765

 Score =   444 bits (1143),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 222/399 (56%), Positives = 290/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+E+ E KS RD +GHG+HT + AAGS+VA ASLFG A G 
Sbjct  175   KLIGARFFLKGYEAALG-PIDETTESKSARDDDGHGSHTLTTAAGSVVAEASLFGLASGT  233

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDI +  D+A++DGV+++S+S+        DYYRD  
Sbjct  234   ARGMATEARVAAYKVCWLSGCFTSDIAAGMDKAIEDGVNILSMSIG---GSIMDYYRDII  290

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AM HG++VS+ AGN GP A + +NVAPWI TVGA TIDR FP+ + LG+G+ +T
Sbjct  291   AIGAFTAMSHGILVSSSAGNGGPSAESLSNVAPWITTVGAGTIDRDFPSYITLGNGKTYT  350

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G SLY+G+P  D+ LP+VY G+ + +     C    L +SKV GKIV CERGGN  V+KG
Sbjct  351   GASLYNGKPSSDSLLPVVYAGNVSESSVGYLCIPDSLTSSKVLGKIVICERGGNSRVEKG  410

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+      GE + A +H++PA  + +     +K+Y+ +  +P A +VF 
Sbjct  411   LVVKNAGGVGMILVNNEAYGEELIADSHLLPAAALGQKSSTVLKDYVFTTKNPRAKLVFG  470

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPN L  +ILKPD+IAPGVNILAGW+GA+GP+G  +D+R V
Sbjct  471   GTHLQVQPS-PVVAAFSSRGPNSLTPKILKPDLIAPGVNILAGWTGAVGPTGLALDKRHV  529

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPH SGLAA+++ A+P WSPAAI+SALM
Sbjct  530   NFNIISGTSMSCPHASGLAAIVKGAYPEWSPAAIRSALM  568



>ref|XP_010693651.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=782

 Score =   445 bits (1145),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 234/403 (58%), Positives = 287/403 (71%), Gaps = 14/403 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KI+GAR FY+GYEA TG  INE +E KSPRD++GHG+HTA   AGS+V  A+L GYA G 
Sbjct  197   KIVGARVFYRGYEAATGK-INEDMEYKSPRDQDGHGSHTAGTVAGSLVHGANLLGYAPGT  255

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGM  +AR+A YK+CW+ GC+ SDILSA DQA+ DGV V+S+S+         Y+RDS 
Sbjct  256   ARGMYPRARVAAYKVCWTGGCFSSDILSAVDQAITDGVDVLSISLG---GGVSSYFRDSL  312

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             ++  FGAME GV VS  AGN GP   + TNVAPW+ TVGAST+DR FPA+V LG G+ FT
Sbjct  313   SVATFGAMEKGVFVSCSAGNGGPEPVSLTNVAPWVATVGASTLDRNFPANVRLGSGKSFT  372

Query  542   GMSLYSGE-PLGDNKL-PLVYGGDANST------YCYSGELIASKVTGKIVFCERGGNLD  697
             G+S+Y G   L   KL P+VY G +NST       C  G L   KV GKIV C+RG N  
Sbjct  373   GVSIYKGRMKLSTEKLYPVVYLG-SNSTNLDLDSLCLEGTLDRRKVQGKIVICDRGINPR  431

Query  698   VDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAA  877
             V KG  V+EAGGVGMI+  T   GE + A  H++PA  V E +GN IK Y  ++P+P A 
Sbjct  432   VQKGQVVKEAGGVGMILANTEANGEELVADCHLLPAVAVGEREGNIIKRYAMTSPNPRAT  491

Query  878   IVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMD  1057
             + F GT +G  PS P VA+FSSRGPN L  E+LKPDV+APGVNILA W+G+ GPS    D
Sbjct  492   MSFLGTKVGIKPS-PIVAAFSSRGPNILSLEVLKPDVVAPGVNILAAWTGSTGPSSVSAD  550

Query  1058  QRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             QRRV+FNI+SGTSM+CPHVSG+AAL++  HP+WSPAAIKSALM
Sbjct  551   QRRVKFNILSGTSMSCPHVSGVAALIKAVHPSWSPAAIKSALM  593



>ref|XP_006396129.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
 gb|ESQ36908.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
Length=762

 Score =   444 bits (1143),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 227/397 (57%), Positives = 285/397 (72%), Gaps = 6/397 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR+F KG++  +G   +   E  SPRD +GHGTHT+S AAGS V NAS  GYA G 
Sbjct  182   KLIGARSFSKGFQMASGGGFSSKRESVSPRDVDGHGTHTSSTAAGSAVRNASFLGYAAGT  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIA YK+CWS GC+ SDIL+A D+A+ DGV V+SLS+    A    YYRD+ 
Sbjct  242   ARGMATRARIATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGSA---PYYRDTI  298

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME GV VS  AGN+GP   +  NVAPW++TVGA T+DR FPA   LG+G+   
Sbjct  299   AIGAFSAMEKGVFVSCSAGNSGPTRSSVANVAPWVMTVGAGTLDRDFPAFANLGNGKRLV  358

Query  542   GMSLYSGEPLGDNKLPLVY--GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFA  715
             G+SLYSGE +G   L LVY  G  ++S  C  G L  + V GKIV C+RG N  V+KG  
Sbjct  359   GVSLYSGEGMGTKPLELVYNKGNSSSSNLCLPGSLDPTTVRGKIVVCDRGVNARVEKGAV  418

Query  716   VREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGT  895
             VR+AGG+GMI+  TA +GE + A +H++PA  V +  G+ ++EY+ S  +P A +VF+GT
Sbjct  419   VRDAGGLGMIMANTAASGEELVADSHLLPAIAVGKKTGDLLREYVKSETNPMAVLVFKGT  478

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             ++   PS P VA+FSSRGPN +  EILKPDVI PGVNILAGWS AIGP+G   D RR +F
Sbjct  479   ILDVRPS-PVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKDSRRTQF  537

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NI+SGTSM+CPH+SGLA LL+ AHP WSP+AIKSALM
Sbjct  538   NIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALM  574



>dbj|BAJ91400.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=783

 Score =   445 bits (1144),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 233/395 (59%), Positives = 279/395 (71%), Gaps = 2/395 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GA+ FYKGYE   G PINE+ E KSP D  GHGTHTAS AAGS V +A+ +GYA+G 
Sbjct  192   KLVGAKVFYKGYEVNLGGPINETEESKSPLDTVGHGTHTASTAAGSAVPDAAFYGYARGN  251

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A GMA  ARIA YK+CW  GC  SDIL+AFD+A+ DGV VIS S+     Y E +Y DST
Sbjct  252   AVGMAPGARIASYKVCWKYGCPSSDILAAFDEAIADGVDVISASLG-SSGYAEPFYMDST  310

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF A+  G++VS  AGN+GP   TA N+APW LTVGASTI+R FPADVVLG+G  F+
Sbjct  311   AVGAFSAVRKGIIVSAAAGNSGPVESTANNIAPWFLTVGASTINRRFPADVVLGNGDTFS  370

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G SLY+G PLG   +PLV G    S  C +G++ AS V GKIV C     L+  +G AV+
Sbjct  371   GASLYAGPPLGPTAIPLVDGRAVGSKTCEAGKMNASLVAGKIVLCGPA-VLNAAQGEAVK  429

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGGVG I+  T   GEL   S +  PAT V      +IK Y+N   SP A IVF GTVI
Sbjct  430   LAGGVGAILTSTKQFGELAVGSPNTFPATTVTFAAAKRIKTYMNKTTSPAATIVFHGTVI  489

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G +PS+PR+A FSSRGPN    EILKPDV APGV ILA W+GA  PSG   D+RRV +N+
Sbjct  490   GPTPSSPRMAPFSSRGPNLHAPEILKPDVTAPGVEILAAWTGAASPSGLDSDRRRVHYNV  549

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +SGTSMACPHVSG+AA+LR+A P WSPAAIKSALM
Sbjct  550   LSGTSMACPHVSGIAAMLRQARPGWSPAAIKSALM  584



>gb|EPS65791.1| hypothetical protein M569_08985, partial [Genlisea aurea]
Length=743

 Score =   443 bits (1140),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 236/399 (59%), Positives = 289/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G P++ES E +SPRD +GHGTHT+S AAGS VA ASLFGYA G 
Sbjct  151   KLIGARFFARGYEATLG-PVDESKESRSPRDNDGHGTHTSSTAAGSAVAGASLFGYAAGT  209

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+A D+A+ D V+V+S+S+        DYYRD+ 
Sbjct  210   ARGMAPRARVAAYKVCWVGGCFSSDILAAMDKAIDDNVNVLSMSLG---GGVSDYYRDTV  266

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G++VS  AGN GP A + +NVAPWI TVGA T+DR FP+ V LG+G+ F+
Sbjct  267   AIGAFAAMEKGILVSCSAGNAGPTASSLSNVAPWITTVGAGTLDRDFPSYVSLGNGKNFS  326

Query  542   GMSLYSGEPLGDNKLPLVYGGDANS----TYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY G  L D  LP VY   A++      C +G LI  KV  KIV C+RG N  V KG
Sbjct  327   GVSLYKGNSLPDKLLPFVYASAASNATSGNLCMTGTLIPEKVKDKIVLCDRGVNPRVQKG  386

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               VR AGG GMI+  TA  G  + A AH++PAT V E  G ++K Y++S  +PTA I+F 
Sbjct  387   AVVRAAGGAGMIMANTAANGAELVADAHLLPATAVSEASGQEMKNYLSSDSNPTATILFE  446

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +   ILKPD+IAPGVNILAGWSGA+GP+G   D RRV
Sbjct  447   GTKVGIEPS-PVVAAFSSRGPNSITPGILKPDLIAPGVNILAGWSGAVGPTGLSEDSRRV  505

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAAL++ A P WSPAAI+SALM
Sbjct  506   NFNIISGTSMSCPHVSGLAALIKSARPNWSPAAIRSALM  544



>emb|CAN62640.1| hypothetical protein VITISV_010210 [Vitis vinifera]
Length=566

 Score =   437 bits (1125),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 224/376 (60%), Positives = 274/376 (73%), Gaps = 8/376 (2%)
 Frame = +2

Query  71    VEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGEARGMAIKARIAVYKICWSLGCYD  250
             +E +SPRD +GHG+HT++ A GS V  A LFG+A G ARGMA  AR+A YK+CW  GCY 
Sbjct  1     MESRSPRDDDGHGSHTSTTAVGSAVEGAXLFGFAAGTARGMATHARVAAYKVCWLGGCYG  60

Query  251   SDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDSTAIGAFGAMEHGVVVSTVAGNTGP  430
             SDI++A D+AV+DGV V+S+S+        DY +DS AIGAF AME G++VS  AGN GP
Sbjct  61    SDIVAAMDKAVQDGVDVLSMSIG---GGLSDYTKDSVAIGAFRAMEQGILVSCSAGNGGP  117

Query  431   GARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFTGMSLYSGEPLGDNKLPLVYGGDA  610
                + +NVAPWI TVGA T+DR FPA V+LGDG+ F+G+SLYSG+PL D+ +PLVY G+A
Sbjct  118   APSSLSNVAPWITTVGAGTLDRDFPAFVMLGDGKKFSGVSLYSGKPLSDSLIPLVYAGNA  177

Query  611   NST----YCYSGELIASKVTGKIVFCERGGNLDVDKGFAVREAGGVGMIVDGTAGTGELI  778
             +S+     C    LI  KV GKIV C+RG N  V KG  V+EAGGVGMI+  T   GE +
Sbjct  178   SSSPNGNLCIPDNLIPGKVAGKIVLCDRGSNARVQKGXVVKEAGGVGMILTNTDLYGEEL  237

Query  779   YASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVIGTSPSAPRVASFSSRGPNP  958
              A AH +P   V +  G+ IK YI+S P+P A I   GT +G  PS P VASFSSRGPNP
Sbjct  238   VADAHXLPTAAVGQKAGDSIKSYISSDPNPMATIAPGGTQVGVQPS-PVVASFSSRGPNP  296

Query  959   LQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNIISGTSMACPHVSGLAALLR  1138
             +  EILKPD+IAPGVNILAGW+GA GP+G  +D R+V FNIISGTSM+CPHVSGLAALL+
Sbjct  297   VTPEILKPDIIAPGVNILAGWTGAXGPTGLQVDTRKVSFNIISGTSMSCPHVSGLAALLK  356

Query  1139  KAHPTWSPAAIKSALM  1186
              AHP W PAAIKSALM
Sbjct  357   AAHPEWXPAAIKSALM  372



>ref|NP_565330.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAC95169.1| subtilisin-like serine protease, putative [Arabidopsis thaliana]
 gb|AAK59595.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAN13182.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEC05985.1| Subtilase-like protein [Arabidopsis thaliana]
Length=754

 Score =   444 bits (1141),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 228/397 (57%), Positives = 286/397 (72%), Gaps = 6/397 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR+F KG++  +G   +   E  SPRD +GHGTHT++ AAGS V NAS  GYA G 
Sbjct  174   KLIGARSFSKGFQMASGGGFSSKRESVSPRDVDGHGTHTSTTAAGSAVRNASFLGYAAGT  233

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CWS GC+ SDIL+A D+A+ DGV V+SLS+    A    YYRD+ 
Sbjct  234   ARGMATRARVATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGSA---PYYRDTI  290

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME GV VS  AGN+GP   +  NVAPW++TVGA T+DR FPA   LG+G+  T
Sbjct  291   AIGAFSAMERGVFVSCSAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKRLT  350

Query  542   GMSLYSGEPLGDNKLPLVY--GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFA  715
             G+SLYSG  +G   L LVY  G  ++S  C  G L +S V GKIV C+RG N  V+KG  
Sbjct  351   GVSLYSGVGMGTKPLELVYNKGNSSSSNLCLPGSLDSSIVRGKIVVCDRGVNARVEKGAV  410

Query  716   VREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGT  895
             VR+AGG+GMI+  TA +GE + A +H++PA  V +  G+ ++EY+ S   PTA +VF+GT
Sbjct  411   VRDAGGLGMIMANTAASGEELVADSHLLPAIAVGKKTGDLLREYVKSDSKPTALLVFKGT  470

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             V+   PS P VA+FSSRGPN +  EILKPDVI PGVNILAGWS AIGP+G   D RR +F
Sbjct  471   VLDVKPS-PVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLDKDSRRTQF  529

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NI+SGTSM+CPH+SGLA LL+ AHP WSP+AIKSALM
Sbjct  530   NIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALM  566



>gb|KFK39884.1| hypothetical protein AALP_AA3G301200 [Arabis alpina]
Length=754

 Score =   443 bits (1139),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 227/397 (57%), Positives = 285/397 (72%), Gaps = 6/397 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR+F KG++  +G   +   E  SPRD +GHGTHT+S AAGS V NAS  GYA G 
Sbjct  174   KLIGARSFSKGFQMASGGGFSTKRESVSPRDVDGHGTHTSSTAAGSAVRNASFLGYAAGT  233

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+A YK+CWS GC+ SDIL+A D+A+ DGV V+SLS+    A    Y+RD+ 
Sbjct  234   ARGMATHARVATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGSA---PYFRDTI  290

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME GV VS  AGN+GP   +  NVAPW++TVGA T+DR FPA   LG+G+  T
Sbjct  291   AIGAFSAMERGVFVSASAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKSLT  350

Query  542   GMSLYSGEPLGDNKLPLVY--GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFA  715
             G+SLYSGE +G   L +VY  G  ++S  C  G L  + V GKIV C+RG N  V+KG  
Sbjct  351   GVSLYSGEGMGKKPLEIVYNKGNSSSSNLCLPGSLDPATVKGKIVVCDRGVNARVEKGAV  410

Query  716   VREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGT  895
             VR+AGG+GMI+  TA +GE + A +H+IPA  V +  G+ ++EY+ S  +PTA +VF+GT
Sbjct  411   VRDAGGLGMIMANTAASGEELVADSHLIPAIAVGKKTGDLLREYVKSDSNPTAVLVFKGT  470

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             V+   PS P VA+FSSRGPN +  EILKPDVI PGVNILAGWS A+GP+G   D RR  F
Sbjct  471   VLDVHPS-PVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDALGPTGLEKDSRRTHF  529

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NI+SGTSM+CPH+SGLA LL+ AHP WSP+AIKSALM
Sbjct  530   NIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALM  566



>ref|NP_001151549.1| subtilisin-like protease precursor [Zea mays]
 gb|ACG43281.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score =   443 bits (1140),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 233/399 (58%), Positives = 283/399 (71%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F KGYEA  G P++   E +SP D +GHGTHT+S AAG+ V  ASLFG+A G 
Sbjct  177   KLVGARFFNKGYEAAMG-PMDTDRESRSPLDDDGHGTHTSSTAAGAAVPGASLFGFAAGT  235

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+  D AV DG  V+SLS+    A   DY RDS 
Sbjct  236   ARGMAPRARVAAYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLGGGAA---DYSRDSV  292

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A E  V+VS  AGN GPG+ T +NVAPWI TVGA T+DR FPA VVLGDG+ +T
Sbjct  293   AIGAFAATEQNVLVSCSAGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVVLGDGKNYT  352

Query  542   GMSLYSGEPLGDNKLPLVYGGDA-NST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY+G+PL    +P+VY  +A NST    C  G L+  KV GKIV C+RG +  V KG
Sbjct  353   GVSLYAGKPLPSAPIPIVYAANASNSTAGNLCMPGTLVPEKVAGKIVVCDRGVSARVQKG  412

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               VR A G GM++  TA  G+ + A AH++PA  V E +G  IK Y+ SA +PT  +V  
Sbjct  413   LVVRXAXGAGMVLSNTAANGQELVADAHLLPAAGVGEREGTAIKSYVASATNPTTTVVVA  472

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  EILKPD+IAPGVNILA W+G  GP+G   D RRV
Sbjct  473   GTEVGVRPS-PVVAAFSSRGPNMVTPEILKPDMIAPGVNILASWTGKAGPTGLAADTRRV  531

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AHP WSPAA++SALM
Sbjct  532   GFNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALM  570



>dbj|BAJ97136.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=779

 Score =   443 bits (1140),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 231/395 (58%), Positives = 283/395 (72%), Gaps = 4/395 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GA+ F +G EA  G  +    + KS  D NGHGTHT+S A GS VA+A  F YA+G+
Sbjct  194   KLVGAKFFQRGQEALRGRALG--ADSKSALDTNGHGTHTSSTAGGSAVADAGFFDYARGK  251

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A GMA  ARIAVYK CW  GC  SDIL+AFD+A+ DGV VIS+S+    + P D+Y D+T
Sbjct  252   AVGMAPGARIAVYKACWE-GCASSDILAAFDEAIADGVDVISVSLGAVGSAP-DFYSDTT  309

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF A+  G+VVS  AGN+GPG  TA N+APW LTVGAST++R FP DVVLG+G  FT
Sbjct  310   AVGAFRAVRRGIVVSASAGNSGPGDSTACNIAPWFLTVGASTLNRQFPGDVVLGNGETFT  369

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G +LY+GEPLG  K+PLVYGGD  S  C  G+L A+ V GKIV CE G N    K  AV+
Sbjct  370   GTTLYAGEPLGPTKIPLVYGGDVGSKACEEGKLNATMVAGKIVLCEPGVNARAAKPLAVK  429

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG G I+  T   GE    + HV PAT V  +DG KI +YI +  SPTA I+FRGTV+
Sbjct  430   LAGGAGAILASTQPFGEQALTTPHVHPATAVAFVDGAKIFKYIRAQASPTATIIFRGTVV  489

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G++P +PR+A+FSSRGPN    EI KPDV APGV+ILA W+GA  P+    D RRV++NI
Sbjct  490   GSTPPSPRMAAFSSRGPNLRAPEIFKPDVTAPGVDILAAWTGANSPTELDSDTRRVKYNI  549

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSG+AALLR+A P WSPAAIKSALM
Sbjct  550   ISGTSMSCPHVSGIAALLRQARPEWSPAAIKSALM  584



>ref|XP_004954113.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=776

 Score =   443 bits (1139),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 242/396 (61%), Positives = 291/396 (73%), Gaps = 4/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GA+ F  GYEA  G  I E+ E +SP D NGHGTHT+S AAGS VA+A+ F YA+G+
Sbjct  188   KLVGAKFFNLGYEAAHGGVIEET-ESRSPLDTNGHGTHTSSTAAGSAVADAAFFDYAKGK  246

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV-AIPRAYPEDYYRDS  358
             A GMA  ARIA YK CW+ GC  SDIL AFD+A+KDGV+VIS+S+ A+ RA    +Y D+
Sbjct  247   AVGMAPGARIAAYKACWTRGCTYSDILMAFDEAIKDGVNVISVSLGAVGRA--PQFYSDT  304

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
             TA+GAF A+  G+VVS  AGN GPG  TA NVAPWILTVGASTI+R FPA++VLG+G  F
Sbjct  305   TAVGAFSAVRKGIVVSASAGNAGPGEFTAVNVAPWILTVGASTINRQFPANIVLGNGETF  364

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG SLY+G PLG +K+ LVYGGD  S+ C SG+L  S V GKIV C+ G N    KG AV
Sbjct  365   TGTSLYAGMPLGPSKIALVYGGDVGSSVCESGKLNTSTVAGKIVVCDPGVNGRAAKGEAV  424

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             + A G G I+  +   GE   A+AHV+PAT V      KIK YI +  SP A IVF+GTV
Sbjct  425   KLARGAGAILVSSKAFGEQALATAHVLPATAVTFAAAEKIKNYIRTNASPVATIVFQGTV  484

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             IG +PS+PR+ASFSSRGPN +  EI KPDV APGV+ILA W+G   PS    D RRV+FN
Sbjct  485   IGRTPSSPRMASFSSRGPNFIAPEIFKPDVTAPGVDILAAWTGENSPSELDSDTRRVKFN  544

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSG+AALLR+AHP WSPAAIKSALM
Sbjct  545   IISGTSMSCPHVSGIAALLRQAHPEWSPAAIKSALM  580



>ref|XP_002301156.2| hypothetical protein POPTR_0002s12130g [Populus trichocarpa]
 gb|EEE80429.2| hypothetical protein POPTR_0002s12130g [Populus trichocarpa]
Length=779

 Score =   443 bits (1139),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 289/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA+ F KGYEA  G PI+E++E KSPRD +GHGTHTA+ AAGS V+ ASLFGYA G 
Sbjct  192   KLIGAQYFSKGYEAAFG-PIDETMESKSPRDDDGHGTHTATTAAGSAVSGASLFGYASGI  250

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+A ++AV DGV+V+S+S+        DY RD+ 
Sbjct  251   ARGMATEARVAAYKVCWLGGCFSSDILAAMEKAVADGVNVMSMSIG---GGLSDYTRDTV  307

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A   G++VS  AGN GP   + +NVAPWI TVGA T+DR FPA V LGDG+ ++
Sbjct  308   AIGAFRAAAQGILVSCSAGNGGPSPGSLSNVAPWITTVGAGTLDRDFPAFVSLGDGKKYS  367

Query  542   GMSLYSGEPLGDNKLPLVYGGD-ANST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL D+ +PLVY G+ +NST    C +G LI ++V GKIV C+RGGN  V KG
Sbjct  368   GISLYSGKPLSDSLVPLVYAGNVSNSTSGSLCMTGTLIPAQVAGKIVICDRGGNSRVQKG  427

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+++GG+GMI+  T   GE + A AH++P   V     N IK Y    P P   I   
Sbjct  428   LVVKDSGGLGMILANTELYGEELVADAHLLPTAAVGLRTANAIKNYAFLDPKPMGTIASG  487

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  E+LKPD+IAPGVNILAGW+G  GP+G   D+R V
Sbjct  488   GTKLGVEPS-PVVAAFSSRGPNLVTPEVLKPDLIAPGVNILAGWTGGAGPTGLTNDKRHV  546

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAAL++ AH  WSPAAIKSALM
Sbjct  547   EFNIISGTSMSCPHVSGLAALIKAAHQDWSPAAIKSALM  585



>ref|XP_010412797.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=754

 Score =   442 bits (1137),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 227/397 (57%), Positives = 286/397 (72%), Gaps = 6/397 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR+F KG++  +G   +   E  SPRD +GHGTHT++ AAGS V NAS  GYA G 
Sbjct  174   KLIGARSFSKGFQMASGGGFSSKRESVSPRDVDGHGTHTSTTAAGSAVRNASFLGYAAGT  233

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CWS GC+ SDIL+A D+A+ DGV V+SLS+    A    YYRD+ 
Sbjct  234   ARGMASRARVATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGSA---PYYRDTI  290

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+F AME GV VS  AGN+GP   +  NVAPW++TVGA T+DR FPA   LG+G+  T
Sbjct  291   AIGSFSAMEKGVFVSCSAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKRLT  350

Query  542   GMSLYSGEPLGDNKLPLVY--GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFA  715
             G+SLYSG  +G   L LVY  G  ++S  C  G L ++ V GKIV C+RG N  V+KG  
Sbjct  351   GVSLYSGVGMGTKPLELVYNQGNSSSSNLCLPGSLDSTLVRGKIVVCDRGVNARVEKGAM  410

Query  716   VREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGT  895
             VR+AGG+GMI+  TA +GE + A +H++PA  V +  G+ ++EYI S   PTA +VF+GT
Sbjct  411   VRDAGGLGMIMANTAASGEELVADSHLLPAIAVGKKTGDLLREYIKSDSHPTAVLVFKGT  470

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             V+   PS P VA+FSSRGPN +  EILKPDVI PGVNILAGWS AIGP+G   D RR +F
Sbjct  471   VLDVKPS-PVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKDSRRTQF  529

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NI+SGTSM+CPH+SGLA LL+ AHP WSP+AIKSALM
Sbjct  530   NIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALM  566



>ref|XP_009112373.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=766

 Score =   442 bits (1137),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 229/400 (57%), Positives = 285/400 (71%), Gaps = 11/400 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYE   G P++ES E +SPRD +GHGTHTAS AAGSIV  A+L G+A G 
Sbjct  180   KLIGARFFVHGYEGKYG-PVDESKESRSPRDDDGHGTHTASTAAGSIVEGANLLGFANGT  238

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW   C+ SD+L+  D+A++D V+V+SLS+   +    DY  +  
Sbjct  239   ARGMAYRARVAVYKVCWKPKCFSSDVLAGIDKAIEDNVNVLSLSLGKRK---RDY-TNHI  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+GAF AME G+ VS  AGN GP   + +NVAPWI TVGA TIDR FP  V LG+G+ + 
Sbjct  295   AMGAFSAMEKGIFVSCSAGNDGPSPSSLSNVAPWITTVGAGTIDRDFPTLVTLGNGKSYI  354

Query  542   GMSLYSGEPLGDNKLPLVYGGDA--NSTY---CYSGELIASKVTGKIVFCERGGNLDVDK  706
             G SL+  + L    LP VY G A  N+TY   C SG LI  KV GKIV CE+G N   +K
Sbjct  355   GASLFKKDALPPKLLPFVYAGSASNNATYGKSCLSGTLIPEKVYGKIVMCEKGENGRAEK  414

Query  707   GFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVF  886
             G  V+ AGG+GMI+   A  GE + A AHV+PATNV +  G+ I+ Y+ + P+PT +IV 
Sbjct  415   GEVVKAAGGIGMILANRASRGEELAAYAHVLPATNVGQKAGDIIRRYVMTDPNPTVSIVI  474

Query  887   RGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRR  1066
             +GTV+   PS P +A+FSSRGPNP+   ILKPD+IAPGVNILA W+GA+GPSG   D RR
Sbjct  475   QGTVVNVKPS-PVLAAFSSRGPNPITPNILKPDLIAPGVNILAAWTGALGPSGLASDTRR  533

Query  1067  VEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             VEFNIISGTSM+CPHVSGLAALL+  HP WSPAAI+SALM
Sbjct  534   VEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALM  573



>ref|XP_003589103.1| Subtilisin-like protease [Medicago truncatula]
Length=858

 Score =   444 bits (1143),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 222/399 (56%), Positives = 290/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+E+ E KS RD +GHG+HT + AAGS+VA ASLFG A G 
Sbjct  175   KLIGARFFLKGYEAALG-PIDETTESKSARDDDGHGSHTLTTAAGSVVAEASLFGLASGT  233

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDI +  D+A++DGV+++S+S+        DYYRD  
Sbjct  234   ARGMATEARVAAYKVCWLSGCFTSDIAAGMDKAIEDGVNILSMSIG---GSIMDYYRDII  290

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AM HG++VS+ AGN GP A + +NVAPWI TVGA TIDR FP+ + LG+G+ +T
Sbjct  291   AIGAFTAMSHGILVSSSAGNGGPSAESLSNVAPWITTVGAGTIDRDFPSYITLGNGKTYT  350

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G SLY+G+P  D+ LP+VY G+ + +     C    L +SKV GKIV CERGGN  V+KG
Sbjct  351   GASLYNGKPSSDSLLPVVYAGNVSESSVGYLCIPDSLTSSKVLGKIVICERGGNSRVEKG  410

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+      GE + A +H++PA  + +     +K+Y+ +  +P A +VF 
Sbjct  411   LVVKNAGGVGMILVNNEAYGEELIADSHLLPAAALGQKSSTVLKDYVFTTKNPRAKLVFG  470

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPN L  +ILKPD+IAPGVNILAGW+GA+GP+G  +D+R V
Sbjct  471   GTHLQVQPS-PVVAAFSSRGPNSLTPKILKPDLIAPGVNILAGWTGAVGPTGLALDKRHV  529

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPH SGLAA+++ A+P WSPAAI+SALM
Sbjct  530   NFNIISGTSMSCPHASGLAAIVKGAYPEWSPAAIRSALM  568



>emb|CDY52259.1| BnaC05g52030D [Brassica napus]
Length=736

 Score =   441 bits (1133),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 238/395 (60%), Positives = 280/395 (71%), Gaps = 40/395 (10%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGARAFYKGY                    + HGTHTAS AAGS+VANASL+ YA+G 
Sbjct  181   KLIGARAFYKGYLT------------------HRHGTHTASTAAGSVVANASLYQYARGV  222

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KARIA                     AV DGVHVISLSV     Y  +Y+ DS 
Sbjct  223   ARGMASKARIA---------------------AVADGVHVISLSVGA-NGYAPEYHMDSI  260

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAFGA  HG+VVS  AGN+GPG +TATN+APWILTVGAST DR F A+ + GDG++FT
Sbjct  261   AIGAFGATRHGIVVSCSAGNSGPGPQTATNIAPWILTVGASTTDREFSANAITGDGKVFT  320

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAVR  721
             G SLY+GEPL D++L LVY GD  S  CY G+L AS V GKIV C+RGGN  V+KG AV+
Sbjct  321   GTSLYAGEPLPDSQLSLVYSGDCGSRLCYPGKLNASLVEGKIVLCDRGGNARVEKGSAVK  380

Query  722   EAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTVI  901
              AGG GMI+   A +GE + A +H++PAT V    G++I+EYI  + SPTA I F GT I
Sbjct  381   IAGGAGMILANIAESGEELTADSHLVPATMVGANAGDQIREYIQKSVSPTATISFLGTSI  440

Query  902   GTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFNI  1081
             G SP +PRVA+FSSRGPN +   ILKPDVIAPGVNILAGW+G +GP+   +D RRV+FNI
Sbjct  441   GPSPPSPRVAAFSSRGPNHITPVILKPDVIAPGVNILAGWTGMVGPTDLDIDPRRVQFNI  500

Query  1082  ISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             ISGTSM+CPHVSGLAALLRKAHP WSPAAIKSAL+
Sbjct  501   ISGTSMSCPHVSGLAALLRKAHPDWSPAAIKSALV  535



>ref|XP_002885806.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   441 bits (1134),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 226/397 (57%), Positives = 285/397 (72%), Gaps = 6/397 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR+F KG++  +G   +   E  SPRD +GHGTHT++ AAGS V NAS  GYA G 
Sbjct  172   KLIGARSFSKGFQMASGGGFSSKRESVSPRDVDGHGTHTSTTAAGSAVGNASFLGYAAGT  231

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+A YK+CWS GC+ SDIL+A D+A+ DGV V+SLS+    A    YYRD+ 
Sbjct  232   ARGMATHARVATYKVCWSSGCFGSDILAAMDRAILDGVDVLSLSLGGGSA---PYYRDTI  288

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+F AME GV VS  AGN+GP   +  NVAPW++TVGA T+DR FPA   LG+G+  T
Sbjct  289   AIGSFSAMERGVFVSCSAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKRLT  348

Query  542   GMSLYSGEPLGDNKLPLVY--GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFA  715
             G+SLYSG  +G   L LVY  G  ++S  C  G L +  V GKIV C+RG N  V+KG  
Sbjct  349   GVSLYSGVGMGTKPLELVYNKGNSSSSNLCLPGSLDSGIVRGKIVVCDRGVNARVEKGAV  408

Query  716   VREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGT  895
             VR+AGG+GMI+  TA +GE + A +H++PA  V +  G+ ++EY+ S  +PTA +VF+GT
Sbjct  409   VRDAGGLGMIMANTAASGEELVADSHLLPAVAVGKKTGDLLREYVKSDSNPTAVLVFKGT  468

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             V+   PS P VA+FSSRGPN +  EILKPDVI PGVNILAGWS AIGP+G   D RR +F
Sbjct  469   VLDVKPS-PVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKDSRRTQF  527

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NI+SGTSM+CPH+SGLA LL+ AHP WSP+AIKSALM
Sbjct  528   NIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALM  564



>ref|XP_010541995.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=765

 Score =   441 bits (1135),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 227/397 (57%), Positives = 284/397 (72%), Gaps = 6/397 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR+F KG++  +G   +   E  SPRD +GHGTHT+S AAGS V NAS  GYA G 
Sbjct  186   KLIGARSFSKGFQMASGGGFSNKRESVSPRDVDGHGTHTSSTAAGSAVRNASFLGYATGT  245

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA ++R+A YK+CWS GC+ SDIL+  D+A+ DGV V+SLS+    A    YYRD+ 
Sbjct  246   ARGMATRSRVATYKVCWSTGCFGSDILAGMDRAILDGVDVLSLSLGGGSA---PYYRDTI  302

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+ VS  AGN+GP   +  NVAPWI+TVGA T+DR FPA  VL +G    
Sbjct  303   AIGAFSAMEKGIFVSCSAGNSGPTKASIANVAPWIMTVGAGTLDRDFPAYAVLDNGDRIK  362

Query  542   GMSLYSGEPLGDNKLPLVY--GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFA  715
             G+SLYSGE +G   L LVY  G  ++S  C  G L  + V GKIV C+RG N  V+KG  
Sbjct  363   GVSLYSGEGMGTKPLALVYNKGNSSSSNLCLPGSLDPTLVRGKIVVCDRGLNARVEKGAV  422

Query  716   VREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGT  895
             VR+AGG GMI+  TA +GE + A +H++PA  V    G+ I+EY+ S+ +PTA +VFRGT
Sbjct  423   VRDAGGAGMILANTAASGEELVADSHLLPAMAVGRKIGDLIREYMKSSKNPTAVLVFRGT  482

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             V+G  PS P VA+FSSRGPN +  +ILKPDVI PGVNILAGWS A+GP+G   D RR +F
Sbjct  483   VLGVRPS-PVVAAFSSRGPNMVTPQILKPDVIGPGVNILAGWSEAVGPTGQEKDTRRTQF  541

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NI+SGTSM+CPH+SGLAA L+ AHP WSP+AIKSALM
Sbjct  542   NIMSGTSMSCPHISGLAAFLKAAHPEWSPSAIKSALM  578



>ref|XP_009112375.1| PREDICTED: subtilisin-like protease isoform X2 [Brassica rapa]
Length=758

 Score =   441 bits (1134),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 224/400 (56%), Positives = 287/400 (72%), Gaps = 11/400 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G P++ES E KSPRD +GHGTHTAS AAGS+V  A+L G+A G 
Sbjct  180   KLIGARFFVRGYEAING-PVDESKESKSPRDDDGHGTHTASTAAGSVVEGANLLGFANGT  238

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARG+A +AR+AVYK+CW  GC+ SDIL+  D+A++D V+++S+S++    Y    Y D  
Sbjct  239   ARGIAYRARVAVYKVCWQPGCFSSDILAGIDKAIEDNVNILSISLSGITTY----YTDDI  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+ VS  AGN GP   + TN+APWI TVGA T+DR FPA  +LG+G+ +T
Sbjct  295   AIGAFAAMERGIFVSCSAGNFGPSPFSVTNIAPWITTVGAGTLDRDFPALAILGNGKNYT  354

Query  542   GMSLYSGE-PLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDK  706
             G+SL+ G+  L    LP +Y G+A+       C+ G LI  KV GKIV C+ GG      
Sbjct  355   GVSLFKGDDELPAKLLPFIYAGNASDDAIGYLCFPGTLIPEKVKGKIVMCDTGGVAPAMI  414

Query  707   GFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVF  886
             G  V+ AGG+GMI+   AG GE + A AH +PAT V E  G+ I+ Y+ + P+PTA+IV 
Sbjct  415   GEVVKSAGGLGMIIANLAGRGEEVQAEAHFLPATAVGEKAGDIIRRYVLTDPNPTASIVI  474

Query  887   RGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRR  1066
             +GTV+   PS P +A+FSSRGPNP+   ILKPD+IAPGVNILA W+G++GP+G   D RR
Sbjct  475   QGTVVNVKPS-PVLAAFSSRGPNPITPNILKPDLIAPGVNILAAWTGSLGPTGLASDTRR  533

Query  1067  VEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             VEFNIISGTSM+CPHVSGLAALL+  HP WSPAAI+SALM
Sbjct  534   VEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALM  573



>ref|XP_009112374.1| PREDICTED: subtilisin-like protease isoform X1 [Brassica rapa]
Length=758

 Score =   440 bits (1132),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 224/400 (56%), Positives = 287/400 (72%), Gaps = 11/400 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G P++ES E KSPRD +GHGTHTAS AAGS+V  A+L G+A G 
Sbjct  180   KLIGARFFVRGYEAING-PVDESKESKSPRDDDGHGTHTASTAAGSVVEGANLLGFANGT  238

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARG+A +AR+AVYK+CW  GC+ SDIL+  D+A++D V+++S+S++    Y    Y D  
Sbjct  239   ARGIAYRARVAVYKVCWQPGCFSSDILAGIDKAIEDNVNILSISLSGITTY----YTDDI  294

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME G+ VS  AGN GP   + TN+APWI TVGA T+DR FPA  +LG+G+ +T
Sbjct  295   AIGAFAAMERGIFVSCSAGNFGPSPFSVTNIAPWITTVGAGTLDRDFPALAILGNGKNYT  354

Query  542   GMSLYSGE-PLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDK  706
             G+SL+ G+  L    LP +Y G+A+       C+ G LI  KV GKIV C+ GG      
Sbjct  355   GVSLFKGDDELPAKLLPFIYAGNASDDAIGYLCFPGTLIPEKVKGKIVMCDTGGVAPAMI  414

Query  707   GFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVF  886
             G  V+ AGG+GMI+   AG GE + A AH +PAT V E  G+ I+ Y+ + P+PTA+IV 
Sbjct  415   GEVVKSAGGLGMIIANLAGRGEEVQAEAHFLPATAVGEKAGDIIRRYVLTDPNPTASIVI  474

Query  887   RGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRR  1066
             +GTV+   PS P +A+FSSRGPNP+   ILKPD+IAPGVNILA W+G++GP+G   D RR
Sbjct  475   QGTVVNVKPS-PVLAAFSSRGPNPITPNILKPDLIAPGVNILAAWTGSLGPTGLASDTRR  533

Query  1067  VEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             VEFNIISGTSM+CPHVSGLAALL+  HP WSPAAI+SALM
Sbjct  534   VEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALM  573



>gb|EYU25500.1| hypothetical protein MIMGU_mgv1a001697mg [Erythranthe guttata]
Length=771

 Score =   441 bits (1133),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 229/399 (57%), Positives = 291/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G PI+E+VE KSPRD +GHGTHT++ A GS V  A+LFG+A G 
Sbjct  183   KLIGARFFSQGYEAAFG-PIDETVESKSPRDDDGHGTHTSTTAGGSAVVGANLFGFAAGT  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+A YK+CW  GC  SDIL+A ++A++DGV ++SLS+    +   DY+RD+ 
Sbjct  242   ARGMARHARLAAYKVCWRGGCISSDILAAMEKAIEDGVDILSLSLGGSLS---DYFRDTV  298

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A   G++VS  AGN+GP   + +NVAPWI TVGA T+DR FP+ V LG+G+ F 
Sbjct  299   AIGAFAATAKGILVSCSAGNSGPSPESLSNVAPWITTVGAGTLDREFPSTVSLGNGKKFV  358

Query  542   GMSLYSGEPLGDNKLPLVYGGDA----NSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G SLY+G+PL  + +PLVY  +A    N   C +G LI  KV GKIV C+RG +   +KG
Sbjct  359   GASLYNGKPLPGSLIPLVYARNASSASNGNLCLTGSLIPEKVKGKIVICDRGLSPRAEKG  418

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               VREAGGVG+I+  T   GE + A AH IP+  V +  G++IK+Y++S P+PTA I   
Sbjct  419   LVVREAGGVGVILSNTYTYGEELVADAHFIPSAAVGQTAGDEIKKYVSSDPNPTATIASG  478

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VASFSSRGPN +  EILKPD+IAPGVNILA W+G +GP+G   D RRV
Sbjct  479   GTQLGVQPS-PVVASFSSRGPNTITPEILKPDLIAPGVNILAAWTGNVGPTGLPEDTRRV  537

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +FNIISGTSM+CPHVSGLAAL++ AHP WSPAAI+SALM
Sbjct  538   DFNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIRSALM  576



>dbj|BAJ86110.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   441 bits (1133),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 287/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G P++ S E +SPRD +GHGTHT+S AAG+ VA+A LFG+A G 
Sbjct  182   KLIGARFFNRGYEAAMG-PMDTSRESRSPRDDDGHGTHTSSTAAGAAVADADLFGFASGT  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KAR+AVYK+CW  GC+ SDIL+  D AV DG  V+SLS+    A   DY RDS 
Sbjct  241   ARGMAPKARVAVYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLGGGSA---DYARDSV  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME  V+VS  AGN GPG+ T +NVAPWI TVGA T+DR FPA V+LG+G+ +T
Sbjct  298   AIGAFAAMEQNVLVSCSAGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVLLGNGKNYT  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDA-NST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY+G+       PL+Y G+A NST    C  G L   KV GKIV C+RG +  V KG
Sbjct  358   GVSLYAGKAPPTTPTPLIYAGNASNSTSGNLCMPGTLSPEKVQGKIVVCDRGISARVQKG  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F VR+AGG GM++  TA  G+ + A AH++PA  V E +G+ IK YI SA  PTA IV  
Sbjct  418   FVVRDAGGAGMVLANTAANGQELVADAHLLPAAGVGEKEGSAIKSYIASAAKPTATIVIA  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPN +  EILKPD+I PGVNILA W+G  GP+G   D RRV
Sbjct  478   GTQVNVRPS-PLVAAFSSRGPNMITPEILKPDIIGPGVNILAAWTGKAGPTGLAADTRRV  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AHP WSPAA++SALM
Sbjct  537   SFNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALM  575



>ref|XP_011017137.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=779

 Score =   440 bits (1132),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 232/399 (58%), Positives = 287/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA+ F KGYEA  G PI+E++E KSPRD +GHGTHTA+ AAGS V+ ASLFGYA G 
Sbjct  192   KLIGAQYFSKGYEASFG-PIDETMESKSPRDDDGHGTHTATTAAGSAVSGASLFGYASGI  250

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+A ++AV DGV+V+S+S+        DY RD+ 
Sbjct  251   ARGMATEARVAAYKVCWLGGCFSSDILAAMEKAVADGVNVMSMSIG---GGLSDYTRDTV  307

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A   G++VS  AGN GP   + +NVAPWI TVGA T+DR FPA V LG+GR  +
Sbjct  308   AIGAFRAAAQGILVSCSAGNGGPSPGSLSNVAPWITTVGAGTLDRDFPAYVSLGNGRKHS  367

Query  542   GMSLYSGEPLGDNKLPLVYGGD-ANST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLYSG+PL D+ +PLVY G+ +NST    C  G LI ++V GKIV C+RGGN  V KG
Sbjct  368   GISLYSGKPLSDSLMPLVYAGNVSNSTSGSLCMIGTLIPAQVAGKIVICDRGGNSRVQKG  427

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+++GG+GMI+  T   GE + A AH++P   V     N IK Y    P P   I   
Sbjct  428   LVVKDSGGLGMILANTELYGEELVADAHLLPTAAVGLRTANAIKNYAFLDPKPVGTIASG  487

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN +  E+LKPD+IAPGVNILAGW+G  GP+G   D+R V
Sbjct  488   GTKLGVEPS-PVVAAFSSRGPNLVTPEVLKPDLIAPGVNILAGWTGGAGPTGLTNDKRHV  546

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNIISGTSM+CPHVSGLAAL++ AH  WSPAAIKSALM
Sbjct  547   EFNIISGTSMSCPHVSGLAALIKAAHQDWSPAAIKSALM  585



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score =   439 bits (1130),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 228/398 (57%), Positives = 287/398 (72%), Gaps = 7/398 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYE-AFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGAR+F KG++ A  G   +   E  SPRD +GHGTHT++ AAGS V NAS  GYA G
Sbjct  176   KLIGARSFSKGFQMASGGGGFSSKRESVSPRDVDGHGTHTSTTAAGSAVRNASFLGYAAG  235

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA +AR+A YK+CWS GC+ SDIL+A D+A+ DGV V+SLS+    A    YYRD+
Sbjct  236   TARGMATRARVATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGSA---PYYRDT  292

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIG+F AME GV VS  AGN+GP   +  NVAPW++TVGA T+DR FPA   LG+G+  
Sbjct  293   IAIGSFSAMEKGVFVSCSAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKRL  352

Query  539   TGMSLYSGEPLGDNKLPLVY--GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGF  712
             TG+SLYSG  +G   L LVY  G  ++S  C  G L +S V GKIV C+RG N  V+KG 
Sbjct  353   TGVSLYSGVGMGTKPLELVYNQGNSSSSNLCLPGSLDSSIVRGKIVVCDRGVNARVEKGA  412

Query  713   AVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRG  892
              VR+AGG+GMI+  TA +GE + A +H++PA  V +  G+ ++EY+ S  +PTA +VF+G
Sbjct  413   VVRDAGGLGMIMANTAASGEELVADSHLLPAIAVGKKTGDLLREYVKSDSNPTAVLVFKG  472

Query  893   TVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVE  1072
             TV+   PS P VA+FSSRGPN +  EILKPDVI PGVNILAGWS AIGP+G   D RR +
Sbjct  473   TVLDVKPS-PVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKDSRRTQ  531

Query  1073  FNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             FNI+SGTSM+CPH+SGLA LL+ AHP WSP+AIKSALM
Sbjct  532   FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALM  569



>gb|EYU37942.1| hypothetical protein MIMGU_mgv1a001727mg [Erythranthe guttata]
Length=768

 Score =   440 bits (1131),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 235/404 (58%), Positives = 288/404 (71%), Gaps = 10/404 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTG-----SPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFG  166
             KI+GAR F KG+EA +G       IN++VE KSPRD +GHGTHTAS AAG     +S+ G
Sbjct  172   KIVGARFFSKGHEAASGFGGIVGGINDTVEFKSPRDADGHGTHTASTAAGRHAFKSSMEG  231

Query  167   YAQGEARGMAIKARIAVYKICW-SLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPED  343
             YA G A+G+A KAR+AVYK+CW S GC+DSDIL+AFD AV DGV VIS+S+         
Sbjct  232   YASGIAKGVAPKARLAVYKVCWRSAGCFDSDILAAFDAAVNDGVDVISISIGGGEGISSP  291

Query  344   YYRDSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLG  523
             YY D  AIGA+GA+  GV VS+ AGN GP   + TN+APW+ TVGA TIDR FPADV+L 
Sbjct  292   YYLDPIAIGAYGAVSRGVFVSSSAGNDGPNGMSVTNLAPWLTTVGAGTIDRNFPADVILS  351

Query  524   DGRIFTGMSLYSGEPLGDNKLPLVYGGDA---NSTYCYSGELIASKVTGKIVFCERGGNL  694
             DGR F+G+SLYSGEPL     PL+Y G +   +++ C    L  + V GKIV C+RG + 
Sbjct  352   DGRKFSGVSLYSGEPLNGKMYPLIYPGKSGILSASLCMENSLDPNLVKGKIVICDRGSSP  411

Query  695   DVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTA  874
              V KG  V++AGGVGMI+   A  GE +   AH+IPA  V   +G++IK Y++S P  TA
Sbjct  412   RVAKGLVVKKAGGVGMILANGASNGEGLVGDAHLIPACAVGSNEGDEIKAYLSSNPKATA  471

Query  875   AIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVM  1054
              I F+GTVIG  P AP VASFS+RGPN L  EILKPD+IAPGVNILA W+ AIGP+G   
Sbjct  472   TINFQGTVIGIKP-APVVASFSARGPNGLNPEILKPDLIAPGVNILAAWTEAIGPTGLDS  530

Query  1055  DQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             D R+ EFNI+SGTSMACPHVSG AALL+ AHP WSPAAI+SA+M
Sbjct  531   DTRKSEFNILSGTSMACPHVSGAAALLKSAHPDWSPAAIRSAMM  574



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score =   439 bits (1130),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 231/400 (58%), Positives = 287/400 (72%), Gaps = 9/400 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTG--SPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQ  175
             K+IGAR+F KGY+  +G  S   +  E  SPRDR+GHGTHTAS AAGS VANASL GYA 
Sbjct  178   KLIGARSFSKGYQMSSGGGSIGKQRKEVVSPRDRDGHGTHTASTAAGSHVANASLLGYAS  237

Query  176   GEARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRD  355
             G ARGMA +AR+A YK+CWS GC+ SDIL+  D+A+ DGV V+S+S+    A    YY D
Sbjct  238   GTARGMATRARVAAYKVCWSTGCFGSDILAGIDRAISDGVDVLSMSLGGGSA---PYYHD  294

Query  356   STAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRI  535
             + AIGAF A+E G+ VS  AGN+GP   +  NVAPWI+TVGA T+DR FPA  VLG+   
Sbjct  295   TIAIGAFSAVEKGIFVSCSAGNSGPSRASLANVAPWIMTVGAGTLDRDFPAYAVLGNKNR  354

Query  536   FTGMSLYSGEPLGDNKLPLVYGGDANST---YCYSGELIASKVTGKIVFCERGGNLDVDK  706
             FTG+SLYSG  +GD  + LVY   ANS+    C +G L    V GK+V C+RG N  V+K
Sbjct  355   FTGVSLYSGPGMGDKPVGLVYSKGANSSSGNLCLAGSLEPEVVRGKVVLCDRGVNARVEK  414

Query  707   GFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVF  886
             G  VREAGG+GMI+  TA +GE + A +H+ PA  V    G++I+EY+ S P+PTA + F
Sbjct  415   GAVVREAGGIGMILANTAASGEELVADSHLSPAVAVGMKVGDQIREYVRSDPNPTALLSF  474

Query  887   RGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRR  1066
              GTV+   PS P VA+FSSRGPN +  +ILKPDVI PGVNILA WS AIGP+G   D R+
Sbjct  475   GGTVLNVRPS-PVVAAFSSRGPNLVTPQILKPDVIGPGVNILAAWSEAIGPTGLEKDTRK  533

Query  1067  VEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              +FNI+SGTSM+CPH+SGLAALL+ AHP WSP+AIKSALM
Sbjct  534   TKFNIMSGTSMSCPHISGLAALLKAAHPDWSPSAIKSALM  573



>gb|KDP41644.1| hypothetical protein JCGZ_16051 [Jatropha curcas]
Length=747

 Score =   439 bits (1129),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 231/399 (58%), Positives = 289/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F +GYEA  G P++E+ E KSPRD +GHGTHTA+ AAGS V+ ASLFG+A G 
Sbjct  160   KLVGARYFSRGYEAAFG-PVDETAESKSPRDDDGHGTHTATTAAGSAVSGASLFGFATGI  218

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIA YK+CW  GC+ SDI++A ++AV+DGV+VIS+S+        DYYRD+ 
Sbjct  219   ARGMAPQARIAAYKVCWLGGCFGSDIVAAMEKAVEDGVNVISMSIG---GGLSDYYRDTV  275

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A GAF A   G++VS  AGN GP   + TN+APWI TVGA T+DR FPA V LG+G+ ++
Sbjct  276   ATGAFTATAQGILVSCSAGNGGPSPGSLTNLAPWITTVGAGTLDRDFPAYVTLGNGKNYS  335

Query  542   GMSLYSGEPLGDNKLPLVYGGD-ANST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G SLY+G+   D+ +PLVY G+  NST    C S  LI ++V GKIV C+RGGN  V KG
Sbjct  336   GASLYNGKASIDSLVPLVYAGNITNSTSGSLCMSDSLIPAQVAGKIVICDRGGNSRVQKG  395

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGGVGMI+  T   GE + A AH++P   V +  G+ IK Y  S P P A I   
Sbjct  396   LEVKNAGGVGMILANTDLYGEELVADAHLLPTAAVGQKSGDIIKSYAFSDPKPVARIASG  455

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN L  E+LKPD+IAPGVNILAGW+GA+GP+G   D+RRV
Sbjct  456   GTHLGIVPS-PVVAAFSSRGPNLLTPEVLKPDLIAPGVNILAGWTGAVGPTGLTDDKRRV  514

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPH+SGLAALL+ AHP WSP AI+SALM
Sbjct  515   NFNIISGTSMSCPHISGLAALLKAAHPDWSPTAIRSALM  553



>ref|XP_010488783.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=755

 Score =   439 bits (1130),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 227/398 (57%), Positives = 287/398 (72%), Gaps = 7/398 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYE-AFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGAR+F KG++ A  G   +   E  SPRD +GHGTHT++ AAGS V NAS  GYA G
Sbjct  174   KLIGARSFSKGFQMASGGGGFSSKRESVSPRDVDGHGTHTSTTAAGSAVRNASFLGYAAG  233

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA +AR+A YK+CWS GC+ SDIL+A D+A+ DGV V+SLS+    A    YYRD+
Sbjct  234   TARGMATRARVATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGSA---PYYRDT  290

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIG+F AME GV VS  AGN+GP   +  NVAPW++TVGA T+DR FPA   LG+G+  
Sbjct  291   IAIGSFSAMEKGVFVSCSAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKRL  350

Query  539   TGMSLYSGEPLGDNKLPLVY--GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGF  712
             TG+SLYSG  +G   L LVY  G  ++S  C  G L ++ V GKIV C+RG N  V+KG 
Sbjct  351   TGVSLYSGVGMGTKPLELVYNQGNSSSSNLCLPGSLDSTLVRGKIVVCDRGVNARVEKGA  410

Query  713   AVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRG  892
              VR+AGG+GMI+  TA +GE + A +H++PA  V +  G+ ++EY+ S  +PTA +VF+G
Sbjct  411   MVRDAGGLGMIIANTAASGEELVADSHLLPAIAVGKKTGDLLREYVKSDSNPTALLVFKG  470

Query  893   TVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVE  1072
             TV+   PS P VA+FSSRGPN +  EILKPDVI PGVNILAGWS AIGP+G   D RR +
Sbjct  471   TVLDVKPS-PVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKDSRRTQ  529

Query  1073  FNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             FNI+SGTSM+CPH+SGLA LL+ AHP WSP+AIKSALM
Sbjct  530   FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALM  567



>ref|XP_010467108.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=756

 Score =   439 bits (1129),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 227/398 (57%), Positives = 287/398 (72%), Gaps = 7/398 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYE-AFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGAR+F KG++ A  G   +   E  SPRD +GHGTHT++ AAGS V NAS  GYA G
Sbjct  175   KLIGARSFSKGFQMASGGGGFSSKRESVSPRDVDGHGTHTSTTAAGSAVRNASFLGYAAG  234

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA +AR+A YK+CWS GC+ SDIL+A D+A+ DGV V+SLS+    A    YYRD+
Sbjct  235   TARGMATRARVATYKVCWSTGCFGSDILAAMDRAILDGVDVLSLSLGGGSA---PYYRDT  291

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIG+F AME GV VS  AGN+GP   +  NVAPW++TVGA T+DR FPA   LG+G+  
Sbjct  292   IAIGSFSAMEKGVFVSCSAGNSGPTRASVANVAPWVMTVGAGTLDRDFPAFANLGNGKRL  351

Query  539   TGMSLYSGEPLGDNKLPLVY--GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGF  712
             TG+SLYSG  +G   L LVY  G  ++S  C  G L ++ V GKIV C+RG N  V+KG 
Sbjct  352   TGVSLYSGVGMGTKPLELVYNQGNSSSSNLCLPGSLDSTLVRGKIVVCDRGVNARVEKGA  411

Query  713   AVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRG  892
              VR+AGG+GMI+  TA +GE + A +H++PA  V +  G+ ++EY+ S  +PTA +VF+G
Sbjct  412   MVRDAGGLGMIIANTAASGEELVADSHLLPAIAVGKKTGDLLREYVKSDSNPTALLVFKG  471

Query  893   TVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVE  1072
             TV+   PS P VA+FSSRGPN +  EILKPDVI PGVNILAGWS AIGP+G   D RR +
Sbjct  472   TVLDVKPS-PVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLEKDSRRTQ  530

Query  1073  FNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             FNI+SGTSM+CPH+SGLA LL+ AHP WSP+AIKSALM
Sbjct  531   FNIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALM  568



>dbj|BAJ88205.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=811

 Score =   440 bits (1132),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 238/399 (60%), Positives = 287/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G P++ S E +SPRD +GHGTHT+S AAG+ VA+A LFG+A G 
Sbjct  182   KLIGARFFNRGYEAAMG-PMDTSRESRSPRDDDGHGTHTSSTAAGAAVADADLFGFASGT  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KAR+AVYK+CW  GC+ SDIL+  D AV DG  V+SLS+    A   DY RDS 
Sbjct  241   ARGMAPKARVAVYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLGGGSA---DYARDSV  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME  V+VS  AGN GPG+ T +NVAPWI TVGA T+DR FPA V+LG+G+ +T
Sbjct  298   AIGAFAAMEQNVLVSCSAGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVLLGNGKNYT  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDA-NST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY+G+       PL+Y G+A NST    C  G L   KV GKIV C+RG +  V KG
Sbjct  358   GVSLYAGKAPPTTPTPLIYAGNASNSTSGNLCMPGTLSPEKVQGKIVVCDRGISARVQKG  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F VR+AGG GM++  TA  G+ + A AH++PA  V E +G+ IK YI SA  PTA IV  
Sbjct  418   FVVRDAGGAGMVLANTAANGQELVADAHLLPAAGVGEKEGSAIKSYIASAAKPTATIVIA  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPN +  EILKPD+I PGVNILA W+G  GP+G   D RRV
Sbjct  478   GTQVNVRPS-PLVAAFSSRGPNMITPEILKPDIIGPGVNILAAWTGKAGPTGLAADTRRV  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AHP WSPAA++SALM
Sbjct  537   SFNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALM  575



>gb|ADD09584.1| proteinase inhibitor [Trifolium repens]
Length=767

 Score =   439 bits (1129),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 227/399 (57%), Positives = 293/399 (73%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F KGYEA  G PI+E  E KSPRD +GHG+HT++ AAGS VA ASLFG+A G 
Sbjct  180   KLVGARFFAKGYEAAFG-PIDEKAESKSPRDDDGHGSHTSTTAAGSAVAGASLFGFASGT  238

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             A+GMA +AR+A YK+CW  GC+ +DI +A D+A++DGV+++S+S+        DYY+D+ 
Sbjct  239   AKGMATQARVAAYKVCWLGGCFTTDIAAAIDKAIEDGVNILSMSIG---GGLMDYYKDTV  295

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             A+G F AMEHG++VS+ AGN GP   T  NVAPWI TVGA TIDR FPA + LG+G+ + 
Sbjct  296   ALGTFAAMEHGILVSSSAGNGGPSRATLANVAPWITTVGAGTIDRDFPAYITLGNGKRYN  355

Query  542   GMSLYSGEPLGDNKLPLVY----GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY+G+   D+ LPLVY    G D+  + C    LI SKV+GKIV C+RGGN   +K 
Sbjct  356   GVSLYNGKLPPDSPLPLVYAANVGQDSTDSLCTEDSLIPSKVSGKIVICDRGGNPRAEKS  415

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG+GMI+      GE + A ++++PA  + E   N++K+Y++SAP+PTA I F 
Sbjct  416   LVVKRAGGIGMILANKEDYGEELVADSYLLPAAALGEKASNEVKKYVSSAPNPTAKIAFG  475

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPN L  +ILKPD+IAPGVNILAGWSG +GP+G   D R V
Sbjct  476   GTQLGVQPS-PVVAAFSSRGPNILTPKILKPDLIAPGVNILAGWSGKVGPTGLAADTRHV  534

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  535   SFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAIRSALM  573



>ref|XP_009772256.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=799

 Score =   440 bits (1131),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 239/412 (58%), Positives = 281/412 (68%), Gaps = 24/412 (6%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGAR F  GYEA  G  +N S + KS RD +GHGTHTASIAAG  V +ASL G+A+G 
Sbjct  200   KIIGARYFTAGYEARIGRIMNSSTDIKSARDSDGHGTHTASIAAGRAVEDASLLGFAKGI  259

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV---AIPRAYPEDYYR  352
             A G+A KARIA YK+CW  GC DSDIL+AFD+AV DGV+VIS+S+   A+P      Y  
Sbjct  260   AVGIAPKARIAAYKVCWKRGCMDSDILAAFDKAVDDGVNVISISIGGGAVP------YNL  313

Query  353   DSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGR  532
             D  AIG+FGAME G++VS  AGN GP   T TNVAPWI TVGASTIDR FPAD+VLG+G+
Sbjct  314   DPIAIGSFGAMEKGILVSASAGNEGPRPMTVTNVAPWITTVGASTIDRKFPADLVLGNGK  373

Query  533   IFTGMSLYSGEPLGDNKLPLVYGGDA--------------NSTYCYSGELIASKVTGKIV  670
               TG SLYSG+PL D +LPLVYGG+               ++  C    L   +V GKIV
Sbjct  374   RITGASLYSGDPLPDKQLPLVYGGNVSVGIRNGARHSSSFSAASCMPDSLDKERVHGKIV  433

Query  671   FCERGGNLDVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYI  850
              C+RGG   V KG  V EAGG G+IV   A  GE + A AH+IP   V E  GN I++YI
Sbjct  434   VCDRGGTPRVAKGEVVNEAGGAGVIVANVAPMGEGLIADAHLIPGLGVTESAGNIIRDYI  493

Query  851   NSAPSPTAAIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGA  1030
             NS  +PTA + F GT +G  P AP VASFSSRGPN     +LKPDVIAPGVNILA W   
Sbjct  494   NSNNNPTATMAFYGTQLGVKP-APVVASFSSRGPNAESIFVLKPDVIAPGVNILAAWPDG  552

Query  1031  IGPSGSVMDQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             + P+    D RR +FNI SGTSM+CPHVSGLAALL+ AHP WSPA I+SALM
Sbjct  553   VAPTELSSDTRRTQFNIESGTSMSCPHVSGLAALLKGAHPDWSPAMIRSALM  604



>ref|XP_009102354.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=763

 Score =   439 bits (1128),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 226/397 (57%), Positives = 284/397 (72%), Gaps = 6/397 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR+F KG++  +G   +   E  SPRD +GHGTHT+S AAGS V NAS  GYA G 
Sbjct  183   KLVGARSFSKGFQMSSGGGFSTKRESVSPRDVDGHGTHTSSTAAGSAVTNASFLGYAAGT  242

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+A YK+CWS GC+ SDIL+A D+A+ DGV V+SLS+    A    YYRD+ 
Sbjct  243   ARGMATGARVATYKVCWSSGCFGSDILAAMDRAILDGVDVLSLSLGGGSA---PYYRDTI  299

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+F AME GV VS  AGN+GP   +  NVAPW++TVGA T+DR FPA   LG+G+   
Sbjct  300   AIGSFSAMEKGVFVSCSAGNSGPTRSSVANVAPWVMTVGAGTLDRDFPAYANLGNGKRLV  359

Query  542   GMSLYSGEPLGDNKLPLVY--GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFA  715
             G+SLYSGE +G   L LVY  G  ++S  C    L  + V GKIV C+RG N  V+KG  
Sbjct  360   GVSLYSGEGMGTKPLELVYNKGNSSSSNLCLPASLDPTTVRGKIVVCDRGVNARVEKGAV  419

Query  716   VREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGT  895
             VR+AGG+GMI+  TA +GE + A +H++PA  V +  G+ ++EYI S  +PTA +VF+GT
Sbjct  420   VRDAGGLGMIMANTAASGEELVADSHLLPAIAVGKKTGDLLREYIKSDSNPTALLVFKGT  479

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             V+   PS P VA+FSSRGPN +  EILKPDVI PGVNILAGWS AIGP+G   D RR +F
Sbjct  480   VLDVRPS-PVVAAFSSRGPNTVTPEILKPDVIGPGVNILAGWSDAIGPTGLDKDSRRTQF  538

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NI+SGTSM+CPH+SGLA LL+ AHP WSP+AIKSALM
Sbjct  539   NIMSGTSMSCPHISGLAGLLKAAHPEWSPSAIKSALM  575



>ref|XP_009782030.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score =   439 bits (1128),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 225/396 (57%), Positives = 288/396 (73%), Gaps = 5/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYE-AFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGAR F KGY+ + +GS  N+  +P+SPRD++GHGTHT+S AAG+ VANASL GYA G
Sbjct  183   KLIGARFFSKGYQMSASGSFTNQPRQPESPRDQDGHGTHTSSTAAGAPVANASLLGYASG  242

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA +AR+A YK+CW  GC+ SDIL+  ++A+ DGV V+SLS+         YYRD+
Sbjct  243   VARGMAPRARVATYKVCWPTGCFGSDILAGMERAILDGVDVLSLSLGGGSG---PYYRDT  299

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAF AME G+VVS  AGN+GP   +  N APWI+TVGA TIDR FPA   LG+G+  
Sbjct  300   IAIGAFSAMEKGIVVSCSAGNSGPAKGSLANTAPWIMTVGAGTIDRDFPAFATLGNGKKI  359

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG+SLYSG+ +G   +PLVY  D++++ C  G L    V GKIV C+RG N  V+KG  V
Sbjct  360   TGVSLYSGKGMGKKVVPLVYSTDSSASLCLPGSLDPKMVRGKIVLCDRGTNARVEKGLVV  419

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             +EAGGVGMI+  TA +GE + A +H++PA  V    G+ I++Y+ S  +P A + F GTV
Sbjct  420   KEAGGVGMILANTAESGEELVADSHLLPAVAVGRKLGDFIRQYVKSEKNPAAVLSFGGTV  479

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             +   PS P VA+FSSRGPN +  +ILKPDVI PGVNILA WS A+GP+G   D RR +FN
Sbjct  480   VNVKPS-PVVAAFSSRGPNTVTPQILKPDVIGPGVNILAAWSEAVGPTGLEKDTRRTKFN  538

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             I+SGTSM+CPH+SGLAALL+ AHP WSP+AIKSALM
Sbjct  539   IMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALM  574



>ref|NP_001050634.1| Os03g0605300 [Oryza sativa Japonica Group]
 gb|AAR87229.1| putaive subtilisin-like proteinase [Oryza sativa Japonica Group]
 gb|AAT78773.1| putative serine protease [Oryza sativa Japonica Group]
 gb|ABF97524.1| cucumisin-like serine protease, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12548.1| Os03g0605300 [Oryza sativa Japonica Group]
 gb|EAZ27735.1| hypothetical protein OsJ_11683 [Oryza sativa Japonica Group]
Length=765

 Score =   438 bits (1127),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 285/399 (71%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F +GYEA  G P++ + E +SPRD +GHGTHT+S AAG+ V+ ASL G+A G 
Sbjct  173   KLVGARFFNRGYEAAMG-PMDTTRESRSPRDDDGHGTHTSSTAAGAAVSGASLLGFASGT  231

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+AVYK+CW  GC+ SDIL+  D AV DG  V+SLS+    A   DY RDS 
Sbjct  232   ARGMAPRARVAVYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLGGGAA---DYARDSV  288

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME  V+VS  AGN GPG  T +NVAPWI TVGA T+DR FPA V LG+G+ +T
Sbjct  289   AIGAFAAMEQNVLVSCSAGNAGPGTSTLSNVAPWITTVGAGTLDRDFPAYVSLGNGKNYT  348

Query  542   GMSLYSGEPLGDNKLPLVYGGDA-NST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY+G+ L    LP+VY  +A NST    C  G L   KV GKIV C+RG +  V KG
Sbjct  349   GVSLYAGKALPSTPLPIVYAANASNSTAGNLCMPGTLTPEKVAGKIVVCDRGVSARVQKG  408

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F VR+AGG GM++  TA  GE + A AH++PA  V   +G  IK Y+ S PSPTA IV  
Sbjct  409   FVVRDAGGAGMVLSNTATNGEELVADAHLLPAAGVGAKEGAAIKAYVASDPSPTATIVVA  468

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPN L  EILKPD+IAPGVNILA W+G  GP+G   D RRV
Sbjct  469   GTQVDVRPS-PVVAAFSSRGPNMLTPEILKPDIIAPGVNILAAWTGKAGPTGIAADTRRV  527

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AHP WSPAA++SALM
Sbjct  528   AFNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALM  566



>ref|XP_007143339.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
 gb|ESW15333.1| hypothetical protein PHAVU_007G064100g [Phaseolus vulgaris]
Length=778

 Score =   439 bits (1128),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 234/403 (58%), Positives = 281/403 (70%), Gaps = 13/403 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KI+GAR FY GYEA TG  I+E  E KSPRD++GHGTHTA+  AGS V  A+L GYA G 
Sbjct  192   KIVGARMFYHGYEAATGK-IDEKTEYKSPRDQDGHGTHTAATVAGSPVHGANLLGYAYGT  250

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  ARIA YK+CW+ GC+ SDILSA D+AV DGV V+S+S+         YYRDS 
Sbjct  251   ARGMAPGARIAAYKVCWTGGCFSSDILSAVDRAVADGVDVLSISLG---GGVSSYYRDSL  307

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             ++ AFGAME GV+VS  AGN GP   + TNV+PWI TVGAST+DR FPA+V LG GR  T
Sbjct  308   SVAAFGAMEKGVLVSCSAGNAGPDPASLTNVSPWITTVGASTMDRDFPAEVSLGTGRKIT  367

Query  542   GMSLYSGEPLG--DNKLPLVYGGDANST------YCYSGELIASKVTGKIVFCERGGNLD  697
             G SLY G  +     + PLVY G+ NS+       C  G L    V+GKIV C+RG +  
Sbjct  368   GTSLYKGRSVLSVKKQYPLVYMGNINSSIPDPRSLCLEGTLDRRMVSGKIVICDRGISPR  427

Query  698   VDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAA  877
             V KG  V+ AGGVGMI+  TA  GE + A  H++PA  V E +G ++K Y+ ++   TA 
Sbjct  428   VQKGQVVKNAGGVGMILINTAANGEELVADCHLLPAVAVGEKEGKELKHYVLTSKKATAT  487

Query  878   IVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMD  1057
             + F  T +G  PS P VA+FSSRGPN L  EILKPDV+APGVNILA WSGAIGPS    D
Sbjct  488   LGFMATRLGVRPS-PVVAAFSSRGPNFLTLEILKPDVVAPGVNILAAWSGAIGPSSLPTD  546

Query  1058  QRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              RRV+FNI+SGTSM+CPHVSG+AALL+  HP WSPAAIKSALM
Sbjct  547   HRRVKFNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALM  589



>ref|XP_003605881.1| Subtilisin-like protease [Medicago truncatula]
 gb|KEH17073.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score =   438 bits (1126),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 229/400 (57%), Positives = 284/400 (71%), Gaps = 10/400 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR + KG EAFTGS I+E+++P+SPRD  GHGTHTAS AAGS V+NA+LFGYA G 
Sbjct  178   KLIGARFYSKGIEAFTGS-IDETIQPRSPRDDIGHGTHTASTAAGSPVSNANLFGYANGT  236

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+AVYK+CW++ C  SDIL+A DQA+ D V+V+SLS+        DY  D+ 
Sbjct  237   ARGMAAGARVAVYKVCWTVFCSISDILAAMDQAIADNVNVLSLSLG---GRSIDYKEDNL  293

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AMEHG++VS  AGN+GP   + TNVAPWI TVGA T+DR FPA V LG+G+ + 
Sbjct  294   AIGAFAAMEHGILVSCSAGNSGPNPLSVTNVAPWITTVGAGTLDRDFPAYVSLGNGKKYP  353

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST-----YCYSGELIASKVTGKIVFCERGGNLDVDK  706
             G+SL  G  L D  +  +Y G+A+        C SG L   KV+GKIVFC+ GG+    K
Sbjct  354   GVSLSKGNSLPDTHVTFIYAGNASINDQGIGTCISGSLDPKKVSGKIVFCDGGGSSRTGK  413

Query  707   GFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVF  886
             G  V+ AGG+GM++      GE + A AH++PAT V   DG  IK+YI S P PT  I+F
Sbjct  414   GNTVKSAGGLGMVLANVESDGEELRADAHILPATAVGFKDGEAIKKYIFSDPKPTGTILF  473

Query  887   RGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRR  1066
             +GT +G  PS P VA FSSRGPN L  +ILKPD IAPGVNILA ++    P+G   D RR
Sbjct  474   QGTKLGVEPS-PIVAKFSSRGPNSLTPQILKPDFIAPGVNILASYTRNTSPTGMDSDPRR  532

Query  1067  VEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             V+FNIISGTSM+CPHVSGLAAL++  HP WSPAAI+SALM
Sbjct  533   VDFNIISGTSMSCPHVSGLAALIKSIHPNWSPAAIRSALM  572



>ref|XP_002452918.1| hypothetical protein SORBIDRAFT_04g034950 [Sorghum bicolor]
 gb|EES05894.1| hypothetical protein SORBIDRAFT_04g034950 [Sorghum bicolor]
Length=780

 Score =   439 bits (1128),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 240/396 (61%), Positives = 293/396 (74%), Gaps = 4/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GA+ F  GYEA  G  + E+ + +SP D NGHGTHT+S AAGS VANA+ F Y +G 
Sbjct  193   KLVGAKFFGLGYEAAHGGEVGET-DSRSPLDTNGHGTHTSSTAAGSAVANAAFFDYGKGT  251

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV-AIPRAYPEDYYRDS  358
             A GMA +ARIA YK CW+ GC  SDIL AFD+A+KDGV+VIS+S+ A+ +A P  +Y DS
Sbjct  252   ATGMAPRARIATYKACWARGCASSDILKAFDEAIKDGVNVISVSLGAVGQAPP--FYSDS  309

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
             TA+GAF A+ +G+VVS  AGN+GPG  TA NVAPWILTVGAST++R FPA+VVLG G  F
Sbjct  310   TAVGAFSAVRNGIVVSASAGNSGPGEFTAVNVAPWILTVGASTLNRQFPANVVLGSGDTF  369

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG SLY+G PLG +KLPLVYGG   S+ C +G+LIAS+V GKIV C+ G      KG AV
Sbjct  370   TGTSLYAGTPLGPSKLPLVYGGSVGSSVCEAGKLIASRVAGKIVVCDPGVIGGAAKGEAV  429

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             + AGG G IV  +   GE    + H+ PAT V      KIK+YI ++ SP A IVF GTV
Sbjct  430   KLAGGAGAIVVSSKAFGEEALTTPHIHPATGVSFAAAEKIKKYIRTSASPVATIVFIGTV  489

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             +G +PS+PR+ASFSSRGPN L  EILKPDV APGV+ILA W+G   P+    D RRV+FN
Sbjct  490   VGGTPSSPRMASFSSRGPNLLAPEILKPDVTAPGVDILAAWTGENSPTELDSDTRRVKFN  549

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             IISGTSM+CPHVSG+AALLR+A P WSPAAIKSALM
Sbjct  550   IISGTSMSCPHVSGIAALLRQAWPDWSPAAIKSALM  585



>ref|XP_011088593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=791

 Score =   439 bits (1129),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 231/404 (57%), Positives = 288/404 (71%), Gaps = 10/404 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTG-----SPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFG  166
             KI+GAR F KG+EA +G       INE++E KSPRD +GHGTHTAS AAG     AS+ G
Sbjct  195   KIVGARYFSKGHEAASGFGGIVGGINETIEFKSPRDADGHGTHTASTAAGRYAFRASMEG  254

Query  167   YAQGEARGMAIKARIAVYKICW-SLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPED  343
             YA G A+G+A KAR+A+YK+CW + GC+DSDIL+AFD AV DGV VIS+S+         
Sbjct  255   YASGIAKGVAPKARLAIYKVCWKNAGCFDSDILAAFDAAVNDGVDVISISIGGGEGISSP  314

Query  344   YYRDSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLG  523
             YY D  AIGA+GA+  G+ VS+ AGN GP   + TN+APW+ TVGA TIDR FPADV+L 
Sbjct  315   YYLDPIAIGAYGAVSRGIFVSSSAGNDGPNGMSVTNLAPWLTTVGAGTIDRNFPADVILD  374

Query  524   DGRIFTGMSLYSGEPLGDNKLPLVYGGDA---NSTYCYSGELIASKVTGKIVFCERGGNL  694
             +GR F+G+SLY+GEPL     PLVY G +   +++ C    L  + V GKIV C+RG + 
Sbjct  375   NGRKFSGVSLYAGEPLNGKMYPLVYPGKSGVLSASLCMENSLDPNLVRGKIVICDRGSSP  434

Query  695   DVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTA  874
              V KG  V++AGGVGMI+      GE +   AH+IPA  V   +G++IK Y+ S P+ +A
Sbjct  435   RVAKGLVVKKAGGVGMILANGVSNGEGLVGDAHLIPACAVGSDEGDQIKSYLASNPAASA  494

Query  875   AIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVM  1054
              I FRGTV+GT P AP VASFS+RGPN L  EILKPD+IAPGVNILA W+ A+GP+G   
Sbjct  495   TINFRGTVVGTKP-APVVASFSARGPNGLNPEILKPDLIAPGVNILAAWTEAVGPTGLDA  553

Query  1055  DQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             D R+ EFNI+SGTSMACPHVSG AALLR AHP WSPAAI+SA+M
Sbjct  554   DTRKTEFNILSGTSMACPHVSGAAALLRSAHPDWSPAAIRSAMM  597



>ref|XP_004243704.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=762

 Score =   438 bits (1126),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 226/396 (57%), Positives = 284/396 (72%), Gaps = 5/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPI-NESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K++GAR F KGY   + S   N+  +P+SPRD++GHGTHTAS AAG+ V NASLFGYA G
Sbjct  181   KLVGARFFAKGYRMSSSSSFANQPRQPESPRDQDGHGTHTASTAAGAPVGNASLFGYASG  240

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA +AR+A YK+CW  GC+ SDIL+  D+A+ DGV V+SLS+         YYRD+
Sbjct  241   IARGMAPRARVATYKVCWPTGCFGSDILAGMDRAILDGVDVLSLSLGGGSG---PYYRDT  297

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIG F AME G+VVS  AGN+GP   +  N APWI+TVGA TIDR FPA  VLG+G+  
Sbjct  298   IAIGGFSAMEKGIVVSCSAGNSGPAKASLANTAPWIMTVGAGTIDRDFPAYAVLGNGKKI  357

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG+SLYSG+ +G   + LVY  D++S+ C  G L    V GKIV C+RG N  V+KG  V
Sbjct  358   TGVSLYSGKGMGKKLVSLVYNTDSSSSLCLPGSLNPKDVRGKIVVCDRGTNARVEKGLVV  417

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             +EAGGVGMI+  T  +GE + A +H++PA  V    GN I++Y+ S  +PTA + F GTV
Sbjct  418   KEAGGVGMILANTVESGEELVADSHLLPAVAVGRKLGNAIRQYVKSERNPTALLSFGGTV  477

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             +   PS P VA+FSSRGPN +  +ILKPD+I PGVNILA WS AIGP+G   D RR +FN
Sbjct  478   VNVKPS-PVVAAFSSRGPNTVTPQILKPDLIGPGVNILAAWSEAIGPTGLEKDTRRTKFN  536

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             I+SGTSM+CPH+SGLAALL+ AHP WSP+AIKSALM
Sbjct  537   IMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALM  572



>dbj|BAJ96698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score =   438 bits (1127),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 286/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA    P++ S E +SPRD +GHGTHT+S AAG+ VA+A LFG+A G 
Sbjct  182   KLIGARFFNRGYEAAM-RPMDTSRESRSPRDDDGHGTHTSSTAAGAAVADADLFGFASGT  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA KAR+AVYK+CW  GC+ SDIL+  D AV DG  V+SLS+    A   DY RDS 
Sbjct  241   ARGMAPKARVAVYKVCWLGGCFSSDILAGMDAAVADGCGVLSLSLGGGSA---DYARDSV  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF AME  V+VS  AGN GPG+ T +NVAPWI TVGA T+DR FPA V+LG+G+ +T
Sbjct  298   AIGAFAAMEQNVLVSCSAGNAGPGSSTLSNVAPWITTVGAGTLDRDFPAYVLLGNGKNYT  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDA-NST---YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G+SLY+G+       PL+Y G+A NST    C  G L   KV GKIV C+RG +  V KG
Sbjct  358   GVSLYAGKAPPTTPTPLIYAGNASNSTSGNLCMPGTLSPEKVQGKIVVCDRGISARVQKG  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
             F VR+AGG GM++  TA  G+ + A AH++PA  V E +G+ IK YI SA  PTA IV  
Sbjct  418   FVVRDAGGAGMVLANTAANGQELVADAHLLPAAGVGEKEGSAIKSYIASAAKPTATIVIA  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPN +  EILKPD+I PGVNILA W+G  GP+G   D RRV
Sbjct  478   GTQVNVRPS-PLVAAFSSRGPNMITPEILKPDIIGPGVNILAAWTGKAGPTGLAADTRRV  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAALLR AHP WSPAA++SALM
Sbjct  537   SFNIISGTSMSCPHVSGLAALLRSAHPEWSPAAVRSALM  575



>ref|XP_003536496.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN02773.1| Subtilisin-like protease [Glycine soja]
Length=782

 Score =   439 bits (1128),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 235/404 (58%), Positives = 280/404 (69%), Gaps = 14/404 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KI+GAR FY GYEA TG  I+E  E KSPRD++GHGTHTA+  AGS V  A+L GYA G 
Sbjct  195   KIVGARMFYHGYEAATGK-IDEQAEYKSPRDQDGHGTHTAATVAGSPVHGANLLGYAYGT  253

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  ARIA YK+CW+ GC+ SDILSA D+AV DGV V+S+S+         YYRDS 
Sbjct  254   ARGMAPGARIAAYKVCWTGGCFSSDILSAVDRAVDDGVDVLSISLG---GGVSSYYRDSL  310

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             ++ +FGAME GV VS  AGN GP   + TNV+PWI TVGAST+DR FPADV LG+GR  T
Sbjct  311   SVASFGAMEKGVFVSCSAGNAGPDPVSLTNVSPWITTVGASTMDRDFPADVSLGNGRKIT  370

Query  542   GMSLYSGEPLG--DNKLPLVYGGDANST------YCYSGELIASKVTGKIVFCERGGNLD  697
             G SLY G  +     + PLVY GD NS+       C  G L    V+GKIV C+RG +  
Sbjct  371   GTSLYKGRSMLSVKKQYPLVYMGDTNSSIPDPKSLCLEGTLDRRMVSGKIVICDRGISPR  430

Query  698   VDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYI-NSAPSPTA  874
             V KG  V+ AGGVGMI+  TA  GE + A  H++PA  + E +G ++K Y+  S    TA
Sbjct  431   VQKGQVVKNAGGVGMILINTAANGEELVADCHLLPAVAIGEKEGKELKHYVLTSKKKATA  490

Query  875   AIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVM  1054
              + FR T +G  PS P VA+FSSRGPN L  EILKPDV+APGVNILA WS AIGPS    
Sbjct  491   TLGFRATRLGVRPS-PVVAAFSSRGPNFLTLEILKPDVVAPGVNILAAWSEAIGPSSLPT  549

Query  1055  DQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             D RRV+FNI+SGTSM+CPHVSG+AALL+  HP WSPAAIKSALM
Sbjct  550   DHRRVKFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALM  593



>ref|XP_010049348.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW81893.1| hypothetical protein EUGRSUZ_C03260 [Eucalyptus grandis]
Length=778

 Score =   438 bits (1127),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 228/398 (57%), Positives = 284/398 (71%), Gaps = 7/398 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSP-INESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGAR F KG+   +GS  +    E +SPRDR+GHGTHTAS AAGS VANASL GYA G
Sbjct  195   KLIGARFFSKGFRMASGSSFLKNPKEVESPRDRDGHGTHTASTAAGSQVANASLLGYASG  254

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA  AR+A YK+CWS GC+ +DIL+  D+A+ DGV V+SLS+    A    YYRD+
Sbjct  255   TARGMAEHARVAAYKVCWSSGCFGADILAGMDRAILDGVDVLSLSLGGGIA---PYYRDT  311

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAF AME G+ VS  AGN+GP   +  NVAPWI+TVGA T+DR FPA  +LG+G+ +
Sbjct  312   IAIGAFTAMERGIFVSCSAGNSGPVKESLANVAPWIMTVGAGTLDRDFPAYALLGNGKRY  371

Query  539   TGMSLYSGEPLGDNKLPLVYGGDAN--STYCYSGELIASKVTGKIVFCERGGNLDVDKGF  712
              G+SLYSG  +G N +P++Y  D+N     C  G L  +   GK+V C+RG N  V+KG 
Sbjct  372   AGVSLYSGPGMGHNPVPVIYSKDSNISGQLCLPGSLNPALTRGKVVLCDRGVNARVEKGQ  431

Query  713   AVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRG  892
              VR+AGGVGMI+  TA  GE + A +H+IPA  V    G+ I+EY+ S  SPTA + FRG
Sbjct  432   VVRDAGGVGMILANTAANGEELVADSHLIPAVAVGRKMGDVIREYVKSDRSPTAVLSFRG  491

Query  893   TVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVE  1072
             TV+   PS P VA+FSSRGPN +  +ILKPDVI PGVNILAGWS A GP+G   D R+  
Sbjct  492   TVVNVRPS-PVVAAFSSRGPNTVTQQILKPDVIGPGVNILAGWSEAAGPTGLESDTRKTL  550

Query  1073  FNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             FNI+SGTSM+CPH+SG+AALL+ AHP WSP+AIKSALM
Sbjct  551   FNILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALM  588



>gb|KHN31561.1| Subtilisin-like protease [Glycine soja]
Length=646

 Score =   434 bits (1116),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 228/402 (57%), Positives = 285/402 (71%), Gaps = 12/402 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR FY GYEA  G  INE  E KSPRD++GHGTHTA+   GS V  A+L GYA G 
Sbjct  57    KVVGARVFYHGYEAAIGR-INEQKEYKSPRDQDGHGTHTAATVGGSPVHGANLLGYANGT  115

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  ARIA YK+CW  GC+ SDI+SA D+AV DGV+V+S+S+         YYRDS 
Sbjct  116   ARGMAPGARIAAYKVCWVGGCFSSDIVSAIDKAVADGVNVLSISLG---GGVSSYYRDSL  172

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             ++ AFGAME GV VS  AGN GP   + TNV+PWI TVGAST+DR FPADV LG+G+  T
Sbjct  173   SVAAFGAMERGVFVSCSAGNAGPDPASLTNVSPWITTVGASTMDRDFPADVRLGNGKKVT  232

Query  542   GMSLYSGEPLG--DNKLPLVYGGDANS-----TYCYSGELIASKVTGKIVFCERGGNLDV  700
             G+SLY G+ +   + + PLVY G  +S     + C  G L    V+GKIV C+RG +  V
Sbjct  233   GVSLYKGKNVLSIEKQYPLVYMGSNSSRVDPRSMCLEGTLDPKVVSGKIVICDRGLSPRV  292

Query  701   DKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAI  880
              KG  VR AGGVGMI+  T   GE + A +H++PA  + E +G ++K Y+ S+ S TA +
Sbjct  293   QKGNVVRSAGGVGMILTNTEANGEELVADSHLLPAVAIGEKEGKELKSYVLSSKSSTATL  352

Query  881   VFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQ  1060
              F+GT +G  PS P VA+FSSRGPN L  +ILKPD++APGVNILA WS AIGPSG  +D 
Sbjct  353   AFKGTRLGIKPS-PIVAAFSSRGPNFLTLDILKPDLVAPGVNILAAWSEAIGPSGLKIDN  411

Query  1061  RRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             R+V+FNI+SGTSM+CPHVSG+AAL++  HP WSPAAIKSALM
Sbjct  412   RKVKFNIVSGTSMSCPHVSGIAALVKSRHPEWSPAAIKSALM  453



>ref|XP_010089708.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38258.1| Subtilisin-like protease [Morus notabilis]
Length=787

 Score =   438 bits (1127),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 240/408 (59%), Positives = 287/408 (70%), Gaps = 21/408 (5%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYE+  G  +NE+ E +SPRD +GHGTHTASIAAG  V  AS  GYA+G 
Sbjct  192   KLIGARFFCEGYESTNGK-MNETTEYRSPRDSDGHGTHTASIAAGRYVFPASTLGYARGV  250

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV---AIPRAYPEDYYR  352
             A GMA KAR+A YK+CW+ GCYDSDIL+AFD AV DGV VISLSV    +P      YY 
Sbjct  251   AAGMAPKARLAAYKVCWNAGCYDSDILAAFDAAVADGVDVISLSVGGVVVP------YYL  304

Query  353   DSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGR  532
             DS AIGAFGA ++GV VS  AGN GPG  T TNVAPW+ TVGA T+DR FPADV LG+GR
Sbjct  305   DSIAIGAFGAADNGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTMDRDFPADVKLGNGR  364

Query  533   IFTGMSLYSGEPLGDNKL-PLVYGGDA-----NSTYCYSGELIASKVTGKIVFCERGGNL  694
                G+S+Y G  L   ++  L+Y G+      +S+ C  G L  S V GKIV C+RG N 
Sbjct  365   TIPGVSVYGGPDLSPGRMYSLIYAGNEGSDGYSSSLCLEGSLNPSSVKGKIVLCDRGINS  424

Query  695   DVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPS---  865
                KG  V++AGGVGMI+      GE + A  HV+PAT+V    G++I++YI SA     
Sbjct  425   RATKGEVVKKAGGVGMILANGVFDGEGLVADCHVLPATSVGASSGDEIRKYITSASKSRS  484

Query  866   -PTAAIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPS  1042
              PTA I+F+GT +G  P AP VASFS+RGPNP   EILKPDVIAPG+NILA W   +GPS
Sbjct  485   PPTATILFKGTKLGIRP-APVVASFSARGPNPESPEILKPDVIAPGLNILAAWPDRVGPS  543

Query  1043  GSVMDQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             G   D+RR EFNI+SGTSMACPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  544   GIPSDKRRTEFNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALM  591



>ref|XP_007038510.1| Subtilase 1.3 [Theobroma cacao]
 gb|EOY23011.1| Subtilase 1.3 [Theobroma cacao]
Length=778

 Score =   437 bits (1125),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 237/402 (59%), Positives = 283/402 (70%), Gaps = 12/402 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KI+GAR FY+GYEA TG  INE  E KSPRD++GHGTHTA+  AGS V  A+L GYA G 
Sbjct  192   KIVGARVFYRGYEAATGK-INEKNEYKSPRDQDGHGTHTAATVAGSPVRGANLLGYAYGT  250

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  ARIA YK+CW+ GC+ SDILSA D+AV DGV V+S+S+         YYRDS 
Sbjct  251   ARGMAPGARIAAYKVCWTGGCFSSDILSAVDRAVADGVSVLSISLG---GGVSSYYRDSL  307

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AI  FGAME GV VS  AGN GP   + TNV+PWI TVGAST+DR FPADV LG GR  T
Sbjct  308   AIATFGAMEMGVFVSCSAGNGGPDPVSLTNVSPWITTVGASTMDRDFPADVKLGTGRTLT  367

Query  542   GMSLYSGEP-LGDNK-LPLVYGGDANST-----YCYSGELIASKVTGKIVFCERGGNLDV  700
             G+SLY G+  L  NK  P+VY G  +S+      C  G L    V+GKIV C+RG +  V
Sbjct  368   GVSLYKGQRFLSPNKQYPIVYMGSNSSSPDPSSLCLEGTLDPHIVSGKIVICDRGISPRV  427

Query  701   DKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAI  880
              KG  V++AGG+GMI+  TA  GE + A  H++PA  V EM+G  IK Y  ++   TA +
Sbjct  428   QKGQVVKDAGGIGMILTNTAANGEELVADCHLLPALAVGEMEGKAIKHYALTSRKATATL  487

Query  881   VFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQ  1060
              F GT +G  PS P VA+FSSRGPN L FEILKPD++APGVNILA W+G +GPS    D 
Sbjct  488   AFLGTRLGIRPS-PVVAAFSSRGPNFLTFEILKPDMVAPGVNILAAWTGELGPSSLQTDH  546

Query  1061  RRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             RRV+FNI+SGTSM+CPHVSG+AALL+  HP WSPAAIKSALM
Sbjct  547   RRVKFNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALM  588



>ref|XP_010519206.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010519207.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=775

 Score =   437 bits (1124),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 234/402 (58%), Positives = 283/402 (70%), Gaps = 12/402 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KI+GAR FYKGYEA TG  I+E +E KSPRDR+GHGTHTA+  AGS V  A+L GYA G 
Sbjct  190   KIVGARVFYKGYEAATGK-IDEQLEYKSPRDRDGHGTHTAATVAGSPVRGANLLGYAYGT  248

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIA YK+CW  GC+ SDILSA D+AV DGVHV+S+S+         YYRDS 
Sbjct  249   ARGMAPRARIAAYKVCWVGGCFSSDILSAVDRAVADGVHVLSISLG---GGISTYYRDSL  305

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             +I AFGAME GV VS  AGN GP   + TNV+PWI TVGAST+DR FPA V LG GR   
Sbjct  306   SIAAFGAMEMGVFVSCSAGNGGPDPISLTNVSPWITTVGASTMDRDFPATVNLGSGRTVR  365

Query  542   GMSLYSGEPL--GDNKLPLVY-GGDANS----TYCYSGELIASKVTGKIVFCERGGNLDV  700
             G+SLY G  +   + + PLVY G +A+S    ++C  G L    V GKIV C+RG    V
Sbjct  366   GVSLYKGTTVLSKNRQYPLVYMGSNASSPDPSSFCLDGALDRRHVAGKIVICDRGVTPRV  425

Query  701   DKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAI  880
              KG  VREAGG+GMI+  TA  GE + A  H++PA  V E +G  IK+Y  ++  PTA +
Sbjct  426   QKGQVVREAGGIGMILTNTATNGEELVADCHLLPAVAVGEKEGKMIKQYAMTSRRPTANL  485

Query  881   VFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQ  1060
                GT +G  PS P VA+FSSRGPN L  EILKPD++APGVNILA W+G +GPS    D 
Sbjct  486   QILGTRLGIKPS-PVVAAFSSRGPNFLTLEILKPDLVAPGVNILAAWTGDMGPSSLSSDH  544

Query  1061  RRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             RRV+FNI+SGTSM+CPHVSG+AAL++  HP WSPAAIKSAL+
Sbjct  545   RRVKFNILSGTSMSCPHVSGVAALIKARHPDWSPAAIKSALL  586



>ref|XP_010047469.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW79384.1| hypothetical protein EUGRSUZ_C00797 [Eucalyptus grandis]
Length=768

 Score =   437 bits (1123),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 232/398 (58%), Positives = 283/398 (71%), Gaps = 7/398 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYE-AFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGAR+F KGY  A  GS + +  E  SPRD+ GHGTHTAS AAGS VANASL GYA G
Sbjct  186   KLIGARSFSKGYHMASGGSFLKDPKETDSPRDQEGHGTHTASTAAGSRVANASLLGYASG  245

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA +AR+A YK+CW  GC+ SDIL+  DQA+ DGV V+SLS+    A    YYRD+
Sbjct  246   TARGMATRARVASYKVCWRNGCFGSDILAGMDQAILDGVDVLSLSLGGGSA---PYYRDT  302

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIG+F A+E G+ VS  AGN GP   T  NVAPWI+TVGA T+DR FPA  VLG+   F
Sbjct  303   IAIGSFAAVERGIFVSCSAGNAGPARATLANVAPWIMTVGAGTLDRDFPAYAVLGNKNRF  362

Query  539   TGMSLYSGEPLGDNKLPLVY--GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGF  712
             TG+SLYSG  +G   + LVY  G D +   C  G L  + V GK+V C+RG N  V+KG 
Sbjct  363   TGVSLYSGPGMGKKLVGLVYDKGSDGSGNLCLPGSLQPALVRGKVVVCDRGTNARVEKGS  422

Query  713   AVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRG  892
              VR AGGVGMI+  TA +GE + A +H++PA  V    G+ I+EY +S  +PTA I F G
Sbjct  423   VVRAAGGVGMILANTAASGEELVADSHLLPAVAVGRKVGDLIREYASSNLNPTATIGFGG  482

Query  893   TVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVE  1072
             TV+G  PS P VA+FSSRGPN +  +ILKPDVI PGVNILA WSGA+GP+G   D R+ +
Sbjct  483   TVLGVQPS-PVVAAFSSRGPNLVTPQILKPDVIGPGVNILAAWSGAVGPTGLEKDTRKTQ  541

Query  1073  FNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             FNI+SGTSM+CPH+SGLAALL+ AHP WSP+AIKSALM
Sbjct  542   FNIMSGTSMSCPHISGLAALLKAAHPNWSPSAIKSALM  579



>gb|EYU46755.1| hypothetical protein MIMGU_mgv1a001548mg [Erythranthe guttata]
Length=798

 Score =   437 bits (1125),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 236/413 (57%), Positives = 288/413 (70%), Gaps = 26/413 (6%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYEA  G  +N S E  S RD +GHGTHTAS AAG  VANASLFGYA G 
Sbjct  199   KLIGARYFSAGYEARKGV-VNSSEEFHSARDSDGHGTHTASTAAGRAVANASLFGYASGV  257

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV---AIPRAYPEDYYR  352
             A G+A KARIAVYKICW  GC DSDIL+AFD+AV+DGV+VIS+SV   A+P      Y  
Sbjct  258   AVGVAPKARIAVYKICWKNGCMDSDILAAFDKAVEDGVNVISISVGGGAVP------YNL  311

Query  353   DSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGR  532
             D  AIGAFGAME G++VS  AGN GP   T TNVAPW+ TVGASTIDR F AD+VLGDGR
Sbjct  312   DPMAIGAFGAMERGILVSASAGNEGPTKMTVTNVAPWMTTVGASTIDRKFVADLVLGDGR  371

Query  533   IFTGMSLYSGEPLGDNK-LPLVYGGDANSTY--------------CYSGELIASKVTGKI  667
             + +G SLYSG+PL +   LPL+YGG+A++++              C +G L  + V GKI
Sbjct  372   VISGASLYSGKPLPEKTYLPLIYGGNASASWGFGGIRAGSFSASTCIAGSLDENSVRGKI  431

Query  668   VFCERGGNLDVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEY  847
             V C+RGGN  V KG  VR+AGG G++V   A  GE + A +H+IP   + E     +++Y
Sbjct  432   VVCDRGGNARVAKGDVVRKAGGAGVVVANVAPIGEGLVADSHLIPGLAISESAARTLRQY  491

Query  848   INSAPSPTAAIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSG  1027
             INS P+P A +VFRGT +G  P AP VASFS+RGP+     +LKPD+IAPGVNILA W  
Sbjct  492   INSNPNPRATMVFRGTQVGIKP-APVVASFSARGPSVESPYVLKPDIIAPGVNILAAWPD  550

Query  1028  AIGPSGSVMDQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              + PS    D RR +FN+ SGTSM+CPHVSG+AALL+ AHP WSPA I+SA+M
Sbjct  551   GVAPSEIASDTRRTQFNVASGTSMSCPHVSGVAALLKGAHPDWSPAMIRSAMM  603



>gb|KHN15704.1| Subtilisin-like protease [Glycine soja]
Length=741

 Score =   436 bits (1120),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 231/403 (57%), Positives = 279/403 (69%), Gaps = 13/403 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KI+GAR FY GYEA TG  I+E  E KSPRD++GHGTHTA+  AGS V  A+  GYA G 
Sbjct  155   KIVGARMFYHGYEAATGK-IDEQAEYKSPRDQDGHGTHTAATVAGSPVHGANFLGYAYGT  213

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  ARIA YK+CW+ GC+ SDILSA D+AV DGV V+S+S+         YYRDS 
Sbjct  214   ARGMAPGARIAAYKVCWTGGCFSSDILSAVDRAVADGVDVLSISLG---GGVSSYYRDSL  270

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             ++ AFGAME GV VS  AGN GP   + TNV+PWI TVGAST+DR FPADV LG+GR  T
Sbjct  271   SVAAFGAMEKGVFVSCSAGNAGPDPVSLTNVSPWITTVGASTMDRDFPADVRLGNGRKIT  330

Query  542   GMSLYSGEPLG--DNKLPLVYGGDANST------YCYSGELIASKVTGKIVFCERGGNLD  697
             G SLY G  +     + PLVY G+ NS+       C  G L    V+GKIV C+RG +  
Sbjct  331   GTSLYKGRSMLSVKKQYPLVYMGNTNSSIPDPKSLCLEGTLDRRMVSGKIVICDRGISPR  390

Query  698   VDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAA  877
             V KG  V+ AGG GMI+  TA  GE + A  H++PA  + E +G ++K Y+ ++   TA 
Sbjct  391   VQKGQVVKNAGGAGMILTNTAANGEELVADCHLLPAVAIGEKEGKELKRYVLTSKKATAT  450

Query  878   IVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMD  1057
             + F+ T +G  PS P VA+FSSRGPN L  EILKPDV+APGVNILA WS AIGPS    D
Sbjct  451   LGFQATRLGVRPS-PVVAAFSSRGPNFLTLEILKPDVVAPGVNILAAWSEAIGPSSLPTD  509

Query  1058  QRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              RRV+FNI+SGTSM+CPHVSG+AALL+  HP WSPAAIKSALM
Sbjct  510   HRRVKFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALM  552



>ref|XP_009596091.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=764

 Score =   436 bits (1122),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 225/396 (57%), Positives = 287/396 (72%), Gaps = 5/396 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYE-AFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGAR F KGY+ + +GS  N+  +P+SPRD++GHGTHT+S AAG+ VANASL GYA G
Sbjct  183   KLIGARFFSKGYQMSASGSFTNQPRQPESPRDQDGHGTHTSSTAAGAPVANASLLGYASG  242

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA +AR+A YK+CW  GC+ SDIL+  ++A+ DGV V+SLS+         YY D+
Sbjct  243   VARGMAPRARVATYKVCWPTGCFGSDILAGMERAILDGVDVLSLSLGGGSG---PYYHDT  299

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAF AME G+VVS  AGN+GP   +  N APWI+TVGA TIDR FPA   LG+G+  
Sbjct  300   IAIGAFSAMEKGIVVSCSAGNSGPAKASLANTAPWIMTVGAGTIDRDFPAFATLGNGKKI  359

Query  539   TGMSLYSGEPLGDNKLPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             TG+SLYSG+ +G   +PLVY  D++++ C  G L    V GKIV C+RG N  V+KG  V
Sbjct  360   TGVSLYSGKGMGKKVVPLVYSTDSSASLCLPGSLDPKIVRGKIVLCDRGTNARVEKGLVV  419

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGTV  898
             +EAGGVGMI+  TA +GE + A +H++PA  V    G+ I++Y+ S  +P A + F GTV
Sbjct  420   KEAGGVGMILANTAESGEELVADSHLLPAVAVGRKLGDFIRQYVKSEKNPAAVLSFGGTV  479

Query  899   IGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEFN  1078
             +   PS P VA+FSSRGPN +  +ILKPDVI PGVNILA WS AIGP+G   D RR +FN
Sbjct  480   VNVKPS-PVVAAFSSRGPNTVTPQILKPDVIGPGVNILAAWSEAIGPTGLEKDTRRTKFN  538

Query  1079  IISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             I+SGTSM+CPH+SGLAALL+ AHP WSP+AIKSALM
Sbjct  539   IMSGTSMSCPHISGLAALLKAAHPEWSPSAIKSALM  574



>ref|XP_009590448.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=794

 Score =   437 bits (1123),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 238/412 (58%), Positives = 278/412 (67%), Gaps = 24/412 (6%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KIIGAR    GYEA  G  +N S + KS RD +GHGTHTAS AAG  V +ASL G+A+G 
Sbjct  194   KIIGARYLTAGYEARIGRIMNSSTDIKSARDSDGHGTHTASTAAGRAVEDASLLGFAKGV  253

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV---AIPRAYPEDYYR  352
             A G+A KARIA YK+CW  GC DSDIL+AFD+AV DGV+VIS+S+   A+P      Y  
Sbjct  254   AVGIAPKARIASYKVCWKRGCMDSDILAAFDKAVDDGVNVISISIGGGAVP------YNL  307

Query  353   DSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGR  532
             D  AIG+FGAME G++VS  AGN GP   T TNVAPWI TVGASTIDR FPAD+VLG+G+
Sbjct  308   DPIAIGSFGAMEKGILVSASAGNEGPRPMTVTNVAPWITTVGASTIDRKFPADIVLGNGK  367

Query  533   IFTGMSLYSGEPLGDNKLPLVYGGDA--------------NSTYCYSGELIASKVTGKIV  670
               TG SLYSG+PL D +LPLVYGG+               ++  C    L   +V GKIV
Sbjct  368   RITGASLYSGDPLPDKQLPLVYGGNVSVGIRNGARHSSSFSAATCMPDSLDKERVHGKIV  427

Query  671   FCERGGNLDVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYI  850
              C RGG   V KG  V EAGG G+IV   A  GE + A AH+IP   V E  GN I++YI
Sbjct  428   VCNRGGTPRVAKGEVVNEAGGAGVIVANVAPMGEGLIADAHLIPGLGVTESAGNIIRDYI  487

Query  851   NSAPSPTAAIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGA  1030
             NS  +PTA I F GT +G  P AP VASFSSRGPN     +LKPDVIAPGVNILA W   
Sbjct  488   NSNNNPTATIAFYGTQLGVKP-APVVASFSSRGPNAESIFVLKPDVIAPGVNILAAWPDG  546

Query  1031  IGPSGSVMDQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             + P+    D RR +FNI SGTSM+CPHVSGLAALL+ AHP WSPA I+SALM
Sbjct  547   VAPTELSSDTRRTQFNIESGTSMSCPHVSGLAALLKGAHPDWSPAMIRSALM  598



>ref|XP_002305511.2| hypothetical protein POPTR_0004s17960g [Populus trichocarpa]
 gb|EEE86022.2| hypothetical protein POPTR_0004s17960g [Populus trichocarpa]
Length=773

 Score =   436 bits (1121),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 232/404 (57%), Positives = 287/404 (71%), Gaps = 10/404 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGS-----PINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFG  166
             K+IGAR F KG+EA +GS     PINE+VE KSPRD +GHGTHTAS AAG  V  AS+ G
Sbjct  177   KLIGARFFIKGHEAASGSMGPITPINETVEFKSPRDADGHGTHTASTAAGRHVFGASMEG  236

Query  167   YAQGEARGMAIKARIAVYKICW-SLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPED  343
             YA G A+G+A KAR+AVYK+CW + GC+DSDIL+AFD AVKDGV VIS+S+         
Sbjct  237   YAAGIAKGVAPKARLAVYKVCWKNAGCFDSDILAAFDAAVKDGVDVISISIGGGDGISAP  296

Query  344   YYRDSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLG  523
             YY D  AIGA+GA   GV VS+ AGN GP   + TN+APWI+TVGA TIDR FPA+VVLG
Sbjct  297   YYLDPIAIGAYGAASRGVFVSSSAGNDGPNLMSVTNLAPWIVTVGAGTIDRNFPAEVVLG  356

Query  524   DGRIFTGMSLYSGEPLGDNKLPLVYGGDA---NSTYCYSGELIASKVTGKIVFCERGGNL  694
             +G+  +G+SLY+G PL     PLVY G +   +S+ C    L  + V GKIV C+RG + 
Sbjct  357   NGKRLSGVSLYAGLPLSGKMYPLVYPGKSGVLSSSLCMENSLDPNMVKGKIVVCDRGSSA  416

Query  695   DVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTA  874
              V KG  V++AGGVGMI+      GE +   AH+IP   +   +G+ +K Y+++  +P A
Sbjct  417   RVAKGLVVKKAGGVGMILANGMSNGEGLVGDAHLIPTCALGSDEGDTVKAYVSATSNPVA  476

Query  875   AIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVM  1054
              I F+GTVIG  P AP VASFS RGPN L  EILKPD+IAPGVNILA W+ A+GP+G   
Sbjct  477   TIAFKGTVIGIKP-APVVASFSGRGPNGLTPEILKPDLIAPGVNILAAWTDAVGPTGLDS  535

Query  1055  DQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             D R+ EFNI+SGTSMACPHVSG AALL+ AHP WSPAAI+SA+M
Sbjct  536   DTRKTEFNILSGTSMACPHVSGAAALLKSAHPDWSPAAIRSAMM  579



>ref|XP_010042589.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=781

 Score =   436 bits (1122),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 228/398 (57%), Positives = 283/398 (71%), Gaps = 7/398 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSP-INESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGAR F KG+   +GS  +    E +SPRDR+GHGTHTAS AAGS VANASL GYA G
Sbjct  198   KLIGARFFSKGFRMASGSSFLKNPQEVESPRDRDGHGTHTASTAAGSPVANASLLGYASG  257

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA  AR+A YK+CWS GC+ +DIL+  D+A+ DGV V+SLS+    A    YYRD+
Sbjct  258   TARGMAEHARVAAYKVCWSSGCFGADILAGMDRAILDGVDVLSLSLGGGIA---PYYRDT  314

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAF AME G+ VS  AGN+GP   +  NVAPWI+TVGA T+DR FPA  +LG+G+ +
Sbjct  315   IAIGAFTAMERGIFVSCSAGNSGPVKESLANVAPWIMTVGAGTLDRDFPAYALLGNGKRY  374

Query  539   TGMSLYSGEPLGDNKLPLVYGGDAN--STYCYSGELIASKVTGKIVFCERGGNLDVDKGF  712
              G+SLYSG  +G N +P++Y  D+N     C  G L  +   GK+V C+RG N  V+KG 
Sbjct  375   AGVSLYSGPGMGHNPVPVIYSKDSNISGQLCLPGSLNPALTRGKVVLCDRGVNARVEKGQ  434

Query  713   AVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRG  892
              VR+AGGVGMI+  TA  GE + A +H+IPA  V    G+ I+EY  S  SPTA + FRG
Sbjct  435   VVRDAGGVGMILANTAANGEELVADSHLIPAVAVGRKMGDVIREYAKSDRSPTAVLSFRG  494

Query  893   TVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVE  1072
             TV+   PS P VA+FSSRGPN +  +ILKPDVI PGVNILAGWS A GP+G   D R+  
Sbjct  495   TVVNVRPS-PVVAAFSSRGPNTVTQQILKPDVIGPGVNILAGWSEAAGPTGLESDTRKTL  553

Query  1073  FNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             FNI+SGTSM+CPH+SG+AALL+ AHP WSP+AIKSALM
Sbjct  554   FNILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALM  591



>ref|XP_006606084.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score =   436 bits (1121),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 231/403 (57%), Positives = 279/403 (69%), Gaps = 13/403 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KI+GAR FY GYEA TG  I+E  E KSPRD++GHGTHTA+  AGS V  A+  GYA G 
Sbjct  195   KIVGARMFYHGYEAATGK-IDEQAEYKSPRDQDGHGTHTAATVAGSPVHGANFLGYAYGT  253

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  ARIA YK+CW+ GC+ SDILSA D+AV DGV V+S+S+         YYRDS 
Sbjct  254   ARGMAPGARIAAYKVCWTGGCFSSDILSAVDRAVADGVDVLSISLG---GGVSSYYRDSL  310

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             ++ AFGAME GV VS  AGN GP   + TNV+PWI TVGAST+DR FPADV LG+GR  T
Sbjct  311   SVAAFGAMEKGVFVSCSAGNAGPDPVSLTNVSPWITTVGASTMDRDFPADVRLGNGRKIT  370

Query  542   GMSLYSGEPLG--DNKLPLVYGGDANST------YCYSGELIASKVTGKIVFCERGGNLD  697
             G SLY G  +     + PLVY G+ NS+       C  G L    V+GKIV C+RG +  
Sbjct  371   GTSLYKGRSMLSVKKQYPLVYMGNTNSSIPDPKSLCLEGTLDRRMVSGKIVICDRGISPR  430

Query  698   VDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAA  877
             V KG  V+ AGG GMI+  TA  GE + A  H++PA  + E +G ++K Y+ ++   TA 
Sbjct  431   VQKGQVVKNAGGAGMILTNTAANGEELVADCHLLPAVAIGEKEGKELKRYVLTSKKATAT  490

Query  878   IVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMD  1057
             + F+ T +G  PS P VA+FSSRGPN L  EILKPDV+APGVNILA WS AIGPS    D
Sbjct  491   LGFQATRLGVRPS-PVVAAFSSRGPNFLTLEILKPDVVAPGVNILAAWSEAIGPSSLPTD  549

Query  1058  QRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              RRV+FNI+SGTSM+CPHVSG+AALL+  HP WSPAAIKSALM
Sbjct  550   HRRVKFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALM  592



>ref|XP_010051409.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=791

 Score =   436 bits (1122),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 227/398 (57%), Positives = 284/398 (71%), Gaps = 7/398 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSP-INESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGAR F KG+   +GS  +    E +SPRDR+GHGTHTAS AAGS VANASL GYA G
Sbjct  194   KLIGARFFSKGFRMASGSNFLKNPKEVESPRDRDGHGTHTASTAAGSPVANASLLGYASG  253

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA  AR+A YK+CWS GC+ +DIL+  D+A+ DGV V+SLS+    A    YYRD+
Sbjct  254   TARGMAEHARVAAYKVCWSSGCFGADILAGMDRAILDGVDVLSLSLGGGIA---PYYRDT  310

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAF AME G+ VS  AGN+GP   +  NVAPWI+TVGA T+DR FPA  +LG+G+ +
Sbjct  311   IAIGAFTAMERGIFVSCSAGNSGPAKESLANVAPWIMTVGAGTLDRDFPAYALLGNGKRY  370

Query  539   TGMSLYSGEPLGDNKLPLVYGGDAN--STYCYSGELIASKVTGKIVFCERGGNLDVDKGF  712
              G+SLYSG  +G N +P++Y  D+N     C  G L  +   GK+V C+RG N  V+KG 
Sbjct  371   AGVSLYSGPGMGHNPVPVIYSKDSNISGQLCLPGSLNPALTRGKVVLCDRGVNARVEKGQ  430

Query  713   AVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRG  892
              VR+AGGVGMI+  TA  GE + A +H+IPA  V    G+ I++Y+ S  SPTA + FRG
Sbjct  431   VVRDAGGVGMILANTAANGEELVADSHLIPAVAVGRKMGDVIRKYVKSDRSPTAVLSFRG  490

Query  893   TVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVE  1072
             TV+   PS P VA+FSSRGPN +  +ILKPDVI PGVNILAGWS A GP+G   D R+  
Sbjct  491   TVVNVRPS-PVVAAFSSRGPNTVTQQILKPDVIGPGVNILAGWSEAAGPTGLESDTRKTL  549

Query  1073  FNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             FNI+SGTSM+CPH+SG+AALL+ AHP WSP+AIKSALM
Sbjct  550   FNILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALM  587



>gb|KHN10472.1| Subtilisin-like protease [Glycine soja]
Length=711

 Score =   434 bits (1116),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 227/402 (56%), Positives = 285/402 (71%), Gaps = 12/402 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR FY GYEA  G  INE  E KSPRD++GHGTHTA+   GS V  A+L GYA G 
Sbjct  122   KVVGARVFYHGYEAAIGR-INEQKEYKSPRDQDGHGTHTAATVGGSPVHGANLLGYANGT  180

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA   RIA YK+CW  GC+ SDI+SA D+AV DGV+V+S+S+         YYRDS 
Sbjct  181   ARGMAPGTRIAAYKVCWIGGCFSSDIVSAIDKAVADGVNVLSISLG---GGVSSYYRDSL  237

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             ++ AFGAME GV VS  AGN+GP   + TNV+PWI TVGAST+DR FP+DV LG+G+   
Sbjct  238   SVAAFGAMERGVFVSCSAGNSGPDPASLTNVSPWITTVGASTMDRDFPSDVKLGNGKKII  297

Query  542   GMSLYSGEPLG--DNKLPLVYGGDANS-----TYCYSGELIASKVTGKIVFCERGGNLDV  700
             G+SLY G+ +     + PLVY G  +S     + C  G L    V+GKIV C+RG +  V
Sbjct  298   GVSLYKGKNVLSIKKQYPLVYLGSNSSRVDPRSMCLEGTLDPKVVSGKIVICDRGLSPRV  357

Query  701   DKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAI  880
              KG  VR AGGVGMI+  T   GE + A +H++PA  + E +G ++K Y+ S+ + TAA+
Sbjct  358   LKGHVVRSAGGVGMILTNTEANGEELVADSHLLPAVAIGEKEGKELKSYVLSSKTATAAL  417

Query  881   VFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQ  1060
              F+GT++G  PS P VA+FSSRGPN L  EILKPD++APGVNILA WS AIGPSG  +D 
Sbjct  418   AFKGTILGIKPS-PVVAAFSSRGPNFLSLEILKPDLVAPGVNILAAWSEAIGPSGLKIDN  476

Query  1061  RRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             RRV+FNI+SGTSM+CPHVSG+AAL++  HP WSPAAIKSALM
Sbjct  477   RRVKFNIVSGTSMSCPHVSGVAALVKSRHPEWSPAAIKSALM  518



>ref|XP_007160895.1| hypothetical protein PHAVU_001G026100g [Phaseolus vulgaris]
 gb|ESW32889.1| hypothetical protein PHAVU_001G026100g [Phaseolus vulgaris]
Length=777

 Score =   436 bits (1121),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 218/399 (55%), Positives = 282/399 (71%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR F KGYE+  G P++ S E KS RD  GHG+HT + AAGS+V  ASLFG A G 
Sbjct  189   KLVGARFFSKGYESALG-PVDLSTESKSARDDEGHGSHTLTTAAGSVVPEASLFGLASGT  247

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDI +  D+A++DGV+V+S+S+        +YYRD  
Sbjct  248   ARGMAAQARVAAYKVCWLGGCFSSDIAAGIDKAIEDGVNVLSMSIG---GSLTEYYRDII  304

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+F A  HG++VS  AGN GP + T +NV+PW+ TVGA T+DR FPA + LG+G+ + 
Sbjct  305   AIGSFTATSHGILVSMSAGNAGPSSSTLSNVSPWVTTVGAGTLDRDFPALITLGNGKTYA  364

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G SLY+G+P+ D+ LPLVY G+A+++     C    LI  KV+GKIV CERGGN  V+KG
Sbjct  365   GASLYNGKPVLDSPLPLVYAGNASNSSVGYLCLQDSLIPEKVSGKIVICERGGNPRVEKG  424

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+ AGG GMI+      GE +    H++PA ++ +     +K Y +S+ +PTA I F 
Sbjct  425   LVVKLAGGAGMILANNEAFGEELVTDPHLLPAASLGQKSSQILKSYASSSANPTAKIAFL  484

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +   PS P VA+FSSRGPN L   ILKPD IAPGVNILAGW+GA+GP+G   D R V
Sbjct  485   GTQLEVKPS-PVVAAFSSRGPNALTPNILKPDFIAPGVNILAGWTGAVGPTGLTADDRHV  543

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPHVSGLAA+L+ AHP WSPAAI+SALM
Sbjct  544   SFNIISGTSMSCPHVSGLAAILKGAHPQWSPAAIRSALM  582



>ref|XP_011072681.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=792

 Score =   436 bits (1122),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 240/408 (59%), Positives = 283/408 (69%), Gaps = 21/408 (5%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F  GYEA  G  +NE+ E +SPRD +GHGTHTASIAAG  V  AS  GYA+G 
Sbjct  197   KLIGARYFCNGYEATNGK-MNETNEFRSPRDSDGHGTHTASIAAGRYVFPASTLGYARGV  255

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSV---AIPRAYPEDYYR  352
             A GMA KAR+A YK+CW+ GCYDSDIL+AFD AV DGV VISLSV    +P      YY 
Sbjct  256   AAGMAPKARLAAYKVCWNAGCYDSDILAAFDAAVADGVDVISLSVGGVVVP------YYL  309

Query  353   DSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGR  532
             D+ AIGAFGA + GV VS  AGN GPG  T TNVAPW+ TVGA TIDR FPADV LG+GR
Sbjct  310   DAIAIGAFGAFDAGVFVSASAGNGGPGGLTVTNVAPWVTTVGAGTIDRDFPADVKLGNGR  369

Query  533   IFTGMSLYSGEPLGDNKL-PLVYGGDA-----NSTYCYSGELIASKVTGKIVFCERGGNL  694
             I  G+S+Y G  L  +KL PL+Y G       +S+ C  G L  + V GKIV C+RG N 
Sbjct  370   IIPGVSVYGGPALAHDKLYPLIYAGSEGSDGYSSSLCLEGSLDPNAVRGKIVLCDRGINS  429

Query  695   DVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPS---  865
                KG  V++AGG+ MI+      GE + A  HV+PAT V    G++I+ YI SA     
Sbjct  430   RAAKGEVVKKAGGIAMILANGVFDGEGLVADCHVLPATAVGATSGDEIRRYIQSAMKSKS  489

Query  866   -PTAAIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPS  1042
              P A I+FRGT +  +P AP VASFS+RGPNP   EILKPD+IAPG+NILA W   +GPS
Sbjct  490   PPVATIIFRGTRLHVAP-APVVASFSARGPNPETPEILKPDLIAPGLNILAAWPDNVGPS  548

Query  1043  GSVMDQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             G   D+RR EFNI+SGTSMACPHVSGLAALL+ AHP WSPAAI+SALM
Sbjct  549   GIPSDKRRTEFNILSGTSMACPHVSGLAALLKAAHPEWSPAAIRSALM  596



>gb|ACN39811.1| unknown [Picea sitchensis]
Length=690

 Score =   433 bits (1113),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 230/405 (57%), Positives = 288/405 (71%), Gaps = 16/405 (4%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR   +GYEA  G PINE+ E +SPRD++GHGTHTAS AAG++V  A L GYA+G 
Sbjct  187   KLIGARFLSRGYEAAVG-PINETAEFRSPRDQDGHGTHTASTAAGAVVLKADLVGYAKGT  245

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +ARIA YK+CW  GC+ +DIL+A D+AV DGV+V+SLS+       E YYRDS 
Sbjct  246   ARGMATRARIAAYKVCWVGGCFSTDILAALDKAVADGVNVLSLSLG---GGLEPYYRDSI  302

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             ++G FGAME G+ VS  AGN GP   + +NVAPWI T+GA T+DR FPA V LG+G  FT
Sbjct  303   SLGTFGAMEKGIFVSCSAGNGGPDPISLSNVAPWIATIGAGTLDRDFPAYVELGNGLNFT  362

Query  542   GMSLYSGE---PLGDNKLPLVYGGDANS-------TYCYSGELIASKVTGKIVFCERGGN  691
             G+SLY G    P G+ ++PLVY G   S         C++G L    V GK+V C+RG +
Sbjct  363   GVSLYHGRRGLPSGE-QVPLVYFGSNTSAGSRSATNLCFAGSLDRKLVAGKMVVCDRGIS  421

Query  692   LDVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPT  871
               V KG  V+ AGGVGMI+  T   GE + A  H++PA+ V E +G+ IK YI S  +PT
Sbjct  422   ARVAKGAVVKSAGGVGMILANTDANGEELVADCHLLPASAVGEANGDAIKHYITSTKNPT  481

Query  872   AAIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSV  1051
             A I F GTV+G  PS P VA+FSSRGPN +  EILKPD+IAPG+NILA W+G  GP+G  
Sbjct  482   ATIHFGGTVLGVKPS-PVVAAFSSRGPNLVNPEILKPDMIAPGLNILAAWTGITGPTGLS  540

Query  1052  MDQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              D RRV+FNI+SGTSM+CPHV+G+AAL++ AHP WSPAAIKSALM
Sbjct  541   DDLRRVKFNILSGTSMSCPHVTGIAALMKGAHPEWSPAAIKSALM  585



>ref|XP_006490276.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
 gb|KDO65327.1| hypothetical protein CISIN_1g044578mg [Citrus sinensis]
Length=769

 Score =   435 bits (1118),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 231/400 (58%), Positives = 284/400 (71%), Gaps = 10/400 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KI+GAR FY+GYEA TG  INE  E KSPRD++GHGTHTA+  AGS V  A+L GYA G 
Sbjct  186   KIVGARVFYRGYEAATGK-INEQNEYKSPRDQDGHGTHTAATVAGSPVHGANLLGYAYGT  244

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGM+  ARIAVYK+CWS GC+ SDILSA D+AV DGV+V+S+S+         Y+RDS 
Sbjct  245   ARGMSTGARIAVYKVCWSGGCFSSDILSAVDRAVADGVNVLSISLG---GGVSSYHRDSL  301

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             +I  FGAME GV VS  AGN GP   + TNV+PWI TVGAST+DR FPA V LG GR  T
Sbjct  302   SIATFGAMEMGVFVSCSAGNGGPDPVSLTNVSPWITTVGASTLDRDFPATVKLGTGRTIT  361

Query  542   GMSLYSGEP--LGDNKLPLVYGGDANST---YCYSGELIASKVTGKIVFCERGGNLDVDK  706
             G+SLY G    L + + P+VY G  +S     C  G L  + V GKIV C+RG +  V K
Sbjct  362   GVSLYKGRRALLPNKQYPVVYMGSNSSNSSSLCLEGTLNPTTVAGKIVICDRGISPRVQK  421

Query  707   GFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVF  886
             G  V++AGG+G+I+  TA  GE + A  H++PA  V E++G +IK+Y +++P  TA++  
Sbjct  422   GQVVKDAGGIGVILANTAANGEELVADCHLLPAVAVGEIEGKEIKQYASTSPKATASLAL  481

Query  887   RGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRR  1066
              GT +G  PS P VA+FSSRGPN L  EILKPD++APGVNILA WSG  GPS    D RR
Sbjct  482   LGTRVGIKPS-PVVAAFSSRGPNFLTLEILKPDIVAPGVNILAAWSGETGPSSLPADHRR  540

Query  1067  VEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             V+FNI+SGTSM+CPHVSG+AALL+  HP WSPAAIKSALM
Sbjct  541   VKFNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALM  580



>ref|XP_003549134.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=781

 Score =   435 bits (1119),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 228/402 (57%), Positives = 285/402 (71%), Gaps = 12/402 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K++GAR FY GYEA  G  INE  E KSPRD++GHGTHTA+   GS V  A+L GYA G 
Sbjct  192   KVVGARVFYHGYEAAIGR-INEQKEYKSPRDQDGHGTHTAATVGGSPVHGANLLGYANGT  250

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  ARIA YK+CW  GC+ SDI+SA D+AV DGV+V+S+S+         YYRDS 
Sbjct  251   ARGMAPGARIAAYKVCWVGGCFSSDIVSAIDKAVADGVNVLSISLG---GGVSSYYRDSL  307

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             ++ AFGAME GV VS  AGN GP   + TNV+PWI TVGAST+DR FPADV LG+G+  T
Sbjct  308   SVAAFGAMERGVFVSCSAGNAGPDPASLTNVSPWITTVGASTMDRDFPADVRLGNGKKVT  367

Query  542   GMSLYSGEPLG--DNKLPLVYGGDANS-----TYCYSGELIASKVTGKIVFCERGGNLDV  700
             G+SLY G+ +   + + PLVY G  +S     + C  G L    V+GKIV C+RG +  V
Sbjct  368   GVSLYKGKNVLSIEKQYPLVYMGSNSSRVDPRSMCLEGTLDPKVVSGKIVICDRGLSPRV  427

Query  701   DKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAI  880
              KG  VR AGGVGMI+  T   GE + A +H++PA  + E +G ++K Y+ S+ S TA +
Sbjct  428   QKGNVVRSAGGVGMILTNTEANGEELVADSHLLPAVAIGEKEGKELKSYVLSSKSSTATL  487

Query  881   VFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQ  1060
              F+GT +G  PS P VA+FSSRGPN L  +ILKPD++APGVNILA WS AIGPSG  +D 
Sbjct  488   AFKGTRLGIKPS-PIVAAFSSRGPNFLTLDILKPDLVAPGVNILAAWSEAIGPSGLKIDN  546

Query  1061  RRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             R+V+FNI+SGTSM+CPHVSG+AAL++  HP WSPAAIKSALM
Sbjct  547   RKVKFNIVSGTSMSCPHVSGIAALVKSRHPEWSPAAIKSALM  588



>ref|XP_010261834.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=773

 Score =   435 bits (1118),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 225/397 (57%), Positives = 286/397 (72%), Gaps = 6/397 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINES-VEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGAR+F KGY   +G+  ++   E +SPRDR+GHGTHTAS AAGS VANASL GYA G
Sbjct  189   KLIGARSFSKGYRMASGASYSKKPKETESPRDRDGHGTHTASTAAGSHVANASLLGYASG  248

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA +AR+A YK+CWS GC+ SDIL+  DQA+ DGV V+SLS+    A    YYRD+
Sbjct  249   TARGMATRARVATYKVCWSTGCFGSDILAGMDQAIADGVDVLSLSLGGGSA---PYYRDT  305

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAF AME G+ VS  AGN+GP   +  NVAPWI TVGA T+DR FPA   LG+G+ F
Sbjct  306   IAIGAFTAMEMGIFVSCSAGNSGPSRASLANVAPWIATVGAGTLDRDFPAYAHLGNGKRF  365

Query  539   TGMSLYSGEPLGDNKLPLVYG-GDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFA  715
             +G+SLYSG+ +G   + L YG G+  S  C  G L    V GK+V C+RG +  V+KG  
Sbjct  366   SGVSLYSGKGMGTKPVSLFYGKGNETSNLCLPGSLEPELVRGKVVLCDRGISARVEKGAV  425

Query  716   VREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGT  895
             VR+AGG+GMI+  TA +GE + A +H++PA  V    G+ I+EY  S P+P A + F GT
Sbjct  426   VRDAGGLGMILANTAASGEELVADSHLLPAVAVGRKVGDMIREYARSDPNPMAVLSFGGT  485

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             V+  +PS P VA+FSSRGPN +  +ILKPD+I PGVNILA WS ++GP+G V D R+  F
Sbjct  486   VLNVTPS-PVVAAFSSRGPNVVTPQILKPDLIGPGVNILAAWSESVGPTGLVKDTRKTGF  544

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NI+SGTSM+CPH+SG+AALL+ AHP WSP+AIKSALM
Sbjct  545   NIMSGTSMSCPHISGVAALLKAAHPNWSPSAIKSALM  581



>ref|XP_002886065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62324.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=765

 Score =   434 bits (1117),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 230/399 (58%), Positives = 277/399 (69%), Gaps = 5/399 (1%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KI+GAR F KG +A   S IN++VE  SPRD +GHG+HTAS AAG     A++ GYA G 
Sbjct  173   KIVGARFFAKGQQAAMFSGINKTVEFLSPRDADGHGSHTASTAAGRQAFRANMAGYASGV  232

Query  182   ARGMAIKARIAVYKICWS-LGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
             A+G+A KARIA YK+CW   GC DSDIL+AFD AV DGV +IS+S+      P  YY D 
Sbjct  233   AKGVAPKARIAAYKVCWKDSGCLDSDILAAFDAAVSDGVDIISISIGGGDGIPSPYYLDP  292

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIG++GA   GV VS+ AGN GP   + TN+APWI TVGA TIDR FPADVVLGDG   
Sbjct  293   IAIGSYGAASMGVFVSSSAGNDGPNGMSVTNLAPWITTVGAGTIDRDFPADVVLGDGHRL  352

Query  539   TGMSLYSGEPLGDNKLPLVYGGDAN---STYCYSGELIASKVTGKIVFCERGGNLDVDKG  709
              G+SLYSG PL     P+VY G      ++ C    L A  V GKIV C+RG N  V KG
Sbjct  353   RGVSLYSGVPLNGQMFPVVYPGKKGMLAASLCMENSLDAKLVRGKIVICDRGSNPRVAKG  412

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V++AGGVGMI+      GE +   AH+IPA+NV    G++IK Y ++ P+P A I F+
Sbjct  413   LVVKKAGGVGMILANAVSNGEGLVGDAHLIPASNVGSSAGDRIKAYASTHPNPIATIDFK  472

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GTVIG  P AP VASFS RGPN L  EILKPD+IAPGVNILA W+ A+GP+G V D+R+ 
Sbjct  473   GTVIGVKP-APVVASFSGRGPNGLNPEILKPDLIAPGVNILAAWTDAVGPTGIVSDRRKT  531

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             EFNI+SGTSMACPHVSG  ALL+ AHP WSPAAI+SA+M
Sbjct  532   EFNILSGTSMACPHVSGATALLKSAHPDWSPAAIRSAMM  570



>ref|XP_011069783.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=769

 Score =   434 bits (1117),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 226/399 (57%), Positives = 287/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F +GYEA  G PI+E+ E KSPRD +GHGTHT++ AAGS V  ASLFGYA G 
Sbjct  182   KLIGARFFSEGYEAAFG-PIDETAESKSPRDDDGHGTHTSTTAAGSTVVGASLFGYAAGT  240

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  AR+A YK+CW  GC  SDIL+  ++A++DGVH++SLS+    +   +Y+RD+ 
Sbjct  241   ARGMARHARVAAYKVCWLGGCLGSDILAGMEKAIEDGVHILSLSLGGSLS---EYFRDTV  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A   G++VS  AGN GP   + +NVAPWI TVGA T+DR FPA V LG+G+  T
Sbjct  298   AIGAFAATSKGILVSCSAGNGGPSPGSLSNVAPWITTVGAGTMDRQFPAYVTLGNGKKLT  357

Query  542   GMSLYSGEPLGDNKLPLVYGGDANST----YCYSGELIASKVTGKIVFCERGGNLDVDKG  709
             G S+YSG+ L  + +PLVY  + +ST     C  G LI  KV GKIV C+RG N    K 
Sbjct  358   GASVYSGKSLAGSLMPLVYARNVSSTSNGNLCTKGSLIPEKVKGKIVVCDRGMNPRAQKS  417

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V++AGG+GM++  T   GE + A AH IP   V ++ G++IK+YI S P+P+A I   
Sbjct  418   LEVKDAGGIGMVLSNTDAFGEELVADAHFIPTAAVGQIAGDEIKKYILSEPNPSATIASA  477

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
             GT +G  PS P VA+FSSRGPNP+  +ILKPD+IAPGVNILAGW+G +GP+G   D R V
Sbjct  478   GTQLGVQPS-PVVAAFSSRGPNPITPDILKPDLIAPGVNILAGWTGKVGPTGLPEDTRHV  536

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +FNIISGTSM+CPHVSGLAAL++ AHP WSPAAI+SALM
Sbjct  537   DFNIISGTSMSCPHVSGLAALVKAAHPEWSPAAIRSALM  575



>ref|XP_011001975.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score =   434 bits (1117),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 231/404 (57%), Positives = 286/404 (71%), Gaps = 10/404 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGS-----PINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFG  166
             K+IGAR F KG+EA +GS     PINE+VE KSPRD +GHGTHTAS AAG  V  AS+ G
Sbjct  177   KLIGARFFIKGHEAASGSTGPITPINETVEFKSPRDADGHGTHTASTAAGRHVFGASMEG  236

Query  167   YAQGEARGMAIKARIAVYKICW-SLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPED  343
             YA G A+G+A KAR+AVYK+CW + GC+DSDIL+AFD AVKDGV VIS+S+         
Sbjct  237   YAAGIAKGVAPKARLAVYKVCWKNAGCFDSDILAAFDAAVKDGVDVISISIGGGDGISAP  296

Query  344   YYRDSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLG  523
             YY D  AIGA+GA   GV VS+ AGN GP   + TN+APWI+TVGA TIDR FPA+VVLG
Sbjct  297   YYLDPIAIGAYGAASRGVFVSSSAGNDGPNLMSVTNLAPWIVTVGAGTIDRNFPAEVVLG  356

Query  524   DGRIFTGMSLYSGEPLGDNKLPLVYGGDA---NSTYCYSGELIASKVTGKIVFCERGGNL  694
             +G+  +G+SLY+G PL     PLVY G +   +++ C    L    V GKIV C+RG + 
Sbjct  357   NGKRLSGVSLYAGLPLSGKMYPLVYPGKSGVLSASLCMENSLDPRVVKGKIVVCDRGSSA  416

Query  695   DVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTA  874
              V KG  V++AGGVGMI+      GE +   AH+IP   +   +G+ +K Y+++  +P A
Sbjct  417   RVAKGLVVKKAGGVGMILANGISNGEGLVGDAHLIPTCALGSDEGDTVKAYVSATSNPVA  476

Query  875   AIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVM  1054
              I F+GTVIG  P AP VASFS RGPN L  EILKPD+IAPGVNILA W+ A+GP+G   
Sbjct  477   TIAFKGTVIGIKP-APVVASFSGRGPNGLTPEILKPDLIAPGVNILAAWTDAVGPTGLDS  535

Query  1055  DQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             D R+ EFNI+SGTSMACPHVSG AALL+ AHP WSPAAI+SA+M
Sbjct  536   DTRKTEFNILSGTSMACPHVSGAAALLKSAHPDWSPAAIRSAMM  579



>ref|XP_007219861.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
 gb|EMJ21060.1| hypothetical protein PRUPE_ppa1027166mg [Prunus persica]
Length=780

 Score =   435 bits (1118),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 233/402 (58%), Positives = 280/402 (70%), Gaps = 12/402 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KI+GAR FY GYEA TG  INE  E KSPRD++GHGTHTA+  AGS V  A+L GYA G 
Sbjct  195   KIVGARIFYHGYEAATGK-INEQTEFKSPRDQDGHGTHTAATVAGSPVRGANLLGYAHGT  253

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  ARIA YK+CW  GC+ SDILSA D+AV DGV+V+S+S+         YYRDS 
Sbjct  254   ARGMAPGARIAAYKVCWVGGCFSSDILSAVDKAVADGVNVLSISLG---GGVSAYYRDSL  310

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             +I AFGAME GV VS  AGN GP   + TNV+PWI TVGAST+DR FP+ V LG+GR  T
Sbjct  311   SIAAFGAMEMGVFVSCSAGNGGPDPVSLTNVSPWITTVGASTMDRDFPSSVKLGNGRTVT  370

Query  542   GMSLYSGEPL--GDNKLPLVYGGDAN-----STYCYSGELIASKVTGKIVFCERGGNLDV  700
             G+SLY G  +   + + P+VY GD +     S+ C  G L    V GKIV C+RG +  V
Sbjct  371   GVSLYKGRMMLSTNKQYPVVYMGDNSTSPDPSSLCLEGTLDRRVVAGKIVICDRGISPRV  430

Query  701   DKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAI  880
              KG  V++AGGVGMI+  TA  GE + A  H++PA  V E +   IK Y  ++P  TA +
Sbjct  431   QKGQVVKDAGGVGMILANTAANGEELVADCHLVPAVAVGETEAKAIKHYALTSPRATATL  490

Query  881   VFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQ  1060
              F GT  G  PS P VA+FSSRGPN +  EILKPDV+APGVNILA W+GA+GPS    D 
Sbjct  491   AFLGTRTGVRPS-PVVAAFSSRGPNFVSLEILKPDVVAPGVNILAAWTGALGPSSLPTDH  549

Query  1061  RRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             RRV+FNI+SGTSM+CPHVSG+AALL+  HP WSPAAIKSALM
Sbjct  550   RRVKFNILSGTSMSCPHVSGIAALLKARHPEWSPAAIKSALM  591



>ref|XP_011001974.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score =   434 bits (1117),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 231/404 (57%), Positives = 286/404 (71%), Gaps = 10/404 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGS-----PINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFG  166
             K+IGAR F KG+EA +GS     PINE+VE KSPRD +GHGTHTAS AAG  V  AS+ G
Sbjct  177   KLIGARFFIKGHEAASGSTGPITPINETVEFKSPRDADGHGTHTASTAAGRHVFGASMEG  236

Query  167   YAQGEARGMAIKARIAVYKICW-SLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPED  343
             YA G A+G+A KAR+AVYK+CW + GC+DSDIL+AFD AVKDGV VIS+S+         
Sbjct  237   YAAGIAKGVAPKARLAVYKVCWKNAGCFDSDILAAFDAAVKDGVDVISISIGGGDGISAP  296

Query  344   YYRDSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLG  523
             YY D  AIGA+GA   GV VS+ AGN GP   + TN+APWI+TVGA TIDR FPA+VVLG
Sbjct  297   YYLDPIAIGAYGAASRGVFVSSSAGNDGPNLMSVTNLAPWIVTVGAGTIDRNFPAEVVLG  356

Query  524   DGRIFTGMSLYSGEPLGDNKLPLVYGGDA---NSTYCYSGELIASKVTGKIVFCERGGNL  694
             +G+  +G+SLY+G PL     PLVY G +   +++ C    L    V GKIV C+RG + 
Sbjct  357   NGKRLSGVSLYAGLPLSGKMYPLVYPGKSGVLSASLCMENSLDPRVVKGKIVVCDRGSSA  416

Query  695   DVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTA  874
              V KG  V++AGGVGMI+      GE +   AH+IP   +   +G+ +K Y+++  +P A
Sbjct  417   RVAKGLVVKKAGGVGMILANGISNGEGLVGDAHLIPTCALGSDEGDTVKAYVSATSNPVA  476

Query  875   AIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVM  1054
              I F+GTVIG  P AP VASFS RGPN L  EILKPD+IAPGVNILA W+ A+GP+G   
Sbjct  477   TIAFKGTVIGIKP-APVVASFSGRGPNGLTPEILKPDLIAPGVNILAAWTDAVGPTGLDS  535

Query  1055  DQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             D R+ EFNI+SGTSMACPHVSG AALL+ AHP WSPAAI+SA+M
Sbjct  536   DTRKTEFNILSGTSMACPHVSGAAALLKSAHPDWSPAAIRSAMM  579



>ref|XP_004142885.1| PREDICTED: subtilisin-like protease-like isoform 2 [Cucumis sativus]
 ref|XP_004172334.1| PREDICTED: subtilisin-like protease-like isoform 2 [Cucumis sativus]
Length=641

 Score =   430 bits (1106),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 231/399 (58%), Positives = 287/399 (72%), Gaps = 9/399 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGAR F KGYEA  G PI+ES E KSPRD +GHG+HT++ AAGS V  A+LFG+A G 
Sbjct  183   KLIGARYFSKGYEAAFG-PIDESQESKSPRDDDGHGSHTSTTAAGSAVTGANLFGFAAGT  241

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA +AR+A YK+CW  GC+ SDIL+A D++V+DG +++S+S+    A   DYYRD+ 
Sbjct  242   ARGMAAEARVATYKVCWLGGCFSSDILAAMDKSVEDGCNILSVSLGGNSA---DYYRDNV  298

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIGAF A   GV VS  AGN GP + T +NVAPWI TVGA T+DR FPA V LG+G+  T
Sbjct  299   AIGAFSATAQGVFVSCSAGNGGPSSSTLSNVAPWITTVGAGTLDRDFPAYVTLGNGKKIT  358

Query  542   GMSLYSGEPLGDNKLPLVYGGDANSTYCYSG----ELIASKVTGKIVFCERGGNLDVDKG  709
             G SLYSG+PL ++ LP+V    A+++   S      L  +KVTGKIV C+RGGN  V KG
Sbjct  359   GESLYSGKPLPNSLLPIVSAASASNSSSGSLCLSGTLNPAKVTGKIVVCDRGGNSRVQKG  418

Query  710   FAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFR  889
               V+EAGG+GMI+  T   GE   A AH+IP   V +  G+ IK YI+S  +PTA I   
Sbjct  419   VVVKEAGGLGMILANTEAYGEEQLADAHLIPTAAVGQKAGDAIKNYISSDSNPTATISTG  478

Query  890   GTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRV  1069
              T +G  PS P VA+FSSRGPN L  +ILKPD+IAPGVNILAGW+G  GP+G   D+R V
Sbjct  479   TTRLGVQPS-PVVAAFSSRGPNLLTPQILKPDLIAPGVNILAGWTGGAGPTGLDSDKRHV  537

Query  1070  EFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              FNIISGTSM+CPH+SGLAAL++ AHP WSPAAI+SALM
Sbjct  538   AFNIISGTSMSCPHISGLAALVKAAHPDWSPAAIRSALM  576



>ref|XP_009348638.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=846

 Score =   436 bits (1122),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 236/403 (59%), Positives = 284/403 (70%), Gaps = 14/403 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             KI+GAR FY GYEA TG  INE  E KSPRD++GHGTHTA+  AGS V  A+L GYA+G 
Sbjct  261   KIVGARIFYHGYEAATGK-INEQTEFKSPRDQDGHGTHTAATVAGSPVRGANLLGYARGT  319

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARGMA  ARIA YK+CW  GC+ SDILSA D+AV DGV+V+S+S+         YYRDS 
Sbjct  320   ARGMAPSARIAAYKVCWVGGCFSSDILSAVDRAVTDGVNVLSISLG---GGVSSYYRDSL  376

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             ++ AFGAME G+ VS  AGN GP   + TNV+PWI TVGAST+DR FPA V LG+GR  T
Sbjct  377   SVAAFGAMEMGIFVSCSAGNGGPDPVSLTNVSPWITTVGASTMDRDFPATVKLGNGRTIT  436

Query  542   GMSLYSGE-PLGDNK-LPLVYGGDANST------YCYSGELIASKVTGKIVFCERGGNLD  697
             G+SLY G   L  NK  P+VY G +NST       C  G L    V GKIV C+RG +  
Sbjct  437   GVSLYRGRMKLSTNKQYPVVYLG-SNSTSPNPGSLCLEGTLDRRVVAGKIVICDRGISPR  495

Query  698   VDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAA  877
             V KG  V+EAGGVGMI+  TA  GE + A  H++PA  V E +   IK Y +++P  TA 
Sbjct  496   VQKGEVVKEAGGVGMILANTAANGEELVADCHLVPAVAVGENEAKGIKHYASTSPRATAT  555

Query  878   IVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMD  1057
             + F GT +G  PS P VA+FSSRGPN +  EILKPD++APGVNILA W+GA+GPS    D
Sbjct  556   LTFLGTRVGVRPS-PVVAAFSSRGPNLVSLEILKPDMVAPGVNILAAWTGALGPSSLPAD  614

Query  1058  QRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             +RRV+FNI+SGTSM+CPHVSG+AALL+  HP WSPAAIKSALM
Sbjct  615   RRRVKFNILSGTSMSCPHVSGIAALLKARHPDWSPAAIKSALM  657



>ref|XP_010686124.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=771

 Score =   434 bits (1117),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 233/398 (59%), Positives = 286/398 (72%), Gaps = 7/398 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQGE  181
             K+IGA AFY GYEA  G    +  E KSP+D NGHGTH ASIAAGS V NA+LF YA+G 
Sbjct  182   KLIGAYAFYAGYEANYGRLPRK--ERKSPKDYNGHGTHCASIAAGSKVVNAALFNYAKGT  239

Query  182   ARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDST  361
             ARG+A KARIA YK CW   C DSDIL+A D+A+KDGVH+IS S+    A   D+   + 
Sbjct  240   ARGVATKARIAAYKACWGSECQDSDILAAMDKAIKDGVHIISASIGSFPAVQYDF--SAI  297

Query  362   AIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIFT  541
             AIG+  A + GV+VS+ AGN GPG  T +NVAPW+L VGAS+IDR F ADV L DGR F+
Sbjct  298   AIGSAHAAQSGVLVSSAAGNDGPGRGTVSNVAPWMLVVGASSIDRQFEADVTLADGRTFS  357

Query  542   GMSLYSGEPLGDNK-LPLVYGGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFAV  718
             G++LY G+P  D + LP+V G ++ S  C  G+L  +KV GKIV CE G   D +  ++V
Sbjct  358   GVTLYPGDPSADAQFLPIVTGENSGSKNCKRGQLQKTKVKGKIVVCEYGKIADTEMSYSV  417

Query  719   REAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAA-IVFRGT  895
             +EAGG GMI+   A  G  + + A+ IPA  V    G+ IK+Y ++    T+A I FRGT
Sbjct  418   QEAGGAGMILINDANWGAELRSQAYFIPAVMVSYSAGDAIKKYASTPTIKTSAKIKFRGT  477

Query  896   VIGT-SPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVE  1072
             V G+ +PS+PRVA+FSSRGPN +  EILKPDVIAPGVNILA WSGA GP+G   D RRVE
Sbjct  478   VTGSATPSSPRVAAFSSRGPNIVNTEILKPDVIAPGVNILAAWSGAAGPTGLDFDTRRVE  537

Query  1073  FNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             FNIISGTSMACPHVSGLAA+L+KAHPTW+PAAI SA+M
Sbjct  538   FNIISGTSMACPHVSGLAAMLKKAHPTWTPAAIMSAIM  575



>ref|XP_010111995.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32306.1| Subtilisin-like protease [Morus notabilis]
Length=733

 Score =   433 bits (1113),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 230/400 (58%), Positives = 281/400 (70%), Gaps = 9/400 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEA--FTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQ  175
             K+IGARAF  GY      GS +N+S E  SPRD +GHGTH AS AAG++ +NAS FGYA+
Sbjct  188   KLIGARAFLAGYHMSNLGGSGLNQSAETNSPRDTDGHGTHVASTAAGAVASNASFFGYAK  247

Query  176   GEARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRD  355
             G A G+A KARIAVYK+C +  C  SD+L+  DQAV DGVH+IS+S++      + YY+D
Sbjct  248   GVAIGVAPKARIAVYKVCLTSTCKQSDMLAGMDQAVSDGVHIISMSIS---GGTDPYYKD  304

Query  356   STAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRI  535
               AI +FGAM HGV++S  AGN GP   T  ++ PW+LTVGAS++DR F ADV LGDGR 
Sbjct  305   IMAIASFGAMRHGVLLSLAAGNDGPDPFTVNHLPPWVLTVGASSVDREFSADVALGDGRT  364

Query  536   FTGMSLYSGEPLGDNK-LPLVYGGDANSTYCYSGELI-ASKVTGKIVFCERGGNLD-VDK  706
             F G SLY G      K   LVY GD  + +C  G+    +++ GKIV C+ GG    +DK
Sbjct  365   FLGSSLYYGPHFPFYKQYKLVYAGDFGNKFCSPGDFTNQNQLAGKIVVCDYGGETSSLDK  424

Query  707   GFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVF  886
             GFAV++  G G I+   A  GE + A  HV P T V   DG KIK YI S+ +PTA I+F
Sbjct  425   GFAVKDVNGRGTIIANNAQVGEELSAEPHVTPTTQVGIKDGRKIKRYIKSSRNPTANILF  484

Query  887   RGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRR  1066
              GTVIGTSP APRVA+FS+RGPNPL  +ILKPDVIAPG+NILA W+  +GPSG   D R+
Sbjct  485   HGTVIGTSPPAPRVAAFSNRGPNPLTPQILKPDVIAPGLNILAAWTQVVGPSGE-GDTRQ  543

Query  1067  VEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             VEFNIISGTSMA PHVSG+AALLR A+P WSPAAIKSALM
Sbjct  544   VEFNIISGTSMAAPHVSGIAALLRNAYPDWSPAAIKSALM  583



>ref|XP_002516266.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF46268.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=768

 Score =   434 bits (1116),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 225/397 (57%), Positives = 286/397 (72%), Gaps = 6/397 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYE-AFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGAR F KGY  A  GS + +S E +SPRD+ GHGTHTAS AAGS V NASL GYA G
Sbjct  183   KLIGARFFSKGYRMASAGSYLKKSKEIESPRDQEGHGTHTASTAAGSQVVNASLLGYASG  242

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA  AR++ YK+CWS GCY SDIL+  D+A+ DGV V+SLS+    A    YYRD+
Sbjct  243   NARGMATHARVSSYKVCWSTGCYASDILAGMDKAIADGVDVLSLSLGGGSA---PYYRDT  299

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              A+GAF A+E G+ VS  AGN+GP   T  NVAPWI+TVGA T+DR FPA  VLG+   F
Sbjct  300   IAVGAFAAVERGIFVSCSAGNSGPSKATLANVAPWIMTVGAGTLDRDFPAYAVLGNQNRF  359

Query  539   TGMSLYSGEPLGDNKLPLVYG-GDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGFA  715
             TG+SLYSG  +G+  + LVY  G+++S  C  G L+ S V GK+V C+RG N  V+KG  
Sbjct  360   TGVSLYSGTGMGNKPVGLVYNKGNSSSNLCLPGSLVPSIVRGKVVVCDRGINPRVEKGAV  419

Query  716   VREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRGT  895
             VR+AGG+GMI+  TA +GE + A +H++PA  V    G+ I+EY+  + +PTA + F GT
Sbjct  420   VRDAGGIGMILANTAASGEELVADSHLLPAVAVGSKAGDMIREYMKGSRNPTALLSFGGT  479

Query  896   VIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVEF  1075
             V+   PS P VA+FSSRGPN +  +ILKPD+I PGVNILA WS A+GP+G   D R+ +F
Sbjct  480   VLNVRPS-PVVAAFSSRGPNMVTPQILKPDLIGPGVNILAAWSEAVGPTGLEKDTRKTQF  538

Query  1076  NIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             NI+SGTSM+CPH+SG+AALL+ A P WSP+AIKSALM
Sbjct  539   NIMSGTSMSCPHISGVAALLKAARPGWSPSAIKSALM  575



>ref|XP_004144036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004166699.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=763

 Score =   434 bits (1116),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 226/398 (57%), Positives = 289/398 (73%), Gaps = 7/398 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYE-AFTGSPINESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGAR+F KGY+ A  G    +  E +S RD++GHGTHTAS AAGS VANASL GYA+G
Sbjct  182   KLIGARSFSKGYQMASGGGYFRKPRENESARDQDGHGTHTASTAAGSHVANASLLGYARG  241

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA +AR+A YK CW  GC+ SDIL+  D+A+ DGV V+SLS+    A    YYRD+
Sbjct  242   IARGMAPQARVAAYKTCWPTGCFGSDILAGMDRAIMDGVDVLSLSLGGGSA---PYYRDT  298

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAF AME GV VS  AGN+GP   +  NVAPWI+TVGA T+DR FPA V LG+G+ F
Sbjct  299   IAIGAFAAMEKGVFVSCSAGNSGPNKASLANVAPWIMTVGAGTLDRDFPAYVQLGNGKRF  358

Query  539   TGMSLYSGEPLGDNKLPLVY--GGDANSTYCYSGELIASKVTGKIVFCERGGNLDVDKGF  712
             TG+SLYSG+ +G+  + LVY  G + +S  C  G L  + V GK+V C+RG N  V+KG 
Sbjct  359   TGVSLYSGQGMGNKAVALVYNKGSNTSSNMCLPGSLEPAVVRGKVVVCDRGINARVEKGG  418

Query  713   AVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRG  892
              VR+AGG+GMI+  TA +GE + A +H++PA  V    G+ I++Y+ S  +PTA + F G
Sbjct  419   VVRDAGGIGMILANTAASGEELVADSHLLPAVAVGRKTGDLIRQYVRSDSNPTAVLSFGG  478

Query  893   TVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVE  1072
             T++   PS P VA+FSSRGPN +  +ILKPDVI PGVNILA WS +IGP+G   D+R+ +
Sbjct  479   TILNVRPS-PVVAAFSSRGPNLVTPQILKPDVIGPGVNILAAWSESIGPTGLENDKRKTQ  537

Query  1073  FNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             FNI+SGTSM+CPH+SGLAALL+ AHP WSP+AIKSALM
Sbjct  538   FNIMSGTSMSCPHISGLAALLKAAHPQWSPSAIKSALM  575



>gb|EYU40429.1| hypothetical protein MIMGU_mgv1a001733mg [Erythranthe guttata]
Length=767

 Score =   434 bits (1116),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 227/405 (56%), Positives = 286/405 (71%), Gaps = 11/405 (3%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSP------INESVEPKSPRDRNGHGTHTASIAAGSIVANASLF  163
             KI+GAR F +G+EA   +       IN +VE KSPRD +GHGTHTAS AAG     AS+ 
Sbjct  170   KIVGARFFSRGHEAAAAAATAGLGGINATVEFKSPRDADGHGTHTASTAAGRHTFRASME  229

Query  164   GYAQGEARGMAIKARIAVYKICW-SLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPE  340
             GYA G A+G+A KAR+AVYK+CW + GC+DSDIL+AFD AV DGV VIS+S+        
Sbjct  230   GYASGIAKGVAPKARLAVYKVCWKNSGCFDSDILAAFDAAVNDGVDVISISIGGSDGTSS  289

Query  341   DYYRDSTAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVL  520
              YY D  AIG++GA+  G+ VS+ AGN GP   +ATN+APW+ TVGA TIDR FPA+V+L
Sbjct  290   PYYLDPIAIGSYGAVSRGIFVSSSAGNGGPNVMSATNLAPWLTTVGAGTIDRNFPAEVIL  349

Query  521   GDGRIFTGMSLYSGEPLGDNKLPLVYGGDA---NSTYCYSGELIASKVTGKIVFCERGGN  691
              DGR FTG+S+YSGE L     PL+Y G +   +++ C    L  + + GKIV C+RG N
Sbjct  350   SDGRKFTGVSIYSGEQLNGKMYPLIYPGKSGALSASLCMENSLSPNSIKGKIVICDRGSN  409

Query  692   LDVDKGFAVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPT  871
               V KG  V++AGG+GMI+      GE +   AH++PA  V   +G++IK Y++S P+ T
Sbjct  410   PRVAKGLVVKKAGGIGMILANGESNGEGLVGDAHLLPACAVGSSEGDRIKAYLSSNPTAT  469

Query  872   AAIVFRGTVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSV  1051
             A I FRGTV+GT P AP VASFS RGPN L  EILKPD+IAPGVNILA W+ A+GP+G  
Sbjct  470   ATINFRGTVVGTKP-APVVASFSGRGPNGLNLEILKPDLIAPGVNILAAWTEAVGPTGLD  528

Query  1052  MDQRRVEFNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
              D R+ EFNI+SGTSMACPHVSG AALL+ AHP WSPAAI+SA+M
Sbjct  529   SDNRKTEFNIVSGTSMACPHVSGAAALLKSAHPDWSPAAIRSAMM  573



>gb|KCW81959.1| hypothetical protein EUGRSUZ_C03325 [Eucalyptus grandis]
Length=840

 Score =   436 bits (1121),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 227/398 (57%), Positives = 284/398 (71%), Gaps = 7/398 (2%)
 Frame = +2

Query  2     KIIGARAFYKGYEAFTGSP-INESVEPKSPRDRNGHGTHTASIAAGSIVANASLFGYAQG  178
             K+IGAR F KG+   +GS  +    E +SPRDR+GHGTHTAS AAGS VANASL GYA G
Sbjct  194   KLIGARFFSKGFRMASGSNFLKNPKEVESPRDRDGHGTHTASTAAGSPVANASLLGYASG  253

Query  179   EARGMAIKARIAVYKICWSLGCYDSDILSAFDQAVKDGVHVISLSVAIPRAYPEDYYRDS  358
              ARGMA  AR+A YK+CWS GC+ +DIL+  D+A+ DGV V+SLS+    A    YYRD+
Sbjct  254   TARGMAEHARVAAYKVCWSSGCFGADILAGMDRAILDGVDVLSLSLGGGIA---PYYRDT  310

Query  359   TAIGAFGAMEHGVVVSTVAGNTGPGARTATNVAPWILTVGASTIDRTFPADVVLGDGRIF  538
              AIGAF AME G+ VS  AGN+GP   +  NVAPWI+TVGA T+DR FPA  +LG+G+ +
Sbjct  311   IAIGAFTAMERGIFVSCSAGNSGPAKESLANVAPWIMTVGAGTLDRDFPAYALLGNGKRY  370

Query  539   TGMSLYSGEPLGDNKLPLVYGGDAN--STYCYSGELIASKVTGKIVFCERGGNLDVDKGF  712
              G+SLYSG  +G N +P++Y  D+N     C  G L  +   GK+V C+RG N  V+KG 
Sbjct  371   AGVSLYSGPGMGHNPVPVIYSKDSNISGQLCLPGSLNPALTRGKVVLCDRGVNARVEKGQ  430

Query  713   AVREAGGVGMIVDGTAGTGELIYASAHVIPATNVDEMDGNKIKEYINSAPSPTAAIVFRG  892
              VR+AGGVGMI+  TA  GE + A +H+IPA  V    G+ I++Y+ S  SPTA + FRG
Sbjct  431   VVRDAGGVGMILANTAANGEELVADSHLIPAVAVGRKMGDVIRKYVKSDRSPTAVLSFRG  490

Query  893   TVIGTSPSAPRVASFSSRGPNPLQFEILKPDVIAPGVNILAGWSGAIGPSGSVMDQRRVE  1072
             TV+   PS P VA+FSSRGPN +  +ILKPDVI PGVNILAGWS A GP+G   D R+  
Sbjct  491   TVVNVRPS-PVVAAFSSRGPNTVTQQILKPDVIGPGVNILAGWSEAAGPTGLESDTRKTL  549

Query  1073  FNIISGTSMACPHVSGLAALLRKAHPTWSPAAIKSALM  1186
             FNI+SGTSM+CPH+SG+AALL+ AHP WSP+AIKSALM
Sbjct  550   FNILSGTSMSCPHISGVAALLKSAHPNWSPSAIKSALM  587



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2998031543124