BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19275_g2_i1 len=451 path=[1:0-450]

Length=451
                                                                      Score     E

ref|XP_007025948.1|  Cysteine-rich protein, putative isoform 2          130   8e-35   
ref|XP_007025947.1|  Cysteine-rich protein, putative isoform 1          133   2e-33   
ref|XP_009598808.1|  PREDICTED: cysteine-rich receptor-like prote...    132   4e-33   
ref|XP_009598807.1|  PREDICTED: cysteine-rich receptor-like prote...    130   3e-32   
emb|CDP04897.1|  unnamed protein product                                124   2e-31   
ref|XP_009762725.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    125   3e-31   
ref|XP_006343408.1|  PREDICTED: cysteine-rich receptor-like prote...    123   1e-29   
emb|CDP04899.1|  unnamed protein product                                123   1e-29   
emb|CDP04893.1|  unnamed protein product                                122   2e-29   
emb|CBI35672.3|  unnamed protein product                                120   3e-28   
ref|XP_010646899.1|  PREDICTED: cysteine-rich receptor-like prote...    119   3e-28   
ref|XP_006388606.1|  hypothetical protein POPTR_0138s00200g             117   4e-28   
ref|XP_006383962.1|  hypothetical protein POPTR_0004s02500g             118   1e-27   
ref|XP_011002059.1|  PREDICTED: cysteine-rich receptor-like prote...    118   1e-27   
emb|CBI34091.3|  unnamed protein product                                117   1e-27   
ref|XP_011002057.1|  PREDICTED: cysteine-rich receptor-like prote...    117   1e-27   
ref|XP_006606026.1|  PREDICTED: cysteine-rich receptor-like prote...    117   2e-27   
ref|XP_010648190.1|  PREDICTED: cysteine-rich receptor-like prote...    117   2e-27   
ref|XP_010648189.1|  PREDICTED: cysteine-rich receptor-like prote...    117   2e-27   
emb|CAN72253.1|  hypothetical protein VITISV_034184                     117   2e-27   Vitis vinifera
emb|CDP04752.1|  unnamed protein product                                117   2e-27   
ref|XP_006606025.1|  PREDICTED: cysteine-rich receptor-like prote...    117   3e-27   
gb|KHN15823.1|  Cysteine-rich receptor-like protein kinase 10           116   4e-27   
emb|CBI29180.3|  unnamed protein product                                114   6e-27   
ref|XP_006449133.1|  hypothetical protein CICLE_v10014789mg             114   9e-27   
ref|XP_010059124.1|  PREDICTED: cysteine-rich receptor-like prote...    112   2e-26   
ref|XP_006383923.1|  hypothetical protein POPTR_0004s01260g             107   3e-26   
gb|KCW75002.1|  hypothetical protein EUGRSUZ_E03765                     113   6e-26   
ref|XP_010057978.1|  PREDICTED: cysteine-rich receptor-like prote...    112   9e-26   
ref|XP_008224859.1|  PREDICTED: cysteine-rich receptor-like prote...    112   1e-25   
ref|XP_003615452.1|  Cysteine-rich receptor-like protein kinase         106   1e-25   
ref|XP_010267898.1|  PREDICTED: uncharacterized protein LOC104605002    113   1e-25   
ref|XP_010655874.1|  PREDICTED: cysteine-rich receptor-like prote...    112   2e-25   
gb|KCW75004.1|  hypothetical protein EUGRSUZ_E03766                     111   2e-25   
gb|KCW74337.1|  hypothetical protein EUGRSUZ_E03008                     108   2e-25   
ref|XP_010644341.1|  PREDICTED: cysteine-rich receptor-like prote...    111   2e-25   
ref|XP_011010158.1|  PREDICTED: cysteine-rich receptor-like prote...    111   3e-25   
ref|XP_003615455.1|  Cysteine-rich receptor-like protein kinase         110   3e-25   
ref|XP_006468228.1|  PREDICTED: uncharacterized protein LOC102629057    112   4e-25   
gb|KHG26430.1|  Cysteine-rich receptor-like protein kinase 10           110   4e-25   
ref|XP_004496792.1|  PREDICTED: cysteine-rich receptor-like prote...    110   4e-25   
emb|CDP20318.1|  unnamed protein product                                110   5e-25   
gb|KDO75602.1|  hypothetical protein CISIN_1g006155mg                   110   5e-25   
ref|XP_006373160.1|  hypothetical protein POPTR_0017s09230g             108   5e-25   
gb|KHG08444.1|  Cysteine-rich receptor-like protein kinase 10           103   6e-25   
ref|XP_010059133.1|  PREDICTED: putative cysteine-rich receptor-l...    109   6e-25   
ref|XP_010059510.1|  PREDICTED: uncharacterized protein LOC104447479    111   6e-25   
ref|XP_010686952.1|  PREDICTED: putative receptor-like protein ki...    110   8e-25   
ref|XP_006449119.1|  hypothetical protein CICLE_v10014496mg             110   8e-25   
gb|KDO37422.1|  hypothetical protein CISIN_1g005846mg                   110   9e-25   
gb|KCW74354.1|  hypothetical protein EUGRSUZ_E030281                    102   9e-25   
gb|KCW75396.1|  hypothetical protein EUGRSUZ_E04150                     109   9e-25   
ref|XP_008349286.1|  PREDICTED: cysteine-rich receptor-like prote...    109   1e-24   
ref|XP_003556014.1|  PREDICTED: cysteine-rich receptor-like prote...    109   1e-24   
ref|XP_008340068.1|  PREDICTED: cysteine-rich receptor-like prote...    109   1e-24   
ref|XP_010665893.1|  PREDICTED: putative receptor-like protein ki...    109   1e-24   
ref|XP_010057745.1|  PREDICTED: cysteine-rich receptor-like prote...    109   1e-24   
gb|KCW75000.1|  hypothetical protein EUGRSUZ_E03762                     109   2e-24   
ref|XP_010040977.1|  PREDICTED: cysteine-rich receptor-like prote...    103   2e-24   
ref|XP_006606024.1|  PREDICTED: serine/threonine kinase-related p...    108   2e-24   
gb|KHN15824.1|  Cysteine-rich receptor-like protein kinase 10           108   2e-24   
ref|XP_006383965.1|  hypothetical protein POPTR_0004s02530g             108   2e-24   
ref|XP_010040976.1|  PREDICTED: cysteine-rich receptor-like prote...    103   2e-24   
ref|XP_006449120.1|  hypothetical protein CICLE_v10014504mg             108   2e-24   
ref|XP_010059664.1|  PREDICTED: cysteine-rich receptor-like prote...    109   2e-24   
gb|KHG16271.1|  Cysteine-rich receptor-like protein kinase 25           108   3e-24   
emb|CDP16211.1|  unnamed protein product                                108   4e-24   
gb|KCW75430.1|  hypothetical protein EUGRSUZ_E041921                    105   4e-24   
ref|XP_006383960.1|  hypothetical protein POPTR_0004s02460g             105   5e-24   
gb|KHN02670.1|  Cysteine-rich receptor-like protein kinase 25           108   5e-24   
ref|XP_006590217.1|  PREDICTED: cysteine-rich receptor-like prote...    108   7e-24   
ref|XP_006467962.1|  PREDICTED: cysteine-rich receptor-like prote...    107   1e-23   
gb|KCW74340.1|  hypothetical protein EUGRSUZ_E03013                     104   1e-23   
ref|XP_007143184.1|  hypothetical protein PHAVU_007G050600g             106   1e-23   
gb|KEH43947.1|  cysteine-rich receptor-kinase-like protein              106   2e-23   
ref|XP_003637975.1|  Cysteine-rich receptor-like protein kinase         106   2e-23   
ref|XP_010087722.1|  Cysteine-rich receptor-like protein kinase 25      106   2e-23   
ref|XP_007214583.1|  hypothetical protein PRUPE_ppa026781mg             106   2e-23   
ref|XP_006387885.1|  hypothetical protein POPTR_0499s002002g            100   2e-23   
ref|XP_010059136.1|  PREDICTED: putative cysteine-rich receptor-l...    106   2e-23   
gb|KCW76230.1|  hypothetical protein EUGRSUZ_D00611                     105   2e-23   
ref|XP_008232237.1|  PREDICTED: cysteine-rich receptor-like prote...    105   3e-23   
ref|XP_010089692.1|  Cysteine-rich receptor-like protein kinase 29      105   3e-23   
ref|XP_008365537.1|  PREDICTED: putative receptor-like protein ki...    105   3e-23   
ref|XP_010052297.1|  PREDICTED: cysteine-rich receptor-like prote...    105   3e-23   
gb|KHN02668.1|  Cysteine-rich receptor-like protein kinase 29           105   3e-23   
ref|XP_010059682.1|  PREDICTED: putative receptor-like protein ki...    105   4e-23   
ref|XP_008779261.1|  PREDICTED: cysteine-rich receptor-like prote...    100   4e-23   
ref|XP_010069590.1|  PREDICTED: putative cysteine-rich receptor-l...    103   5e-23   
gb|KFK28882.1|  hypothetical protein AALP_AA7G060200                    105   5e-23   
ref|XP_009341461.1|  PREDICTED: cysteine-rich receptor-like prote...    104   5e-23   
ref|XP_010655950.1|  PREDICTED: cysteine-rich receptor-like prote...    104   5e-23   
ref|XP_003536563.1|  PREDICTED: cysteine-rich receptor-like prote...    104   6e-23   
ref|XP_010247617.1|  PREDICTED: cysteine-rich receptor-like prote...    104   6e-23   
ref|XP_002304944.2|  hypothetical protein POPTR_0004s02370g             102   7e-23   Populus trichocarpa [western balsam poplar]
ref|XP_010059687.1|  PREDICTED: cysteine-rich receptor-like prote...    102   7e-23   
gb|KDO59868.1|  hypothetical protein CISIN_1g037548mg                   104   8e-23   
ref|XP_010103954.1|  Cysteine-rich receptor-like protein kinase 25      103   8e-23   
gb|KCW75005.1|  hypothetical protein EUGRSUZ_E03767                     101   9e-23   
ref|XP_010059147.1|  PREDICTED: putative cysteine-rich receptor-l...    103   1e-22   
ref|XP_007143185.1|  hypothetical protein PHAVU_007G050700g             103   1e-22   
ref|XP_004153532.1|  PREDICTED: cysteine-rich receptor-like prote...    103   1e-22   
ref|XP_004172413.1|  PREDICTED: cysteine-rich receptor-like prote...    103   1e-22   
ref|XP_002518553.1|  ATP binding protein, putative                      103   1e-22   Ricinus communis
ref|XP_009340920.1|  PREDICTED: cysteine-rich receptor-like prote...    103   2e-22   
ref|XP_008345332.1|  PREDICTED: cysteine-rich receptor-like prote...    103   2e-22   
ref|XP_011002055.1|  PREDICTED: cysteine-rich receptor-like prote...  99.0    2e-22   
ref|XP_006469728.1|  PREDICTED: cysteine-rich receptor-like prote...    103   2e-22   
gb|KHN17294.1|  Cysteine-rich receptor-like protein kinase 8            103   2e-22   
ref|XP_006603048.1|  PREDICTED: putative cysteine-rich receptor-l...    103   2e-22   
ref|XP_002304956.2|  hypothetical protein POPTR_0004s02490g             100   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_008224858.1|  PREDICTED: cysteine-rich receptor-like prote...    101   2e-22   
ref|XP_010932139.1|  PREDICTED: cysteine-rich receptor-like prote...    100   2e-22   
emb|CDY15056.1|  BnaC03g44170D                                          103   2e-22   
ref|XP_009357378.1|  PREDICTED: cysteine-rich receptor-like prote...  99.0    2e-22   
ref|XP_006603049.1|  PREDICTED: putative cysteine-rich receptor-l...    102   3e-22   
emb|CDX93057.1|  BnaA03g37790D                                          102   3e-22   
ref|XP_007157184.1|  hypothetical protein PHAVU_002G049500g             102   3e-22   
ref|XP_009136144.1|  PREDICTED: cysteine-rich receptor-like prote...    102   3e-22   
gb|KHN15822.1|  Cysteine-rich receptor-like protein kinase 25           103   3e-22   
ref|XP_008358736.1|  PREDICTED: cysteine-rich receptor-like prote...    102   3e-22   
ref|XP_007025936.1|  Cysteine-rich RLK 29, putative isoform 2           101   4e-22   
ref|XP_006383968.1|  hypothetical protein POPTR_0004s02560g             102   4e-22   
ref|XP_010267893.1|  PREDICTED: uncharacterized protein LOC104604997    103   4e-22   
ref|XP_008224863.1|  PREDICTED: uncharacterized protein LOC103324571    103   5e-22   
ref|XP_010686956.1|  PREDICTED: cysteine-rich receptor-like prote...    102   5e-22   
ref|XP_007025935.1|  Cysteine-rich RLK 29, putative isoform 1           102   5e-22   
ref|XP_008800494.1|  PREDICTED: putative receptor-like protein ki...    102   5e-22   
gb|KHN01543.1|  Cysteine-rich receptor-like protein kinase 29           101   5e-22   
ref|XP_010247622.1|  PREDICTED: cysteine-rich receptor-like prote...    102   6e-22   
ref|XP_006606016.1|  PREDICTED: cysteine-rich receptor-like prote...    102   6e-22   
ref|XP_010059683.1|  PREDICTED: putative cysteine-rich receptor-l...    101   7e-22   
ref|XP_007213903.1|  hypothetical protein PRUPE_ppa003904mg             100   8e-22   
ref|XP_010529593.1|  PREDICTED: cysteine-rich receptor-like prote...    101   9e-22   
ref|XP_010059665.1|  PREDICTED: cysteine-rich receptor-like prote...    100   1e-21   
ref|XP_011007635.1|  PREDICTED: cysteine-rich receptor-like prote...    101   1e-21   
ref|XP_006603573.1|  PREDICTED: cysteine-rich receptor-like prote...    101   1e-21   
ref|XP_009340923.1|  PREDICTED: cysteine-rich receptor-like prote...    101   1e-21   
emb|CBI23554.3|  unnamed protein product                              97.8    1e-21   
ref|XP_008349189.1|  PREDICTED: cysteine-rich receptor-like prote...  98.6    1e-21   
ref|XP_008446411.1|  PREDICTED: cysteine-rich receptor-like prote...    102   1e-21   
ref|XP_010057979.1|  PREDICTED: cysteine-rich receptor-like prote...    100   1e-21   
ref|XP_010059149.1|  PREDICTED: cysteine-rich receptor-like prote...  98.6    1e-21   
gb|KDP20816.1|  hypothetical protein JCGZ_21287                         100   1e-21   
ref|XP_008224765.1|  PREDICTED: cysteine-rich receptor-like prote...    100   1e-21   
ref|XP_010686953.1|  PREDICTED: cysteine-rich receptor-like prote...    100   2e-21   
emb|CBI39033.3|  unnamed protein product                                100   2e-21   
ref|XP_009357384.1|  PREDICTED: cysteine-rich receptor-like prote...    100   2e-21   
ref|XP_010646643.1|  PREDICTED: cysteine-rich receptor-like prote...  97.8    2e-21   
emb|CDO99704.1|  unnamed protein product                                101   2e-21   
emb|CDP11362.1|  unnamed protein product                                100   2e-21   
ref|XP_004953651.1|  PREDICTED: cysteine-rich receptor-like prote...  99.0    2e-21   
ref|XP_009136145.1|  PREDICTED: cysteine-rich receptor-like prote...  99.8    2e-21   
ref|XP_010924008.1|  PREDICTED: putative receptor-like protein ki...    100   2e-21   
ref|XP_010540897.1|  PREDICTED: cysteine-rich receptor-like prote...    100   2e-21   
ref|XP_006383966.1|  hypothetical protein POPTR_0004s02550g             100   2e-21   
ref|XP_008377958.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  97.8    3e-21   
ref|XP_007025934.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  97.1    3e-21   
ref|XP_011002062.1|  PREDICTED: putative receptor-like protein ki...  99.8    3e-21   
gb|KHN04839.1|  Cysteine-rich receptor-like protein kinase 10         98.6    3e-21   
ref|XP_007211369.1|  hypothetical protein PRUPE_ppa002516mg           99.8    3e-21   
gb|KEH40076.1|  cysteine-rich receptor-kinase-like protein            99.8    4e-21   
ref|XP_003517662.1|  PREDICTED: cysteine-rich receptor-like prote...  99.8    4e-21   
ref|XP_006387146.1|  hypothetical protein POPTR_1704s00210g           93.2    4e-21   
ref|XP_002518558.1|  conserved hypothetical protein                   99.0    4e-21   Ricinus communis
ref|XP_008384459.1|  PREDICTED: cysteine-rich receptor-like prote...  99.4    5e-21   
ref|XP_011002063.1|  PREDICTED: putative receptor-like protein ki...  99.4    5e-21   
gb|KHN40432.1|  Cysteine-rich receptor-like protein kinase 14         98.6    5e-21   
ref|XP_009338731.1|  PREDICTED: cysteine-rich receptor-like prote...  99.0    5e-21   
ref|XP_003637378.1|  Cysteine-rich receptor-like protein kinase       98.6    6e-21   
ref|XP_006283285.1|  hypothetical protein CARUB_v10004321mg           99.0    6e-21   
ref|XP_007143203.1|  hypothetical protein PHAVU_007G052500g           99.0    6e-21   
ref|XP_003637461.1|  Cysteine-rich receptor-like protein kinase       99.0    6e-21   
gb|KHN02663.1|  Cysteine-rich receptor-like protein kinase 29         99.0    6e-21   
ref|XP_007143171.1|  hypothetical protein PHAVU_007G049600g           99.0    6e-21   
ref|XP_007143170.1|  hypothetical protein PHAVU_007G0495000g          94.0    7e-21   
ref|XP_007025939.1|  Cysteine-rich RLK 29                             99.8    7e-21   
gb|KDP20812.1|  hypothetical protein JCGZ_21283                       99.0    7e-21   
ref|XP_007025923.1|  Cysteine-rich RLK 29, putative isoform 2         98.6    7e-21   
gb|KHN40584.1|  Cysteine-rich receptor-like protein kinase 25         99.4    8e-21   
ref|XP_006388607.1|  hypothetical protein POPTR_0138s00210g           98.2    8e-21   
ref|XP_008345852.1|  PREDICTED: cysteine-rich receptor-like prote...  98.6    9e-21   
ref|XP_009340926.1|  PREDICTED: cysteine-rich receptor-like prote...  98.6    1e-20   
ref|XP_010910126.1|  PREDICTED: putative receptor-like protein ki...  98.6    1e-20   
emb|CBI38466.3|  unnamed protein product                              94.0    1e-20   
ref|XP_010540889.1|  PREDICTED: cysteine-rich receptor-like prote...  98.2    1e-20   
ref|XP_010267800.1|  PREDICTED: putative receptor-like protein ki...  98.2    1e-20   
gb|KHN15821.1|  Cysteine-rich receptor-like protein kinase 25         98.2    1e-20   
ref|XP_010646641.1|  PREDICTED: putative receptor-like protein ki...  98.2    1e-20   
ref|XP_003556018.2|  PREDICTED: cysteine-rich receptor-like prote...  98.2    1e-20   
ref|XP_010267801.1|  PREDICTED: cysteine-rich receptor-like prote...  97.8    1e-20   
ref|XP_002271125.3|  PREDICTED: cysteine-rich receptor-like prote...  98.2    1e-20   Vitis vinifera
gb|KHN01541.1|  Cysteine-rich receptor-like protein kinase 25         97.4    1e-20   
ref|XP_010910239.1|  PREDICTED: putative receptor-like protein ki...  98.2    1e-20   
emb|CBI23454.3|  unnamed protein product                              98.2    1e-20   
ref|XP_007025922.1|  Cysteine-rich RLK 29, putative isoform 1         98.2    1e-20   
ref|XP_008371138.1|  PREDICTED: cysteine-rich receptor-like prote...  98.2    1e-20   
ref|XP_002518555.1|  ATP binding protein, putative                    98.2    1e-20   Ricinus communis
ref|XP_002867728.1|  predicted protein                                97.8    1e-20   
ref|XP_009334798.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...  97.8    2e-20   
emb|CDP11365.1|  unnamed protein product                              97.4    2e-20   
ref|XP_007025937.1|  Cysteine-rich RLK 29, putative                   97.8    2e-20   
emb|CDP11364.1|  unnamed protein product                              95.9    2e-20   
ref|XP_010923981.1|  PREDICTED: putative receptor-like protein ki...  97.4    2e-20   
gb|KHN01555.1|  Cysteine-rich receptor-like protein kinase 25         95.9    2e-20   
ref|XP_010931318.1|  PREDICTED: putative receptor-like protein ki...  97.4    2e-20   
ref|XP_004496761.1|  PREDICTED: cysteine-rich receptor-like prote...  97.4    2e-20   
ref|XP_007011084.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  97.4    2e-20   
ref|XP_007157183.1|  hypothetical protein PHAVU_002G049400g           97.8    2e-20   
ref|XP_006606898.1|  PREDICTED: cysteine-rich receptor-like prote...  97.1    2e-20   
gb|KCW74344.1|  hypothetical protein EUGRSUZ_E03020                   97.1    3e-20   
emb|CDP11357.1|  unnamed protein product                              92.8    3e-20   
gb|KCW74330.1|  hypothetical protein EUGRSUZ_E029981                  95.1    3e-20   
ref|XP_008370580.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  97.1    3e-20   
ref|XP_010647640.1|  PREDICTED: cysteine-rich receptor-like prote...  91.3    3e-20   
ref|XP_006383964.1|  hypothetical protein POPTR_0004s02520g           90.9    3e-20   
ref|XP_010089690.1|  Cysteine-rich receptor-like protein kinase 10    94.7    3e-20   
ref|XP_010059142.1|  PREDICTED: putative cysteine-rich receptor-l...  97.1    3e-20   
ref|XP_007025949.1|  Cysteine-rich RLK 25                             96.7    3e-20   
ref|XP_011002064.1|  PREDICTED: putative receptor-like protein ki...  96.7    3e-20   
ref|XP_010247616.1|  PREDICTED: cysteine-rich receptor-like prote...  97.1    3e-20   
ref|XP_010439209.1|  PREDICTED: cysteine-rich receptor-like prote...  97.1    3e-20   
gb|KCW74376.1|  hypothetical protein EUGRSUZ_E030551                  94.0    4e-20   
gb|KHN15831.1|  Cysteine-rich receptor-like protein kinase 29         97.4    4e-20   
ref|XP_003635675.2|  PREDICTED: cysteine-rich receptor-like prote...  94.4    4e-20   
ref|XP_009357379.1|  PREDICTED: cysteine-rich receptor-like prote...  96.7    4e-20   
ref|XP_007143180.1|  hypothetical protein PHAVU_007G050200g           96.7    4e-20   
ref|XP_007143159.1|  hypothetical protein PHAVU_007G048800g           96.7    4e-20   
emb|CBI33308.3|  unnamed protein product                              91.7    4e-20   
gb|ADQ37376.1|  unknown                                               96.7    4e-20   
gb|ADQ37353.1|  unknown                                               96.7    4e-20   
ref|XP_010661211.1|  PREDICTED: putative receptor-like protein ki...  96.7    4e-20   
ref|XP_010647173.1|  PREDICTED: putative receptor-like protein ki...  96.3    5e-20   
ref|XP_010087724.1|  Cysteine-rich receptor-like protein kinase 25    97.1    5e-20   
gb|AID21688.1|  At4g21400p-like protein                               96.3    5e-20   
ref|XP_010923985.1|  PREDICTED: putative receptor-like protein ki...  96.3    5e-20   
ref|XP_006602739.1|  PREDICTED: putative cysteine-rich receptor-l...  96.7    5e-20   
ref|XP_008355945.1|  PREDICTED: cysteine-rich receptor-like prote...  96.3    5e-20   
ref|XP_010923983.1|  PREDICTED: putative receptor-like protein ki...  96.3    6e-20   
ref|XP_007143160.1|  hypothetical protein PHAVU_007G048900g           96.3    6e-20   
ref|XP_010247618.1|  PREDICTED: putative receptor-like protein ki...  96.3    6e-20   
ref|XP_010661208.1|  PREDICTED: putative receptor-like protein ki...  95.9    6e-20   
ref|XP_004496856.1|  PREDICTED: cysteine-rich receptor-like prote...  96.3    6e-20   
ref|XP_007025943.1|  Cysteine-rich protein, putative isoform 1        96.3    6e-20   
ref|XP_008377957.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...  95.9    7e-20   
ref|XP_010448757.1|  PREDICTED: cysteine-rich receptor-like prote...  95.9    7e-20   
ref|XP_010448756.1|  PREDICTED: cysteine-rich receptor-like prote...  95.9    7e-20   
emb|CDP19430.1|  unnamed protein product                              94.4    7e-20   
ref|XP_003638006.1|  Cysteine-rich receptor-like protein kinase       93.6    7e-20   
ref|XP_006606897.1|  PREDICTED: cysteine-rich receptor-like prote...  95.9    7e-20   
ref|XP_010646640.1|  PREDICTED: putative receptor-like protein ki...  95.9    7e-20   
ref|XP_008776134.1|  PREDICTED: putative cysteine-rich receptor-l...  93.2    7e-20   
ref|XP_006590220.1|  PREDICTED: cysteine-rich receptor-like prote...  95.9    7e-20   
ref|XP_010057983.1|  PREDICTED: cysteine-rich receptor-like prote...  95.9    8e-20   
ref|XP_006413569.1|  hypothetical protein EUTSA_v10024579mg           95.9    8e-20   
gb|EEC76826.1|  hypothetical protein OsI_14969                        94.0    8e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_008364117.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  95.9    9e-20   
emb|CBI33228.3|  unnamed protein product                              93.2    1e-19   
ref|NP_001052219.1|  Os04g0197200                                     94.0    1e-19   Oryza sativa Japonica Group [Japonica rice]
gb|KHG24658.1|  Cysteine-rich receptor-like protein kinase 10         90.9    1e-19   
ref|XP_008363779.1|  PREDICTED: cysteine-rich receptor-like prote...  95.5    1e-19   
ref|XP_003637960.1|  Cysteine-rich receptor-like protein kinase       93.6    1e-19   
ref|XP_006606020.1|  PREDICTED: cysteine-rich receptor-like prote...  93.6    1e-19   
ref|XP_009340921.1|  PREDICTED: cysteine-rich receptor-like prote...  95.5    1e-19   
ref|XP_010439210.1|  PREDICTED: cysteine-rich receptor-like prote...  95.1    1e-19   
emb|CAN62393.1|  hypothetical protein VITISV_021304                   95.1    1e-19   Vitis vinifera
ref|XP_010108868.1|  Cysteine-rich receptor-like protein kinase 26    95.5    1e-19   
ref|XP_002530691.1|  kinase, putative                                 95.1    1e-19   Ricinus communis
ref|XP_009357560.1|  PREDICTED: cysteine-rich receptor-like prote...  94.7    1e-19   
ref|XP_003637949.1|  Cysteine-rich receptor-like protein kinase       92.0    1e-19   
ref|XP_010267891.1|  PREDICTED: cysteine-rich receptor-like prote...  95.1    1e-19   
ref|XP_008393358.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  92.4    1e-19   
ref|XP_003635160.1|  PREDICTED: putative receptor-like protein ki...  95.1    1e-19   
ref|XP_006383954.1|  hypothetical protein POPTR_0004s024001g          88.2    1e-19   
emb|CAD40120.3|  OSJNBa0061C06.4                                      93.6    2e-19   Oryza sativa [red rice]
gb|KHN01545.1|  Cysteine-rich receptor-like protein kinase 29         94.7    2e-19   
gb|KHN01554.1|  Cysteine-rich receptor-like protein kinase 29         94.7    2e-19   
ref|XP_011004253.1|  PREDICTED: cysteine-rich receptor-like prote...  94.7    2e-19   
ref|XP_009357380.1|  PREDICTED: cysteine-rich receptor-like prote...  94.7    2e-19   
ref|XP_010057674.1|  PREDICTED: putative receptor-like protein ki...  94.7    2e-19   
ref|XP_011004252.1|  PREDICTED: putative receptor-like protein ki...  94.7    2e-19   
emb|CDP16212.1|  unnamed protein product                              93.2    2e-19   
ref|XP_007043326.1|  Cysteine-rich RLK 10, putative                   94.7    2e-19   
ref|XP_010529370.1|  PREDICTED: cysteine-rich receptor-like prote...  94.7    2e-19   
ref|XP_011003249.1|  PREDICTED: cysteine-rich receptor-like prote...  93.2    2e-19   
ref|XP_003635677.2|  PREDICTED: putative receptor-like protein ki...  94.7    2e-19   
gb|KEH18840.1|  receptor-like kinase                                  91.7    2e-19   
ref|XP_008371201.1|  PREDICTED: cysteine-rich receptor-like prote...  94.7    2e-19   
ref|XP_009357385.1|  PREDICTED: cysteine-rich receptor-like prote...  94.4    2e-19   
ref|XP_008227365.1|  PREDICTED: receptor-like serine/threonine-pr...  95.1    2e-19   
ref|XP_007213610.1|  hypothetical protein PRUPE_ppa002309mg           94.7    2e-19   
gb|KEH43962.1|  cysteine-rich receptor-kinase-like protein            94.4    2e-19   
gb|KCW75422.1|  hypothetical protein EUGRSUZ_E04182                   92.0    2e-19   
gb|KHG20235.1|  Cysteine-rich receptor-like protein kinase 25         93.6    2e-19   
emb|CDP11363.1|  unnamed protein product                              94.4    2e-19   
gb|EYU23764.1|  hypothetical protein MIMGU_mgv1a019802mg              92.8    2e-19   
ref|XP_011070689.1|  PREDICTED: putative receptor-like protein ki...  93.6    2e-19   
ref|XP_008225008.1|  PREDICTED: uncharacterized protein LOC103324687  95.1    3e-19   
emb|CBI23398.3|  unnamed protein product                              90.1    3e-19   
ref|XP_008778702.1|  PREDICTED: cysteine-rich receptor-like prote...  90.9    3e-19   
gb|AID21610.1|  At4g21400p-like protein                               94.4    3e-19   
ref|XP_006605283.1|  PREDICTED: serine/threonine kinase-like prot...  94.0    3e-19   
gb|AGN12880.1|  putative cysteine-rich receptor-like protein kina...  94.4    3e-19   
gb|KCW74373.1|  hypothetical protein EUGRSUZ_E03054                   94.4    3e-19   
gb|KHN15830.1|  Cysteine-rich receptor-like protein kinase 25         94.4    3e-19   
ref|XP_009364708.1|  PREDICTED: cysteine-rich receptor-like prote...  94.0    3e-19   
ref|XP_002304949.2|  hypothetical protein POPTR_0004s02440g           91.7    3e-19   
gb|AID21634.1|  At4g21400p-like protein                               94.4    3e-19   
ref|XP_010646959.1|  PREDICTED: cysteine-rich receptor-like prote...  94.4    3e-19   
gb|KCW74377.1|  hypothetical protein EUGRSUZ_E03056                   94.0    3e-19   
ref|XP_007143157.1|  hypothetical protein PHAVU_007G048600g           94.0    3e-19   
gb|KCW61423.1|  hypothetical protein EUGRSUZ_H04150                   94.0    3e-19   
ref|XP_010059160.1|  PREDICTED: cysteine-rich receptor-like prote...  94.4    4e-19   
emb|CCI61485.1|  unnamed protein product                              94.0    4e-19   
ref|NP_001237891.1|  serine/threonine kinase-like protein precursor   93.6    4e-19   
ref|XP_010544472.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  93.6    4e-19   
ref|XP_008778305.1|  PREDICTED: putative receptor-like protein ki...  94.0    4e-19   
ref|XP_003556008.1|  PREDICTED: cysteine-rich receptor-like prote...  94.0    4e-19   
gb|ADQ37395.1|  unknown                                               94.0    4e-19   
ref|XP_006283252.1|  hypothetical protein CARUB_v10004288mg           93.6    4e-19   
ref|XP_010646979.1|  PREDICTED: cysteine-rich receptor-like prote...  93.6    4e-19   
ref|XP_006606021.1|  PREDICTED: cysteine-rich receptor-like prote...  93.6    4e-19   
ref|XP_010647003.1|  PREDICTED: putative receptor-like protein ki...  93.6    4e-19   
ref|XP_008337115.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...  93.6    5e-19   
gb|KCW74327.1|  hypothetical protein EUGRSUZ_E02994                   91.3    5e-19   
gb|KCW74851.1|  hypothetical protein EUGRSUZ_E03589                   93.6    5e-19   
gb|AID21661.1|  At4g21400p-like protein                               93.6    5e-19   
ref|XP_010451232.1|  PREDICTED: cysteine-rich receptor-like prote...  93.6    5e-19   
ref|XP_004496790.1|  PREDICTED: cysteine-rich receptor-like prote...  93.6    5e-19   
ref|XP_003635656.2|  PREDICTED: cysteine-rich receptor-like prote...  91.3    5e-19   
ref|XP_010931375.1|  PREDICTED: putative receptor-like protein ki...  93.6    5e-19   
ref|XP_007025945.1|  Cysteine-rich protein, putative                  89.4    5e-19   
ref|XP_010027129.1|  PREDICTED: cysteine-rich receptor-like prote...  93.2    5e-19   
ref|XP_003555319.1|  PREDICTED: cysteine-rich receptor-like prote...  93.2    6e-19   
ref|XP_007143168.1|  hypothetical protein PHAVU_007G049400g           93.2    7e-19   
gb|AAD21872.1|  receptor-like protein kinase homolog RK20-1           93.2    7e-19   
ref|XP_008776133.1|  PREDICTED: putative receptor-like protein ki...  93.2    7e-19   
ref|XP_006606014.1|  PREDICTED: cysteine-rich receptor-like prote...  93.2    7e-19   
gb|KCW61422.1|  hypothetical protein EUGRSUZ_H04149                   92.0    7e-19   
emb|CBI35335.3|  unnamed protein product                              93.2    7e-19   
gb|ADQ37365.1|  unknown                                               92.8    8e-19   
ref|XP_007143162.1|  hypothetical protein PHAVU_007G049100g           92.8    8e-19   
gb|ADQ37385.1|  unknown                                               93.2    8e-19   
ref|XP_009364729.1|  PREDICTED: cysteine-rich receptor-like prote...  92.8    8e-19   
ref|XP_002454403.1|  hypothetical protein SORBIDRAFT_04g030210        91.3    8e-19   
gb|KFK22120.1|  hypothetical protein AALP_AAs48628U000100             90.9    8e-19   
ref|XP_010932126.1|  PREDICTED: cysteine-rich receptor-like prote...  92.4    8e-19   
ref|XP_010439191.1|  PREDICTED: cysteine-rich receptor-like prote...  92.8    8e-19   
ref|XP_008365742.1|  PREDICTED: putative receptor-like protein ki...  91.7    9e-19   
ref|XP_008777204.1|  PREDICTED: cysteine-rich receptor-like prote...  90.5    9e-19   
ref|XP_010267900.1|  PREDICTED: cysteine-rich receptor-like prote...  87.4    9e-19   
ref|XP_003556003.1|  PREDICTED: cysteine-rich receptor-like prote...  92.8    9e-19   
gb|KHN01550.1|  Cysteine-rich receptor-like protein kinase 29         92.4    9e-19   
ref|XP_010059122.1|  PREDICTED: cysteine-rich receptor-like prote...  90.9    9e-19   
gb|EEE62912.1|  hypothetical protein OsJ_17717                        89.0    9e-19   
ref|XP_010448301.1|  PREDICTED: cysteine-rich receptor-like prote...  92.8    9e-19   
ref|XP_010057984.1|  PREDICTED: cysteine-rich receptor-like prote...  92.4    9e-19   
gb|AES98408.2|  cysteine-rich receptor-kinase-like protein            92.8    1e-18   
gb|KCW75411.1|  hypothetical protein EUGRSUZ_E04169                   90.1    1e-18   
ref|XP_007143161.1|  hypothetical protein PHAVU_007G049000g           92.8    1e-18   
ref|XP_007143176.1|  hypothetical protein PHAVU_007G049900g           90.5    1e-18   
ref|XP_010646639.1|  PREDICTED: putative receptor-like protein ki...  92.8    1e-18   
ref|XP_006468226.1|  PREDICTED: uncharacterized protein LOC102628483  93.2    1e-18   
gb|KDO75658.1|  hypothetical protein CISIN_1g0029692mg                90.9    1e-18   
ref|XP_003637959.1|  Cysteine-rich receptor-like protein kinase       92.4    1e-18   
gb|KDP20811.1|  hypothetical protein JCGZ_21282                       93.2    1e-18   
ref|XP_003615209.1|  Cysteine-rich receptor-like protein kinase       92.4    1e-18   
ref|XP_003638007.1|  Cysteine-rich receptor-like protein kinase       92.4    1e-18   
ref|XP_010448753.1|  PREDICTED: cysteine-rich receptor-like prote...  92.4    1e-18   
ref|XP_002518556.1|  kinase, putative                                 92.4    1e-18   
gb|KHN02662.1|  Cysteine-rich receptor-like protein kinase 26         92.4    1e-18   
gb|KCW75006.1|  hypothetical protein EUGRSUZ_E03770                   92.4    1e-18   
ref|XP_006589611.1|  PREDICTED: cysteine-rich receptor-like prote...  92.4    1e-18   
ref|XP_011004254.1|  PREDICTED: putative receptor-like protein ki...  92.4    1e-18   
ref|XP_007213217.1|  hypothetical protein PRUPE_ppb014490mg           91.3    1e-18   
ref|XP_010267806.1|  PREDICTED: putative receptor-like protein ki...  92.4    1e-18   
ref|XP_010267805.1|  PREDICTED: putative receptor-like protein ki...  92.4    1e-18   
ref|XP_009631896.1|  PREDICTED: putative receptor-like protein ki...  92.4    1e-18   
gb|KCW74356.1|  hypothetical protein EUGRSUZ_E03031                   92.4    1e-18   
gb|KCW74357.1|  hypothetical protein EUGRSUZ_E03031                   92.0    1e-18   
gb|KEH43966.1|  cysteine-rich receptor-kinase-like protein            92.4    1e-18   
ref|XP_004153871.1|  PREDICTED: cysteine-rich receptor-like prote...  89.0    1e-18   
ref|XP_002515717.1|  ATP binding protein, putative                    92.0    1e-18   
ref|XP_007143158.1|  hypothetical protein PHAVU_007G048700g           92.0    1e-18   
ref|XP_010267802.1|  PREDICTED: putative receptor-like protein ki...  92.0    1e-18   
ref|XP_010267803.1|  PREDICTED: cysteine-rich receptor-like prote...  92.0    1e-18   
gb|KHN15816.1|  Cysteine-rich receptor-like protein kinase 25         92.0    1e-18   
gb|KCW75412.1|  hypothetical protein EUGRSUZ_E04171                   90.1    2e-18   
ref|XP_007139788.1|  hypothetical protein PHAVU_008G058700g           92.0    2e-18   
gb|KHG04598.1|  Cysteine-rich receptor-like protein kinase 10         89.7    2e-18   
ref|XP_009367024.1|  PREDICTED: cysteine-rich receptor-like prote...  92.0    2e-18   
ref|XP_011076612.1|  PREDICTED: putative receptor-like protein ki...  92.0    2e-18   
ref|XP_010059127.1|  PREDICTED: putative cysteine-rich receptor-l...  91.7    2e-18   
gb|AID21590.1|  At4g21410p-like protein                               92.0    2e-18   
gb|KHG20236.1|  Cysteine-rich receptor-like protein kinase 25         90.9    2e-18   
ref|XP_006285393.1|  hypothetical protein CARUB_v10006798mg           90.9    2e-18   
sp|O65405.2|CRK28_ARATH  RecName: Full=Cysteine-rich receptor-lik...  92.0    2e-18   
ref|XP_010530410.1|  PREDICTED: cysteine-rich receptor-like prote...  87.4    2e-18   
gb|KHN01547.1|  Cysteine-rich receptor-like protein kinase 29         91.7    2e-18   
emb|CBI23395.3|  unnamed protein product                              89.7    2e-18   
ref|NP_193871.1|  cysteine-rich receptor-like protein kinase 28       92.0    2e-18   
ref|XP_009631897.1|  PREDICTED: cysteine-rich receptor-like prote...  91.7    2e-18   
ref|XP_008355788.1|  PREDICTED: cysteine-rich receptor-like prote...  89.7    2e-18   
ref|XP_007143174.1|  hypothetical protein PHAVU_007G049900g           90.5    2e-18   
ref|XP_010059513.1|  PREDICTED: cysteine-rich receptor-like prote...  91.7    2e-18   
ref|NP_567677.1|  cysteine-rich receptor-like protein kinase 5        91.7    2e-18   
ref|XP_007025946.1|  Cysteine-rich protein, putative                  91.7    2e-18   
ref|NP_849425.1|  cysteine-rich receptor-like protein kinase 5        91.7    2e-18   
ref|XP_006588454.1|  PREDICTED: cysteine-rich receptor-like prote...  91.7    2e-18   
ref|XP_009108047.1|  PREDICTED: cysteine-rich receptor-like prote...  91.7    2e-18   
gb|KHN26412.1|  Cysteine-rich receptor-like protein kinase 10         91.7    2e-18   
ref|XP_010686955.1|  PREDICTED: cysteine-rich receptor-like prote...  91.7    2e-18   
ref|XP_003593412.1|  Serine/threonine protein kinase                  92.0    2e-18   
ref|XP_010052451.1|  PREDICTED: cysteine-rich receptor-like prote...  91.7    2e-18   
gb|KCW76456.1|  hypothetical protein EUGRSUZ_D00849                   91.3    2e-18   
ref|XP_010057985.1|  PREDICTED: putative receptor-like protein ki...  91.7    2e-18   
ref|XP_003615450.1|  Cysteine-rich receptor-like protein kinase       91.7    2e-18   
emb|CAN73041.1|  hypothetical protein VITISV_044351                   91.3    2e-18   
ref|XP_010052480.1|  PREDICTED: receptor-like serine/threonine-pr...  86.7    3e-18   
gb|KEH16075.1|  cysteine-rich receptor-kinase-like protein            91.3    3e-18   
ref|XP_009361871.1|  PREDICTED: G-type lectin S-receptor-like ser...  90.9    3e-18   
gb|KHN02666.1|  Cysteine-rich receptor-like protein kinase 29         90.9    3e-18   
ref|XP_009367095.1|  PREDICTED: cysteine-rich receptor-like prote...  91.3    3e-18   
emb|CBI14851.3|  unnamed protein product                              87.0    3e-18   
ref|XP_010089688.1|  Cysteine-rich receptor-like protein kinase 29    91.3    3e-18   
ref|XP_010932197.1|  PREDICTED: uncharacterized protein LOC105052907  92.0    3e-18   
emb|CDX94167.1|  BnaC07g38010D                                        91.3    3e-18   
ref|XP_010448768.1|  PREDICTED: cysteine-rich receptor-like prote...  91.3    3e-18   
gb|KCW76451.1|  hypothetical protein EUGRSUZ_D00843                   91.3    3e-18   
ref|XP_010924011.1|  PREDICTED: putative receptor-like protein ki...  90.1    3e-18   
ref|XP_004151820.1|  PREDICTED: cysteine-rich receptor-like prote...  88.2    3e-18   
ref|XP_003589300.1|  Cysteine-rich receptor-like protein kinase       91.3    3e-18   
emb|CAA18460.1|  protein kinase-like protein                          91.3    3e-18   
ref|XP_010434889.1|  PREDICTED: putative cysteine-rich receptor-l...  91.3    3e-18   
ref|XP_006648976.1|  PREDICTED: G-type lectin S-receptor-like ser...  89.7    3e-18   
ref|XP_009108598.1|  PREDICTED: cysteine-rich receptor-like prote...  91.3    3e-18   
ref|XP_002316624.2|  hypothetical protein POPTR_0011s03220g           90.9    3e-18   
ref|XP_006605286.1|  PREDICTED: receptor-like protein kinase isof...  91.3    4e-18   
ref|XP_010059132.1|  PREDICTED: cysteine-rich receptor-like prote...  90.1    4e-18   
ref|XP_009108599.1|  PREDICTED: cysteine-rich receptor-like prote...  91.3    4e-18   
ref|XP_006377261.1|  hypothetical protein POPTR_0011s03230g           90.9    4e-18   
ref|XP_006606015.1|  PREDICTED: cysteine-rich receptor-like prote...  90.9    4e-18   
ref|XP_008804396.1|  PREDICTED: putative receptor-like protein ki...  90.9    4e-18   
ref|XP_004496793.1|  PREDICTED: cysteine-rich receptor-like prote...  90.9    4e-18   
ref|XP_010090762.1|  Cysteine-rich receptor-like protein kinase 29    91.3    4e-18   
ref|XP_003535667.1|  PREDICTED: cysteine-rich receptor-like prote...  90.9    4e-18   
ref|XP_007143193.1|  hypothetical protein PHAVU_007G051500g           90.9    4e-18   
ref|XP_006285944.1|  hypothetical protein CARUB_v10007464mg           90.9    4e-18   
gb|KHN01552.1|  Cysteine-rich receptor-like protein kinase 29         90.9    4e-18   
ref|XP_009405651.1|  PREDICTED: putative receptor-like protein ki...  90.9    4e-18   
ref|XP_002316708.2|  hypothetical protein POPTR_0011s03290g           90.9    4e-18   
ref|XP_008234313.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  90.5    5e-18   
ref|XP_008225006.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  91.3    5e-18   
gb|KCW44131.1|  hypothetical protein EUGRSUZ_L02457                   88.2    5e-18   
emb|CDX76340.1|  BnaA08g10600D                                        91.3    5e-18   
ref|XP_007208684.1|  hypothetical protein PRUPE_ppa026449mg           90.1    5e-18   
ref|XP_004169841.1|  PREDICTED: cysteine-rich receptor-like prote...  87.0    5e-18   
emb|CAI44660.1|  OSJNBa0061C06.14                                     88.6    5e-18   
ref|XP_007143156.1|  hypothetical protein PHAVU_007G048500g           90.5    5e-18   
emb|CBI38478.3|  unnamed protein product                              90.1    5e-18   
ref|XP_008383136.1|  PREDICTED: cysteine-rich receptor-like prote...  88.2    5e-18   
ref|XP_009136382.1|  PREDICTED: cysteine-rich receptor-like prote...  90.5    5e-18   
ref|XP_004496794.1|  PREDICTED: cysteine-rich receptor-like prote...  90.1    5e-18   
ref|NP_001241572.1|  cysteine-rich receptor-like protein kinase 1...  89.0    6e-18   
gb|EYU26072.1|  hypothetical protein MIMGU_mgv1a024803mg              89.4    6e-18   
ref|XP_009136374.1|  PREDICTED: cysteine-rich receptor-like prote...  90.5    6e-18   
ref|XP_010924012.1|  PREDICTED: putative receptor-like protein ki...  90.5    6e-18   
ref|NP_193872.2|  cysteine-rich receptor-like protein kinase 29       90.5    6e-18   
ref|XP_003610650.1|  Cysteine-rich receptor-like protein kinase       90.5    6e-18   
ref|XP_009137321.1|  PREDICTED: cysteine-rich receptor-like prote...  90.5    6e-18   
ref|XP_003556004.1|  PREDICTED: cysteine-rich receptor-like prote...  90.5    6e-18   
gb|KHN02672.1|  Cysteine-rich receptor-like protein kinase 25         89.7    6e-18   
ref|XP_009136389.1|  PREDICTED: cysteine-rich receptor-like prote...  90.1    7e-18   
gb|KHN01556.1|  Putative cysteine-rich receptor-like protein kina...  87.8    7e-18   
gb|EYU23766.1|  hypothetical protein MIMGU_mgv1a021757mg              88.6    7e-18   
ref|XP_003635466.1|  PREDICTED: putative receptor-like protein ki...  90.1    7e-18   
gb|EYU26074.1|  hypothetical protein MIMGU_mgv1a025313mg              88.2    7e-18   
ref|XP_007133637.1|  hypothetical protein PHAVU_011G196200g           90.1    7e-18   
ref|XP_007206688.1|  hypothetical protein PRUPE_ppa022095mg           90.1    7e-18   
ref|XP_008446434.1|  PREDICTED: cysteine-rich receptor-like prote...  90.9    7e-18   
ref|XP_006283286.1|  hypothetical protein CARUB_v10004325mg           90.1    7e-18   
gb|KFK30477.1|  hypothetical protein AALP_AA7G265900                  89.0    7e-18   
ref|XP_010529376.1|  PREDICTED: cysteine-rich receptor-like prote...  90.1    7e-18   
ref|XP_010529578.1|  PREDICTED: putative cysteine-rich receptor-l...  90.1    8e-18   
ref|XP_007208249.1|  hypothetical protein PRUPE_ppa016784mg           90.1    8e-18   
ref|XP_011096162.1|  PREDICTED: cysteine-rich receptor-like prote...  90.5    8e-18   
ref|XP_008383135.1|  PREDICTED: cysteine-rich receptor-like prote...  88.2    8e-18   
gb|KFK30476.1|  hypothetical protein AALP_AA7G265900                  89.0    8e-18   
ref|XP_002274577.2|  PREDICTED: putative receptor-like protein ki...  90.1    8e-18   
emb|CCI61486.1|  unnamed protein product                              90.1    8e-18   
ref|XP_004134966.1|  PREDICTED: cysteine-rich receptor-like prote...  90.1    9e-18   
ref|XP_010278041.1|  PREDICTED: putative receptor-like protein ki...  90.1    9e-18   
ref|XP_008377959.1|  PREDICTED: cysteine-rich receptor-like prote...  90.1    9e-18   
emb|CAA18705.1|  serine/threonine protein kinase                      90.1    9e-18   
ref|XP_010451230.1|  PREDICTED: cysteine-rich receptor-like prote...  85.1    9e-18   
ref|XP_010059117.1|  PREDICTED: cysteine-rich receptor-like prote...  89.7    9e-18   
ref|XP_010059156.1|  PREDICTED: putative receptor-like protein ki...  89.7    9e-18   
ref|XP_002867729.1|  cysteine-rich rlk5                               89.7    9e-18   
ref|XP_003589297.1|  Cysteine-rich receptor-like protein kinase       88.2    1e-17   
ref|XP_010433941.1|  PREDICTED: cysteine-rich receptor-like prote...  89.7    1e-17   



>ref|XP_007025948.1| Cysteine-rich protein, putative isoform 2 [Theobroma cacao]
 gb|EOY28570.1| Cysteine-rich protein, putative isoform 2 [Theobroma cacao]
Length=190

 Score =   130 bits (328),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 82/112 (73%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHW   T ++++D SL   YSRNEVI+CIH+GLLCVQE+  ERPTMA +VLML+S+S
Sbjct  80   YAWKHWNSGTPLELLDPSLRSSYSRNEVIRCIHIGLLCVQEDPAERPTMAAIVLMLNSYS  139

Query  182  ATRRAPNPPATF---SDEMTISAGQE-ADQSTNKSPPLSSVNEVSISDLYPR  325
             T +AP PPATF     E   S  +E +DQS +KS P  SVNE SISDLYPR
Sbjct  140  ITLQAPRPPATFLIPRSESNFSINEEGSDQSASKSIPF-SVNEASISDLYPR  190



>ref|XP_007025947.1| Cysteine-rich protein, putative isoform 1 [Theobroma cacao]
 gb|EOY28569.1| Cysteine-rich protein, putative isoform 1 [Theobroma cacao]
Length=638

 Score =   133 bits (335),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 68/112 (61%), Positives = 82/112 (73%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHW   T ++++D SL   YSRNEVI+CIH+GLLCVQE+  ERPTMA +VLML+S+S
Sbjct  528  YAWKHWNSGTPLELLDPSLRSSYSRNEVIRCIHIGLLCVQEDPAERPTMAAIVLMLNSYS  587

Query  182  ATRRAPNPPATF---SDEMTISAGQE-ADQSTNKSPPLSSVNEVSISDLYPR  325
             T +AP PPATF     E   S  +E +DQS +KS P  SVNE SISDLYPR
Sbjct  588  ITLQAPRPPATFLIPRSESNFSINEEGSDQSASKSIPF-SVNEASISDLYPR  638



>ref|XP_009598808.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform 
X2 [Nicotiana tomentosiformis]
Length=540

 Score =   132 bits (331),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 65/111 (59%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WK+WR+ T ++++D + G  YSRNEVIQCIH+GLLCVQE+V ERPTM +VVLML+S+S
Sbjct  430  YVWKNWRDGTPLNIMDPTFGESYSRNEVIQCIHIGLLCVQEDVTERPTMESVVLMLNSYS  489

Query  182  ATRRAPNPPATFSDEMT--ISAGQEADQ-STNKSPPLSSVNEVSISDLYPR  325
             T+ AP  PA F    T  +  G E+DQ ST+KS PL S NEVSI++L+PR
Sbjct  490  VTKAAPQQPAFFFRSRTEMLPKGLESDQYSTSKSIPLLSENEVSITELHPR  540



>ref|XP_009598807.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Nicotiana tomentosiformis]
Length=675

 Score =   130 bits (328),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 65/111 (59%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WK+WR+ T ++++D + G  YSRNEVIQCIH+GLLCVQE+V ERPTM +VVLML+S+S
Sbjct  565  YVWKNWRDGTPLNIMDPTFGESYSRNEVIQCIHIGLLCVQEDVTERPTMESVVLMLNSYS  624

Query  182  ATRRAPNPPATFSDEMT--ISAGQEADQ-STNKSPPLSSVNEVSISDLYPR  325
             T+ AP  PA F    T  +  G E+DQ ST+KS PL S NEVSI++L+PR
Sbjct  625  VTKAAPQQPAFFFRSRTEMLPKGLESDQYSTSKSIPLLSENEVSITELHPR  675



>emb|CDP04897.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 83/112 (74%), Gaps = 4/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+ WR+ T + +VD ++G  YSRNEVIQ IHVGLLCVQ+ +++RPTMA+VVLML+S S
Sbjct  136  YAWRQWRDGTPLALVDPTIGDAYSRNEVIQSIHVGLLCVQDEIEQRPTMASVVLMLNSIS  195

Query  182  ATRRAPNPPATFSDEMTISAGQE---ADQSTN-KSPPLSSVNEVSISDLYPR  325
             T  APNPPA F    T S+  +   +D ST  KSPP  S+N+VSI++L+PR
Sbjct  196  ITLPAPNPPAYFGSSRTQSSPNDLPVSDTSTGTKSPPNPSINDVSITELHPR  247



>ref|XP_009762725.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10, partial [Nicotiana sylvestris]
Length=404

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WK+WR+ T ++++D + G  YSRNEVIQCIH+GLLCVQ++V++RPTM +VVLML+S+S
Sbjct  294  YVWKNWRDGTPLNIMDPTFGDSYSRNEVIQCIHIGLLCVQDDVNQRPTMESVVLMLNSYS  353

Query  182  ATRRAPNPPATFSDEMT--ISAGQEADQ-STNKSPPLSSVNEVSISDLYPR  325
             T+ AP  PA F    T  +  G E+DQ ST+ S PL S NEVSI++L+PR
Sbjct  354  VTKPAPQQPAFFFRSRTEMLPKGLESDQYSTSNSIPLLSENEVSITELHPR  404



>ref|XP_006343408.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Solanum tuberosum]
Length=662

 Score =   123 bits (309),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 60/110 (55%), Positives = 81/110 (74%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WK+WR+ T ++++D      YSRNEVIQCIH+GLLCVQE+V+ERPTM +VVLML+S+S
Sbjct  554  YVWKNWRDGTPLNIMDPIFAESYSRNEVIQCIHIGLLCVQEDVNERPTMDSVVLMLNSYS  613

Query  182  ATRRAPNPPATF--SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T + P  PA F  S    +  G ++DQS +KS PL S+NEVSI+++ PR
Sbjct  614  ITTQPPKQPAFFFRSRSEMLPKGMDSDQSKSKSMPL-SINEVSITEMEPR  662



>emb|CDP04899.1| unnamed protein product [Coffea canephora]
Length=644

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 83/112 (74%), Gaps = 4/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+ WR+ T + +VD ++G  YSRNEVIQ IHVGLLCVQ+ +++RPTMA+VVLML+S S
Sbjct  533  YAWRQWRDGTPLALVDPTIGDAYSRNEVIQSIHVGLLCVQDEIEQRPTMASVVLMLNSIS  592

Query  182  ATRRAPNPPATFSDEMTISAGQE---ADQSTN-KSPPLSSVNEVSISDLYPR  325
             T  APNPPA F    T S+  +   +D ST  KSPP  S+N+VSI++L+PR
Sbjct  593  ITLPAPNPPAYFGSSRTQSSPNDLPVSDTSTGTKSPPNPSINDVSITELHPR  644



>emb|CDP04893.1| unnamed protein product [Coffea canephora]
Length=556

 Score =   122 bits (305),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 59/112 (53%), Positives = 83/112 (74%), Gaps = 4/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+ WR+ T + +VD ++G  Y+RNEVI+ IH GLLCVQ+ +++RPTMA++VLML+S+S
Sbjct  445  YAWRQWRDGTPLALVDPTIGDTYARNEVIRSIHAGLLCVQDEIEQRPTMASIVLMLNSNS  504

Query  182  ATRRAPNPPATFSDEMTISAGQE---ADQSTN-KSPPLSSVNEVSISDLYPR  325
             T  APNPPA F    T S+  +   +D ST+ KS P  S+NEVSI++L+PR
Sbjct  505  ITLLAPNPPAYFGRSRTQSSPNDLPVSDSSTSTKSAPNPSINEVSITELHPR  556



>emb|CBI35672.3| unnamed protein product [Vitis vinifera]
Length=699

 Score =   120 bits (300),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR+ T ++++D  +   Y+RNEVI+CIH+GLLCVQE+ D+RP+MA+VVLML S+S
Sbjct  590  YAWKLWRDGTPLELMDPIMRDSYARNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYS  649

Query  182  ATRRAPNPPATFSDEMTISA---GQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T S      E+DQST+KS P  SVNE SIS+LYPR
Sbjct  650  VTLPLPQQPAFFIGSGTQSGFPIKAESDQSTSKSTPW-SVNETSISELYPR  699



>ref|XP_010646899.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=668

 Score =   119 bits (299),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR+ T ++++D  +   Y+RNEVI+CIH+GLLCVQE+ D+RP+MA+VVLML S+S
Sbjct  559  YAWKLWRDGTPLELMDPIMRDSYARNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYS  618

Query  182  ATRRAPNPPATFSDEMTISA---GQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T S      E+DQST+KS P  SVNE SIS+LYPR
Sbjct  619  VTLPLPQQPAFFIGSGTQSGFPIKAESDQSTSKSTPW-SVNETSISELYPR  668



>ref|XP_006388606.1| hypothetical protein POPTR_0138s00200g [Populus trichocarpa]
 gb|ERP47520.1| hypothetical protein POPTR_0138s00200g [Populus trichocarpa]
Length=505

 Score =   117 bits (294),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 78/112 (70%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W+    ++++D S G  YSRNE+ +C+H+GLLCVQE+ ++RPT++ +VLML S S
Sbjct  395  YAWKQWKNGAVLELMDSSFGDSYSRNEITRCVHIGLLCVQEDPNDRPTLSTIVLMLTSFS  454

Query  182  ATRRAPNPPATFSDEMTI----SAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T+    +   E+D+ST+KS PL SVN++SI++LYPR
Sbjct  455  VTLPLPREPAYFGQSRTVPKFPTTELESDRSTSKSKPL-SVNDMSITELYPR  505



>ref|XP_006383962.1| hypothetical protein POPTR_0004s02500g [Populus trichocarpa]
 gb|ERP61759.1| hypothetical protein POPTR_0004s02500g [Populus trichocarpa]
Length=673

 Score =   118 bits (295),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/112 (51%), Positives = 79/112 (71%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+ W+    +++VD SLG  YSRNE+ +C+H+ LLCVQE+ ++RPT+ +VVLML S S
Sbjct  563  YAWQQWKNGAALELVDPSLGDSYSRNEITRCLHIALLCVQEDPNDRPTLTSVVLMLTSFS  622

Query  182  ATRRAPNPPATFSDEMTISA----GQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  P++F   MTIS+      E+DQS  KS PL SVN+VSI++LYPR
Sbjct  623  ISLPLPREPSSFEQSMTISSLPLTELESDQSNIKSKPL-SVNDVSITELYPR  673



>ref|XP_011002059.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Populus 
euphratica]
Length=680

 Score =   118 bits (295),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/112 (51%), Positives = 78/112 (70%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W+    +++VD SLG  YSRNE+ +C+H+ LLCVQE+ ++RPT+  VVLML S S
Sbjct  570  YAWKQWKNGAALELVDPSLGDSYSRNEITRCLHIALLCVQEDPNDRPTLTEVVLMLTSFS  629

Query  182  ATRRAPNPPATFSDEMTISA----GQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  P++F   MT+S+      E+DQS  KS PL SVN+VSI++LYPR
Sbjct  630  ISLPLPQEPSSFEQSMTVSSLPLTELESDQSNIKSTPL-SVNDVSITELYPR  680



>emb|CBI34091.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 79/112 (71%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR+ T ++++D  +G  Y+RNEVI+CIH+GLLCVQE+ D+RP+MA+VVLML S+S
Sbjct  522  YAWKLWRDGTPLELMDPMMGDSYARNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYS  581

Query  182  ATRRAPNPPATFSDEMTISA----GQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T S       E+DQS +KS P  S+NE SIS+LYPR
Sbjct  582  VTLPLPQQPAFFIRSGTQSGFPINALESDQSASKSTPW-SLNETSISELYPR  632



>ref|XP_011002057.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Populus euphratica]
Length=668

 Score =   117 bits (294),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/112 (50%), Positives = 79/112 (71%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W+    ++++D SLG  YSRNE+ +CIH+GLLCVQE+ ++RPT+A +VL+L S S
Sbjct  558  YAWKQWKNGAALELMDASLGHSYSRNEITRCIHIGLLCVQEDPNDRPTLATIVLVLTSFS  617

Query  182  ATRRAPNPPATFSDEMTI----SAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T+    +   E+D+ST+KS PL SVN++SI++LYPR
Sbjct  618  VTLPLPREPAYFGQSRTVPTFPTTELESDRSTSKSKPL-SVNDMSITELYPR  668



>ref|XP_006606026.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X2 [Glycine max]
Length=615

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 79/111 (71%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+W E T + ++D +L G YSRNEV +CIH+GLLCVQEN  +RP+MA + LML+S+S
Sbjct  506  YAWKNWTEQTPLQLLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYS  565

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA+F    +   ++ G ++DQST  S P  SVNEVSI+D+YPR
Sbjct  566  VTLSMPRQPASFLRGRNPNRLNQGLDSDQSTTCSIPW-SVNEVSITDIYPR  615



>ref|XP_010648190.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Vitis vinifera]
Length=681

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 79/112 (71%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR+ T ++++D  +G  Y+RNEVI+CIH+GLLCVQE+ D+RP+MA+VVLML S+S
Sbjct  571  YAWKLWRDGTPLELMDPMMGDSYARNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYS  630

Query  182  ATRRAPNPPATFSDEMTISA----GQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T S       E+DQS +KS P  S+NE SIS+LYPR
Sbjct  631  VTLPLPQQPAFFIRSGTQSGFPINALESDQSASKSTPW-SLNETSISELYPR  681



>ref|XP_010648189.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=682

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 79/112 (71%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR+ T ++++D  +G  Y+RNEVI+CIH+GLLCVQE+ D+RP+MA+VVLML S+S
Sbjct  572  YAWKLWRDGTPLELMDPMMGDSYARNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYS  631

Query  182  ATRRAPNPPATFSDEMTISA----GQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T S       E+DQS +KS P  S+NE SIS+LYPR
Sbjct  632  VTLPLPQQPAFFIRSGTQSGFPINALESDQSASKSTPW-SLNETSISELYPR  682



>emb|CAN72253.1| hypothetical protein VITISV_034184 [Vitis vinifera]
Length=655

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 79/112 (71%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR+ T ++++D  +G  Y+RNEVI+CIH+GLLCVQE+ D+RP+MA+VVLML S+S
Sbjct  545  YAWKLWRDGTPLELMDPMMGDSYARNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYS  604

Query  182  ATRRAPNPPATFSDEMTISA----GQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T S       E+DQS +KS P  S+NE SIS+LYPR
Sbjct  605  VTLPLPQQPAFFIRSGTQSGFPINALESDQSASKSTPW-SLNETSISELYPR  655



>emb|CDP04752.1| unnamed protein product [Coffea canephora]
Length=690

 Score =   117 bits (293),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/112 (49%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+ WR+ T + ++D  +G  Y RNEVI+ IHV LLCVQ+ +++RPTMA+VVLML+S+S
Sbjct  579  YAWRQWRDGTPLALMDPKMGDSYERNEVIKSIHVALLCVQDEIEQRPTMASVVLMLNSNS  638

Query  182  ATRRAPNPPATF----SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   PNPPA F    +  + I   +    +  K  P  SVNEVSI++LYPR
Sbjct  639  VTLPVPNPPAYFGRSRTQNLPIDQPESGTSTNTKLLPGPSVNEVSITELYPR  690



>ref|XP_006606025.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X1 [Glycine max]
Length=659

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 79/111 (71%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+W E T + ++D +L G YSRNEV +CIH+GLLCVQEN  +RP+MA + LML+S+S
Sbjct  550  YAWKNWTEQTPLQLLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYS  609

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA+F    +   ++ G ++DQST  S P  SVNEVSI+D+YPR
Sbjct  610  VTLSMPRQPASFLRGRNPNRLNQGLDSDQSTTCSIPW-SVNEVSITDIYPR  659



>gb|KHN15823.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja]
Length=659

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+W E T +  +D +L G YSRNEV +CIH+GLLCVQEN  +RP+MA + LML+S+S
Sbjct  550  YAWKNWTEQTPLQFLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYS  609

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA+F    +   ++ G ++DQST  S P  SVNEVSI+D+YPR
Sbjct  610  VTLSMPRQPASFLRGRNLNRLNQGLDSDQSTTCSIPW-SVNEVSITDIYPR  659



>emb|CBI29180.3| unnamed protein product [Vitis vinifera]
Length=523

 Score =   114 bits (286),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR DT ++ +  +    +S+NEVI+CIH+GLLCVQE+ D+RP+MA+VVLML S+S
Sbjct  413  YAWKLWRNDTPLEFMGPTTRNSFSKNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYS  472

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA+FS    +S       E+DQS +KS    SVNE SI+DLYPR
Sbjct  473  VTLPLPQQPASFSRTGALSDFPIMALESDQSASKSMTW-SVNEASITDLYPR  523



>ref|XP_006449133.1| hypothetical protein CICLE_v10014789mg [Citrus clementina]
 gb|ESR62373.1| hypothetical protein CICLE_v10014789mg [Citrus clementina]
Length=555

 Score =   114 bits (286),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 79/117 (68%), Gaps = 11/117 (9%)
 Frame = +2

Query  5    AWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
            AWK+WRE TTV+++D +L    S  E+I+CIH+GLLCVQENV  RPTMA+VVLML+S+S 
Sbjct  440  AWKNWREGTTVNIIDPTLSS-GSITEMIRCIHIGLLCVQENVASRPTMASVVLMLNSYSL  498

Query  185  TRRAPNPPATFSD-----EMTISAGQ-----EADQSTNKSPPLSSVNEVSISDLYPR  325
            T   P+ PA F D     +M+ S        E DQ   ++ PLS  NE+SI+DLYPR
Sbjct  499  TLPVPSEPAFFMDSIIESDMSSSLAHDSRIMETDQPGCETLPLSGNNEISITDLYPR  555



>ref|XP_010059124.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=342

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 81/110 (74%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WK+ R+ T+++++D ++G LY RNEV++C+H+GLLCVQE+  +RP+MAN+VLML ++S
Sbjct  234  YVWKNRRDGTSLEVLDLAIGDLYPRNEVLRCLHIGLLCVQEDPFDRPSMANIVLMLSNYS  293

Query  182  ATRRAPNPPATFSDEMTISAGQ--EADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T    +  E+DQST++S PLS+ NE+SI ++YPR
Sbjct  294  VTLALPQQPAFFLRSRTEKPMKELESDQSTSRSMPLST-NEISIIEVYPR  342



>ref|XP_006383923.1| hypothetical protein POPTR_0004s01260g [Populus trichocarpa]
 gb|ERP61720.1| hypothetical protein POPTR_0004s01260g [Populus trichocarpa]
Length=158

 Score =   107 bits (268),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHW   T ++++D SLG  YSRNE+ +C+H+ LLCVQE+ + RP +  +VLML S S
Sbjct  48   YAWKHWTNGTALELMDASLGHSYSRNEIARCLHIALLCVQEDPNNRPPLTTIVLMLTSFS  107

Query  182  ATRRAPNPPATFSDEMTISA----GQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA      T S+      E+D+ST+KS PL SVN+VSI++LYPR
Sbjct  108  VTLPLPRKPAYCVRSRTGSSLPITELESDRSTSKSKPL-SVNDVSITELYPR  158



>gb|KCW75002.1| hypothetical protein EUGRSUZ_E03765 [Eucalyptus grandis]
Length=728

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 84/110 (76%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WK+WR+ T ++++D ++G  YSR+EV++C+H+GLLCVQE+  +RPTMAN+VLML+S+S
Sbjct  620  YVWKNWRDGTPLEVLDPAVGDSYSRDEVLRCLHIGLLCVQEDPMDRPTMANIVLMLNSYS  679

Query  182  ATRRAPNPPATFSDEMTISAGQE--ADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F    T ++ +E  +DQS ++S P+ S+NE+S++++YPR
Sbjct  680  VSLALPQQPALFFRSRTETSMKELKSDQSASRSAPV-SINEMSVTEVYPR  728



>ref|XP_010057978.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Eucalyptus 
grandis]
 gb|KCW75398.1| hypothetical protein EUGRSUZ_E04152 [Eucalyptus grandis]
Length=666

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 84/110 (76%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WK+WR+ T ++++D ++G  YSR+EV++C+H+GLLCVQE+  +RPTMAN+VLML+S+S
Sbjct  558  YVWKNWRDGTPLEVLDPAVGDSYSRDEVLRCLHIGLLCVQEDPMDRPTMANIVLMLNSYS  617

Query  182  ATRRAPNPPATFSDEMTISAGQ--EADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F    T ++ +  E+DQS ++S P+ S+NE+S++++YPR
Sbjct  618  VSLALPQQPAFFLRSRTETSMKELESDQSASRSTPV-SINEMSVTEVYPR  666



>ref|XP_008224859.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Prunus 
mume]
Length=668

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 80/113 (71%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+HWR+ T ++++D +L   Y++ EV +C+H+GLLCVQE  DERPTM ++VLML S+S
Sbjct  557  YAWRHWRDGTPLELLDPNLRDSYAKAEVTRCVHIGLLCVQEIPDERPTMQSIVLMLSSYS  616

Query  182  ATRRAPNPPATF---SDEMTISA--GQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F     E+ + +   + +DQ+T+KS P  SVNEVSI++LYPR
Sbjct  617  VTMALPQKPALFLHSRSELNMPSLTTESSDQTTSKSLPF-SVNEVSITELYPR  668



>ref|XP_003615452.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES98410.1| cysteine-rich RLK (receptor-like kinase) protein, putative [Medicago 
truncatula]
Length=160

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 73/118 (62%), Gaps = 12/118 (10%)
 Frame = +2

Query  5    AWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
             WK WRE TT +++D SL    SRNE+++CIH+GLLCVQ+NV  R TMA +VL++ S+S 
Sbjct  44   VWKSWREGTTTNIIDSSLFDDSSRNEIMRCIHIGLLCVQDNVARRRTMATIVLLISSNSL  103

Query  185  TRRAPNPPATFSDEMTI-----------SAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            T   P+ PA F D  T+           S    + QST KS P+ SVNE S +D YPR
Sbjct  104  TLPIPSEPAFFMDSRTVSLPEMRLCEENSGTTRSSQSTTKSAPV-SVNEASFTDPYPR  160



>ref|XP_010267898.1| PREDICTED: uncharacterized protein LOC104605002 [Nelumbo nucifera]
Length=1359

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 81/117 (69%), Gaps = 11/117 (9%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WKHW E T +++VD  LG  YSR+EV++CIH+GLLC Q++V +RPTMA VVLML+S+S
Sbjct  561  YVWKHWNEGTALELVDPILGEAYSRDEVMKCIHIGLLCTQDDVADRPTMATVVLMLNSNS  620

Query  182  ATRRAPNPPATF-SDEM---TISAGQ------EADQSTNKSPPLSSVNEVSISDLYP  322
             T   P+ PA + S +M    I+ G+      E+DQS  KS P  SVNEVSI++L P
Sbjct  621  VTLAVPSRPAVYASSKMFSGVITGGESEGKATESDQSATKSMPW-SVNEVSITELQP  676


 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 77/116 (66%), Gaps = 10/116 (9%)
 Frame = +2

Query  2     YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
             YAW+ W+E   ++++D +L   YSR+E ++C H+GLLCVQEN+ +RPTM+ V+LML+S+S
Sbjct  1246  YAWRRWKEGAVLELIDPTLCDRYSRHEALRCFHIGLLCVQENLADRPTMSLVILMLNSYS  1305

Query  182   ATRRAPNPPATF--SDEMTI------SAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
              T   P+ P  F      TI      S G E+DQS +K   L S+N +S++++YPR
Sbjct  1306  VTLALPSAPPYFISGRAKTIVPARSESQGTESDQSASKV-LLQSIN-MSLTEVYPR  1359



>ref|XP_010655874.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=661

 Score =   112 bits (279),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 81/108 (75%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+ W++ T ++++D  +GG YSR+EV++CIH+GLLCVQE+  +RPTMA+V LML+S+S
Sbjct  560  YAWRQWKDRTALELIDPIVGGEYSRSEVMRCIHIGLLCVQEDAADRPTMASVALMLNSYS  619

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA F     + + +E++ ST+KS  + SV+E SI+++YPR
Sbjct  620  VTLPLPSKPAFF-----LHSKKESNPSTSKSVSM-SVDEGSITEVYPR  661



>gb|KCW75004.1| hypothetical protein EUGRSUZ_E03766 [Eucalyptus grandis]
Length=666

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            + WK+WR+ T ++++D ++G  YSR+EV++C+H+GLLCVQE+  +RPTMAN+VLML+S+S
Sbjct  558  HVWKNWRDGTPLEVLDLAVGDSYSRDEVLRCLHIGLLCVQEDPMDRPTMANIVLMLNSYS  617

Query  182  ATRRAPNPPATF--SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F  S   T+    E+DQS ++S P+ S+NE+S++++YPR
Sbjct  618  VSLALPQQPAFFLRSRTETLMKELESDQSASRSTPV-SINEMSVTEVYPR  666



>gb|KCW74337.1| hypothetical protein EUGRSUZ_E03008 [Eucalyptus grandis]
Length=281

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR D  +D++D +LG  YSR++V++CIH+G LCVQE+   RPTMAN+VL L   +
Sbjct  171  YAWKHWRSDAPLDILDPALGESYSRSQVLKCIHIGFLCVQEDPANRPTMANIVLALSGQT  230

Query  182  ATRRAPNPPATF-SDEM---TISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F   EM    +   Q  DQ T+ S PL S+NE S++++YPR
Sbjct  231  LSLPVPREPAFFLQREMPNNFMGKDQGYDQITSSSVPL-SINEASVTEVYPR  281



>ref|XP_010644341.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=660

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR DT ++ +  +    +S+NEVI+CIH+GLLCVQE+ D+RP+MA+VVLML S+S
Sbjct  550  YAWKLWRNDTPLEFMGPTTRNSFSKNEVIRCIHMGLLCVQEDPDDRPSMASVVLMLSSYS  609

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA+FS    +S       E+DQS +KS    SVNE SI+DLYPR
Sbjct  610  VTLPLPQQPASFSRTGALSDFPIMALESDQSASKSMTW-SVNEASITDLYPR  660



>ref|XP_011010158.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Populus 
euphratica]
Length=675

 Score =   111 bits (277),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 57/113 (50%), Positives = 78/113 (69%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WKHWR+ T ++++D +L   YSRNEVI+CIH+GLLCVQE+   RPTMA VVLML+S+S
Sbjct  564  YVWKHWRDGTPLEVMDPTLTDTYSRNEVIRCIHIGLLCVQEDPASRPTMATVVLMLNSYS  623

Query  182  ATRRAPNPPATF----SDEMTISAGQ-EADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    +D+ +I + +  AD+S   S P S  +E SI+++YPR
Sbjct  624  ITLPLPQEPAFFLHSRTDQGSIPSKEFFADKSKTNSVPYSG-DEGSITEVYPR  675



>ref|XP_003615455.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES98413.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=666

 Score =   110 bits (276),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 58/119 (49%), Positives = 75/119 (63%), Gaps = 13/119 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW+ WRE T  +++D SL    SRNE+++CIH+GLLCVQ+NV  RPTMAN+VLML S+S
Sbjct  550  FAWRSWREGTAANIIDSSLYN-SSRNEIMRCIHIGLLCVQDNVTRRPTMANIVLMLSSYS  608

Query  182  ATRRAPNPPATFSDEMTISAGQ-----------EADQSTNKSPPLSSVNEVSISDLYPR  325
                 P+ PA F D  T S  +            + QST+KS P  SVNE S +D YPR
Sbjct  609  LALSIPSEPAFFMDSRTRSLQEMRLWEEKSGTTRSSQSTSKSAP-ESVNEASFTDPYPR  666



>ref|XP_006468228.1| PREDICTED: uncharacterized protein LOC102629057 [Citrus sinensis]
Length=1332

 Score =   112 bits (279),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 56/113 (50%), Positives = 78/113 (69%), Gaps = 6/113 (5%)
 Frame = +2

Query  2     YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
             YAWK WR+ T + ++D +L   YSRNEVI+CIH+GLLCVQE+  ERP++A +VLML+S+S
Sbjct  1221  YAWKQWRDGTPLQLLDPNLTDSYSRNEVIRCIHLGLLCVQEDPAERPSLATIVLMLNSYS  1280

Query  182   ATRRAPNPPATFSDEMT-----ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
              T  +P  PA F    T         + +D+ST+KS P  SV+E SI+++YPR
Sbjct  1281  VTLPSPQQPAFFIGSRTERSLPTKEFEFSDKSTSKSMPW-SVDEASITEVYPR  1332


 Score = 67.4 bits (163),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 4/92 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+ W+E   ++ VD  L    S  +V++CIH+GLLCVQE+   RPTM+NVV +L S S
Sbjct  549  YVWQLWKEGKEMEFVDPLLMKSSSIPQVVRCIHIGLLCVQEDPAVRPTMSNVVALLGSES  608

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSP  277
                 P  P  F    TI     A+Q + K P
Sbjct  609  IALSEPRQPP-FPVGRTIVL---AEQPSTKDP  636



>gb|KHG26430.1| Cysteine-rich receptor-like protein kinase 10 [Gossypium arboreum]
Length=661

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 81/112 (72%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W++  +++++D  L   YSRNEVI+CI +GLLCVQE+  +RPTMA VVL+L+S+S
Sbjct  551  YAWKLWKDGRSLELLDPVLRDNYSRNEVIRCIQLGLLCVQEDPADRPTMATVVLLLNSYS  610

Query  182  ATRRAPNPPA----TFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            AT + P  PA    + +D      G E+DQST++S P S+ NEVSI++LYPR
Sbjct  611  ATLQVPKQPAFVLQSRTDGRMPDKGLESDQSTSQSMPWSN-NEVSITELYPR  661



>ref|XP_004496792.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Cicer arietinum]
Length=664

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W E T ++++D +L G  SRNEVI+CIH+GLLCVQEN ++RP+M  + LML+S+S
Sbjct  555  YAWKKWSEQTPLELLDPTLRGSCSRNEVIRCIHMGLLCVQENPNDRPSMETIALMLNSYS  614

Query  182  ATRRAPNPPATFSDEMT---ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  P +F    T   I+ G  +DQS+  S P  SVNEVSI+++YPR
Sbjct  615  VTLSLPRQPPSFLRGRTPDRITQGLNSDQSSTCSIPW-SVNEVSITEVYPR  664



>emb|CDP20318.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 76/110 (69%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            + WK+WR+ T V ++D  LG   +RNEVIQ IH+GLLCVQE+VDERP MA+VVLML S S
Sbjct  570  HCWKNWRDGTPVALLDPILGNSSARNEVIQSIHIGLLCVQEDVDERPNMASVVLMLSSRS  629

Query  182  ATRRAPNPPATFSDEMTISAGQE--ADQSTNKSPPLSSVNEVSISDLYPR  325
            AT   P+ PA F    T S   E   D ST+ S P +SVNE ++++LYPR
Sbjct  630  ATLPTPDRPAFFVRSKTESFPSEFQFDASTSNSMP-ASVNETTVTELYPR  678



>gb|KDO75602.1| hypothetical protein CISIN_1g006155mg [Citrus sinensis]
Length=658

 Score =   110 bits (275),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 11/117 (9%)
 Frame = +2

Query  5    AWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
            AWK+WRE TTV+++D +L    S  E+I+CIH+GLLCVQENV  RPTMA+VVLML+S+S 
Sbjct  543  AWKNWREGTTVNIIDPTLSS-GSITEMIRCIHIGLLCVQENVASRPTMASVVLMLNSYSL  601

Query  185  TRRAPNPPATFSD-----EMTISAGQ-----EADQSTNKSPPLSSVNEVSISDLYPR  325
            T   P+ PA F D     +M+ S        E DQ   ++  LS  NE+SI+DLYPR
Sbjct  602  TLPVPSEPAFFMDSIIESDMSFSLAHDSRITETDQPGCENLLLSGNNEISITDLYPR  658



>ref|XP_006373160.1| hypothetical protein POPTR_0017s09230g [Populus trichocarpa]
 gb|ERP50957.1| hypothetical protein POPTR_0017s09230g [Populus trichocarpa]
Length=419

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 80/113 (71%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR+ T ++++D +L   YSRNEV++CIH+GLLCVQE+   RPTMA VVL+L+S+S
Sbjct  308  YAWKHWRDGTPLEVMDPTLADTYSRNEVMRCIHIGLLCVQEDPASRPTMATVVLLLNSYS  367

Query  182  ATRRAPNPPATF----SDEMTISAGQ-EADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    +D+ +I + +  AD+S + S P S  +E SI+++YPR
Sbjct  368  ITLPLPQEPAFFLHSRTDQGSIPSKEFFADKSKSNSVPYSG-DEGSITEVYPR  419



>gb|KHG08444.1| Cysteine-rich receptor-like protein kinase 10 [Gossypium arboreum]
Length=146

 Score =   103 bits (258),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W+++  +++++  L   YSRNEV +CI +GLLC QE+  +RPTMA +VL ++ HS
Sbjct  36   YAWKLWKDERPLELLNPVLRNDYSRNEVTKCIQLGLLCAQEDPADRPTMATIVLRINRHS  95

Query  182  ATRRAPNPPATFSDEMT----ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            A    P  PA   D  T     + G E DQST +S P SS+NEVSI++LYPR
Sbjct  96   AKLLMPKRPAFVFDSRTDGRMQNKGLELDQSTTQSTP-SSINEVSITELYPR  146



>ref|XP_010059133.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Eucalyptus grandis]
Length=549

 Score =   109 bits (273),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR D  +D++D +LG  YSR++V++CIH+G LCVQE+   RPTMAN+VL L   +
Sbjct  439  YAWKHWRSDAPLDILDPALGESYSRSQVLKCIHIGFLCVQEDPANRPTMANIVLALSGQT  498

Query  182  ATRRAPNPPATF-SDEMT---ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F   EM    +   Q  DQ T+ S PL S+NE S++++YPR
Sbjct  499  LSLPVPREPAFFLQREMPNNFMGKDQGYDQITSSSVPL-SINEASVTEVYPR  549



>ref|XP_010059510.1| PREDICTED: uncharacterized protein LOC104447479 [Eucalyptus grandis]
Length=1330

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 83/110 (75%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            + WK+WR+ T ++++D ++G  YSR+EV++C+H+GLLCVQE+  +RPTMAN+VLML+S+S
Sbjct  557  HVWKNWRDGTPLEVLDLAVGDSYSRDEVLRCLHIGLLCVQEDPMDRPTMANIVLMLNSYS  616

Query  182  ATRRAPNPPATF--SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F  S   T+    E+DQS ++S P+ S+NE+S++++YPR
Sbjct  617  VSLALPQQPAFFLRSRTETLMKELESDQSASRSTPV-SINEMSVTEVYPR  665


 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 76/110 (69%), Gaps = 3/110 (3%)
 Frame = +2

Query  2     YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
             YAWKHWR  T ++++D  +   YS +EV++C+H+GLL VQE+  +RPTMA++VLML SHS
Sbjct  1222  YAWKHWRAGTPLEVLDPFISNAYSIDEVVRCLHIGLLGVQEDPADRPTMASIVLMLTSHS  1281

Query  182   ATRRAPNPPATFSDEMTISAGQ--EADQSTNKSPPLSSVNEVSISDLYPR  325
                  P  PA F    T    +  E+D+ST++S P S+ NE+S++++YPR
Sbjct  1282  VKLSQPRQPAFFLQRSTERRLKEPESDESTSRSMPWST-NEMSVTEVYPR  1330



>ref|XP_010686952.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Beta 
vulgaris subsp. vulgaris]
Length=665

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W + T ++ VD ++ GL S + VI+C+H+G LCVQE++D+RPTM  +VLML  +S
Sbjct  559  YAWKQWIDGTPLEFVDPTIRGLCSSDAVIRCMHLGFLCVQESIDDRPTMGTIVLMLECYS  618

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T  AP  PA F +    S   E+DQS +KS    SVN+VSI+++ PR
Sbjct  619  VTLTAPKEPAFFGNNSIFSKHMESDQSNSKSIH-GSVNDVSITEMEPR  665



>ref|XP_006449119.1| hypothetical protein CICLE_v10014496mg [Citrus clementina]
 gb|ESR62359.1| hypothetical protein CICLE_v10014496mg [Citrus clementina]
Length=674

 Score =   110 bits (274),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 56/113 (50%), Positives = 77/113 (68%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR+ T + ++D +L   +SRNEVI+CI +GLLCVQE+  ERP+MA +VLML+S+S
Sbjct  563  YAWKQWRDGTPLQLLDPNLTDSHSRNEVIRCIQLGLLCVQEDPAERPSMATIVLMLNSYS  622

Query  182  ATRRAPNPPATFSDEMT-----ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T  +P  PA F    T         + +D+STNKS P  SV+E SI+++YPR
Sbjct  623  VTLPSPQQPAFFIGSRTERSLPTKEFEFSDKSTNKSMPW-SVDEASITEVYPR  674



>gb|KDO37422.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=674

 Score =   110 bits (274),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 55/113 (49%), Positives = 78/113 (69%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR+ T + ++D +L   YSRNEVI+CI +GLLCVQE+  ERP+MA +VLML+S+S
Sbjct  563  YAWKQWRDGTPLQLLDTNLTDSYSRNEVIRCIQLGLLCVQEDPAERPSMATIVLMLNSYS  622

Query  182  ATRRAPNPPATF-----SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T  +P  PA F       ++     + +D+ST+KS P  SV+E SI+++YPR
Sbjct  623  VTLPSPQQPAFFIGSRTERDLPTKEFECSDKSTSKSIPW-SVDEASITEVYPR  674



>gb|KCW74354.1| hypothetical protein EUGRSUZ_E030281, partial [Eucalyptus grandis]
Length=110

 Score =   102 bits (254),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 76/111 (68%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    AWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
            AWKHWR+D   +++D +LG  YSR++V++CIH+G LCVQE+  +RPTMA++VL L S + 
Sbjct  1    AWKHWRDDVPSEILDPALGESYSRSQVLRCIHIGFLCVQEDPADRPTMASIVLALSSQTL  60

Query  185  TRRAPNPPATF----SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
                P  PA F    +++  I+  Q  DQ+ + S PL SVN +SI+++YPR
Sbjct  61   ILPVPQGPAFFFRSWTEQPNIANDQGHDQNNSGSAPL-SVNGMSITEVYPR  110



>gb|KCW75396.1| hypothetical protein EUGRSUZ_E04150 [Eucalyptus grandis]
Length=570

 Score =   109 bits (272),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 80/110 (73%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+WR+   ++++D ++G LYSR+EV++C+H+GLLCVQE+  +RPTMA VVLML S+S
Sbjct  462  YAWKNWRDGKPLEVLDPAIGDLYSRDEVLRCLHIGLLCVQEDPMDRPTMATVVLMLSSYS  521

Query  182  ATRRAPNPPATFSDEMTI--SAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +  +P  PA F    T       E+DQST +S  + S+NE+S++++YPR
Sbjct  522  VSLASPLQPAFFLRSRTEIPMKNLESDQSTGRSMAM-SINEMSVTEVYPR  570



>ref|XP_008349286.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (70%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+ T+++++D+ L   YSR EVI+CIH+GLLCVQE+  +RPTM +VVLML+S+S
Sbjct  555  HAWKLWRDGTSLELLDQCLRDSYSRTEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYS  614

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F    T+        E+DQS +KS P  SVNE SI+++YPR
Sbjct  615  VSLPLPKQPAFFLQSRTVGNMPMITLESDQSISKSSP--SVNEGSITEVYPR  664



>ref|XP_003556014.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
isoform 2 [Glycine max]
Length=666

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 80/111 (72%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W+++  ++++D+SL   Y+RNEVI+CIH+GLLCVQE+  +RPTMA+VVLML S+S
Sbjct  557  YAWKLWKDEAPLELMDQSLRESYTRNEVIRCIHIGLLCVQEDPIDRPTMASVVLMLDSYS  616

Query  182  ATRRAPNPPATFSDEMT---ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T + PN PA + +  T   +  G + DQST  S    SVN++S+S++ PR
Sbjct  617  VTLQVPNQPAFYINSRTEPNMPKGLKIDQSTTNSTS-KSVNDMSVSEVDPR  666



>ref|XP_008340068.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=668

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (70%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+ T+++++D+ L   YSR EVI+CIH+GLLCVQE+  +RPTM +VVLML+S+S
Sbjct  559  HAWKLWRDGTSLELLDQCLRDSYSRTEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYS  618

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F    T+        E+DQS +KS P  SVNE SI+++YPR
Sbjct  619  VSLPLPKQPAFFLQSRTVGNMPMITLESDQSISKSSP--SVNEGSITEVYPR  668



>ref|XP_010665893.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Beta 
vulgaris subsp. vulgaris]
Length=668

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 74/111 (67%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W   T ++ VD ++ GL S NEVI+C+H+G LCVQE++D+RPTMA +VLML SHS
Sbjct  559  YAWKQWIAGTPLEFVDPTIRGLCSSNEVIRCMHLGFLCVQESIDDRPTMATLVLMLESHS  618

Query  182  ATRRAPNPPATFSDEMTISAGQE---ADQSTNKSPPLSSVNEVSISDLYPR  325
             T +AP  P  F    + S   E   +DQS  K   L S+N+VS+++L PR
Sbjct  619  VTLKAPQEPTFFGKSGSNSGFVEHMGSDQSKRK-LILGSINDVSLTELEPR  668



>ref|XP_010057745.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=644

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 81/110 (74%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+WR+   ++++D ++G LYSR+EV++C+H+GLLCVQE+  +RPTMA+VVLML S+S
Sbjct  536  YAWKNWRDGKPLEVLDPTIGDLYSRDEVLRCLHIGLLCVQEDPMDRPTMASVVLMLSSYS  595

Query  182  ATRRAPNPPATFSDEMTIS--AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F    T       E+DQST++S  + S+NE+S++++YPR
Sbjct  596  VSLAQPLQPAFFLRSRTERPMTNLESDQSTSRSMAM-SINEMSVTEVYPR  644



>gb|KCW75000.1| hypothetical protein EUGRSUZ_E03762 [Eucalyptus grandis]
Length=665

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 81/110 (74%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+WR+   ++++D ++G LYSR+EV++C+H+GLLCVQE+  +RPTMA+VVLML S+S
Sbjct  557  YAWKNWRDGKPLEVLDPTIGDLYSRDEVLRCLHIGLLCVQEDPMDRPTMASVVLMLSSYS  616

Query  182  ATRRAPNPPATFSDEMTIS--AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F    T       E+DQST++S  + S+NE+S++++YPR
Sbjct  617  VSLAQPLQPAFFLRSRTERPMTNLESDQSTSRSMAM-SINEMSVTEVYPR  665



>ref|XP_010040977.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Eucalyptus grandis]
Length=160

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 74/114 (65%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR+D  ++++D +LG  YSR++V++CI + LLCVQE+   RPTMAN+VL L S +
Sbjct  48   YAWKHWRDDMPLEILDAALGESYSRSQVLRCIQISLLCVQEDPVNRPTMANIVLALSSQT  107

Query  182  ATRRAPNPPATFSDEMT------ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T      I   +E DQ T+   P SSVNEVSI+++ PR
Sbjct  108  LTLPLPREPAFFLRSQTGPPNTIIENDKEHDQYTSGCEP-SSVNEVSITEVGPR  160



>ref|XP_006606024.1| PREDICTED: serine/threonine kinase-related protein [Glycine max]
Length=664

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 79/115 (69%), Gaps = 7/115 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK+W E T ++++D +L G YSRNEV +CIH+GLLCVQEN  +RP+MA + LML+S+S
Sbjct  550  HAWKNWTEKTPLELLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYS  609

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQST-NKSPPLS---SVNEVSISDLYPR  325
             T   P  PA+         ++ G ++D ST N+S   S   SVNEVSI+DLYPR
Sbjct  610  VTMSMPRQPASLLRGRGPNRLNRGMDSDSSTSNQSTTCSIAWSVNEVSITDLYPR  664



>gb|KHN15824.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja]
Length=665

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 79/115 (69%), Gaps = 7/115 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK+W E T ++++D +L G YSRNEV +CIH+GLLCVQEN  +RP+MA + LML+S+S
Sbjct  551  HAWKNWTEQTPLELLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYS  610

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQST-NKSPPLS---SVNEVSISDLYPR  325
             T   P  PA+         ++ G ++D ST N+S   S   SVNEVSI+DLYPR
Sbjct  611  VTMSMPRQPASLLRGRGPNRLNRGMDSDSSTSNQSTTCSIAWSVNEVSITDLYPR  665



>ref|XP_006383965.1| hypothetical protein POPTR_0004s02530g [Populus trichocarpa]
 gb|ERP61762.1| hypothetical protein POPTR_0004s02530g [Populus trichocarpa]
Length=683

 Score =   108 bits (271),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 51/109 (47%), Positives = 75/109 (69%), Gaps = 5/109 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W+    ++++D S G  YSRNE+ +C+H+GLLCVQE+ ++RPT++ +VLML S S
Sbjct  558  YAWKQWKNGAVLELMDSSFGDSYSRNEITRCVHIGLLCVQEDPNDRPTLSTIVLMLTSFS  617

Query  182  ATRRAPNPPATFSDEMTI----SAGQEADQSTNKSPPLSSVNEVSISDL  316
             T   P  PA F    T+    +   E+D+ST+KS PL SVN++SI++L
Sbjct  618  VTLPLPREPAYFGQSRTVPTFPTTELESDRSTSKSKPL-SVNDMSITEL  665



>ref|XP_010040976.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Eucalyptus grandis]
Length=177

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 74/114 (65%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR+D  ++++D +LG  YSR++V++CI + LLCVQE+   RPTMAN+VL L S +
Sbjct  65   YAWKHWRDDMPLEILDAALGESYSRSQVLRCIQISLLCVQEDPVNRPTMANIVLALSSQT  124

Query  182  ATRRAPNPPATFSDEMT------ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T      I   +E DQ T+   P SSVNEVSI+++ PR
Sbjct  125  LTLPLPREPAFFLRSQTGPPNTIIENDKEHDQYTSGCEP-SSVNEVSITEVGPR  177



>ref|XP_006449120.1| hypothetical protein CICLE_v10014504mg [Citrus clementina]
 gb|ESR62360.1| hypothetical protein CICLE_v10014504mg [Citrus clementina]
Length=671

 Score =   108 bits (270),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 56/113 (50%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR+ T + ++D +L   YSRNEVI+CI +GLLCVQE+  ERP+MA +VLML+S+S
Sbjct  560  YAWKQWRDGTPLQLLDTNLTDSYSRNEVIRCIQLGLLCVQEDPAERPSMATIVLMLNSYS  619

Query  182  ATRRAPNPPATFSDEMT-----ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T         + +D+ST+KS P  SV+E SI+++YPR
Sbjct  620  VTLPLPQQPAFFIGSRTERGLPTKEFECSDKSTSKSIPW-SVDEASITEVYPR  671



>ref|XP_010059664.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=1054

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 80/110 (73%), Gaps = 3/110 (3%)
 Frame = +2

Query  2     YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
             YAWK+WR+   ++++D ++G LYSR+EV++C+H+GLLCVQE+  +RPTMA VVLML S+S
Sbjct  946   YAWKNWRDGKPLEVLDPAIGDLYSRDEVLRCLHIGLLCVQEDPMDRPTMATVVLMLSSYS  1005

Query  182   ATRRAPNPPATFSDEMTI--SAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
              +  +P  PA F    T       E+DQST +S  + S+NE+S++++YPR
Sbjct  1006  VSLASPLQPAFFLRSRTEIPMKNLESDQSTGRSMAM-SINEMSVTEVYPR  1054



>gb|KHG16271.1| Cysteine-rich receptor-like protein kinase 25 [Gossypium arboreum]
Length=662

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 77/114 (68%), Gaps = 9/114 (8%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y+WK W+  T ++++D  L   YSRNE I+CI +GLLCVQE+  ERPTMA + +ML+S+S
Sbjct  552  YSWKQWKNGTPLELLDTVLKDNYSRNEFIRCIQIGLLCVQEDPAERPTMATIAMMLNSYS  611

Query  182  ATRRAPNPPATFSDEMTISAGQ------EADQSTNKSPPLSSVNEVSISDLYPR  325
             T   PN PA F +  T   G+      E+DQST++S P  S+NEVSI++L PR
Sbjct  612  VTLPVPNQPAFFCNSRT--QGKMPNMELESDQSTSRSTPW-SINEVSITELDPR  662



>emb|CDP16211.1| unnamed protein product [Coffea canephora]
Length=680

 Score =   108 bits (269),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 59/116 (51%), Positives = 73/116 (63%), Gaps = 13/116 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW HWR   T+ ++D S+G  Y+RNEVIQCI VGLLCV+E V +RPTMA+VV ML+  S
Sbjct  570  YAWNHWRRGQTLALLDSSIGDSYARNEVIQCIQVGLLCVEEYVIKRPTMASVVSMLNPSS  629

Query  182  ATRRAPNPPATFSDEMTISAGQEA-------DQS-TNKSPPLSSVNEVSISDLYPR  325
               R P+ PA F      S G E+       DQS T +    SSVNE SI++ YPR
Sbjct  630  VPLRTPHCPAVFR-----SCGSESRVDDLKVDQSNTQRISAPSSVNEASITEQYPR  680



>gb|KCW75430.1| hypothetical protein EUGRSUZ_E041921, partial [Eucalyptus grandis]
Length=390

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR D  +D++D +LG  YSR++V++CIH+  LCVQE+   RPTMAN+VL L   +
Sbjct  280  YAWKHWRSDAPLDILDPALGESYSRSQVLKCIHISFLCVQEDPANRPTMANIVLALSGQT  339

Query  182  ATRRAPNPPATF-SDEM---TISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F   EM    +   Q  DQ T+ S PL S+NE S++++YPR
Sbjct  340  LSLPVPREPAFFLQREMPNNFMGKDQGYDQITSSSVPL-SINEASVTEVYPR  390



>ref|XP_006383960.1| hypothetical protein POPTR_0004s02460g [Populus trichocarpa]
 gb|ERP61757.1| hypothetical protein POPTR_0004s02460g [Populus trichocarpa]
Length=332

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 75/113 (66%), Gaps = 5/113 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WKHWR+ T ++++D +L   YSRNEVI+CIH+GLLCVQE+   RP MA ++L L+S+S
Sbjct  220  YVWKHWRDGTPLEVLDPTLTDTYSRNEVIRCIHIGLLCVQEDPAIRPAMATIILTLNSYS  279

Query  182  ATRRAPNPPATF-----SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T  +P  PA F     +DE+ IS+ +   + +       SV+E SI+++YPR
Sbjct  280  VTLPSPQEPAFFFHSTITDEVNISSKEFLLEQSKSKSVAYSVDEDSITEVYPR  332



>gb|KHN02670.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=800

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 80/115 (70%), Gaps = 7/115 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK+W   T ++++D +L G YSRNEV +CIH+GLLCVQEN  +RP+MA + LML+S+S
Sbjct  686  HAWKNWTLQTPLELLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYS  745

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQS-TNKSPPLS---SVNEVSISDLYPR  325
             T   P  PA+F        ++ G ++DQS T++S   S   SVNEVSI+D+YPR
Sbjct  746  VTMSMPQQPASFLRGRGPNRLNQGMDSDQSTTDQSTTCSIPWSVNEVSITDVYPR  800



>ref|XP_006590217.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Glycine max]
Length=960

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 80/115 (70%), Gaps = 7/115 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK+W   T ++++D +L G YSRNEV +CIH+GLLCVQEN  +RP+MA + LML+S+S
Sbjct  846  HAWKNWTLQTPLELLDPTLRGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYS  905

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQS-TNKSPPLS---SVNEVSISDLYPR  325
             T   P  PA+F        ++ G ++DQS T++S   S   SVNEVSI+D+YPR
Sbjct  906  VTMSMPQQPASFLRGRGPNRLNQGMDSDQSTTDQSTTCSIPWSVNEVSITDVYPR  960



>ref|XP_006467962.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Citrus sinensis]
Length=674

 Score =   107 bits (266),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 55/113 (49%), Positives = 75/113 (66%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR+ T + ++D +L   YSRNEVI+CI +GLLCVQE+  ERP+MA +VLML+S+S
Sbjct  563  YAWKQWRDGTPLQLLDTNLTDSYSRNEVIRCIQLGLLCVQEDPAERPSMATIVLMLNSYS  622

Query  182  ATRRAPNPPATFSDEMT-----ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T         + +D +T+KS P  SV+E SI+++YPR
Sbjct  623  VTLPLPQQPAFFIGSRTERGLPTKEFECSDNTTSKSIPW-SVDEASITEVYPR  674



>gb|KCW74340.1| hypothetical protein EUGRSUZ_E03013 [Eucalyptus grandis]
Length=366

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 73/114 (64%), Gaps = 8/114 (7%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WKHWR++  +++VD +LG  YSR+EV++CIH+ LLCVQE+   RPTMAN+VL L S +
Sbjct  255  YVWKHWRDNAPLEIVDPALGESYSRSEVLRCIHISLLCVQEDPANRPTMANIVLALSSQT  314

Query  182  ATRRAPNPPATFSDEMT------ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F    T      I  G+  D+ T    P  SVNEVSI+++YPR
Sbjct  315  LSLPLPREPAFFFRSQTEPMINFIGNGKGHDRITRGFVP--SVNEVSITEVYPR  366



>ref|XP_007143184.1| hypothetical protein PHAVU_007G050600g [Phaseolus vulgaris]
 gb|ESW15178.1| hypothetical protein PHAVU_007G050600g [Phaseolus vulgaris]
Length=661

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 77/116 (66%), Gaps = 9/116 (8%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK W E TT++ +D +L G  SRNEV +CIH+GLLCVQEN  +RP+MA + LML+S+S
Sbjct  547  FAWKKWTEQTTMEFLDPALRGSCSRNEVNRCIHIGLLCVQENPSDRPSMATIALMLNSYS  606

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNK-----SPPLSSVNEVSISDLYPR  325
             T   P  PA+F        ++ G E+DQST       S P  SVNEVS++++YPR
Sbjct  607  VTLSMPRQPASFLRGRGPNRLNQGLESDQSTTDQFTSCSVPW-SVNEVSLTEVYPR  661



>gb|KEH43947.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=669

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W E T ++++D +L   YSRNEV++CIH+GLLCVQE+  +RP+M  + LML+S+S
Sbjct  560  YAWKKWSEQTPLELLDPTLRDSYSRNEVMRCIHIGLLCVQESPYDRPSMETIALMLNSYS  619

Query  182  ATRRAPNPPATFSDEMT---ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  P +     T   I  G ++DQST  S P  SVNEVSI+++YPR
Sbjct  620  VTLSLPRQPPSLMRGRTPDRIKQGLDSDQSTTCSIPW-SVNEVSITEVYPR  669



>ref|XP_003637975.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 ref|XP_003638034.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=676

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W E T ++++D +L   YSRNEV++CIH+GLLCVQE+  +RP+M  + LML+S+S
Sbjct  567  YAWKKWSEQTPLELLDPTLRDSYSRNEVMRCIHIGLLCVQESPYDRPSMETIALMLNSYS  626

Query  182  ATRRAPNPPATFSDEMT---ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  P +     T   I  G ++DQST  S P  SVNEVSI+++YPR
Sbjct  627  VTLSLPRQPPSLMRGRTPDRIKQGLDSDQSTTCSIPW-SVNEVSITEVYPR  676



>ref|XP_010087722.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
 gb|EXB29710.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
Length=667

 Score =   106 bits (264),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 72/110 (65%), Gaps = 2/110 (2%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W+E T + ++D +L   YS NEV++CIH+GLLCVQE+ ++RPTM  +VLM +S+S
Sbjct  558  YAWKLWKEGTPLKLLDPTLMDSYSENEVVKCIHIGLLCVQEDPEDRPTMKTIVLMFNSYS  617

Query  182  ATRRAPNPPATFSDEMTISAGQEA--DQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA ++   +     E   DQS + +    SVNE SI++LYPR
Sbjct  618  VTLPVPEKPAFYNRTESDMPAMEMKYDQSPSTAGYPLSVNEASITELYPR  667



>ref|XP_007214583.1| hypothetical protein PRUPE_ppa026781mg [Prunus persica]
 gb|EMJ15782.1| hypothetical protein PRUPE_ppa026781mg [Prunus persica]
Length=659

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+HWR+ T ++++D +L   Y++ EV +C+H+GLLCVQE  DERPTM +VVLML S+S
Sbjct  548  YAWRHWRDGTPLELLDPNLRDSYAKAEVTRCVHIGLLCVQEIPDERPTMQSVVLMLSSYS  607

Query  182  ATRRAPNPPATF---SDEMTISA--GQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  P  F     E+ + +   +  DQ+ + S P  SVNEVSI++LYPR
Sbjct  608  VTMALPQKPVLFLHSGTELNMPSLTTESFDQTPSNSSPF-SVNEVSITELYPR  659



>ref|XP_006387885.1| hypothetical protein POPTR_0499s002002g, partial [Populus trichocarpa]
 gb|ERP46799.1| hypothetical protein POPTR_0499s002002g, partial [Populus trichocarpa]
Length=160

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 81/119 (68%), Gaps = 13/119 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW++WRE T ++++D +L    SR E+++CIH+GLLCVQEN+ +RPTMA++VLML S+S
Sbjct  44   YAWRNWREGTGLNVIDPALS-TGSRTEMMRCIHIGLLCVQENIADRPTMASIVLMLSSYS  102

Query  182  ATRRAPNPPATFSDEMT----ISAGQE-------ADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA F +  T    IS+  +       + ++  ++ PLS+ NE SI++LYPR
Sbjct  103  LTLPVPSQPAFFMNSSTYQSDISSSMDYNSRVTNSSEAKTEALPLSA-NEASITELYPR  160



>ref|XP_010059136.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Eucalyptus grandis]
Length=950

 Score =   106 bits (265),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 73/114 (64%), Gaps = 8/114 (7%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WKHWR++  +++VD +LG  YSR+EV++CIH+ LLCVQE+   RPTMAN+VL L S +
Sbjct  839  YVWKHWRDNAPLEIVDPALGESYSRSEVLRCIHISLLCVQEDPANRPTMANIVLALSSQT  898

Query  182  ATRRAPNPPATFSDEMT------ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F    T      I  G+  D+ T    P  SVNEVSI+++YPR
Sbjct  899  LSLPLPREPAFFFRSQTEPMINFIGNGKGHDRITRGFVP--SVNEVSITEVYPR  950


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/72 (50%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR++   +++D  LG  YSR++V++CIH+G LCVQE+  +RPTMA++VL L S +
Sbjct  245  YAWKHWRDNVPWEILDPVLGESYSRSQVLRCIHIGFLCVQEDPADRPTMASIVLALSSQT  304

Query  182  ATRRAPNPPATF  217
             +   P  PA F
Sbjct  305  LSLAVPREPAFF  316



>gb|KCW76230.1| hypothetical protein EUGRSUZ_D00611 [Eucalyptus grandis]
Length=682

 Score =   105 bits (263),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 55/111 (50%), Positives = 76/111 (68%), Gaps = 5/111 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR  T ++++D  +G  YS +EV++C+H+GLL VQE+   RPTMA++VLML SHS
Sbjct  574  YAWKHWRAGTPLEVLDPFIGDSYSIDEVVRCLHIGLLGVQEDPAYRPTMASIVLMLSSHS  633

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
                 P  PA F   S E  +    E+DQS ++S  LS+ NE+SI++LYPR
Sbjct  634  VKLPQPRRPAFFLRRSTERQLKE-HESDQSASRSMSLST-NEMSITELYPR  682



>ref|XP_008232237.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Prunus 
mume]
Length=659

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 79/113 (70%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+HWR+ T ++++D +L   Y++ EV +C+H+GLLCVQEN DERPTM ++VLML S+S
Sbjct  548  YAWRHWRDGTPLELLDPNLRDSYAKAEVTRCVHIGLLCVQENPDERPTMQSIVLMLSSYS  607

Query  182  ATRRAPNPPATF---SDEMTISA--GQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA     S E+ + +   + +D +T+KS P  S+NE SI++L+PR
Sbjct  608  VTMALPQMPAFVLHSSTELNMPSLTTESSDPTTSKSLPF-SINEASITELHPR  659



>ref|XP_010089692.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
 gb|EXB38215.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
Length=680

 Score =   105 bits (263),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/108 (45%), Positives = 73/108 (68%), Gaps = 9/108 (8%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW++W+E   +++VD  +    SR+E+++CIH+ LLCVQE V +RPTM++V+LML S S
Sbjct  582  YAWENWKEGKAMNLVDPKMSHSASRHEIVRCIHIALLCVQEKVADRPTMSSVILMLSSFS  641

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
               R+P+ PA F          E+DQS N   P+S  N+VS+++LYPR
Sbjct  642  LALRSPSRPAYFL--------MESDQSNNNLAPISE-NDVSVTELYPR  680



>ref|XP_008365537.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Malus 
domestica]
Length=670

 Score =   105 bits (263),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/110 (45%), Positives = 74/110 (67%), Gaps = 2/110 (2%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+HW   T+++++D SLG  + R EV++CIH+GLLCVQE   ERPTM+ VV+ML+S++
Sbjct  561  YAWQHWANGTSLELLDPSLGDQWPRYEVLKCIHIGLLCVQEAAAERPTMSEVVMMLNSYT  620

Query  182  ATRRAPNPPATFSDEMTISAGQE--ADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA +  + + +  Q   A +    S    SVN+V++S+LYPR
Sbjct  621  ITSVVPSQPAFYVRQESSANSQNLAASELDMLSEAAQSVNDVTVSELYPR  670



>ref|XP_010052297.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=662

 Score =   105 bits (262),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 55/111 (50%), Positives = 76/111 (68%), Gaps = 5/111 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR  T ++++D  +G  YS +EV++C+H+GLL VQE+   RPTMA++VLML SHS
Sbjct  554  YAWKHWRAGTPLEVLDPFIGDSYSIDEVVRCLHIGLLGVQEDPAYRPTMASIVLMLSSHS  613

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
                 P  PA F   S E  +    E+DQS ++S  LS+ NE+SI++LYPR
Sbjct  614  VKLPQPRRPAFFLRRSTERQLKE-HESDQSASRSMSLST-NEMSITELYPR  662



>gb|KHN02668.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=552

 Score =   105 bits (261),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 76/114 (67%), Gaps = 8/114 (7%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++WR  T  ++VD +L    S+NE+++CIH+GLLCVQENV  RPTMA++ LML+S+S
Sbjct  441  FAWRNWRAGTASNIVDPTLND-GSQNEIMRCIHIGLLCVQENVVARPTMASIGLMLNSYS  499

Query  182  ATRRAPNPPATFSDEMTISAGQ------EADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA   D  T S  +         +S N+S P  S+NEVSI++LYPR
Sbjct  500  LTLPVPSEPALLVDSRTRSLSEHDSMETRTSESANQSTP-KSINEVSITELYPR  552



>ref|XP_010059682.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
Length=652

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR D  +D++D +LG  YSR++V++CIH+  LCVQE+   RPTMAN+VL L   +
Sbjct  542  YAWKHWRSDAPLDILDPALGESYSRSQVLKCIHISFLCVQEDPANRPTMANIVLALSGQT  601

Query  182  ATRRAPNPPATF-SDEM---TISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F   EM    +   Q  DQ T+ S PL S+NE S++++YPR
Sbjct  602  LSLPVPREPAFFLQREMPNNFMGKDQGYDQITSSSVPL-SINEASVTEVYPR  652



>ref|XP_008779261.1| PREDICTED: cysteine-rich receptor-like protein kinase 8 [Phoenix 
dactylifera]
Length=208

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 74/130 (57%), Gaps = 23/130 (18%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+HW E     ++DRSL   Y   EV++CIH+GLLCVQE   ERP+MA+V+LML S+S
Sbjct  80   YVWRHWNEGMASQVIDRSLDDQYQLREVLRCIHIGLLCVQEEPAERPSMASVILMLSSYS  139

Query  182  ATRRAPNPPATFSDEMTISAGQ--EAD--------------------QSTNKSPPLSSVN  295
             T  AP+ PA F    TIS  Q  E+D                    +   KS P+ SVN
Sbjct  140  ITIAAPSAPAFFISSGTISESQVIESDMRTGLSGSESSSGSTTRKTRRRAEKSGPV-SVN  198

Query  296  EVSISDLYPR  325
            +VSI+D+ PR
Sbjct  199  DVSITDMEPR  208



>ref|XP_010069590.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Eucalyptus grandis]
Length=438

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 74/114 (65%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR+D  ++++D +LG  YSR++V++CI + LLCVQE+   RPTMAN+VL L S +
Sbjct  326  YAWKHWRDDMPLEILDAALGESYSRSQVLRCIQISLLCVQEDPVNRPTMANIVLALSSQT  385

Query  182  ATRRAPNPPATFSDEMT------ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T      I   +E DQ T+   P SSVNEVSI+++ PR
Sbjct  386  LTLPLPREPAFFVRSRTGLPNTIIENDKEHDQYTSGCEP-SSVNEVSITEVDPR  438



>gb|KFK28882.1| hypothetical protein AALP_AA7G060200 [Arabis alpina]
Length=675

 Score =   105 bits (261),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 50/112 (45%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+ WRE + +D+VD ++GG Y RNE I+ IH+ LLCVQ++  +RPT+A+++LML S++
Sbjct  565  YVWRLWRESSPLDLVDPAIGGSYDRNEAIRFIHIALLCVQDDPADRPTLASIILMLTSNT  624

Query  182  ATRRAPNPPATF----SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  P  F     D+  ++ G E+ QST +S P  +VN+VSI++L PR
Sbjct  625  ITLPVPRQPGFFLQGRHDQDFVAEGIESIQSTERSVPY-TVNDVSITELAPR  675



>ref|XP_009341461.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=635

 Score =   104 bits (260),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/110 (44%), Positives = 74/110 (67%), Gaps = 2/110 (2%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+HW   T+++++D SLG  + R EV++CIH+GLLCVQE   ERPTM+ VV+ML+S++
Sbjct  526  YAWQHWANGTSLELLDPSLGDQWPRYEVLKCIHIGLLCVQEAAAERPTMSEVVMMLNSYT  585

Query  182  ATRRAPNPPATFSDEMTISAGQE--ADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA +  + + +  Q   A +    +    SVN+V++S+LYPR
Sbjct  586  ITSAVPSQPAFYVRQESSANSQNLTASELDMLAEAAQSVNDVTVSELYPR  635



>ref|XP_010655950.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=667

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR  T ++++D  +G  Y+RNEVI+CIH+GLLCVQE+ ++RP+MA+VVLML S+S
Sbjct  557  YAWKLWRNGTPLELMDPIMGDSYARNEVIRCIHMGLLCVQEDPEDRPSMASVVLMLSSYS  616

Query  182  ATRRAPNPPATFSDEMTISAG----QEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA      T S       ++DQS +KS P  SVNE SIS+L PR
Sbjct  617  VTPPLPQQPAFCIGSGTRSGFPINVLKSDQSASKSTPW-SVNETSISELDPR  667



>ref|XP_003536563.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=669

 Score =   104 bits (260),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 76/114 (67%), Gaps = 8/114 (7%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++WR  T  ++VD +L    S+NE+++CIH+GLLCVQENV  RPTMA++ LML+S+S
Sbjct  558  FAWRNWRAGTASNIVDPTLND-GSQNEIMRCIHIGLLCVQENVVARPTMASIGLMLNSYS  616

Query  182  ATRRAPNPPATFSDEMTISAGQ------EADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA   D  T S  +         +S N+S P  S+NEVSI++LYPR
Sbjct  617  LTLPVPSEPAFLVDSRTRSLSEHDSMETRTSESANQSTP-KSINEVSITELYPR  669



>ref|XP_010247617.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=690

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 77/117 (66%), Gaps = 10/117 (9%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+HW E T + M+D  L   YSR+EV++C H+GLLCVQE+V +RPTMA +VLML+S+S
Sbjct  575  YAWRHWNEGTALQMLDPILTEHYSRDEVMRCTHIGLLCVQEDVVDRPTMARIVLMLNSYS  634

Query  182  ATRRAPNPPATFSDEMTIS---AGQ------EADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  P  F+    I+    G+      E D ST++S P  SVN+VSI++L PR
Sbjct  635  VTLELPLRPPRFAHSKMITDMATGETERQETEPDTSTSRSIPF-SVNDVSITELDPR  690



>ref|XP_002304944.2| hypothetical protein POPTR_0004s02370g [Populus trichocarpa]
 gb|EEE85455.2| hypothetical protein POPTR_0004s02370g [Populus trichocarpa]
Length=403

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W HWR+ T ++++D +L   YSRNEVI+CIH+GLLCVQE+   RP MA +VL L+S+ 
Sbjct  291  YVWNHWRDGTPLEVLDPTLTDTYSRNEVIRCIHIGLLCVQEDPAIRPAMATIVLTLNSYL  350

Query  182  ATRRAPNPPATF-----SDEMTISAGQE-ADQSTNKSPPLSSVNEVSISDLYPR  325
             T  +P   A F     +DE+ IS+ +   DQS  KS    SV+EVSI+++YPR
Sbjct  351  VTLPSPQEAAFFFRSTITDEVNISSKEFLLDQSKRKSIAY-SVDEVSITEVYPR  403



>ref|XP_010059687.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=355

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 75/114 (66%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR++   +++D  LG  YSR++V++CIH+G LCVQE+  +RPTMA++VLML S +
Sbjct  243  YAWKHWRDNVPWEILDPVLGKSYSRSQVLRCIHIGFLCVQEDPADRPTMASIVLMLSSQT  302

Query  182  ATRRAPNPPATFSDEMT------ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F    T      I+  Q  DQ+T+ S PL SVN VSI++L  R
Sbjct  303  LSLPVPREPAFFLRSWTEPPKNIIANDQGHDQNTSGSTPL-SVNGVSITELSAR  355



>gb|KDO59868.1| hypothetical protein CISIN_1g037548mg [Citrus sinensis]
Length=680

 Score =   104 bits (259),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 48/114 (42%), Positives = 75/114 (66%), Gaps = 6/114 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+HW   T ++++D +LG  + + EV++CIH+GLLCVQE   +RP+M+++V ML S+S
Sbjct  567  YAWQHWMNRTALELLDPALGNQWPKYEVLKCIHIGLLCVQEAAADRPSMSDIVTMLSSYS  626

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKS------PPLSSVNEVSISDLYPR  325
             T   P+ PA FS   ++ +  E   +T++S      P   S+NEV+IS+L PR
Sbjct  627  KTSPEPSKPAFFSSRESLGSDLEERGNTSQSDKSNTVPLQQSINEVTISELDPR  680



>ref|XP_010103954.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
 gb|EXB97657.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
Length=590

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W+  T +D VD  L   YS +EV++C+ +GLLCVQE+ ++RPTM  VVLM +S+S
Sbjct  478  YAWKLWKAGTPLDFVDPKLESAYSEDEVLRCVQIGLLCVQEDPEDRPTMTTVVLMFNSYS  537

Query  182  ATRRAPNPPATF-----SDEMTISAGQEAD-QSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA +      + M  +AG   D QST+   PL SVNE SI+D YPR
Sbjct  538  VTPGQPQQPAFYVRTSEPEHMMPAAGLNFDHQSTSNQLPL-SVNEASITDFYPR  590



>gb|KCW75005.1| hypothetical protein EUGRSUZ_E03767 [Eucalyptus grandis]
Length=363

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 76/110 (69%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR  T ++++D  +   YS +EV++C+H+GLL VQE+  +RPTMA++VLML SHS
Sbjct  255  YAWKHWRAGTPLEVLDPFISNAYSIDEVVRCLHIGLLGVQEDPADRPTMASIVLMLTSHS  314

Query  182  ATRRAPNPPATFSDEMTISAGQ--EADQSTNKSPPLSSVNEVSISDLYPR  325
                 P  PA F    T    +  E+D+ST++S P S+ NE+S++++YPR
Sbjct  315  VKLSQPRQPAFFLQRSTERRLKEPESDESTSRSMPWST-NEMSVTEVYPR  363



>ref|XP_010059147.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
30 [Eucalyptus grandis]
Length=508

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 76/111 (68%), Gaps = 5/111 (5%)
 Frame = +2

Query  5    AWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
            AWKHWR+D   +++D +LG  YSR++V++CIH+G LCVQE+  +RPTMA++VL L S + 
Sbjct  399  AWKHWRDDVPSEILDPALGESYSRSQVLRCIHIGFLCVQEDPADRPTMASIVLALSSQTL  458

Query  185  TRRAPNPPATF----SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
                P  PA F    +++  I+  Q  DQ+ + S PL SVN +SI+++YPR
Sbjct  459  ILPVPQGPAFFFRSWTEQPNIANDQGHDQNNSGSAPL-SVNGMSITEVYPR  508



>ref|XP_007143185.1| hypothetical protein PHAVU_007G050700g [Phaseolus vulgaris]
 gb|ESW15179.1| hypothetical protein PHAVU_007G050700g [Phaseolus vulgaris]
Length=659

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  5    AWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
            AWKHW E+T ++ +D +L G YSRNEV +CIH+GLLCVQE+  +RP+MA + LML+S+S 
Sbjct  546  AWKHWTEETPMEFLDPTLRGSYSRNEVNRCIHIGLLCVQESPSDRPSMATIALMLNSYSV  605

Query  185  TRRAPNPPATFSDEMT---ISAGQEADQSTNKSPPLS----SVNEVSISDLYPR  325
            T   P  PA+F    +   ++ G ++DQST      S    SVNEVSI++LYPR
Sbjct  606  TMSMPRQPASFLRGRSPNRLNPGLDSDQSTTNQSTTSSIPWSVNEVSITELYPR  659



>ref|XP_004153532.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Cucumis sativus]
Length=666

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 5/111 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW  W++   ++++D +L   YSRNEV++CIH+ LLCVQE+ + RP+MA++VLML+S+S
Sbjct  558  YAWALWKDGIPLELLDPTLKDSYSRNEVLRCIHIALLCVQEDPNSRPSMASIVLMLNSYS  617

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    D    + G  +D S+NKS    SVNE SIS+L+PR
Sbjct  618  VTLPIPKEPALFMRSKDNNGTTIG--SDHSSNKSTTKWSVNETSISELHPR  666



>ref|XP_004172413.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Cucumis sativus]
Length=666

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 75/111 (68%), Gaps = 5/111 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW  W++   ++++D +L   YSRNEV++CIH+ LLCVQE+ + RP+MA++VLML+S+S
Sbjct  558  YAWALWKDGIPLELLDPTLKDSYSRNEVLRCIHIALLCVQEDPNSRPSMASIVLMLNSYS  617

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    D    + G  +D S+NKS    SVNE SIS+L+PR
Sbjct  618  VTLPIPKEPALFMRSKDNNGTTIG--SDHSSNKSTTKWSVNETSISELHPR  666



>ref|XP_002518553.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43940.1| ATP binding protein, putative [Ricinus communis]
Length=674

 Score =   103 bits (257),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 54/112 (48%), Positives = 73/112 (65%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W HW++ T +++VD  L   YSRNEV++CI +GLLCVQE+  +RPTMA ++LML+S S
Sbjct  564  YVWTHWKDGTPMEVVDPVLKDSYSRNEVLRCIQIGLLCVQEDATDRPTMATIMLMLNSFS  623

Query  182  ATRRAPNPPATF---SDEMTIS-AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F   S E T+   G ++D+ST KS      NE SI+ +YPR
Sbjct  624  VTLPVPRQPAFFLHSSSEPTMPMEGLQSDKSTTKSMQWYG-NEESITQVYPR  674



>ref|XP_009340920.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=676

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+ T+++++D  L   YSR EVI+CIH+GLLCVQE+  +RPTM +VVLML+S+S
Sbjct  567  HAWKLWRDGTSLELLDPCLRDSYSRTEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYS  626

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F     +        E+DQS +KS P  SV E SI+++YPR
Sbjct  627  VSLPLPKQPAFFLQSRAVGNMPKISLESDQSISKSSP--SVYEGSITEVYPR  676



>ref|XP_008345332.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+ T+++++D  L   YSR EVI+CIH+GLLCVQE+  +RPTM +VVLML+S+S
Sbjct  555  HAWKLWRDGTSLELLDPCLRDSYSRIEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYS  614

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F     +        E+DQS NKS P  SV E SI+++YPR
Sbjct  615  VSLALPKQPAFFLQSRPMGNMSKITLESDQSINKSSP--SVYEGSITEVYPR  664



>ref|XP_011002055.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Populus 
euphratica]
Length=192

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 72/113 (64%), Gaps = 5/113 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WKHWR+ T ++++D +L   YSRNEVI+CIH+GLLCVQE+   RP M  +VL L+++S
Sbjct  80   YVWKHWRDGTPLEVLDPTLTYTYSRNEVIRCIHIGLLCVQEDPAIRPAMVTIVLTLNTYS  139

Query  182  ATRRAPNPPATF-----SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F     +DE+  S+ +   + +       SV+E SI+++YPR
Sbjct  140  VTLPLPQEPAFFFHSTITDEVNSSSKEFLLEHSKSKSVAYSVDEDSITEVYPR  192



>ref|XP_006469728.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Citrus sinensis]
Length=666

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/114 (42%), Positives = 75/114 (66%), Gaps = 6/114 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+HW   T ++++D +LG  + + EV++CIH+GLLCVQE   +RP+M+++V ML S+S
Sbjct  553  YAWQHWMNRTALELLDPALGNQWPKYEVLKCIHIGLLCVQEAAADRPSMSDIVTMLSSYS  612

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKS------PPLSSVNEVSISDLYPR  325
             T   P+ PA FS   ++ +  E   +T++S      P   S+NEV+IS+L PR
Sbjct  613  ITSPEPSKPAFFSSRESLGSDLEERGNTSQSDKSNSVPLQQSINEVTISELDPR  666



>gb|KHN17294.1| Cysteine-rich receptor-like protein kinase 8 [Glycine soja]
Length=670

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 55/112 (49%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+ WRE+T + ++D S+   YS  EVI+CIH+GLLCVQ+N D RPTMA +V  L S+ 
Sbjct  560  YVWRQWREETLLGVLDSSIKDNYSEIEVIRCIHIGLLCVQQNPDVRPTMATIVSYLSSYL  619

Query  182  ATRRAPNPPATFSDEMT--ISAGQEA--DQSTNKSPPLSSVNEVSISDLYPR  325
                 P  PA F  E    IS  QE+  +QS N+S P  SVN++SISD  PR
Sbjct  620  IDLPTPQEPAFFLHERIDPISLAQESGCNQSANRSIPF-SVNKMSISDFIPR  670



>ref|XP_006603048.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
31-like isoform X1 [Glycine max]
Length=670

 Score =   103 bits (257),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 55/112 (49%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+ WRE+T + ++D S+   YS  EVI+CIH+GLLCVQ+N D RPTMA +V  L S+ 
Sbjct  560  YVWRQWREETLLGVLDSSIKDNYSEIEVIRCIHIGLLCVQQNPDVRPTMATIVSYLSSYL  619

Query  182  ATRRAPNPPATFSDEMT--ISAGQEA--DQSTNKSPPLSSVNEVSISDLYPR  325
                 P  PA F  E    IS  QE+  +QS N+S P  SVN++SISD  PR
Sbjct  620  IDLPTPQEPAFFLHERIHPISLAQESGCNQSANRSIPF-SVNKMSISDFIPR  670



>ref|XP_002304956.2| hypothetical protein POPTR_0004s02490g [Populus trichocarpa]
 gb|EEE85467.2| hypothetical protein POPTR_0004s02490g [Populus trichocarpa]
Length=332

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 74/113 (65%), Gaps = 5/113 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WKHWR+ T + ++D +L   YSRNEVI+CIH+GLLCVQE+   RP MA ++L L+S+S
Sbjct  220  YVWKHWRDGTPLAVLDPTLTDTYSRNEVIRCIHIGLLCVQEDPAIRPAMATIILTLNSYS  279

Query  182  ATRRAPNPPA-----TFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T  +P  PA     T +DE+  S+ +   + + +     SV+E SI+++YPR
Sbjct  280  VTLPSPQEPAFLVHSTITDEVNSSSKEFLLEHSKRKSVAYSVDEDSITEVYPR  332



>ref|XP_008224858.1| PREDICTED: cysteine-rich receptor-like protein kinase 10, partial 
[Prunus mume]
Length=424

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+ T ++++D S+   YSR+EVI+CIH+GLLCVQE+  +RPTM +VVLML+S+S
Sbjct  315  HAWKLWRDGTPLELLDPSMRDSYSRSEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYS  374

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T         E+D S +KS P  SV+E SI+ +YPR
Sbjct  375  VTLPLPEQPAFFLRSRTEGNMPKITLESDLSVSKSTP--SVDEASITAVYPR  424



>ref|XP_010932139.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Elaeis 
guineensis]
Length=356

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW+HW +   ++++D SLG LY R E + CIH+GLLC QE++ +RP MA+VVLML ++S
Sbjct  248  FAWEHWSKGKALEIIDHSLGELYHRQEALTCIHIGLLCAQEDMRKRPCMASVVLMLSNYS  307

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLS-SVNEVSISDLYPR  325
             T   P+ PA F    T S    A ++T+ +P  S SV  VSI+++ PR
Sbjct  308  VTLPTPSIPAYFVQGRTTSESDVALRTTDSTPSGSLSVCNVSITEMEPR  356



>emb|CDY15056.1| BnaC03g44170D [Brassica napus]
Length=671

 Score =   103 bits (256),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 48/112 (43%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+ W   + +++VD ++G  Y  NEV +CIH+ LLC+QEN D+RP ++N++LML S++
Sbjct  561  YAWRLWINGSPLELVDPAIGRNYQSNEVTRCIHIALLCIQENPDDRPLLSNIILMLGSNT  620

Query  182  ATRRAPNPPATF----SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            +T  AP  P +F     + + +S G E+++ST + P L S N+VS +DL PR
Sbjct  621  STLPAPCLPGSFRRSRQELVHVSEGLESNESTGR-PTLYSFNDVSFTDLEPR  671



>ref|XP_009357378.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=215

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+   ++++D  L   YSR EVI+CIH+GLLCVQE+  +RPTM +VVLML+S+S
Sbjct  106  HAWKLWRDGAPLELLDPCLRNSYSRTEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYS  165

Query  182  ATRRAPNPPATFSDEMTISAGQEAD----QSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F     +    EA     QS +KS P  SV E SI+++YPR
Sbjct  166  VTLPLPQQPAFFLQSRAMGNMLEATLDSAQSMSKSSP--SVYEGSITEVYPR  215



>ref|XP_006603049.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
31-like isoform X2 [Glycine max]
Length=664

 Score =   102 bits (255),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 55/112 (49%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+ WRE+T + ++D S+   YS  EVI+CIH+GLLCVQ+N D RPTMA +V  L S+ 
Sbjct  554  YVWRQWREETLLGVLDSSIKDNYSEIEVIRCIHIGLLCVQQNPDVRPTMATIVSYLSSYL  613

Query  182  ATRRAPNPPATFSDEMT--ISAGQEA--DQSTNKSPPLSSVNEVSISDLYPR  325
                 P  PA F  E    IS  QE+  +QS N+S P  SVN++SISD  PR
Sbjct  614  IDLPTPQEPAFFLHERIHPISLAQESGCNQSANRSIPF-SVNKMSISDFIPR  664



>emb|CDX93057.1| BnaA03g37790D [Brassica napus]
Length=667

 Score =   102 bits (255),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/112 (43%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+ W   + +++VD ++G  Y  NEV +CIH+ LLC+QEN D+RP ++N++LML S++
Sbjct  557  YAWRLWINGSPLELVDPAIGRNYQSNEVTRCIHIALLCIQENPDDRPLLSNIILMLGSNT  616

Query  182  ATRRAPNPPATF----SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            +T  AP  P +F     + + +S G E+++ST + P   S N+VSI+DL PR
Sbjct  617  STLPAPCLPGSFPRSRQELVHVSEGLESNESTGR-PTTYSFNDVSITDLEPR  667



>ref|XP_007157184.1| hypothetical protein PHAVU_002G049500g [Phaseolus vulgaris]
 gb|ESW29178.1| hypothetical protein PHAVU_002G049500g [Phaseolus vulgaris]
Length=719

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 77/111 (69%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW  W++ T ++++D  L   Y++NE+I+ IH+GLLCVQE+ ++RPTMA +VLML S++
Sbjct  610  YAWLLWKDGTPLELMDPILRESYNQNEIIRSIHIGLLCVQEDPEDRPTMATIVLMLDSNT  669

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F     + T+  GQ+ DQS  KS P+ S+N+VSIS++ PR
Sbjct  670  VTLPTPKRPAFFIHSGTDATMPKGQQFDQSITKSLPM-SINDVSISEMDPR  719



>ref|XP_009136144.1| PREDICTED: cysteine-rich receptor-like protein kinase 14 isoform 
X1 [Brassica rapa]
Length=667

 Score =   102 bits (255),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 48/112 (43%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+ W   + +++VD ++G  Y  NEV +CIH+ LLC+QEN D+RP ++N++LML S++
Sbjct  557  YAWRLWINGSPLELVDPAIGRNYQSNEVTRCIHIALLCIQENPDDRPLLSNIILMLGSNT  616

Query  182  ATRRAPNPPATF----SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            +T  AP  P +F     + + +S G E+++ST + P   S N+VSI+DL PR
Sbjct  617  STLPAPCLPGSFPRSRQELVHVSEGLESNESTGR-PTTYSFNDVSITDLEPR  667



>gb|KHN15822.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=855

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 76/108 (70%), Gaps = 4/108 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W+++  ++++D+SL   Y+ NEVI+CIH+GLLCVQE+  +RPTMA+VVLML S+S
Sbjct  570  YAWKLWKDEAPLELMDQSLRESYTPNEVIRCIHIGLLCVQEDPIDRPTMASVVLMLDSYS  629

Query  182  ATRRAPNPPATFSDEMT---ISAGQEADQSTNKSPPLSSVNEVSISDL  316
             T + PN PA + +  T   +  G + DQST  S    SVN++S+ D+
Sbjct  630  VTLQVPNQPAFYINSRTEPNMPKGLKIDQSTTNSTS-KSVNDMSVMDM  676



>ref|XP_008358736.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+  +++++D+ +   YSR EVI+CIH+GLLCVQE+  +RPTM +VVLML+S+S
Sbjct  555  HAWKLWRDGKSLELLDQCMRDSYSRTEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYS  614

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F     +        E+DQS +KS P  SV E SI+++YPR
Sbjct  615  VSLALPKXPAFFLQSRAVGNMPKITLESDQSISKSSP--SVYEGSITEVYPR  664



>ref|XP_007025936.1| Cysteine-rich RLK 29, putative isoform 2 [Theobroma cacao]
 gb|EOY28558.1| Cysteine-rich RLK 29, putative isoform 2 [Theobroma cacao]
Length=491

 Score =   101 bits (251),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%), Gaps = 12/118 (10%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+WRE T ++++D +L    SRNE+++CIH+GLLCVQENV  RPTMA VVLML+S S
Sbjct  376  YAWKNWREGTALNLIDPTLRD-GSRNEMLRCIHIGLLCVQENVANRPTMATVVLMLNSFS  434

Query  182  ATRRAPNPPATF-----SDEMTISAGQEADQSTNKSP-----PLSSVNEVSISDLYPR  325
             +   P+ PA F       +M+ S G  +  S ++       PL S+NE SI++LYPR
Sbjct  435  ISLPLPSQPAFFIHSNIDSDMSSSRGYNSRMSESQQSKSESIPL-SMNEASITELYPR  491



>ref|XP_006383968.1| hypothetical protein POPTR_0004s02560g [Populus trichocarpa]
 gb|ERP61765.1| hypothetical protein POPTR_0004s02560g [Populus trichocarpa]
Length=621

 Score =   102 bits (254),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 53/119 (45%), Positives = 81/119 (68%), Gaps = 13/119 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW++WRE T ++++D +L    SR E+++CIH+GLLCVQEN+ +RPTMA++VLML S+S
Sbjct  505  YAWRNWREGTGLNVIDPALS-TGSRTEMMRCIHIGLLCVQENIADRPTMASIVLMLSSYS  563

Query  182  ATRRAPNPPATFSDEMT----ISAGQE-------ADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA F +  T    IS+  +       + ++  ++ PLS+ NE SI++LYPR
Sbjct  564  LTLPVPSQPAFFMNSSTYQSDISSSMDYNSRVTNSSEAKTEALPLSA-NEASITELYPR  621



>ref|XP_010267893.1| PREDICTED: uncharacterized protein LOC104604997 [Nelumbo nucifera]
Length=1361

 Score =   103 bits (256),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 53/112 (47%), Positives = 77/112 (69%), Gaps = 5/112 (4%)
 Frame = +2

Query  2     YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
             +AW++W E   +D++D  L   YSR EV +CIH+GLLCVQ++V +RPTMA VVLML+S+S
Sbjct  1251  FAWRNWNEGNALDLLDPILSKFYSREEVRRCIHIGLLCVQDDVAQRPTMATVVLMLNSYS  1310

Query  182   ATRRAPNPPA--TFSDEMTISAGQ--EADQSTNKSPPLSSVNEVSISDLYPR  325
              T   P  PA   +S   T +  Q  E+D+ST++S P  S+N+V+ ++L PR
Sbjct  1311  VTLEPPQQPAFLGYSRMETNTEEQPTESDRSTSRSIP-GSINDVTNTELDPR  1361


 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 77/120 (64%), Gaps = 12/120 (10%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++W+E   ++++D  L   YSR+EV++CIH+GLLCVQ+NV  RPTM  VVLML S+S
Sbjct  531  FAWRNWKEGKALELLDPILREFYSRDEVMRCIHIGLLCVQDNVARRPTMETVVLMLSSYS  590

Query  182  ATRRAPNPPATF----------SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR*F  331
             T   P PPA            + E+      E+D+ST++S    S+N+V+I++L PR F
Sbjct  591  VTLEVPQPPAFLGYRKMEPKKPTREIE-EQSTESDRSTSRSLA-GSINDVTITELDPRFF  648



>ref|XP_008224863.1| PREDICTED: uncharacterized protein LOC103324571 [Prunus mume]
Length=1411

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 76/114 (67%), Gaps = 6/114 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+ T ++++D S+   YSR+EVI+CIH+GLLCVQE+  +RPTM +VVLML+S+S
Sbjct  565  HAWKLWRDGTPLELLDPSMRDSYSRSEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYS  624

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR*F  331
             T   P  PA F    T         E+D S +KS P  SV+E SIS +YPR F
Sbjct  625  VTLPLPEQPAFFLRSRTEGNMPKITLESDLSVSKSTP--SVDEASISAVYPRYF  676


 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 0/77 (0%)
 Frame = +2

Query  2     YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
             YAW+ W E   ++++D  L    S NE ++ IH+GLLCVQE  + RPTM+ VVLML S +
Sbjct  1311  YAWQIWNERKGLELMDPLLKNSCSPNEFLRYIHIGLLCVQEEANNRPTMSTVVLMLKSET  1370

Query  182   ATRRAPNPPATFSDEMT  232
              +   P  PA F+   T
Sbjct  1371  TSLSGPEKPAFFTGRST  1387



>ref|XP_010686956.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Beta 
vulgaris subsp. vulgaris]
Length=652

 Score =   102 bits (253),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 71/108 (66%), Gaps = 3/108 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+   ++ VD S+      NEV++C+H+GLLCVQE++D+RPTMA  VLML SHS
Sbjct  548  FAWKRWRDGMPLEFVDESIKDSCPINEVMRCMHLGLLCVQESIDDRPTMATAVLMLDSHS  607

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  P  F        G  +DQST+KS PL S+N++S++++  R
Sbjct  608  ITLPMPQQPGFFIKSYVKGIG--SDQSTSKSMPL-SINDISVTEVEAR  652



>ref|XP_007025935.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
 gb|EOY28557.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
Length=666

 Score =   102 bits (253),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%), Gaps = 12/118 (10%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+WRE T ++++D +L    SRNE+++CIH+GLLCVQENV  RPTMA VVLML+S S
Sbjct  551  YAWKNWREGTALNLIDPTLRD-GSRNEMLRCIHIGLLCVQENVANRPTMATVVLMLNSFS  609

Query  182  ATRRAPNPPATF-----SDEMTISAGQEADQSTNKSP-----PLSSVNEVSISDLYPR  325
             +   P+ PA F       +M+ S G  +  S ++       PL S+NE SI++LYPR
Sbjct  610  ISLPLPSQPAFFIHSNIDSDMSSSRGYNSRMSESQQSKSESIPL-SMNEASITELYPR  666



>ref|XP_008800494.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Phoenix 
dactylifera]
Length=686

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 13/119 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+ W   T ++++D SLG    R+EV++CIH+GLLCVQEN  +RPTM+ VV+ML+S+S
Sbjct  570  YIWERWTVGTILEILDPSLGNHCPRSEVLRCIHIGLLCVQENPSDRPTMSQVVVMLNSNS  629

Query  182  ATRRAPNPPA-----------TFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             + +AP+ PA            +S+E  +S G   D+S+ KS P+S  NEVSIS+L PR
Sbjct  630  VSLQAPSRPAFCIGKSSMDSNAYSNEFNLSGG-ATDRSSGKSIPMSP-NEVSISELEPR  686



>gb|KHN01543.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=549

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 79/119 (66%), Gaps = 14/119 (12%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSL-GGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSH  178
            +AW++WR+ TT ++VD +L  GL  RNE+++CIH+GLLCVQENV  RPTMA+V LML+S+
Sbjct  434  FAWRNWRDGTTTNIVDPTLTDGL--RNEIMRCIHIGLLCVQENVAARPTMASVALMLNSY  491

Query  179  SATRRAPNPPATFSDEMTISA----------GQEADQSTNKSPPLSSVNEVSISDLYPR  325
            S T   P+ PA   D  T S            ++  +S N+S   +SVNE SI++LYPR
Sbjct  492  SLTLPVPSEPAFVGDGRTRSLPDMQSSSEHNSRQTIESANQSAH-NSVNEASITELYPR  549



>ref|XP_010247622.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=675

 Score =   102 bits (253),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 52/115 (45%), Positives = 73/115 (63%), Gaps = 10/115 (9%)
 Frame = +2

Query  8    WKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSAT  187
            W+HW E T +D++D  L   YS++EV +C H+GLLCVQE+V +RPTM  VVLML+S+S T
Sbjct  562  WRHWNEGTALDLLDPILRDHYSKDEVTRCFHIGLLCVQESVADRPTMGTVVLMLNSYSVT  621

Query  188  RRAPNPPATFSDEMTISA---------GQEADQSTNKSPPLSSVNEVSISDLYPR  325
               P  PA  +     S            ++DQST+KS    S+N+VSI++L+PR
Sbjct  622  LEMPLQPAFVAPRKMQSGTTTGDSQGEASKSDQSTSKSAQW-SINDVSITELHPR  675



>ref|XP_006606016.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=667

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 79/119 (66%), Gaps = 14/119 (12%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSL-GGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSH  178
            +AW++WR+ TT ++VD +L  GL  RNE+++CIH+GLLCVQENV  RPTMA+V LML+S+
Sbjct  552  FAWRNWRDGTTTNIVDPTLTDGL--RNEIMRCIHIGLLCVQENVAARPTMASVALMLNSY  609

Query  179  SATRRAPNPPATFSDEMTISA----------GQEADQSTNKSPPLSSVNEVSISDLYPR  325
            S T   P+ PA   D  T S            ++  +S N+S   +SVNE SI++LYPR
Sbjct  610  SLTLPVPSEPAFVGDGRTRSLPDMQSSSEHNSRQTIESANQSAQ-NSVNEASITELYPR  667



>ref|XP_010059683.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Eucalyptus grandis]
Length=703

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 75/114 (66%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR++   +++D  LG  YSR++V++CIH+G LCVQE+  +RPTMA++VLML S +
Sbjct  591  YAWKHWRDNVPWEILDPVLGKSYSRSQVLRCIHIGFLCVQEDPADRPTMASIVLMLSSQT  650

Query  182  ATRRAPNPPATFSDEMT------ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F    T      I+  Q  DQ+T+ S PL SVN VSI++L  R
Sbjct  651  LSLPMPREPAFFLRSWTEPPKNIIANDQGHDQNTSGSTPL-SVNGVSITELSAR  703



>ref|XP_007213903.1| hypothetical protein PRUPE_ppa003904mg [Prunus persica]
 gb|EMJ15102.1| hypothetical protein PRUPE_ppa003904mg [Prunus persica]
Length=541

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+ T ++++D S+   YSR+EVI+CIH+GLLCVQE+  +RPTM +VVLML+S+S
Sbjct  432  HAWKLWRDGTPLELLDPSMRDSYSRSEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYS  491

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T         E+D S +KS P  SV+E SI+ +YPR
Sbjct  492  VTLPLPEQPAFFLRSRTEGNMPKITLESDLSISKSTP--SVDEASITAVYPR  541



>ref|XP_010529593.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 [Tarenaya 
hassleriana]
Length=665

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 77/111 (69%), Gaps = 10/111 (9%)
 Frame = +2

Query  5    AWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
            AW+ WR+ + +D+VD +LG  Y R+E I+CIH+GLLCVQEN  +RPT++ ++LML S++ 
Sbjct  561  AWRAWRKGSPLDLVDPTLGENYQRDEAIRCIHIGLLCVQENPTDRPTLSTIMLMLTSNTI  620

Query  185  TRRAPNPPATFSDEMTISAGQE----ADQSTNKSPPLSSVNEVSISDLYPR  325
            T   P+PP  F     + +GQ+    ++ +T+KS P  SV++ S +DLYPR
Sbjct  621  TLPVPHPPGFF-----LPSGQDLSSVSESTTSKSVP-CSVDDSSFTDLYPR  665



>ref|XP_010059665.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=594

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 76/110 (69%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR  T ++++D  +   YS +EV++C+H+GLL VQE+  +RPTMA++VLML SHS
Sbjct  486  YAWKHWRAGTPLEVLDPFISNAYSIDEVVRCLHIGLLGVQEDPADRPTMASIVLMLTSHS  545

Query  182  ATRRAPNPPATFSDEMTISAGQ--EADQSTNKSPPLSSVNEVSISDLYPR  325
                 P  PA F    T    +  E+D+ST++S P S+ NE+S++++YPR
Sbjct  546  VKLSQPRQPAFFLQRSTERRLKEPESDESTSRSMPWSN-NEMSVTEVYPR  594



>ref|XP_011007635.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Populus 
euphratica]
Length=675

 Score =   101 bits (251),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 72/113 (64%), Gaps = 5/113 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WKHWR+ T ++++D +L   YSRNEVI+CIH+GLLCVQE+   RP M  +VL L+++S
Sbjct  563  YVWKHWRDGTPLEVLDPTLTYTYSRNEVIRCIHIGLLCVQEDPAIRPAMVTIVLTLNTYS  622

Query  182  ATRRAPNPPA-----TFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA     T +DE+  S+ +   + +       SV+E SI+++YPR
Sbjct  623  VTLPLPQEPAFFFHSTITDEVNSSSKEFLLEHSKSKSVAYSVDEDSITEVYPR  675



>ref|XP_006603573.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=710

 Score =   101 bits (251),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 55/118 (47%), Positives = 72/118 (61%), Gaps = 12/118 (10%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW+ W+E T  +++D  L    S+NE+I+C H+GLLCVQEN+  RPTMANV LML+S S
Sbjct  595  FAWRSWQEGTVTNIIDPILNN-SSQNEMIRCTHIGLLCVQENLANRPTMANVALMLNSCS  653

Query  182  ATRRAPNPPATFSDEMTI----------SAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F D  T           S    ++QST KS    S++E SIS+LYPR
Sbjct  654  ITLPVPTKPAFFMDSATTSLPNMSWEVNSGTTRSNQSTTKSAH-DSLSEASISELYPR  710



>ref|XP_009340923.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Pyrus x bretschneideri]
Length=694

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+  +++++D  L   YSR EVI+C+H+GLLCVQE+  +RPTM ++VLML+S+S
Sbjct  585  HAWKLWRDGRSLELLDPCLRDSYSRTEVIRCVHIGLLCVQEDPTDRPTMQSLVLMLNSYS  644

Query  182  ATRRAPNPPATFSDEMTISAGQ----EADQSTNKSPPLSSVNEVSISDLYPR  325
             +  +P  PA F     + +      E+DQS  KS    SVNE SI++LYPR
Sbjct  645  VSLPSPKQPAFFLRSGAVGSMSDPKLESDQSITKSS--QSVNEESITELYPR  694



>emb|CBI23554.3| unnamed protein product [Vitis vinifera]
Length=247

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 78/118 (66%), Gaps = 12/118 (10%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+WRE    +++D ++G + S +E+++CIH+GLLCVQEN  +RPTMA++VLML+S+S
Sbjct  132  YAWKNWREGKATNVMDPTMG-IGSTSEIMRCIHIGLLCVQENEADRPTMASIVLMLNSYS  190

Query  182  ATRRAPNPPATFSDEMT----------ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P+ PA F +              S+  ++D S +KS   S+ NE SI+DLYPR
Sbjct  191  LSLPLPSQPAFFMNSGMNGDLPLELEDNSSVTKSDHSQSKSAKFSA-NEASITDLYPR  247



>ref|XP_008349189.1| PREDICTED: cysteine-rich receptor-like protein kinase 10, partial 
[Malus domestica]
Length=309

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+   ++++D  L   YSR EVI+CIH+GLLCVQE+  +RPTM +VVLML+S+S
Sbjct  200  HAWKLWRDGAPLELLDPCLWDSYSRTEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYS  259

Query  182  ATRRAPNPPATFSDEMTISAGQEAD----QSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F     +    EA     QS +KS P  SV E SI+++YPR
Sbjct  260  VTLPLPQQPAFFLQSRAMGNMLEATLDSAQSISKSSP--SVYEGSITEVYPR  309



>ref|XP_008446411.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Cucumis 
melo]
Length=1250

 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = +2

Query  2     YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
             YAW  W++   ++++D  L   YSRNEV++CIH+ LLCVQE+ + RP+MA++VLML+S+S
Sbjct  1144  YAWALWKDGIPLELLDPMLKDNYSRNEVLRCIHIALLCVQEDPNSRPSMASIVLMLNSYS  1203

Query  182   ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
              T   P  PA F           +D S+NKS    SVNE S+S+L+PR
Sbjct  1204  VTLPIPKEPALFVRSKDNGNTIGSDHSSNKSTK-CSVNETSLSELHPR  1250


 Score = 91.3 bits (225),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 3/107 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W+E+  +++ D SL   YS++EV++CIH+GLLCVQ++   RP+MA++VLML+++S
Sbjct  436  YAWKLWKEEMALELSDPSLETRYSKDEVLRCIHIGLLCVQDDPSRRPSMASIVLMLNTYS  495

Query  182  ATRRAPNPPATFSDEMTISAGQEADQ-STNKSPPLSSVNEVSISDLY  319
                 P  P  F      +    +DQ +TN    +SS NE+SI++L+
Sbjct  496  VPLPLPEEPTIFMHNTDNAIVINSDQLATNLF--ISSTNEISITELH  540



>ref|XP_010057979.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
 gb|KCW75404.1| hypothetical protein EUGRSUZ_E04159 [Eucalyptus grandis]
Length=674

 Score =   100 bits (250),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 51/113 (45%), Positives = 77/113 (68%), Gaps = 6/113 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW  WRE T + ++D ++   YSR++V++C+H+ LLC+QE+   RPTMA VVLML S+S
Sbjct  563  YAWNQWREGTPLKVLDPAIVDSYSRDQVLRCLHICLLCIQEDPAIRPTMATVVLMLSSNS  622

Query  182  ATRRAPNPPATF----SDEMTISAGQ-EADQSTNKSPPLSSVNEVSISDLYPR  325
             T  +P  PA F    S  + I   + E+D+S N++ P SS+N +S+++LYPR
Sbjct  623  ITLPSPQHPAFFIRSISQGLNIPIRELESDESANRTMP-SSINGMSVTELYPR  674



>ref|XP_010059149.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=354

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 71/109 (65%), Gaps = 8/109 (7%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y  KHWR++  +++V  +LG  YSR+EV++CIH+GLLCVQE+  ERPTMAN+VL L S +
Sbjct  248  YVGKHWRDNAPLEIVGSALGESYSRSEVLRCIHIGLLCVQEDPAERPTMANIVLALSSQT  307

Query  182  ATRRAPNPPATFSDEMT------ISAGQEADQSTNKSPPLSSVNEVSIS  310
             +   P  PA F    T      I  G+  D+ T++S P  SVNEVSI+
Sbjct  308  LSLPLPREPAFFFRSQTEPMINFIGNGKGHDRFTSRSVP--SVNEVSIT  354



>gb|KDP20816.1| hypothetical protein JCGZ_21287 [Jatropha curcas]
Length=670

 Score =   100 bits (250),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 58/120 (48%), Positives = 76/120 (63%), Gaps = 13/120 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+WRE T ++++D  L    S NE+++CIH+GLLCVQENV +RP MA+VVLML S+S
Sbjct  552  YAWKNWREGTYMNLIDPILRTSGSTNEMMRCIHIGLLCVQENVADRPNMASVVLMLSSYS  611

Query  182  ATRRAPNPPATFSDEMTI----------SAGQEADQSTNK--SPPLSSVNEVSISDLYPR  325
             T   P+ PA F    T           S   E + S  K  + PL SVNEVSI++L+PR
Sbjct  612  LTLPVPSKPAFFMHSSTQSDVSSSLGCSSRASETESSQFKIGTLPL-SVNEVSITELFPR  670



>ref|XP_008224765.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Prunus 
mume]
Length=679

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+ T ++++D S+   YSR+EVI+CIH+GLLCVQE+  +RPTM +VVLML+S+S
Sbjct  570  HAWKLWRDGTPLELLDPSMRDSYSRSEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYS  629

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T         E+D S +KS P  SV+E SI+ +YPR
Sbjct  630  VTLPLPEQPAFFLRSRTEGNMPKITLESDLSISKSTP--SVDEASITAVYPR  679



>ref|XP_010686953.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Beta 
vulgaris subsp. vulgaris]
Length=664

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 69/108 (64%), Gaps = 1/108 (1%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W   T ++ VD ++ G  S +EV++C+++G LCVQE++D+RPT A +VLML S S
Sbjct  558  YAWKQWIAGTPLEFVDATIRGSCSLDEVVRCMNLGFLCVQESIDDRPTTATIVLMLESQS  617

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T  AP  P         S   E+DQS NKS  L  VN+VSI+++ PR
Sbjct  618  LTLTAPKEPTLCGKSSIFSKHVESDQSNNKS-ILGFVNDVSITEMEPR  664



>emb|CBI39033.3| unnamed protein product [Vitis vinifera]
Length=615

 Score =   100 bits (249),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/91 (48%), Positives = 68/91 (75%), Gaps = 5/91 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+ W++ T ++++D  +GG YSR+EV++CIH+GLLCVQE+  +RPTMA+V LML+S+S
Sbjct  520  YAWRQWKDRTALELIDPIVGGEYSRSEVMRCIHIGLLCVQEDAADRPTMASVALMLNSYS  579

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKS  274
             T   P+ PA F     + + +E++ ST+KS
Sbjct  580  VTLPLPSKPAFF-----LHSKKESNPSTSKS  605



>ref|XP_009357384.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=663

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 74/112 (66%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+ T+++++D  L   YSR EVI+CIH+GLLCVQE+  +RPTM +VVLML+S+S
Sbjct  554  HAWKLWRDGTSLELLDLCLRDSYSRTEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYS  613

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F     +        E+DQS +KS    SV E SI+++YPR
Sbjct  614  VSLPLPKQPAFFLQSRAVGNMPKISLESDQSISKSSL--SVYEGSITEVYPR  663



>ref|XP_010646643.1| PREDICTED: cysteine-rich receptor-like protein kinase 10, partial 
[Vitis vinifera]
Length=317

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 78/118 (66%), Gaps = 12/118 (10%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+WRE    +++D ++G + S +E+++CIH+GLLCVQEN  +RPTMA++VLML+S+S
Sbjct  202  YAWKNWREGKATNVMDPTMG-IGSTSEIMRCIHIGLLCVQENEADRPTMASIVLMLNSYS  260

Query  182  ATRRAPNPPATFSDEMT----------ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P+ PA F +              S+  ++D S +KS   S+ NE SI+DLYPR
Sbjct  261  LSLPLPSQPAFFMNSGMNGDLPLELEDNSSVTKSDHSQSKSAKFSA-NEASITDLYPR  317



>emb|CDO99704.1| unnamed protein product [Coffea canephora]
Length=1313

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR+   V ++DR++G   SRNEVIQCIH+GLLCVQE+ ++RP MA VVLML+S+S
Sbjct  555  YAWKQWRDGAPVALLDRNVGDSSSRNEVIQCIHIGLLCVQEDAEQRPNMAAVVLMLNSYS  614

Query  182  ATRRAPN-PPATF  217
            AT  +PN PP  F
Sbjct  615  ATMPSPNQPPILF  627


 Score = 94.4 bits (233),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 49/108 (45%), Positives = 65/108 (60%), Gaps = 5/108 (5%)
 Frame = +2

Query  2     YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
             YAWK W   T + +VD ++  L +R EVI+ IH+GLLC QE+ +ERP MA VVLML+S S
Sbjct  1211  YAWKQWMNGTPLALVDPNIADLCAREEVIRRIHIGLLCDQEDAEERPNMATVVLMLNSSS  1270

Query  182   ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
              T   P+ PA F     +S+G E  +          VNE SI++L PR
Sbjct  1271  HTMPTPSRPAFF-----VSSGTEGWRKEQLEADEGPVNEASITELSPR  1313



>emb|CDP11362.1| unnamed protein product [Coffea canephora]
Length=654

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 71/111 (64%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW HWR   T+ ++D S+G  Y+RNEVIQCI VGLLCV+E+  +RPTMA+VV ML+  S
Sbjct  544  YAWNHWRRGQTLALLDSSIGDSYARNEVIQCIQVGLLCVEEDASKRPTMASVVSMLNPSS  603

Query  182  ATRRAPNPPATFSDEMTISAGQE--ADQS-TNKSPPLSSVNEVSISDLYPR  325
                 P+ PA F    + S   E   DQS T +    SSVN+ SI++ YPR
Sbjct  604  VPLPTPHRPAAFRSHGSESRVDELKVDQSNTQRISAPSSVNDASITEPYPR  654



>ref|XP_004953651.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Setaria italica]
Length=452

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = +2

Query  5    AWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
            AWK W ED   D +D SL G YSR+E  +C HVGLLCVQEN + RPTM+NVVLML S   
Sbjct  346  AWKLWNEDRAADFMDASLAGSYSRDEAWRCFHVGLLCVQENPELRPTMSNVVLMLISDQT  405

Query  185  TRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
               AP  P  F+    +S  + +      +    SVNEVSIS + PR
Sbjct  406  QMPAPAQPPLFARFKKVSVSEFSLAMKTDTTKTQSVNEVSISMIEPR  452



>ref|XP_009136145.1| PREDICTED: cysteine-rich receptor-like protein kinase 14 isoform 
X2 [Brassica rapa]
Length=522

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+ W   + +++VD ++G  Y  NEV +CIH+ LLC+QEN D+RP ++N++LML S++
Sbjct  412  YAWRLWINGSPLELVDPAIGRNYQSNEVTRCIHIALLCIQENPDDRPLLSNIILMLGSNT  471

Query  182  ATRRAPNPPATF----SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            +T  AP  P +F     + + +S G E+++ST + P   S N+VSI+DL PR
Sbjct  472  STLPAPCLPGSFPRSRQELVHVSEGLESNESTGR-PTTYSFNDVSITDLEPR  522



>ref|XP_010924008.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=662

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+HW +D  + ++D SLG LY R E + CIH+GLLCVQE+  +RP M +VVLML ++S
Sbjct  555  YVWEHWSKDMALQIIDHSLGELYHRQEALTCIHIGLLCVQEDSRKRPCMESVVLMLSNYS  614

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA F      +      +  + SP LSS++ +SI+++ PR
Sbjct  615  ITLPTPSMPAYFVPSRAANDSNVTSRIADSSPSLSSIHNMSITEIEPR  662



>ref|XP_010540897.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Tarenaya hassleriana]
Length=677

 Score =   100 bits (249),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/112 (44%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR+ + +++VD ++G  Y RNEV +CIH+GLLCVQE++ +RP M+ +VLML S++
Sbjct  567  YAWKLWRKGSPLELVDPTIGESYQRNEVTRCIHIGLLCVQEDLGDRPNMSTIVLMLTSNT  626

Query  182  ATRRAPNPPATF----SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  P  F     ++  +  G  +DQS +KS  L SV++ SI+++ PR
Sbjct  627  VTLPVPQQPGFFFRSRQEKDPLDKGLGSDQSMSKS-ILWSVDDASITEIDPR  677



>ref|XP_006383966.1| hypothetical protein POPTR_0004s02550g [Populus trichocarpa]
 gb|ERP61763.1| hypothetical protein POPTR_0004s02550g [Populus trichocarpa]
Length=651

 Score =   100 bits (248),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 55/113 (49%), Positives = 73/113 (65%), Gaps = 7/113 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVD-MVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSH  178
            Y W++W     +D ++D +L    SRNE+++CIHVGLLCVQEN  +RP MA+VV+ML S+
Sbjct  541  YTWENWNSGPNLDKLIDATLRA-GSRNEMLRCIHVGLLCVQENALDRPNMASVVIMLSSY  599

Query  179  SATRRAPNPPATFSDEM----TISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            S T   P  PA F+       T S   E+DQS + S P  S+NE SIS+LYPR
Sbjct  600  SVTLPVPQKPAFFARGTVLPGTSSTWTESDQSRSASVPF-SINEASISELYPR  651



>ref|XP_008377958.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10 [Malus domestica]
Length=364

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 79/123 (64%), Gaps = 19/123 (15%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WRE T  +++D +L    SRNE+++CIH+GLLCVQEN+  RPTM  +VLML+S+S
Sbjct  246  YAWKCWREGTASNLIDPALT-XGSRNEIMRCIHIGLLCVQENIAHRPTMMXIVLMLNSYS  304

Query  182  ATRRAPNPPATFSD-----EMT---------ISAGQEADQSTNKSPPLSSVNEVS-ISDL  316
             T   P+ PA F D     +MT         I+ G  +DQS + S   +S NEVS I+++
Sbjct  305  VTLLVPSQPAFFRDSNVGSDMTLGWKNSSEVITTG--SDQSKSSSIK-ASENEVSLITEV  361

Query  317  YPR  325
            YPR
Sbjct  362  YPR  364



>ref|XP_007025934.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 29 [Theobroma 
cacao]
 gb|EOY28556.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 29 [Theobroma 
cacao]
Length=279

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 76/116 (66%), Gaps = 10/116 (9%)
 Frame = +2

Query  5    AWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
             W +WRE T ++++D +L    SRNE+++CIH+GLLCVQENV  RPTMA VVLML+S S 
Sbjct  165  VWTNWREGTALNLIDPTLRD-GSRNEILRCIHIGLLCVQENVANRPTMATVVLMLNSFSI  223

Query  185  TRRAPNPPATFSD-----EMTISAGQE---ADQSTNKSPPL-SSVNEVSISDLYPR  325
            +   P+ PA F D     +M+ S G +   ++   +KS P+  S NE SI++ YPR
Sbjct  224  SLPMPSQPAFFMDSNIDSDMSSSRGYQSRISESKQSKSEPIPQSQNEASITEPYPR  279



>ref|XP_011002062.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Populus euphratica]
Length=657

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 7/111 (6%)
 Frame = +2

Query  8    WKHWREDTTVD-MVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
            W++W     +D ++D +L    SRNE+++CIHVGLLCVQEN  +RP MA+VV+ML S+S 
Sbjct  549  WENWNSGPNLDKLIDSTLRA-GSRNEMLRCIHVGLLCVQENALDRPNMASVVIMLSSYSV  607

Query  185  TRRAPNPPATF--SDEM--TISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            T   P  PA F  S EM  T S   E+DQS + S P  S+NE SI++LYPR
Sbjct  608  TLPVPQKPAFFAHSTEMPGTTSTWTESDQSRSASVP-CSINEASITELYPR  657



>gb|KHN04839.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja]
Length=457

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 72/118 (61%), Gaps = 12/118 (10%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW+ W+E T  +++D  L    S+NE+I+C H+GLLCVQEN+  RPTMANV LML+S S
Sbjct  342  FAWRSWQEGTVTNIIDPILNN-SSQNEMIRCTHIGLLCVQENLANRPTMANVALMLNSCS  400

Query  182  ATRRAPNPPATFSDEMTI----------SAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F D  T           S    ++QST KS    S++E SIS+LYPR
Sbjct  401  ITLPVPTKPAFFMDSATTSLPNMSWEVNSGTTRSNQSTTKSAH-DSLSEASISELYPR  457



>ref|XP_007211369.1| hypothetical protein PRUPE_ppa002516mg [Prunus persica]
 gb|EMJ12568.1| hypothetical protein PRUPE_ppa002516mg [Prunus persica]
Length=663

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+ T ++++D S+   YSR+EVI+CIH+GLLCVQE+  +RPTM +VVLML+S+S
Sbjct  554  HAWKLWRDGTPLELLDPSMRDSYSRSEVIRCIHIGLLCVQEDPADRPTMQSVVLMLNSYS  613

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    T         E+D S +KS P  SV+E SI+ +YPR
Sbjct  614  VTLPLPEQPAFFLRSRTEGNMPKITLESDLSISKSTP--SVDEGSITAVYPR  663



>gb|KEH40076.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=678

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 72/110 (65%), Gaps = 6/110 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            + W++WR+ +  +++D +L    S NE+++CIH+GLLCVQEN   RPTMA++VLML+SHS
Sbjct  573  FVWRNWRDGSPTNVIDPTLNN-DSVNEIMRCIHIGLLCVQENAASRPTMASIVLMLNSHS  631

Query  182  ATRRAPNPPATFSDEMTISAG--QEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA + D     AG  Q+  QS   S    SVNE SI++ YPR
Sbjct  632  LTLSRPSEPAFYVDS---GAGDFQDMMQSLESSSVQESVNEASITEPYPR  678



>ref|XP_003517662.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Glycine max]
Length=674

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 72/118 (61%), Gaps = 12/118 (10%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW+ W+E T  +++D  L    S+NE+I+C H+GLLCVQEN+  RPTMANV LML+S S
Sbjct  559  FAWRSWQEGTVTNIIDPILNN-SSQNEMIRCTHIGLLCVQENLANRPTMANVALMLNSCS  617

Query  182  ATRRAPNPPATFSDEMTI----------SAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F D  T           S    ++QST KS    SV+E SIS+LYPR
Sbjct  618  ITLPVPTKPAFFMDSATTSLPNMSWEVNSGTTRSNQSTTKSAH-DSVSEASISELYPR  674



>ref|XP_006387146.1| hypothetical protein POPTR_1704s00210g [Populus trichocarpa]
 gb|ERP46060.1| hypothetical protein POPTR_1704s00210g [Populus trichocarpa]
Length=116

 Score = 93.2 bits (230),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 69/111 (62%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHW   T ++++D SLG  YSRNE+ +C+H+ LLCVQE+   RPT+  +VLML S S
Sbjct  6    YAWKHWTNGTALELMDASLGHSYSRNEIARCLHIALLCVQEDPKNRPTLTTIVLMLTSFS  65

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNK---SPPLSSVNEVSISDLYPR  325
             T   P  PA      T S+    +  +++       SSVN++SI++LYPR
Sbjct  66   VTLPLPRKPAYCVRSRTGSSLPIIELESDRSTSKSMSSSVNDMSITELYPR  116



>ref|XP_002518558.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43945.1| conserved hypothetical protein [Ricinus communis]
Length=590

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 70/108 (65%), Gaps = 7/108 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW++W E T ++++D +L  + SR+E+++CIH+GLLCVQEN  ERPTMA ++ +L SHS
Sbjct  490  YAWRNWNEGTALNLIDPALT-VGSRSEMLRCIHIGLLCVQENETERPTMAQIITLLSSHS  548

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F     +  G ++    N      S NE+SISDLYPR
Sbjct  549  VTLAVPLRPAFFM-HGELRMGTQSSSENN-----GSRNEMSISDLYPR  590



>ref|XP_008384459.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=658

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 72/112 (64%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+ T+++++D SL   YS  EVI+CIH GLLCVQE+  +RP M  VVLML+S+S
Sbjct  549  HAWKLWRDGTSLELLDPSLRDSYSXTEVIRCIHXGLLCVQEDPVDRPXMQXVVLMLNSYS  608

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F     +        E+DQS +KS P  SV E SI++LYPR
Sbjct  609  VSLPLPKZPAFFLQSKAVGNPSMTTLESDQSISKSSP--SVYEGSITELYPR  658



>ref|XP_011002063.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Populus euphratica]
Length=653

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 75/113 (66%), Gaps = 7/113 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVD-MVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSH  178
            Y W++W     +D ++D +L    SRNE+++CIHVGLLCVQEN  +RP MA+VV+ML S+
Sbjct  543  YTWENWNSGPNLDKLIDSTLRA-GSRNEMLRCIHVGLLCVQENALDRPNMASVVIMLSSY  601

Query  179  SATRRAPNPPATF--SDEM--TISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            S T   P  PA F  S EM  T S   E+DQS + S P  S+NE SI++LYPR
Sbjct  602  SVTLPVPQKPAFFAHSTEMPGTTSTWTESDQSRSASVP-CSINEASITELYPR  653



>gb|KHN40432.1| Cysteine-rich receptor-like protein kinase 14 [Glycine soja]
Length=538

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 72/118 (61%), Gaps = 12/118 (10%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW+ W+E T  +++D  L    S+NE+I+C H+GLLCVQEN+  RPTMANV LML+S S
Sbjct  423  FAWRSWQEGTVTNIIDPILNN-SSQNEMIRCTHIGLLCVQENLANRPTMANVALMLNSCS  481

Query  182  ATRRAPNPPATFSDEMTI----------SAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F D  T           S    ++QST KS    S++E SIS+LYPR
Sbjct  482  ITLPVPTKPAFFMDSATTSLPNMSWEVNSGTTRSNQSTTKSAH-DSLSEASISELYPR  538



>ref|XP_009338731.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Pyrus x bretschneideri]
Length=665

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 73/112 (65%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+   ++++D  L   YSR EVI+CIH+GLLCVQE+  +RPTM +VVLML S+S
Sbjct  556  HAWKLWRDGAPLELLDPCLRDFYSRIEVIRCIHIGLLCVQEDPADRPTMQSVVLMLSSYS  615

Query  182  ATRRAPNPPATFSDEMTIS----AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T  +P  PA F     +     A  ++ QS +KS P  SV E SI+++YPR
Sbjct  616  LTLPSPQQPAFFLQSRAMGNMSKATLDSTQSISKSSP--SVYEGSITEVYPR  665



>ref|XP_003637378.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=573

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 73/108 (68%), Gaps = 5/108 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y+W  W ED +++++D  L   Y+ NEVI+CIH+GLLCVQE+  +RPTM+NVV+ML S +
Sbjct  471  YSWNLWCEDKSLELLDPILKNTYTTNEVIKCIHIGLLCVQEDAVDRPTMSNVVVMLASDT  530

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   PN PA FS    +  G    +ST+K+    SVNEV+++++ PR
Sbjct  531  MTLPNPNHPA-FSVGRKVVEG----ESTSKASNDPSVNEVTVTNILPR  573



>ref|XP_006283285.1| hypothetical protein CARUB_v10004321mg [Capsella rubella]
 gb|EOA16183.1| hypothetical protein CARUB_v10004321mg [Capsella rubella]
Length=660

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W   T +++VD ++   + RNEV++C+H+GLLCVQE+  ERPTM+ +VLML S++
Sbjct  553  YAWKLWSNGTPLELVDPAIADNFQRNEVVRCVHIGLLCVQEDPVERPTMSTIVLMLTSNT  612

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  P  F          + DQ +     + SV++ SI+D+YPR
Sbjct  613  VTLPVPRQPGLFFQSRLGKDPLDTDQFSTTKSLIGSVDDASITDIYPR  660



>ref|XP_007143203.1| hypothetical protein PHAVU_007G052500g [Phaseolus vulgaris]
 gb|ESW15197.1| hypothetical protein PHAVU_007G052500g [Phaseolus vulgaris]
Length=682

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 77/118 (65%), Gaps = 11/118 (9%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++W+E   +++VD SL    SRNE+++CIH+GLLCVQEN+ +RPTMAN+VLML+S+S
Sbjct  566  FAWRNWKEGKAINIVDPSLNS-NSRNEMLRCIHIGLLCVQENLVDRPTMANIVLMLNSYS  624

Query  182  ATRRAPNPPATFSDEMTISAGQEA-----DQSTNKSPPL-----SSVNEVSISDLYPR  325
             +   P  PA + +  T S  +        + T  S P+      S NEVSI++LYPR
Sbjct  625  LSLPIPAEPAFYMNSRTRSLPEMQSWDYNSRETGSSEPILKSAQESENEVSITELYPR  682



>ref|XP_003637461.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=626

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 50/108 (46%), Positives = 73/108 (68%), Gaps = 5/108 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y+W  W ED +++++D  L   Y+ NEVI+CIH+GLLCVQE+  +RPTM+NVV+ML S +
Sbjct  524  YSWNLWCEDKSLELLDPILKNTYTTNEVIKCIHIGLLCVQEDAVDRPTMSNVVVMLASDT  583

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   PN PA FS    +  G    +ST+K+    SVNEV+++++ PR
Sbjct  584  MTLPNPNHPA-FSVGRKVVEG----ESTSKASNDPSVNEVTVTNILPR  626



>gb|KHN02663.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=633

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 51/118 (43%), Positives = 77/118 (65%), Gaps = 11/118 (9%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++W+E T +++VD SL    SRNE+++ IH+GLLCVQEN+ +RPTMAN++LML+S+S
Sbjct  517  FAWRNWKEGTAINIVDPSLNN-NSRNEMMRSIHIGLLCVQENLADRPTMANIILMLNSYS  575

Query  182  ATRRAPNPPATFSDEMTIS-----AGQEADQSTNKSPPL-----SSVNEVSISDLYPR  325
             +   P  PA + +  T S     + +   + T  S P+      S NE SI++LYPR
Sbjct  576  LSLPIPAEPAFYMNSRTQSRPDMQSWEYNSRETGTSEPILKSAQESENEASITELYPR  633



>ref|XP_007143171.1| hypothetical protein PHAVU_007G049600g [Phaseolus vulgaris]
 gb|ESW15165.1| hypothetical protein PHAVU_007G049600g [Phaseolus vulgaris]
Length=685

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 74/118 (63%), Gaps = 11/118 (9%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++W+E   +++VD SL    SRNE+++CIH+GLLCVQEN+ +RPTMAN+VLML+S+S
Sbjct  569  FAWRNWKEGKAINIVDPSLNN-NSRNEMLRCIHIGLLCVQENLVDRPTMANIVLMLNSYS  627

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLS----------SVNEVSISDLYPR  325
             +   P  PA + +  T S  +      N   P S          S NE SIS+LYPR
Sbjct  628  LSLPIPAEPAFYMNSRTRSLPEMQSWEYNSREPGSSEAIFKSVQESENEASISELYPR  685



>ref|XP_007143170.1| hypothetical protein PHAVU_007G0495000g, partial [Phaseolus vulgaris]
 gb|ESW15164.1| hypothetical protein PHAVU_007G0495000g, partial [Phaseolus vulgaris]
Length=166

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 11/118 (9%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++W+E   +++VD SL    SRNE+++CIH+GL+CVQEN+ +RPTMAN++LML+S+S
Sbjct  50   FAWRNWKEGKAINIVDPSLNS-NSRNEMLKCIHIGLICVQENLVDRPTMANIMLMLNSYS  108

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLS----------SVNEVSISDLYPR  325
             +   P  PA + +  T S  +      N     S          S NE SI++LYPR
Sbjct  109  LSLPIPGEPAFYINSRTRSLPETQSWEYNSRETGSREAKLISAQESENEASITELYPR  166



>ref|XP_007025939.1| Cysteine-rich RLK 29 [Theobroma cacao]
 gb|EOY28561.1| Cysteine-rich RLK 29 [Theobroma cacao]
Length=1349

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 57/117 (49%), Positives = 76/117 (65%), Gaps = 12/117 (10%)
 Frame = +2

Query  5     AWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
             AWK+WRE T ++++D +L    SRNE+++CIH+GLLCVQENV  RPTMA VVLML+S S 
Sbjct  1235  AWKNWREGTALNIIDPTLRD-GSRNEMLRCIHIGLLCVQENVANRPTMATVVLMLNSISI  1293

Query  185   TRRAPNPPATF-----SDEMTISAG-----QEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P+ PA F       +M+ S        E+  S  +S PLS  NE SI++LYPR
Sbjct  1294  SLPLPSQPAFFMHSNIDSDMSSSWDYNSRVSESKPSKRESIPLSQ-NEASITELYPR  1349


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 50/109 (46%), Positives = 71/109 (65%), Gaps = 9/109 (8%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW++W++ T + +VD  L    SR EV++CIH+GLLCVQEN  +RP MA+VVLML S+S
Sbjct  570  YAWRNWKDGTALKLVDPILREA-SRTEVMRCIHIGLLCVQENAAQRPNMASVVLMLTSYS  628

Query  182  ATRRAPNPPATF------SDEMTISAG-QEADQSTNKSPPLSSVNEVSI  307
             T   P+ PA F      SD + +++G  E+ QS N+   +S  NE+ I
Sbjct  629  VTLPLPSEPAFFMHSNTQSDMLWLNSGATESTQSRNEVAAVSE-NEIKI  676



>gb|KDP20812.1| hypothetical protein JCGZ_21283 [Jatropha curcas]
Length=673

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 75/114 (66%), Gaps = 6/114 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WKHWR  T ++++D +L   +SR+EV++CI +GLLCVQE+  +RPTM  +VLML S+S
Sbjct  560  YVWKHWRNGTPMEVLDPTLVDSHSRSEVLRCIQIGLLCVQEDPADRPTMPTIVLMLSSYS  619

Query  182  ATRRAPNPPATF----SDEMTISAGQEADQST--NKSPPLSSVNEVSISDLYPR  325
             T   P  PA F    S++     G E+D+ST  +KS  + SV+E  I+ +YPR
Sbjct  620  VTLPVPQQPAFFLNSGSEQSMQLKGFESDKSTTISKSTVICSVDEEPITQVYPR  673



>ref|XP_007025923.1| Cysteine-rich RLK 29, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY28545.1| Cysteine-rich RLK 29, putative isoform 2, partial [Theobroma 
cacao]
Length=669

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 53/119 (45%), Positives = 78/119 (66%), Gaps = 13/119 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++WRE T ++++D +L    SR+++++CIH+GLLCVQENV  RPTMA+VV ML+S S
Sbjct  553  FAWRNWREGTALNLIDPTLSD-GSRDDMMRCIHIGLLCVQENVAGRPTMASVVFMLNSFS  611

Query  182  ATRRAPNPPA------TFSDEMTISAG-----QEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA          + + S G      E++QS N+  P+S  NEVSI++L PR
Sbjct  612  TTLAVPSQPAFALQSNNIESDRSSSLGTNSWPSESNQSKNELLPVSQ-NEVSITELSPR  669



>gb|KHN40584.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=898

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 51/111 (46%), Positives = 69/111 (62%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            + W+HW+++T ++ +D  L   YS  EVI+CI +GLLCVQEN D RPTM  +V  L SHS
Sbjct  789  FVWRHWKDETPLNTLDPKLRDNYSNIEVIKCIRIGLLCVQENPDARPTMLTIVSYLSSHS  848

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
                +P  P  F     + T++    + QSTN S P SS+NE+SIS  YPR
Sbjct  849  IELPSPQEPTFFLYHRMDPTVAHESSSRQSTNNSIP-SSINEMSISKFYPR  898



>ref|XP_006388607.1| hypothetical protein POPTR_0138s00210g [Populus trichocarpa]
 gb|ERP47521.1| hypothetical protein POPTR_0138s00210g [Populus trichocarpa]
Length=526

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 73/113 (65%), Gaps = 7/113 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVD-MVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSH  178
            Y W++W     +D ++D +L    SRNE+++CIHVGLLCVQEN  +RP MA+VV+ML S+
Sbjct  416  YTWENWNSGPNLDKLIDATLRAG-SRNEMLRCIHVGLLCVQENALDRPNMASVVIMLSSY  474

Query  179  SATRRAPNPPATFSDEMTI----SAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            S T   P  PA F+    +    S   E+DQS + S P  S+NE SIS+LYPR
Sbjct  475  SVTLPVPQKPAFFARGTVLPGTSSTWTESDQSRSASVPF-SINEASISELYPR  526



>ref|XP_008345852.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 [Malus 
domestica]
Length=671

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 56/124 (45%), Positives = 79/124 (64%), Gaps = 21/124 (17%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSL-GGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSH  178
            YAWK WRE T  +++D +L  G  SRNE+++CIH+GLLCVQEN+ +RPTM  +VLML+S+
Sbjct  553  YAWKCWREGTASNLIDPALING--SRNEIMRCIHIGLLCVQENIADRPTMNAIVLMLNSY  610

Query  179  SATRRAPNPPATFSD-----EMT---------ISAGQEADQSTNKSPPLSSVNEVS-ISD  313
            S T   P+ PA F D     +MT         I+ G +  +S++   P    NEVS I++
Sbjct  611  SVTLPVPSQPAFFRDSNVGSDMTSGWKNSSEVITTGSDRSKSSSVKAP---ENEVSLITE  667

Query  314  LYPR  325
            +YPR
Sbjct  668  VYPR  671



>ref|XP_009340926.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=705

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 70/110 (64%), Gaps = 2/110 (2%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+ T ++++D  L   YSR E I+CIH+GLLCVQE+  +RPTM ++VLML S+S
Sbjct  596  HAWKLWRDGTPLELLDPCLRDSYSRTEAIRCIHIGLLCVQEDPADRPTMQSIVLMLSSYS  655

Query  182  ATRRAPNPPATFSDEMTISAGQEA--DQSTNKSPPLSSVNEVSISDLYPR  325
             T  +P  PA F     +    EA  D + + S    SV E SI+++YPR
Sbjct  656  VTLPSPQKPAFFLQSRAMGNMSEATLDSAQSISKSSLSVYEGSITEIYPR  705



>ref|XP_010910126.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=683

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 78/119 (66%), Gaps = 13/119 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+ W E T ++++D SLG    R+E ++CIH+GLLCVQEN  +RP M+ VV+ML S+S
Sbjct  567  YIWERWTEGTILEILDPSLGNHCPRSEALRCIHIGLLCVQENPSDRPNMSQVVVMLSSNS  626

Query  182  ATRRAPNPPA-----------TFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             + +AP+ PA            +S+E  +S G   D+S++KS P+S  NEVSI++L PR
Sbjct  627  VSLQAPSRPAFCIGKSSMDSDVYSNEFNMSRGAN-DRSSSKSIPMSP-NEVSITELEPR  683



>emb|CBI38466.3| unnamed protein product [Vitis vinifera]
Length=184

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 76/118 (64%), Gaps = 14/118 (12%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW+ WR+ +  +++D S+    SR+E+++CIH+GLLCVQENV +RPTMA+VVLML S+S
Sbjct  71   FAWRSWRDGSVSNLIDPSVSS-GSRSEIMRCIHIGLLCVQENVADRPTMASVVLMLSSYS  129

Query  182  ATRRAPNPPATFSDEMTISAG------QEADQSTNKS----PPLSSVNEVSISDLYPR  325
             T   P+ PA F   +  S G      Q++D    KS        SVNE SI++L+PR
Sbjct  130  LTVPLPSQPAFF---LHGSMGPETPLLQDSDSGVTKSSDNVSAGMSVNETSITELHPR  184



>ref|XP_010540889.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Tarenaya hassleriana]
Length=664

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK WR+ + +++VD ++G  Y RNEV +CIH+GLLCVQE++ +RP M+ +VLML S++
Sbjct  554  YAWKLWRKGSPLELVDPTIGESYQRNEVTRCIHIGLLCVQEDLGDRPNMSTIVLMLTSNT  613

Query  182  ATRRAPNPPATF----SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  P  F     ++  +  G  +DQS +KS  L SV++ SI+++ PR
Sbjct  614  VTLPVPQQPGFFFRSRQEKDPLDKGLGSDQSMSKS-ILWSVDDASITEIDPR  664



>ref|XP_010267800.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Nelumbo nucifera]
Length=650

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++W E T  +++D  L   YSR EV++CIH+GLLCVQ+NVD+RPTMA +   L+ HS
Sbjct  549  FAWRNWNEGTASELLDPILREFYSREEVMRCIHIGLLCVQDNVDQRPTMATIARTLNIHS  608

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
                 P  PA    E       E  QST++S P  S+N+V+ ++L PR
Sbjct  609  VALELPQRPAFLGYER-----METTQSTSRSIP-ESMNDVTNTELAPR  650



>gb|KHN15821.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=592

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 73/111 (66%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W+++T +++++ SL   Y+ NEVI+ IH+GLLCVQE+  +RPTMA+VVLML S+S
Sbjct  483  YAWKFWKDETPLELLEHSLRESYTPNEVIRSIHIGLLCVQEDPADRPTMASVVLMLSSYS  542

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   PN PA F     E  +    + DQS  KS    SVNE+S+S   PR
Sbjct  543  VTLPVPNQPALFMHSRTESNMLKWVQIDQSITKSTT-KSVNEMSLSGDIPR  592



>ref|XP_010646641.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
 emb|CBI23449.3| unnamed protein product [Vitis vinifera]
Length=661

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 52/116 (45%), Positives = 76/116 (66%), Gaps = 10/116 (9%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW+ WRE +  +++D S+    SR+ +++CIH+GLLCVQENV +RPTMA++VLML S+S
Sbjct  548  FAWRSWREGSASNLIDPSMNS-GSRSGIMRCIHIGLLCVQENVADRPTMASIVLMLSSYS  606

Query  182  ATRRAPNPPATFSDEMT-----ISAGQEA---DQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ P  F    T     +  G ++   + S N S P+ SVNE SI+DL+PR
Sbjct  607  LTLPLPSQPGFFMHSSTNPDAPLLQGSDSGVINSSNNVSAPV-SVNEASITDLHPR  661



>ref|XP_003556018.2| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
isoform 1 [Glycine max]
Length=707

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 73/111 (66%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W+++T +++++ SL   Y+ NEVI+ IH+GLLCVQE+  +RPTMA+VVLML S+S
Sbjct  598  YAWKFWKDETPLELLEHSLRESYTPNEVIRSIHIGLLCVQEDPADRPTMASVVLMLSSYS  657

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   PN PA F     E  +    + DQS  KS    SVNE+S+S   PR
Sbjct  658  VTLPVPNQPALFMHSRTESNMLKWVQIDQSITKSTT-KSVNEMSLSGDIPR  707



>ref|XP_010267801.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Nelumbo nucifera]
Length=608

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++W E T  +++D  L   YSR EV++CIH+GLLCVQ+NVD+RPTMA +   L+ HS
Sbjct  507  FAWRNWNEGTASELLDPILREFYSREEVMRCIHIGLLCVQDNVDQRPTMATIARTLNIHS  566

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
                 P  PA    E       E  QST++S P  S+N+V+ ++L PR
Sbjct  567  VALELPQRPAFLGYER-----METTQSTSRSIP-ESMNDVTNTELAPR  608



>ref|XP_002271125.3| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=692

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 78/118 (66%), Gaps = 12/118 (10%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+WRE    +++D ++G + S +E+++CIH+GLLCVQEN  +RPTMA++VLML+S+S
Sbjct  577  YAWKNWREGKATNVMDPTMG-IGSTSEIMRCIHIGLLCVQENEADRPTMASIVLMLNSYS  635

Query  182  ATRRAPNPPATFSDEMT----------ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P+ PA F +              S+  ++D S +KS   S+ NE SI+DLYPR
Sbjct  636  LSLPLPSQPAFFMNSGMNGDLPLELEDNSSVTKSDHSQSKSAKFSA-NEASITDLYPR  692



>gb|KHN01541.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=543

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 78/123 (63%), Gaps = 21/123 (17%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++WR+ TT D++D +L    SRNE+++CIH+GLLC QENV  RPTMA+VVLML+S+S
Sbjct  427  FAWRNWRDGTTTDIIDPTLND-GSRNEIMRCIHIGLLCAQENVTARPTMASVVLMLNSYS  485

Query  182  ATRRAPNPPATFSD-------EMTIS--------AGQEADQSTNKSPPLSSVNEVSISDL  316
             T   P+  A   D       +M +S        + + A +ST K     S+NE SI++L
Sbjct  486  LTLPLPSETAFVLDSNIRSFPDMLLSEHNSRETRSSETAIKSTQK-----SINEASITEL  540

Query  317  YPR  325
            YPR
Sbjct  541  YPR  543



>ref|XP_010910239.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=686

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 77/119 (65%), Gaps = 13/119 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+ W E T ++++D SLG    R+EV++CIH+GLLCVQEN  +RP M+ VV+ML S S
Sbjct  570  YIWERWTEGTILEILDPSLGNHCPRSEVLRCIHIGLLCVQENPSDRPNMSQVVVMLSSDS  629

Query  182  ATRRAPNPPA-----------TFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             + +AP+ PA            +S+E  +S G   D+S+ KS P+S  N+VSI++L PR
Sbjct  630  VSLQAPSRPAFCIGKSSMESDVYSNEFNLSRGAN-DRSSTKSVPMSP-NDVSITELEPR  686



>emb|CBI23454.3| unnamed protein product [Vitis vinifera]
Length=647

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 78/118 (66%), Gaps = 12/118 (10%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+WRE    +++D ++G + S +E+++CIH+GLLCVQEN  +RPTMA++VLML+S+S
Sbjct  532  YAWKNWREGKATNVMDPTMG-IGSTSEIMRCIHIGLLCVQENEADRPTMASIVLMLNSYS  590

Query  182  ATRRAPNPPATFSDEMT----------ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P+ PA F +              S+  ++D S +KS   S+ NE SI+DLYPR
Sbjct  591  LSLPLPSQPAFFMNSGMNGDLPLELEDNSSVTKSDHSQSKSAKFSA-NEASITDLYPR  647


 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW+ WR+ +  +++D S+    SR+E+++CIH+GLLCVQENV +RPTMA+VVLML S+S
Sbjct  234  FAWRSWRDGSAPNVIDPSVSS-GSRSEIMRCIHIGLLCVQENVADRPTMASVVLMLSSYS  292

Query  182  ATRRAPNPPATF  217
             T   P+ PA F
Sbjct  293  ITLPLPSQPAFF  304



>ref|XP_007025922.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
 gb|EOY28544.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
Length=689

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 53/119 (45%), Positives = 78/119 (66%), Gaps = 13/119 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++WRE T ++++D +L    SR+++++CIH+GLLCVQENV  RPTMA+VV ML+S S
Sbjct  573  FAWRNWREGTALNLIDPTLSD-GSRDDMMRCIHIGLLCVQENVAGRPTMASVVFMLNSFS  631

Query  182  ATRRAPNPPA------TFSDEMTISAG-----QEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA          + + S G      E++QS N+  P+S  NEVSI++L PR
Sbjct  632  TTLAVPSQPAFALQSNNIESDRSSSLGTNSWPSESNQSKNELLPVSQ-NEVSITELSPR  689



>ref|XP_008371138.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=692

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 56/124 (45%), Positives = 79/124 (64%), Gaps = 21/124 (17%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSL-GGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSH  178
            YAWK WRE T  +++D +L  G  SRNE+++CIH+GLLCVQEN+ +RPTM  +VLML+S+
Sbjct  574  YAWKCWREGTASNLIDPALING--SRNEIMRCIHIGLLCVQENIADRPTMNAIVLMLNSY  631

Query  179  SATRRAPNPPATFSD-----EMT---------ISAGQEADQSTNKSPPLSSVNEVS-ISD  313
            S T   P+ PA F D     +MT         I+ G +  +S++   P    NEVS I++
Sbjct  632  SVTLPVPSQPAFFRDSNVGSDMTSGWKNSSEVITTGSDRSKSSSVKAP---ENEVSLITE  688

Query  314  LYPR  325
            +YPR
Sbjct  689  VYPR  692



>ref|XP_002518555.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43942.1| ATP binding protein, putative [Ricinus communis]
Length=671

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 53/112 (47%), Positives = 71/112 (63%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WKHWR+ T ++++D  +   YSRNEV++CI +GLLCVQE+  +R TMA VVLML+S S
Sbjct  561  YVWKHWRDGTPMEVMDPVIKDSYSRNEVLRCIQIGLLCVQEDPADRLTMATVVLMLNSFS  620

Query  182  ATRRAPNPPA----TFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA    + S       G E D+ST KS  L SV++  I+ +YPR
Sbjct  621  VTLPVPQQPAFLIHSRSQPTMPMKGLELDKSTPKSMQL-SVDQEPITQIYPR  671



>ref|XP_002867728.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43987.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 49/108 (45%), Positives = 69/108 (64%), Gaps = 5/108 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+ W  +T +++VD S    Y RNE+I+CIH+ LLCVQE+ ++RPTM+ +V ML + S
Sbjct  569  YTWRLWTNETPLELVDSSFRTNYQRNEIIRCIHIALLCVQEDTEDRPTMSMIVQMLTTSS  628

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +  AP PP  F      S  +EA  STNKS  L S+++ SI+ L PR
Sbjct  629  ISLAAPRPPGFFFR----SKHEEAGPSTNKS-SLCSIDDASITMLTPR  671



>ref|XP_009334798.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor-like protein 
kinase At4g00960 [Pyrus x bretschneideri]
Length=680

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 75/109 (69%), Gaps = 4/109 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRS-LGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSH  178
            Y W +WRE+TT +++D + + G  SR E+++CIH+GLLCVQ+NV +RPTMA+V+LML S+
Sbjct  575  YVWNNWREETTSNIIDPTWIAG--SRGEILRCIHIGLLCVQQNVADRPTMASVILMLTSN  632

Query  179  SATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            S +   P+ PA F     ++A +  DQ    S    SVNEVSI++L PR
Sbjct  633  SLSLPEPSQPAFFMVRSDMTAVEGLDQ-YRSSFIQQSVNEVSITELSPR  680



>emb|CDP11365.1| unnamed protein product [Coffea canephora]
Length=644

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW HWR   T+ + D S+G  Y+RNEVIQCI VGLLCV+E+  +RP MA+VV ML+  S
Sbjct  534  YAWNHWRRGQTLALWDSSVGDSYARNEVIQCIQVGLLCVEEDASKRPKMASVVSMLNPGS  593

Query  182  ATRRAPNPPATFSDEMTISAGQE--ADQS-TNKSPPLSSVNEVSISDLYPR  325
             +   P+ PA F    + S   E   DQS T +    SSVN+ SI++ YPR
Sbjct  594  VSLPTPHRPAVFRSNGSESRVDELKVDQSNTQRISAPSSVNDASITEPYPR  644



>ref|XP_007025937.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
 gb|EOY28559.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
Length=680

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 78/115 (68%), Gaps = 9/115 (8%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW++W++ T +++VD  L    SR EV++CIH+GLLCVQEN  +RP MA+VVLML S+S
Sbjct  568  YAWRNWKDGTPLNLVDPILREA-SRTEVMRCIHIGLLCVQENAAQRPNMASVVLMLTSYS  626

Query  182  ATRRAPNPPATF------SDEMTISAGQ-EADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F      SD + +++G  E+ QS N +  +S  NEVSI++L+PR
Sbjct  627  VTLPLPAEPAFFMHSNTQSDMLWLNSGATESTQSRNDAAAVSE-NEVSITELHPR  680



>emb|CDP11364.1| unnamed protein product [Coffea canephora]
Length=415

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 71/110 (65%), Gaps = 3/110 (3%)
 Frame = +2

Query  5    AWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
             WKHWR    + ++D S+G  +++NEVIQC+ +GLLCV+E V +RPT+A+VV ML+S S 
Sbjct  306  VWKHWRRGEPLALLDSSIGDSFAKNEVIQCVQLGLLCVEEYVSKRPTVASVVNMLNSSSV  365

Query  185  TRRAPNPPATFSDEM--TISAGQEADQSTNKSPPL-SSVNEVSISDLYPR  325
            T   P+ PA F      +I    E +QS  +   + SSVNE SI++ YPR
Sbjct  366  TLPTPHRPAVFRSHGSESIVEELEVEQSNTERISIPSSVNEASITEPYPR  415



>ref|XP_010923981.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=663

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+HW +D  + ++D SLG LY R E + CIH+GLLCVQE+  +RP M +VVLML ++S
Sbjct  556  YVWEHWSKDMALQIIDHSLGELYHRQEALTCIHIGLLCVQEDSRKRPCMQSVVLMLSNYS  615

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
                 P+ PA F      +      +  + SP LSS++  SI+++ PR
Sbjct  616  IALPTPSMPAYFVPSRAATDSNVTSRIADSSPTLSSMHNTSITEIEPR  663



>gb|KHN01555.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=427

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 7/112 (6%)
 Frame = +2

Query  8    WKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSAT  187
            W++WRE T  ++VD +L    SRNE+++CIH+GLLCVQEN   RPTM +VVLML+S+S T
Sbjct  317  WRNWREGTATNIVDPTLND-GSRNEIMRCIHIGLLCVQENDAGRPTMTSVVLMLNSYSLT  375

Query  188  RRAPNPPATFSDEMTIS------AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
               P+ PA   D  T S          + Q+ +     +SVNE SI++LYPR
Sbjct  376  LPVPSEPAFVVDSRTRSLPSSELTEHNSSQTRSSESTQNSVNEASITELYPR  427



>ref|XP_010931318.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Elaeis 
guineensis]
Length=683

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 80/119 (67%), Gaps = 13/119 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+ W + T ++++D SLG    R+E+++C+H+GLLCVQEN  +RP M+ VV+ML+S+S
Sbjct  567  YVWERWIKGTILEILDPSLGNHCPRSEMLRCVHIGLLCVQENPSDRPNMSQVVVMLNSNS  626

Query  182  ATRRAPNPPAT-----------FSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             + +AP+ PA            +S+E  +S G   DQS++KS P+S  NEVSI++L PR
Sbjct  627  VSLQAPSRPAFCNGQSGMDSGDYSNEYDLSEGMH-DQSSSKSIPVSP-NEVSITELEPR  683



>ref|XP_004496761.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Cicer arietinum]
Length=669

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 50/115 (43%), Positives = 75/115 (65%), Gaps = 7/115 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W++   ++++D +L   YSR+EV +CIHVGL CVQE+  ERP+M  +VL+L S S
Sbjct  555  YAWKKWKDGAALELLDITLRDSYSRDEVRRCIHVGLSCVQEDPVERPSMQTIVLLLSSQS  614

Query  182  ATRRAPNPPATF----SDEMTISAG--QEADQSTNKSPPLS-SVNEVSISDLYPR  325
             T  AP  PA +    SD+ +      + +D+ST K+  ++ SV+E SI+ +YPR
Sbjct  615  VTLEAPKQPAGYINSKSDQQSYPTREFENSDKSTTKTQSVTASVDEESITHVYPR  669



>ref|XP_007011084.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 25, putative 
[Theobroma cacao]
 gb|EOY19894.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 25, putative 
[Theobroma cacao]
Length=655

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 73/116 (63%), Gaps = 9/116 (8%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+WRE TT++++D SL  + S+ E+ +CIH+ LLCVQENV +RPTMA+V +ML+S+S
Sbjct  541  YAWKNWREGTTLNLIDPSLK-VSSKAEITRCIHIALLCVQENVVDRPTMASVAIMLNSYS  599

Query  182  ATRRAPNPPATFSDEM--------TISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA F            ++   +  D S N      S NE SI++LYPR
Sbjct  600  VTLPVPSHPAFFMHSTIESNLSSSSVYTSRVTDHSLNDEILPLSKNETSITELYPR  655



>ref|XP_007157183.1| hypothetical protein PHAVU_002G049400g [Phaseolus vulgaris]
 gb|ESW29177.1| hypothetical protein PHAVU_002G049400g [Phaseolus vulgaris]
Length=827

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 51/111 (46%), Positives = 73/111 (66%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW  W++ T ++++D  L   Y+  ++I+ IH+GLLCVQE+ + RPTMA +VLML S+S
Sbjct  718  YAWLLWKDGTPLELMDPMLRESYNEIKIIRSIHIGLLCVQEDPEYRPTMATIVLMLASNS  777

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F     + T+  GQ+ DQS  KS  L S+N+VSIS++ PR
Sbjct  778  VTLPTPKRPAFFIHSGTDATMPKGQQFDQSMTKS-LLMSINDVSISEMDPR  827



>ref|XP_006606898.1| PREDICTED: cysteine-rich receptor-like protein kinase 26-like 
[Glycine max]
Length=657

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 78/123 (63%), Gaps = 21/123 (17%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++WR+ TT D++D +L    SRNE+++CIH+GLLC QENV  RPTMA+VVLML+S+S
Sbjct  541  FAWRNWRDGTTTDIIDPTLND-GSRNEIMRCIHIGLLCAQENVTARPTMASVVLMLNSYS  599

Query  182  ATRRAPNPPATFSD-------EMTIS--------AGQEADQSTNKSPPLSSVNEVSISDL  316
             T   P+  A   D       +M +S        + + A +ST K     S+NE SI++L
Sbjct  600  LTLPLPSETAFVLDSNIRSFPDMLLSEHNSRETRSSETAIKSTQK-----SINEASITEL  654

Query  317  YPR  325
            YPR
Sbjct  655  YPR  657



>gb|KCW74344.1| hypothetical protein EUGRSUZ_E03020 [Eucalyptus grandis]
Length=658

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 73/114 (64%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR++   +++D  LG  YSR++ ++CIH+G LCVQE+  +RPTMA++VL L S +
Sbjct  546  YAWKHWRDNVPSEILDPVLGESYSRSQELRCIHIGFLCVQEDPADRPTMASIVLALSSQT  605

Query  182  ATRRAPNPPATFSDEMT------ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F    T      I+  Q  DQ+T+ S PL SVN VSI++L  R
Sbjct  606  LSLLVPREPAFFLRSWTEPPKNIIANDQGHDQNTSGSTPL-SVNGVSITELSAR  658



>emb|CDP11357.1| unnamed protein product [Coffea canephora]
Length=190

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 68/111 (61%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WKHWR    + ++D S+G  ++ NEVIQCI +GLLCV+E V +RPT+A+VV ML+S S
Sbjct  80   YVWKHWRRGEPLALLDSSIGDSFAENEVIQCIQLGLLCVEEYVSKRPTVASVVNMLNSSS  139

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F     E  +   +    +T +    SSVNE +I++ YPR
Sbjct  140  VTLPTPRRPAVFRFHETESMVEEVEVEQSNTERISIPSSVNEATITEPYPR  190



>gb|KCW74330.1| hypothetical protein EUGRSUZ_E029981, partial [Eucalyptus grandis]
Length=377

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 71/109 (65%), Gaps = 3/109 (3%)
 Frame = +2

Query  5    AWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
            AWKHWR  T ++++D   G  YS +EV++C+H+GLL VQE+  +RPTMA +VLM  SHS 
Sbjct  270  AWKHWRAGTLLEVLDAFTGDSYSIDEVLRCLHIGLLGVQEDPADRPTMARIVLMFSSHSV  329

Query  185  TRRAPNPPATFSDEMTISAGQE--ADQSTNKSPPLSSVNEVSISDLYPR  325
                P  P  F    T    +E  +D+ST+ S P  S+NE+S+S+++PR
Sbjct  330  KLPQPRRPTFFLQRSTERQLKELKSDESTSGSMPW-SINEMSVSEVHPR  377



>ref|XP_008370580.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10 [Malus domestica]
Length=661

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+ T +++++  L   YSR EVI+CIH+GLLCVQEN  +RPTM +V+LM++S S
Sbjct  552  HAWKLWRDGTPLELLNPCLRDSYSRTEVIRCIHIGLLCVQENPADRPTMQSVILMINSDS  611

Query  182  ATRRAPNPPATFSDEMTISAGQEA----DQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F     +    EA     QS NKS   S V E SI+++YPR
Sbjct  612  VTLPLPQQPAFFFRSRAVGNMSEATLDSTQSINKSS--SYVYEGSITEVYPR  661



>ref|XP_010647640.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 [Vitis 
vinifera]
 emb|CBI33306.3| unnamed protein product [Vitis vinifera]
Length=120

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 73/115 (63%), Gaps = 8/115 (7%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW+ WRE +  +++D S+    SR+ +++CIH+GLLCVQENV +RPTMA++VLML S+S
Sbjct  7    FAWRSWREGSASNLIDPSMNS-GSRSGIMRCIHIGLLCVQENVADRPTMASIVLMLSSYS  65

Query  182  ATRRAPNPPATF-----SDEMTISAGQEAD--QSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ P  F     + E  +  G ++    ++N      SVNE SI++L PR
Sbjct  66   LTLPLPSQPGFFMHSSTNPETPLLQGSDSGVINASNNVSARVSVNETSITELRPR  120



>ref|XP_006383964.1| hypothetical protein POPTR_0004s02520g [Populus trichocarpa]
 gb|ERP61761.1| hypothetical protein POPTR_0004s02520g [Populus trichocarpa]
Length=111

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  32   TVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSATRRAPNPPA  211
            +++ +D SLG  YSRNE+ +C+H+ LLCVQE+  +RPT+  +VLML S S T   P  PA
Sbjct  11   SLEQMDASLGHSYSRNEIARCLHIALLCVQEDPKKRPTLTTIVLMLTSFSVTLPLPRKPA  70

Query  212  TFSDEMTISA----GQEADQSTNKSPPLSSVNEVSISDLYPR  325
                  T S+    G E+D+ST+ S PL SVN++SI++LYPR
Sbjct  71   YCVQSRTGSSLPIIGLESDRSTSTSKPL-SVNDMSITELYPR  111



>ref|XP_010089690.1| Cysteine-rich receptor-like protein kinase 10 [Morus notabilis]
 gb|EXB38213.1| Cysteine-rich receptor-like protein kinase 10 [Morus notabilis]
Length=367

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 76/115 (66%), Gaps = 7/115 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW++WRE T +++ D  +  + S +E+ +CIH+ LLCVQ NV +RPTM  VVLML+S+S
Sbjct  253  YAWRNWREGTALNVADPLMRQISSGSEITRCIHIALLCVQVNVADRPTMNTVVLMLNSNS  312

Query  182  ATRRAPNPPATF-----SDEMTISA--GQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P+ PA F     + +M++++     +D S ++S   +SVNE SI++ YPR
Sbjct  313  LSLPVPSEPAFFMHSRIASDMSLASDLNSRSDHSKSESGNQASVNEASITEFYPR  367



>ref|XP_010059142.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Eucalyptus grandis]
Length=706

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 73/114 (64%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHWR++   +++D  LG  YSR++ ++CIH+G LCVQE+  +RPTMA++VL L S +
Sbjct  594  YAWKHWRDNVPSEILDPVLGESYSRSQELRCIHIGFLCVQEDPADRPTMASIVLALSSQT  653

Query  182  ATRRAPNPPATFSDEMT------ISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F    T      I+  Q  DQ+T+ S PL SVN VSI++L  R
Sbjct  654  LSLLVPREPAFFLRSWTEPPKNIIANDQGHDQNTSGSTPL-SVNGVSITELSAR  706



>ref|XP_007025949.1| Cysteine-rich RLK 25 [Theobroma cacao]
 gb|EOY28571.1| Cysteine-rich RLK 25 [Theobroma cacao]
Length=558

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 5/111 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+HW+  T ++++D +L   Y+ NEV +CI +GLLCVQE+ D RPTMA VVLML S S
Sbjct  450  YVWRHWKNGTPIELMDSTLQDSYASNEVRRCIQIGLLCVQEDPDTRPTMARVVLMLSSSS  509

Query  182  ATRRAPNPPATFSDEMTISAGQEADQS---TNKSPPLSSVNEVSISDLYPR  325
             T  AP   A F    T +  Q ++Q    +  +   ++VNE SI++L+PR
Sbjct  510  VTLPAPQKTAFFFG--TTTGRQFSEQKSDPSKSTSSSATVNEASITELFPR  558



>ref|XP_011002064.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X3 [Populus euphratica]
Length=633

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 7/111 (6%)
 Frame = +2

Query  8    WKHWREDTTVD-MVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
            W++W     +D ++D +L    SRNE+++CIHVGLLCVQEN  +RP MA+VV+ML S+S 
Sbjct  525  WENWNSGPNLDKLIDSTLRA-GSRNEMLRCIHVGLLCVQENALDRPNMASVVIMLSSYSV  583

Query  185  TRRAPNPPATF--SDEM--TISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            T   P  PA F  S EM  T S   E+DQS + S P  S+NE SI++LYPR
Sbjct  584  TLPVPQKPAFFAHSTEMPGTTSTWTESDQSRSASVP-CSINEASITELYPR  633



>ref|XP_010247616.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Nelumbo 
nucifera]
Length=676

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 47/104 (45%), Positives = 70/104 (67%), Gaps = 9/104 (9%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW++W E T ++++D  L   YSR+EV++CIH+GLLCVQE+V +RPTMA VVLML+S+S
Sbjct  566  YAWRNWNEGTALELLDPILTEHYSRDEVMRCIHIGLLCVQEDVADRPTMATVVLMLNSYS  625

Query  182  ATRRAPNPPATFSDEMTISA---------GQEADQSTNKSPPLS  286
             T   P  PA+F     +S+           ++D+ST+++  LS
Sbjct  626  VTLELPLRPASFGHSKMVSSMATSETERQATDSDKSTSQNIGLS  669



>ref|XP_010439209.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Camelina sativa]
Length=666

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/108 (39%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+ W   T  ++VD ++   + RNEV++C+H+GLLCVQE+  ERPT++++V+ML S++
Sbjct  559  YAWRLWSNGTPSELVDPAIADSFQRNEVVRCVHIGLLCVQEDPAERPTLSSIVMMLTSNT  618

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  P  F          + DQ +     + SV++ +I+DLYPR
Sbjct  619  VTLPVPRQPGLFFQSRIGKDPLDTDQFSTTRSLIGSVDDATITDLYPR  666



>gb|KCW74376.1| hypothetical protein EUGRSUZ_E030551, partial [Eucalyptus grandis]
Length=298

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 75/118 (64%), Gaps = 12/118 (10%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WK+WRE T  +++D  +    S  E+++C+H+GLLCVQENV  RPTMA+++LML+SHS
Sbjct  183  YVWKNWREGTISNIIDPCITSNLS-TEIVRCVHIGLLCVQENVVNRPTMASILLMLNSHS  241

Query  182  ATRRAPNPPATF---SDEMTISAGQ-------EADQSTNKSPPLSSVNEVSISDLYPR  325
             T + P+ PA F    +E  +S+ Q       E D+S NKS   S   E S+++ YPR
Sbjct  242  VTLQVPSQPAFFLHSGNESDMSSTQDYSSRVPEVDKSRNKSNQ-SLKKEASMTEPYPR  298



>gb|KHN15831.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=1343

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 51/108 (47%), Positives = 71/108 (66%), Gaps = 3/108 (3%)
 Frame = +2

Query  2     YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
             + W++WR++T + +VD++L   YSRNE+++CIH+GLLCVQEN+  RPTMA VV M  S+S
Sbjct  1239  FVWRNWRKETALSIVDQTLSN-YSRNEIMRCIHIGLLCVQENLVNRPTMATVVNMFSSNS  1297

Query  182   ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
              T   P+ PA +S      +    D+S N     SS NE SIS+L PR
Sbjct  1298  LTLPVPSQPA-YSMNARDPSDTRLDESRNNCMQASS-NEASISELDPR  1343


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 51/115 (44%), Positives = 71/115 (62%), Gaps = 9/115 (8%)
 Frame = +2

Query  5    AWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHSA  184
            AW + R+ TT +++D +L   + R+E+++CI++GLLCVQE V +RPTMA+VVLML SHS 
Sbjct  565  AWTNLRKGTTTNIIDPTLNNAF-RDEIVRCIYIGLLCVQEKVADRPTMASVVLMLESHSF  623

Query  185  TRRAPNPPATFSDEMTISAGQ-----EADQSTNKSPPLS---SVNEVSISDLYPR  325
                P  PA F +   +S  Q      A+  +N+    S   S NE SIS LYPR
Sbjct  624  ALPVPLQPAYFMNNSCLSDIQFLGCSSAETGSNEQRSNSADVSANEASISSLYPR  678



>ref|XP_003635675.2| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=363

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 79/117 (68%), Gaps = 10/117 (9%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK+WRE TT +++D ++  + S +E+++CIH+GLLCVQEN  +RPTMA++VLML+S+S
Sbjct  248  YAWKNWREGTTTNLIDSTMR-ISSISEIMRCIHIGLLCVQENEADRPTMASIVLMLNSYS  306

Query  182  ATRRAPNPPATFSD-----EMTISAGQEADQS-TNKSPPLS---SVNEVSISDLYPR  325
             +   P+ PA F +     +M++     +  + +N  P  S   SVNE SI+D YPR
Sbjct  307  LSLPVPSHPAFFMNTSMNRDMSLELEDNSRVAQSNYLPSRSSHFSVNEASITDPYPR  363



>ref|XP_009357379.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=669

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AWK WR+   ++++D  L   YSR EVI+CIH+GLLCVQE+  +RPTM ++VLML+S+S
Sbjct  560  HAWKLWRDGAPLELLDPCLRDSYSRTEVIRCIHIGLLCVQEDPADRPTMQSIVLMLNSYS  619

Query  182  ATRRAPNPPATF--SDEM--TISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA F  S  M   + A  ++ QS +KS P  SV E SI+++YPR
Sbjct  620  VSLPLPQRPAFFLQSRAMGNMLEATLDSTQSISKSSP--SVYEGSITEVYPR  669



>ref|XP_007143180.1| hypothetical protein PHAVU_007G050200g [Phaseolus vulgaris]
 gb|ESW15174.1| hypothetical protein PHAVU_007G050200g [Phaseolus vulgaris]
Length=657

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 69/108 (64%), Gaps = 8/108 (7%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+ WR+ T  ++VD ++ G  S NE+++CIH+ LLCVQE  D+RPTMA+V LML+SHS
Sbjct  558  YTWQTWRKRTMSNIVDPTISG--SSNEIMRCIHIALLCVQEKGDDRPTMASVALMLNSHS  615

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA   D  ++S  Q      +  P + SVNE SI++ + R
Sbjct  616  VTLPLPSKPAFSIDSTSLSVIQ------SNEPNIQSVNEASITEPFAR  657



>ref|XP_007143159.1| hypothetical protein PHAVU_007G048800g [Phaseolus vulgaris]
 gb|ESW15153.1| hypothetical protein PHAVU_007G048800g [Phaseolus vulgaris]
Length=670

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 51/118 (43%), Positives = 72/118 (61%), Gaps = 11/118 (9%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW+ W+E   +++VD SL    SRNE+++CIH+GLLCVQEN+ +RPTMAN+VLML+S+S
Sbjct  554  FAWRSWKEGKAINVVDPSLNN-NSRNEMLRCIHIGLLCVQENLVDRPTMANIVLMLNSYS  612

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLS----------SVNEVSISDLYPR  325
             +   P  PA + +  T S  +      N     S          S NE SI++LYPR
Sbjct  613  LSLPIPAEPAFYMNSRTRSLPETQSWEYNSRETGSSEAILKSAQESENEASITELYPR  670



>emb|CBI33308.3| unnamed protein product [Vitis vinifera]
Length=152

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW+ WR+ +  +++D S+    SR+E+++C+H+GLLCVQENV +RPTMA+VVLML S+S
Sbjct  42   FAWRSWRDGSASNLIDPSVSS-GSRSEIMRCMHIGLLCVQENVADRPTMASVVLMLSSYS  100

Query  182  ATRRAPN-PPATFSDEMTISAG--QEADQ-STNKSPPLSSVNEVSISDLYPR  325
             T   P+ PP      M   A   Q++D  +T  S    SVN+ SIS+L+PR
Sbjct  101  ITLPLPSQPPFFMHSSMDTEAPLLQDSDSGATRSSDNALSVNDASISELHPR  152



>gb|ADQ37376.1| unknown [Arabidopsis lyrata]
Length=683

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 72/108 (67%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            + W+ WREDT + ++D SL    SR+E+++CIH+GLLCVQE+   RPTM +V LML+S S
Sbjct  582  WVWRCWREDTILSVIDPSLT-TGSRSEILRCIHIGLLCVQESAASRPTMDSVALMLNSSS  640

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA       + +G  ++ S++  P L S+N+V++S+L PR
Sbjct  641  YTLPTPSRPA-----FVLESGMPSNVSSSIEPLLMSLNDVTVSELSPR  683



>gb|ADQ37353.1| unknown [Arabidopsis lyrata]
Length=644

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 72/108 (67%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            + W+ WREDT + ++D SL    SR+E+++CIH+GLLCVQE+   RPTM +V LML+S+S
Sbjct  543  WVWRCWREDTILSVIDPSLT-TGSRSEILRCIHIGLLCVQESAASRPTMDSVALMLNSYS  601

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA  S+ +  S       S++  P L S+N+V++S+L PR
Sbjct  602  YTLSTPSRPAFVSESVMPSI-----VSSSTEPLLMSLNDVTVSELSPR  644



>ref|XP_010661211.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
Length=655

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 67/108 (62%), Gaps = 4/108 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+HW E   VD+VD  LG    RNE+I+C+H+GLLCVQE+V  RPTMA +V ML+S+ 
Sbjct  552  YAWRHWNEGRVVDIVDPILG-TNLRNEIIRCLHIGLLCVQESVANRPTMALIVSMLNSYY  610

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
                +P+ P       T  AG  +    +      +VNEVSI+DLYPR
Sbjct  611  LPLPSPSRPGFLLQSSTQIAGHSSQMRISTQ---FTVNEVSITDLYPR  655



>ref|XP_010647173.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
Length=657

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 70/108 (65%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W E+  +++VD +LG ++  NEV++CIH+GLLCVQE+  +RPTM++V  ML+S+S
Sbjct  556  YAWKLWTENRPLELVDSALGNMFPSNEVLKCIHIGLLCVQEDAADRPTMSSVAFMLNSYS  615

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            +T   P PP    +  +    +E   S  +S    SVNE+  S++ PR
Sbjct  616  STLDHPAPPPLVGENRS----KELHWSATRSQ--YSVNELDASEIEPR  657



>ref|XP_010087724.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
 gb|EXB29712.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
Length=1110

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 73/106 (69%), Gaps = 5/106 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW HW+E T ++++D +L   + RNEV++CIH+GLLCVQEN   RPTMA +VLML+S+S
Sbjct  552  FAWGHWKEGTPLELLDPTLRHSFPRNEVMRCIHMGLLCVQENPALRPTMATIVLMLNSYS  611

Query  182  ATRRAPNPPATF-SDEMTISAG---QEADQSTNKSPPLSSVNEVSI  307
             T  AP  PA F  + M  SA     E+D+ T+KS  L SVN+ S+
Sbjct  612  VTLPAPQQPAFFHRNRMQSSAAAKDHESDRFTSKSISL-SVNDGSM  656



>gb|AID21688.1| At4g21400p-like protein [Arabidopsis lyrata]
Length=670

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 72/108 (67%), Gaps = 6/108 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            + W+ WREDT + ++D SL    SR+E+++CIH+GLLCVQE+   RPTM +V LML+S+S
Sbjct  569  WVWRCWREDTILSVIDPSLT-TGSRSEILRCIHIGLLCVQESAASRPTMDSVALMLNSYS  627

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA  S+ +  S       S++  P L S+N+V++S+L PR
Sbjct  628  YTLSTPSRPAFVSESVMPSI-----VSSSTEPLLMSLNDVTVSELSPR  670



>ref|XP_010923985.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X2 [Elaeis guineensis]
Length=644

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 13/121 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHW     + ++DR+LG  Y R E  +CIH+GLLCVQE+  +RP+M  VVLML SHS
Sbjct  524  YAWKHWNTGRALHLMDRNLGDQYDRQEASRCIHMGLLCVQEDQTKRPSMELVVLMLSSHS  583

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLS-------------SVNEVSISDLYP  322
             T   P+ PA F           A ++ N +PP S             S+N+V+IS++ P
Sbjct  584  LTVSTPSVPAFFVQGSATPEPDLASRNRNSNPPESGNSYQYEEKSNSASINDVTISEMEP  643

Query  323  R  325
            R
Sbjct  644  R  644



>ref|XP_006602739.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
23-like isoform X1 [Glycine max]
Length=916

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 69/111 (62%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            + W+HW+++T ++ +D  L   YS  EVI+CI +GLLCVQEN D RPTM  +V  L SHS
Sbjct  807  FVWRHWKDETPLNTLDPKLRDNYSNIEVIKCIRIGLLCVQENPDARPTMLTIVSYLSSHS  866

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
                +P  P  F     + T++    + QSTN S P SS+NE+SIS  YPR
Sbjct  867  IELPSPQEPTFFLYHRMDPTVAHESSSRQSTNNSIP-SSINEMSISKFYPR  916



>ref|XP_008355945.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 [Malus 
domestica]
Length=673

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 79/124 (64%), Gaps = 21/124 (17%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSL-GGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSH  178
            YAWK WRE T  +++D +L  G  SRNE+++CIH+GLLCVQEN+ +RPTM  +VLML+S+
Sbjct  555  YAWKCWREGTASNLIDPALING--SRNEIMRCIHIGLLCVQENIADRPTMNAIVLMLNSY  612

Query  179  SATRRAPNPPATFSD-----EMT---------ISAGQEADQSTNKSPPLSSVNEVS-ISD  313
            S T   P+ PA F D     +MT         I+ G +  +S++   P    NEVS I++
Sbjct  613  SVTLPVPSQPAFFRDSNVGSDMTSGWKNSSEVITTGSDRSKSSSVKAP---ENEVSLITE  669

Query  314  LYPR  325
            +YPR
Sbjct  670  VYPR  673



>ref|XP_010923983.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Elaeis guineensis]
Length=683

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 13/121 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWKHW     + ++DR+LG  Y R E  +CIH+GLLCVQE+  +RP+M  VVLML SHS
Sbjct  563  YAWKHWNTGRALHLMDRNLGDQYDRQEASRCIHMGLLCVQEDQTKRPSMELVVLMLSSHS  622

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLS-------------SVNEVSISDLYP  322
             T   P+ PA F           A ++ N +PP S             S+N+V+IS++ P
Sbjct  623  LTVSTPSVPAFFVQGSATPEPDLASRNRNSNPPESGNSYQYEEKSNSASINDVTISEMEP  682

Query  323  R  325
            R
Sbjct  683  R  683



>ref|XP_007143160.1| hypothetical protein PHAVU_007G048900g [Phaseolus vulgaris]
 gb|ESW15154.1| hypothetical protein PHAVU_007G048900g [Phaseolus vulgaris]
Length=671

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 76/119 (64%), Gaps = 13/119 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW++W+E   + +VD SL    SRNE+++CIH+GLLCVQEN+ +RPTMAN+VLML+S+S
Sbjct  555  FAWRNWKEGKAIYIVDPSLNS-NSRNEMLRCIHIGLLCVQENLVDRPTMANIVLMLNSYS  613

Query  182  ATRRAPNPPATFSDEMTISAGQ-----------EADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P  PA + + +T S  +            + +S  KS    S NE SI++LYPR
Sbjct  614  LSLPIPAEPAFYMNSITRSLPEMQSWDYNSRETRSSESIRKSAQ-ESENEASITELYPR  671



>ref|XP_010247618.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010247619.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Nelumbo nucifera]
Length=676

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 61/120 (51%), Positives = 79/120 (66%), Gaps = 14/120 (12%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+HW E T +++VD +LG  YSR EV++CI +GLLCVQE+V  RPTMA+VVLML S S
Sbjct  559  YAWRHWTEGTAINLVDPALGDGYSREEVLRCIQIGLLCVQEHVTNRPTMASVVLMLSSSS  618

Query  182  ATRRAPNPPATFSDEMTI------------SAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
            AT    + P TFS    +            S+  E+ QST++S PL SVNE SI++L PR
Sbjct  619  ATLNPLSSP-TFSVPSRMKPYNYRPPRGYDSSTSESRQSTSESKPL-SVNEASITELSPR  676



>ref|XP_010661208.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
Length=642

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 67/108 (62%), Gaps = 4/108 (4%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+HW E   VD+VD  LG    RNE+I+C+H+GLLCVQE+V  RPTMA +V ML+S+ 
Sbjct  539  YAWRHWNEGRVVDIVDPILG-TNLRNEIIRCLHIGLLCVQESVANRPTMALIVSMLNSYY  597

Query  182  ATRRAPNPPATFSDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
                +P+ P       T  AG  +    +      +VNEVSI+DLYPR
Sbjct  598  LPLPSPSRPGFLMQSSTQIAGHSSQMRISTH---FTVNEVSITDLYPR  642



>ref|XP_004496856.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Cicer arietinum]
Length=666

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 46/110 (42%), Positives = 68/110 (62%), Gaps = 3/110 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAW+ WRE    +++D SL    S NE+++CIH+ LLC+QEN+ +RPTMA + LML S+S
Sbjct  558  YAWRRWREGRGTNIIDESLIN-SSENEIMRCIHIALLCIQENIVDRPTMATIALMLSSYS  616

Query  182  ATRRAPNPPATF--SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA F  S   ++S  +    +   +    S+N+ SI+D YPR
Sbjct  617  LTLSIPSKPAYFTGSGSRSLSDTRSGAHNLRATRSTESINQASITDPYPR  666



>ref|XP_007025943.1| Cysteine-rich protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007025944.1| Cysteine-rich protein, putative isoform 1 [Theobroma cacao]
 gb|EOY28565.1| Cysteine-rich protein, putative isoform 1 [Theobroma cacao]
 gb|EOY28566.1| Cysteine-rich protein, putative isoform 1 [Theobroma cacao]
Length=672

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 51/111 (46%), Positives = 70/111 (63%), Gaps = 6/111 (5%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y+WK W +   ++++D  L   YS +EVI+C+ +GLLCVQE+  +RPTM  +VLML+S  
Sbjct  565  YSWKLWSDGAALELLDPLLRESYSEDEVIRCMQIGLLCVQEDPAKRPTMTTIVLMLNSQI  624

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T  AP  PA+F    DE +I   +   QS   S P SS+NE SIS+ YPR
Sbjct  625  LTLEAPQRPASFFRYKDETSIPTNE--GQSPLLSMP-SSINETSISETYPR  672



>ref|XP_008377957.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor-like protein 
kinase At4g00960 [Malus domestica]
Length=610

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 76/124 (61%), Gaps = 21/124 (17%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            YAWK W+E T  +++D +L    SRNE+++CIH+GLLCVQEN+ +RPTM  +VLML+S+S
Sbjct  492  YAWKCWKEGTASNLIDPALTN-GSRNEIMRCIHIGLLCVQENIPDRPTMNAIVLMLNSYS  550

Query  182  ATRRAPNPPATFSD---------------EMTISAGQEADQSTNKSPPLSSVNEVS-ISD  313
             T   P+ PA F D               E+  +    ++ ++ K+P     NEVS I++
Sbjct  551  VTLPVPSQPAFFRDSNVGSDMTLGWKNSSEVITTGSDRSNGNSVKAPE----NEVSLITE  606

Query  314  LYPR  325
            +YPR
Sbjct  607  VYPR  610



>ref|XP_010448757.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Camelina sativa]
Length=653

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 69/109 (63%), Gaps = 2/109 (2%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+ WR  T +D+VD  +      +EV++CIH+GLLCVQE+  +RPT+  +VLML S++
Sbjct  546  YTWRLWRNGTPLDLVDPVIVHNCKMDEVVRCIHIGLLCVQEDPVDRPTLPAIVLMLTSNT  605

Query  182  ATRRAPNPPATFSDEMTISAGQEADQST-NKSPPLSSVNEVSISDLYPR  325
             T  AP  P  F          +++QST +KS P  SVN+ SI+DLYPR
Sbjct  606  VTLSAPKEPGLFFQSKPTKDPLDSEQSTISKSVPW-SVNDASITDLYPR  653



>ref|XP_010448756.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Camelina sativa]
Length=654

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 49/109 (45%), Positives = 69/109 (63%), Gaps = 2/109 (2%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y W+ WR  T +D+VD  +      +EV++CIH+GLLCVQE+  +RPT+  +VLML S++
Sbjct  547  YTWRLWRNGTPLDLVDPVIVHNCKMDEVVRCIHIGLLCVQEDPVDRPTLPAIVLMLTSNT  606

Query  182  ATRRAPNPPATFSDEMTISAGQEADQST-NKSPPLSSVNEVSISDLYPR  325
             T  AP  P  F          +++QST +KS P  SVN+ SI+DLYPR
Sbjct  607  VTLSAPKEPGLFFQSKPTKDPLDSEQSTISKSVPW-SVNDASITDLYPR  654



>emb|CDP19430.1| unnamed protein product [Coffea canephora]
Length=415

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 69/111 (62%), Gaps = 3/111 (3%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            Y WKHWR   ++ ++D S+G  ++ NEVIQCI +GLLCV+E V +RPT+A+VV ML+S S
Sbjct  301  YVWKHWRRGESLALLDSSIGDSFAENEVIQCIQLGLLCVEEYVSKRPTVASVVNMLNSSS  360

Query  182  ATRRAPNPPATF---SDEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P  PA F     E  +   +    +T +    SSVNE +I++ YPR
Sbjct  361  VTLPTPRRPAVFRCHETESMVEEVEVEQSNTERISIPSSVNEATITEPYPR  411



>ref|XP_003638006.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|KEH43965.1| receptor-like kinase [Medicago truncatula]
Length=362

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 70/115 (61%), Gaps = 13/115 (11%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            +AW+ WRE    +M+D +L  + S NE+++CIH+GLLCVQENV +RPTMA V LML+S+S
Sbjct  254  FAWRSWREGKAQNMIDAALNNI-SANEIMRCIHIGLLCVQENVVDRPTMATVALMLNSYS  312

Query  182  ATRRAPNPPATFS-------DEMTISAGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             T   P+ PA F         +M + AG     ++ +     SVN  S +D YPR
Sbjct  313  LTLSIPSKPAYFYGSGTRSLQDMELWAGNIGSTTSGE-----SVNHASNTDPYPR  362



>ref|XP_006606897.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=667

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 72/114 (63%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    YAWKHWREDTTVDMVDRSLGGLYSRNEVIQCIHVGLLCVQENVDERPTMANVVLMLHSHS  181
            + W++WRE T  ++VD +L    SRNE+++CIH+GLLCVQEN   RPTM +VVLML+S+S
Sbjct  555  FVWRNWREGTATNIVDPTLND-GSRNEIMRCIHIGLLCVQENDAGRPTMTSVVLMLNSYS  613

Query  182  ATRRAPNPPATFSDEMTIS------AGQEADQSTNKSPPLSSVNEVSISDLYPR  325
             +   P+ PA   D  T S          + Q+ +     +SVNE SI++LYPR
Sbjct  614  LSLPVPSEPAFVVDSRTRSLPSSELTEHNSSQTRSSESTQNSVNEASITELYPR  667



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509219560224