BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19269_g1_i1 len=938 path=[1687:0-505 2193:506-937]

Length=938
                                                                      Score     E

gb|KDO76309.1|  hypothetical protein CISIN_1g005058mg                   163   7e-42   
gb|KDO76305.1|  hypothetical protein CISIN_1g005058mg                   163   7e-42   
ref|XP_006439494.1|  hypothetical protein CICLE_v10019130mg             163   8e-42   
ref|XP_009800804.1|  PREDICTED: homeobox protein BEL1 homolog           163   8e-42   
ref|XP_006476516.1|  PREDICTED: homeobox protein BEL1 homolog           163   8e-42   
gb|KDO76303.1|  hypothetical protein CISIN_1g005058mg                   163   1e-41   
ref|XP_002279230.2|  PREDICTED: homeobox protein BEL1 homolog           162   2e-41   Vitis vinifera
ref|XP_009604673.1|  PREDICTED: homeobox protein BEL1 homolog           160   5e-41   
gb|KHN25686.1|  Homeobox protein BEL1 like                              158   8e-41   
ref|XP_003517476.1|  PREDICTED: homeobox protein BEL1 homolog iso...    158   4e-40   
ref|XP_003538310.1|  PREDICTED: homeobox protein BEL1 homolog iso...    157   7e-40   
gb|KHN35035.1|  Homeobox protein BEL1 like                              157   7e-40   
ref|XP_002299516.2|  hypothetical protein POPTR_0001s09720g             156   1e-39   Populus trichocarpa [western balsam poplar]
gb|KDP25399.1|  hypothetical protein JCGZ_20555                         156   2e-39   
ref|XP_011029331.1|  PREDICTED: homeobox protein BEL1 homolog           154   7e-39   
ref|XP_006385769.1|  hypothetical protein POPTR_0003s13120g             152   5e-38   
ref|XP_007040322.1|  POX family protein isoform 1                       151   9e-38   
ref|XP_007158519.1|  hypothetical protein PHAVU_002G159000g             151   9e-38   
ref|XP_011022632.1|  PREDICTED: homeobox protein BEL1 homolog           150   2e-37   
ref|XP_002509843.1|  bel1 homeotic protein, putative                    147   5e-36   Ricinus communis
ref|XP_008238940.1|  PREDICTED: homeobox protein BEL1 homolog           144   6e-35   
ref|XP_007210325.1|  hypothetical protein PRUPE_ppa002081mg             144   9e-35   
ref|XP_010053224.1|  PREDICTED: homeobox protein BEL1 homolog           140   2e-33   
ref|XP_009363416.1|  PREDICTED: homeobox protein BEL1 homolog           138   8e-33   
ref|XP_009363409.1|  PREDICTED: homeobox protein BEL1 homolog           138   8e-33   
ref|XP_008373620.1|  PREDICTED: homeobox protein BEL1 homolog           135   1e-31   
ref|XP_011073138.1|  PREDICTED: homeobox protein BEL1 homolog           130   1e-30   
ref|XP_010275694.1|  PREDICTED: homeobox protein BEL1 homolog           125   2e-28   
ref|XP_004143976.1|  PREDICTED: homeobox protein BEL1 homolog           122   1e-27   
ref|XP_010089065.1|  Homeobox protein BEL1-like protein                 122   2e-27   
gb|KGN50071.1|  hypothetical protein Csa_5G152860                       122   2e-27   
ref|XP_008437318.1|  PREDICTED: LOW QUALITY PROTEIN: homeobox pro...    117   9e-26   
gb|KHN16798.1|  Homeobox protein BEL1 like                              114   2e-25   
ref|XP_010255251.1|  PREDICTED: homeobox protein BEL1 homolog           114   1e-24   
ref|XP_006580557.1|  PREDICTED: homeobox protein BEL1 homolog iso...    114   1e-24   
ref|XP_003532909.1|  PREDICTED: homeobox protein BEL1 homolog iso...    114   1e-24   
ref|XP_008807227.1|  PREDICTED: homeobox protein BEL1 homolog           110   1e-23   
gb|KEH21114.1|  BEL1-related homeotic protein                           107   3e-22   
ref|XP_010933991.1|  PREDICTED: homeobox protein BEL1 homolog           101   2e-20   
ref|XP_006343945.1|  PREDICTED: homeobox protein BEL1 homolog           101   2e-20   
gb|ACD39462.1|  BEL14 protein                                         97.8    2e-19   Solanum etuberosum
gb|ACD39465.1|  BEL14 protein                                         95.9    1e-18   Solanum palustre
gb|AAN03624.1|AF406700_1  BEL1-related homeotic protein 14            95.9    1e-18   Solanum tuberosum [potatoes]
ref|XP_004503684.1|  PREDICTED: homeobox protein BEL1 homolog         95.1    3e-18   
ref|XP_004298825.1|  PREDICTED: homeobox protein BEL1 homolog         89.7    2e-16   
ref|XP_011080922.1|  PREDICTED: homeobox protein BEL1 homolog         89.0    3e-16   
gb|ACU01963.1|  bell1-like protein                                    85.1    2e-15   Comandra umbellata [bastard toadflax]
ref|NP_001266274.1|  bell-like homeodomain protein 3                  86.3    2e-15   
ref|XP_010325299.1|  PREDICTED: bell-like homeodomain protein 3 i...  86.3    3e-15   
gb|AAP47023.1|AF375964_1  bell-like homeodomain protein 3             83.2    2e-14   Solanum lycopersicum
emb|CBI34373.3|  unnamed protein product                              80.9    1e-13   
gb|EYU23458.1|  hypothetical protein MIMGU_mgv1a002357mg              78.2    1e-12   
ref|XP_007160096.1|  hypothetical protein PHAVU_002G292000g           77.0    2e-12   
ref|XP_008783445.1|  PREDICTED: homeobox protein BEL1 homolog         72.0    1e-10   
ref|XP_010919091.1|  PREDICTED: homeobox protein BEL1 homolog         71.2    2e-10   
ref|XP_010934930.1|  PREDICTED: homeobox protein BEL1 homolog         68.9    1e-09   
gb|EPS58139.1|  hypothetical protein M569_16677                       67.8    2e-09   
ref|XP_009384235.1|  PREDICTED: homeobox protein BEL1 homolog         67.4    4e-09   
ref|XP_007208166.1|  hypothetical protein PRUPE_ppa002583mg           67.4    4e-09   
ref|XP_008230296.1|  PREDICTED: BEL1-like homeodomain protein 1       67.4    4e-09   
gb|KHG11905.1|  BEL1-like homeodomain protein 1                       67.0    5e-09   
gb|KHG11906.1|  BEL1-like homeodomain protein 1                       67.0    6e-09   
ref|XP_009396189.1|  PREDICTED: homeobox protein BEL1 homolog         66.2    9e-09   
ref|XP_008794767.1|  PREDICTED: homeobox protein BEL1 homolog         66.2    9e-09   
ref|XP_010676435.1|  PREDICTED: homeobox protein BEL1 homolog         65.5    2e-08   
ref|XP_011042587.1|  PREDICTED: BEL1-like homeodomain protein 1       65.5    2e-08   
ref|XP_006373820.1|  hypothetical protein POPTR_0016s07040g           65.5    2e-08   
ref|XP_006649302.1|  PREDICTED: homeobox protein BEL1 homolog         63.5    8e-08   
ref|XP_009418083.1|  PREDICTED: homeobox protein BEL1 homolog iso...  63.2    9e-08   
ref|XP_009418082.1|  PREDICTED: homeobox protein BEL1 homolog iso...  63.2    9e-08   
ref|XP_011090301.1|  PREDICTED: BEL1-like homeodomain protein 1       63.2    1e-07   
ref|XP_008387112.1|  PREDICTED: BEL1-like homeodomain protein 1       62.8    1e-07   
gb|EMT30798.1|  BEL1-like homeodomain protein 1                       62.4    1e-07   
ref|XP_009389789.1|  PREDICTED: homeobox protein BEL1 homolog         62.8    1e-07   
ref|XP_002275098.1|  PREDICTED: BEL1-like homeodomain protein 1       62.8    2e-07   Vitis vinifera
dbj|BAJ88195.1|  predicted protein                                    61.6    2e-07   
ref|XP_010089795.1|  BEL1-like homeodomain protein 1                  62.4    2e-07   
emb|CAC82983.1|  putative BEL1-like protein                           62.0    2e-07   Gnetum gnemon
gb|EPS62339.1|  hypothetical protein M569_12452                       62.0    2e-07   
ref|XP_010093716.1|  BEL1-like homeodomain protein 1                  62.0    2e-07   
ref|XP_009628712.1|  PREDICTED: BEL1-like homeodomain protein 1       62.0    2e-07   
emb|CAN69527.1|  hypothetical protein VITISV_027380                   62.0    3e-07   Vitis vinifera
ref|XP_010557446.1|  PREDICTED: BEL1-like homeodomain protein 5 i...  62.0    3e-07   
ref|XP_010557445.1|  PREDICTED: BEL1-like homeodomain protein 5 i...  62.0    3e-07   
ref|XP_010941166.1|  PREDICTED: homeobox protein BEL1 homolog         62.0    3e-07   
ref|XP_006430060.1|  hypothetical protein CICLE_v10011201mg           62.0    3e-07   
ref|NP_198957.1|  homeobox protein BEL1                               62.0    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447491.1|  PREDICTED: homeobox protein BEL1 homolog         61.6    3e-07   
ref|XP_006481599.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  61.6    3e-07   
gb|KDO70617.1|  hypothetical protein CISIN_1g005514mg                 61.6    3e-07   
gb|ACD39464.1|  BEL5 protein                                          61.6    4e-07   Solanum palustre
gb|AAK96704.1|  homeotic protein BEL1 homolog                         61.2    4e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ACD39468.1|  BEL5 protein                                          61.6    4e-07   Solanum etuberosum
ref|XP_010557975.1|  PREDICTED: BEL1-like homeodomain protein 1       61.6    4e-07   
gb|KEH29763.1|  BEL1-related homeotic protein                         61.6    4e-07   
ref|XP_010533636.1|  PREDICTED: homeobox protein BEL1 homolog         61.2    4e-07   
ref|XP_003576293.1|  PREDICTED: BEL1-like homeodomain protein 1       61.2    4e-07   
ref|XP_011046419.1|  PREDICTED: BEL1-like homeodomain protein 1       61.2    4e-07   
ref|XP_006381943.1|  hypothetical protein POPTR_0006s21950g           61.2    4e-07   
ref|XP_009395039.1|  PREDICTED: homeobox protein BEL1 homolog         61.2    4e-07   
ref|XP_009787672.1|  PREDICTED: BEL1-like homeodomain protein 1       61.2    5e-07   
ref|XP_008796900.1|  PREDICTED: homeobox protein BEL1 homolog         60.8    5e-07   
ref|XP_010263012.1|  PREDICTED: BEL1-like homeodomain protein 1       60.8    5e-07   
ref|XP_002870636.1|  hypothetical protein ARALYDRAFT_493837           60.8    6e-07   
ref|XP_002524053.1|  bel1 homeotic protein, putative                  60.8    6e-07   Ricinus communis
ref|XP_006663234.1|  PREDICTED: BEL1-like homeodomain protein 1-like  60.5    7e-07   
dbj|BAK05542.1|  predicted protein                                    60.8    7e-07   
gb|KHG12855.1|  BEL1-like homeodomain protein 1                       60.5    7e-07   
gb|KHG12856.1|  BEL1-like homeodomain protein 1                       60.5    8e-07   
ref|XP_010521016.1|  PREDICTED: BEL1-like homeodomain protein 1       60.5    8e-07   
ref|XP_010543869.1|  PREDICTED: BEL1-like homeodomain protein 1 i...  60.1    9e-07   
ref|XP_010543867.1|  PREDICTED: BEL1-like homeodomain protein 1 i...  60.1    9e-07   
emb|CDP15553.1|  unnamed protein product                              60.5    9e-07   
ref|XP_010436095.1|  PREDICTED: homeobox protein BEL1 homolog         60.1    1e-06   
gb|AFV46214.1|  hypothetical protein                                  58.9    1e-06   
ref|XP_002974618.1|  hypothetical protein SELMODRAFT_414952           60.5    1e-06   
gb|KHG01894.1|  BEL1-like homeodomain protein 1                       60.1    1e-06   
ref|XP_006283321.1|  hypothetical protein CARUB_v10004359mg           60.1    1e-06   
ref|XP_008391977.1|  PREDICTED: BEL1-like homeodomain protein 1       60.1    1e-06   
ref|XP_009348973.1|  PREDICTED: BEL1-like homeodomain protein 1       60.1    1e-06   
ref|XP_010676226.1|  PREDICTED: BEL1-like homeodomain protein 1 i...  60.1    1e-06   
dbj|BAK04585.1|  predicted protein                                    59.3    1e-06   
ref|XP_008360598.1|  PREDICTED: BEL1-like homeodomain protein 1       60.1    1e-06   
ref|XP_010676227.1|  PREDICTED: BEL1-like homeodomain protein 1 i...  60.1    1e-06   
ref|XP_004978737.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  60.1    1e-06   
ref|XP_006361091.1|  PREDICTED: BEL1-related homeotic protein 5       59.7    1e-06   
gb|KFK33010.1|  hypothetical protein AALP_AA6G318600                  59.7    1e-06   
ref|XP_010059079.1|  PREDICTED: BEL1-like homeodomain protein 1       59.7    1e-06   
ref|XP_010247184.1|  PREDICTED: BEL1-like homeodomain protein 1       59.7    1e-06   
ref|XP_002450321.1|  hypothetical protein SORBIDRAFT_05g003750        59.7    1e-06   Sorghum bicolor [broomcorn]
ref|XP_007145789.1|  hypothetical protein PHAVU_007G267900g           59.7    2e-06   
ref|XP_010107001.1|  BEL1-like homeodomain protein 1                  59.3    2e-06   
gb|AFK36785.1|  unknown                                               58.5    2e-06   
ref|XP_002313498.2|  hypothetical protein POPTR_0009s02250g           59.3    2e-06   Populus trichocarpa [western balsam poplar]
ref|NP_001274921.1|  BEL1-related homeotic protein 5                  59.3    2e-06   
dbj|BAE71188.1|  BEL1-like homeodomain transcription factor           59.3    2e-06   Trifolium pratense [peavine clover]
ref|XP_004985907.1|  PREDICTED: homeobox protein BEL1 homolog iso...  59.3    2e-06   
ref|XP_008442920.1|  PREDICTED: BEL1-like homeodomain protein 1       59.3    2e-06   
ref|XP_001779432.1|  predicted protein                                59.7    2e-06   
ref|XP_008679683.1|  PREDICTED: BEL1-like homeodomain protein 1       59.3    2e-06   
gb|KDP36113.1|  hypothetical protein JCGZ_08757                       59.3    2e-06   
gb|AFW65587.1|  putative POX domain/homeobox DNA-binding domain f...  59.3    2e-06   
gb|KDO46590.1|  hypothetical protein CISIN_1g005901mg                 59.3    2e-06   
ref|XP_006494895.1|  PREDICTED: BEL1-like homeodomain protein 1-like  59.3    2e-06   
ref|XP_006348466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  59.3    2e-06   
ref|XP_003539486.1|  PREDICTED: BEL1-like homeodomain protein 1-like  58.9    2e-06   
emb|CDX75085.1|  BnaA05g08310D                                        59.3    2e-06   
ref|XP_003572007.1|  PREDICTED: BEL1-like homeodomain protein 4       59.3    2e-06   
ref|XP_008449596.1|  PREDICTED: BEL1-like homeodomain protein 1       59.3    2e-06   
ref|XP_004140170.1|  PREDICTED: BEL1-like homeodomain protein 1-like  59.3    2e-06   
gb|KHN10043.1|  BEL1-like homeodomain protein 1                       58.9    2e-06   
gb|KHN17979.1|  BEL1-like homeodomain protein 1                       58.9    2e-06   
ref|XP_003519115.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  58.9    2e-06   
ref|XP_006595918.1|  PREDICTED: BEL1-like homeodomain protein 3-l...  58.9    3e-06   
ref|XP_006664357.1|  PREDICTED: BEL1-like homeodomain protein 1-like  58.5    3e-06   
emb|CDX84171.1|  BnaC04g09330D                                        58.9    3e-06   
ref|XP_011003835.1|  PREDICTED: BEL1-like homeodomain protein 1       58.9    3e-06   
ref|NP_001065164.1|  Os10g0534900                                     58.5    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002299773.2|  hypothetical protein POPTR_0001s22430g           58.9    3e-06   Populus trichocarpa [western balsam poplar]
ref|NP_001234599.1|  bell-like homeodomain protein 2                  58.9    3e-06   
ref|XP_006424091.1|  hypothetical protein CICLE_v10027955mg           58.5    3e-06   
gb|ACU01965.1|  bell1-like protein                                    57.8    3e-06   Santalum album
ref|XP_010545511.1|  PREDICTED: homeobox protein BEL1 homolog         58.5    3e-06   
gb|ACU01957.1|  aintegumenta-like protein                             57.8    3e-06   Santalum album
gb|EEE51314.1|  hypothetical protein OsJ_32275                        58.5    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EEE51686.1|  hypothetical protein OsJ_33045                        58.5    3e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CDY44476.1|  BnaCnng11290D                                        58.5    4e-06   
ref|XP_010230386.1|  PREDICTED: BEL1-like homeodomain protein 4       58.5    4e-06   
ref|XP_010031566.1|  PREDICTED: BEL1-like homeodomain protein 1       58.5    4e-06   
ref|XP_006856142.1|  hypothetical protein AMTR_s00059p00164750        58.2    4e-06   
ref|XP_009404911.1|  PREDICTED: BEL1-like homeodomain protein 1       58.5    4e-06   
ref|NP_001065808.2|  Os11g0158600                                     58.5    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010505121.1|  PREDICTED: BEL1-like homeodomain protein 1       58.5    4e-06   
ref|XP_007015671.1|  BEL1 homeodomain 1, putative                     58.5    4e-06   
ref|XP_011021429.1|  PREDICTED: BEL1-like homeodomain protein 1       58.5    4e-06   
ref|XP_009140091.1|  PREDICTED: homeobox protein BEL1 homolog         58.2    4e-06   
ref|XP_010441306.1|  PREDICTED: homeobox protein BEL1 homolog         58.2    4e-06   
ref|XP_003543416.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  58.2    4e-06   
gb|KEH24245.1|  BEL1-related homeotic protein                         58.2    5e-06   
ref|XP_006405354.1|  hypothetical protein EUTSA_v10027690mg           58.2    5e-06   
ref|XP_007027982.1|  BEL1-like homeodomain protein 1 isoform 1        58.2    5e-06   
ref|NP_001051171.2|  Os03g0732800                                     56.2    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008799712.1|  PREDICTED: BEL1-like homeodomain protein 1       58.2    5e-06   
ref|XP_008241058.1|  PREDICTED: BEL1-like homeodomain protein 1       58.2    5e-06   
emb|CBI24428.3|  unnamed protein product                              57.8    5e-06   
ref|XP_003535815.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  58.2    5e-06   
emb|CBI22785.3|  unnamed protein product                              57.8    5e-06   
gb|KHN48417.1|  BEL1-like homeodomain protein 1                       57.8    5e-06   
gb|ACC77468.1|  BEL1                                                  57.8    5e-06   Kalanchoe x houghtonii
ref|XP_007204250.1|  hypothetical protein PRUPE_ppa002158mg           58.2    5e-06   
ref|XP_009420594.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  57.8    5e-06   
dbj|BAJ89622.1|  predicted protein                                    57.8    5e-06   
ref|XP_007160717.1|  hypothetical protein PHAVU_001G011100g           57.8    5e-06   
ref|XP_004136516.1|  PREDICTED: BEL1-like homeodomain protein 1-like  57.8    6e-06   
ref|XP_009395654.1|  PREDICTED: BEL1-like homeodomain protein 4       57.8    6e-06   
gb|AGU36601.1|  BEL1-related homeotic protein 29                      55.8    6e-06   
ref|XP_004171976.1|  PREDICTED: BEL1-like homeodomain protein 1-like  57.8    6e-06   
gb|AGU36605.1|  BEL1-related homeotic protein 29                      55.8    6e-06   
gb|AGU36610.1|  BEL1-related homeotic protein 29                      55.8    6e-06   
gb|AGU36609.1|  BEL1-related homeotic protein 29                      55.8    6e-06   
gb|AGU36603.1|  BEL1-related homeotic protein 29                      55.8    6e-06   
emb|CDY45383.1|  BnaC06g42380D                                        56.6    6e-06   
gb|AGU36604.1|  BEL1-related homeotic protein 29                      55.8    6e-06   
ref|XP_007160715.1|  hypothetical protein PHAVU_001G011000g           57.8    6e-06   
ref|NP_001131173.1|  uncharacterized protein LOC100192481             57.8    6e-06   Zea mays [maize]
gb|AGU36602.1|  BEL1-related homeotic protein 29                      55.8    6e-06   
ref|XP_010685441.1|  PREDICTED: BEL1-like homeodomain protein 1       57.8    6e-06   
gb|AGU36600.1|  BEL1-related homeotic protein 29                      55.5    7e-06   
ref|XP_004506223.1|  PREDICTED: BEL1-like homeodomain protein 1-like  57.8    7e-06   
ref|XP_010558342.1|  PREDICTED: BEL1-like homeodomain protein 9 i...  57.4    7e-06   
dbj|BAJ91914.1|  predicted protein                                    57.4    7e-06   
dbj|BAJ85202.1|  predicted protein                                    57.4    7e-06   
ref|XP_004228612.1|  PREDICTED: BEL1-like homeodomain protein 1       57.4    7e-06   
ref|NP_001048808.1|  Os03g0124000                                     57.4    8e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CDY40420.1|  BnaA04g20970D                                        57.4    8e-06   
ref|XP_009141535.1|  PREDICTED: BEL1-like homeodomain protein 1       57.4    8e-06   
ref|XP_010097899.1|  BEL1-like homeodomain protein 2                  57.4    8e-06   
emb|CDX79646.1|  BnaC03g19820D                                        57.4    8e-06   
gb|AAN03626.1|AF406702_1  BEL1-related homeotic protein 29            57.4    8e-06   Solanum tuberosum [potatoes]
ref|XP_009133059.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  57.4    9e-06   
gb|KHF99976.1|  BEL1-like homeodomain protein 1                       57.4    9e-06   
emb|CDY32069.1|  BnaC04g44970D                                        57.4    9e-06   
gb|ACD39469.1|  BEL29 protein                                         57.0    9e-06   Solanum etuberosum
ref|XP_009395309.1|  PREDICTED: homeobox protein BEL1 homolog         57.0    9e-06   
emb|CDX84585.1|  BnaA03g16450D                                        57.4    9e-06   
ref|XP_007162972.1|  hypothetical protein PHAVU_001G195800g           57.0    1e-05   
ref|XP_010544329.1|  PREDICTED: BEL1-like homeodomain protein 5       57.0    1e-05   
ref|XP_004303380.1|  PREDICTED: BEL1-like homeodomain protein 1-like  57.0    1e-05   
emb|CDP10596.1|  unnamed protein product                              57.0    1e-05   
ref|XP_001777380.1|  predicted protein                                57.4    1e-05   
ref|XP_004494251.1|  PREDICTED: BEL1-like homeodomain protein 1-like  57.0    1e-05   
gb|EMT11923.1|  Homeobox BEL1-like protein                            56.2    1e-05   
gb|EAY88336.1|  hypothetical protein OsI_09793                        56.6    1e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_003540818.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  57.0    1e-05   
gb|ACN27211.1|  unknown                                               55.8    1e-05   Zea mays [maize]
ref|XP_007132496.1|  hypothetical protein PHAVU_011G099100g           57.0    1e-05   
gb|KHN21192.1|  BEL1-like homeodomain protein 1                       56.6    1e-05   
ref|XP_010553534.1|  PREDICTED: homeobox protein BEL1 homolog         56.6    1e-05   
gb|ABF98710.1|  homeodomain protein JUBEL1, putative, expressed       56.2    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008794017.1|  PREDICTED: BEL1-like homeodomain protein 7 i...  56.6    1e-05   
ref|XP_008794014.1|  PREDICTED: BEL1-like homeodomain protein 7 i...  56.6    1e-05   
gb|EEC67362.1|  hypothetical protein OsI_34463                        56.6    1e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_003539151.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  56.6    2e-05   
ref|XP_002281889.1|  PREDICTED: BEL1-like homeodomain protein 4       56.6    2e-05   Vitis vinifera
gb|KHN19925.1|  BEL1-like homeodomain protein 1                       56.6    2e-05   
ref|XP_006435065.1|  hypothetical protein CICLE_v10000508mg           56.2    2e-05   
ref|XP_006473564.1|  PREDICTED: BEL1-like homeodomain protein 3-l...  56.2    2e-05   
gb|AGU36608.1|  BEL1-related homeotic protein 29                      54.3    2e-05   
gb|KDO84667.1|  hypothetical protein CISIN_1g005863mg                 56.2    2e-05   
gb|EMS65600.1|  Homeobox protein BEL1-like protein                    56.2    2e-05   
dbj|BAJ04684.1|  BEL1-type homeodomain protein                        56.2    2e-05   
ref|XP_009140780.1|  PREDICTED: BEL1-like homeodomain protein 5       56.2    2e-05   
ref|XP_007150022.1|  hypothetical protein PHAVU_005G119300g           56.2    2e-05   
ref|NP_001147963.1|  BEL1-related homeotic protein 30                 56.2    2e-05   Zea mays [maize]
ref|XP_008675002.1|  PREDICTED: BEL1-related homeotic protein 30 ...  56.2    2e-05   
tpg|DAA43039.1|  TPA: putative POX domain/homeobox DNA-binding do...  55.5    2e-05   
gb|KDO79423.1|  hypothetical protein CISIN_1g0033231mg                54.3    2e-05   
ref|XP_002266838.1|  PREDICTED: BEL1-like homeodomain protein 1       56.2    2e-05   Vitis vinifera
dbj|BAK04286.1|  predicted protein                                    56.2    2e-05   
emb|CDY30566.1|  BnaA04g15670D                                        55.8    2e-05   
emb|CAN63083.1|  hypothetical protein VITISV_015358                   56.2    2e-05   Vitis vinifera
dbj|BAJ99003.1|  predicted protein                                    56.2    2e-05   
emb|CBI19630.3|  unnamed protein product                              55.5    2e-05   
ref|XP_007150021.1|  hypothetical protein PHAVU_005G119300g           56.2    2e-05   
ref|XP_009403681.1|  PREDICTED: BEL1-like homeodomain protein 1       55.8    2e-05   
ref|XP_007047070.1|  BEL1-like homeodomain protein 2 isoform 1        56.2    2e-05   
ref|XP_007047071.1|  BEL1-like homeodomain protein 2 isoform 2        56.2    2e-05   
gb|EYU18114.1|  hypothetical protein MIMGU_mgv1a010011mg              55.5    2e-05   
gb|KDP38560.1|  hypothetical protein JCGZ_04485                       55.8    2e-05   
ref|XP_010931060.1|  PREDICTED: BEL1-like homeodomain protein 1       55.8    2e-05   
ref|XP_007156875.1|  hypothetical protein PHAVU_002G024800g           55.8    3e-05   
gb|KDP31824.1|  hypothetical protein JCGZ_12285                       55.8    3e-05   
ref|XP_003521496.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  55.8    3e-05   
dbj|BAJ04685.1|  BEL1-type homeodomain protein                        55.8    3e-05   
ref|XP_007017638.1|  BEL1-like homeodomain protein 3, putative        55.8    3e-05   
gb|EEE64958.1|  hypothetical protein OsJ_19849                        55.1    3e-05   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ04686.1|  BEL1-type homeodomain protein                        55.8    3e-05   
gb|EMT21256.1|  Homeobox BEL1-like protein                            55.5    3e-05   
emb|CDX69252.1|  BnaC01g02010D                                        55.5    3e-05   
ref|XP_009773899.1|  PREDICTED: BEL1-like homeodomain protein 1       55.5    3e-05   
emb|CAC82982.1|  putative BEL1-like protein                           53.9    3e-05   
gb|EMT28215.1|  BEL1-like homeodomain protein 2                       55.5    3e-05   
ref|XP_002306443.2|  hypothetical protein POPTR_0005s13780g           55.5    3e-05   
gb|KHN33154.1|  BEL1-like homeodomain protein 1                       55.1    3e-05   
ref|XP_009613053.1|  PREDICTED: BEL1-like homeodomain protein 1       55.5    3e-05   
ref|XP_011009913.1|  PREDICTED: BEL1-like homeodomain protein 4       55.5    3e-05   
ref|XP_009125437.1|  PREDICTED: BEL1-like homeodomain protein 9       55.5    3e-05   
ref|XP_003562164.1|  PREDICTED: homeobox protein BEL1 homolog         55.5    3e-05   
ref|XP_008442501.1|  PREDICTED: BEL1-like homeodomain protein 9       55.1    3e-05   
ref|XP_007136630.1|  hypothetical protein PHAVU_009G060400g           55.5    3e-05   
gb|EEE58245.1|  hypothetical protein OsJ_09231                        55.8    3e-05   
gb|ACD39466.1|  BEL29 protein                                         55.5    3e-05   
ref|XP_002464081.1|  hypothetical protein SORBIDRAFT_01g011960        55.5    3e-05   
ref|XP_010918561.1|  PREDICTED: homeobox protein ATH1-like isofor...  55.5    4e-05   
ref|XP_006829091.1|  hypothetical protein AMTR_s00001p00262320        55.1    4e-05   
gb|KHG19008.1|  BEL1-like homeodomain protein 9                       55.1    4e-05   
ref|XP_010254699.1|  PREDICTED: BEL1-like homeodomain protein 11      55.1    4e-05   
gb|EEC79849.1|  hypothetical protein OsI_21328                        55.1    4e-05   
ref|XP_010107836.1|  BEL1-like homeodomain protein 6                  55.1    4e-05   
ref|XP_008675423.1|  PREDICTED: BEL1-related homeotic protein 14 ...  55.1    4e-05   
ref|NP_001148180.1|  BEL1-related homeotic protein 14                 55.1    4e-05   
dbj|BAD67687.1|  putative homeotic protein BEL1                       55.1    5e-05   
ref|XP_009778869.1|  PREDICTED: BEL1-like homeodomain protein 1       55.1    5e-05   
ref|XP_002512955.1|  bel1 homeotic protein, putative                  55.1    5e-05   
ref|NP_001056572.1|  Os06g0108900                                     55.1    5e-05   
emb|CDX76849.1|  BnaC08g34350D                                        54.7    5e-05   
ref|XP_011037163.1|  PREDICTED: BEL1-like homeodomain protein 6       54.7    5e-05   
ref|XP_010066189.1|  PREDICTED: BEL1-like homeodomain protein 6       54.7    5e-05   
tpg|DAA46068.1|  TPA: putative POX domain/homeobox DNA-binding do...  53.9    5e-05   
ref|XP_010313381.1|  PREDICTED: BEL1-like homeodomain protein 1       54.7    5e-05   
gb|EAY91758.1|  hypothetical protein OsI_13400                        54.7    6e-05   
ref|XP_009109344.1|  PREDICTED: BEL1-like homeodomain protein 2       54.7    6e-05   
emb|CDP07470.1|  unnamed protein product                              54.7    6e-05   
ref|XP_008810401.1|  PREDICTED: uncharacterized protein LOC103721825  54.7    6e-05   
emb|CDY24765.1|  BnaA08g15450D                                        54.7    6e-05   
dbj|BAE98691.1|  putative homeodomain protein BELL1                   54.3    6e-05   
emb|CDY22463.1|  BnaC03g61760D                                        54.7    6e-05   
ref|XP_006425770.1|  hypothetical protein CICLE_v10024897mg           54.7    6e-05   
ref|XP_006425771.1|  hypothetical protein CICLE_v10024897mg           54.7    6e-05   
gb|EEE59870.1|  hypothetical protein OsJ_12461                        54.7    6e-05   
ref|XP_009396457.1|  PREDICTED: BEL1-like homeodomain protein 4       54.7    6e-05   
ref|XP_004156658.1|  PREDICTED: BEL1-like homeodomain protein 9-like  53.9    6e-05   
ref|XP_011025689.1|  PREDICTED: BEL1-like homeodomain protein 4       54.7    7e-05   
ref|NP_177674.1|  BEL1-like homeodomain 3                             54.3    7e-05   
gb|AAL32623.1|  Similar to homeodomain proteins                       54.3    7e-05   
ref|XP_004137755.1|  PREDICTED: BEL1-like homeodomain protein 9-like  54.3    7e-05   
emb|CDY63699.1|  BnaC08g19170D                                        54.3    7e-05   
gb|AFK47923.1|  unknown                                               52.4    7e-05   
ref|XP_009614985.1|  PREDICTED: BEL1-like homeodomain protein 4       54.3    7e-05   
gb|AAN03622.1|AF406698_1  BEL1-related homeotic protein 11            54.3    7e-05   
ref|XP_006362847.1|  PREDICTED: BEL1-like homeodomain protein 1-like  54.3    7e-05   
ref|XP_008778978.1|  PREDICTED: BEL1-like homeodomain protein 4 i...  54.3    7e-05   
emb|CAN65696.1|  hypothetical protein VITISV_001987                   54.3    8e-05   
ref|XP_004983819.1|  PREDICTED: homeobox protein BEL1 homolog iso...  54.3    8e-05   
ref|XP_010254698.1|  PREDICTED: BEL1-like homeodomain protein 6       54.3    8e-05   
ref|XP_009629592.1|  PREDICTED: BEL1-like homeodomain protein 1       54.3    8e-05   
gb|KHG17019.1|  BEL1-like homeodomain protein 6                       54.3    8e-05   
dbj|BAJ96483.1|  predicted protein                                    54.3    9e-05   
ref|XP_008236952.1|  PREDICTED: BEL1-like homeodomain protein 7       53.9    9e-05   
gb|KHN42028.1|  BEL1-like homeodomain protein 2                       53.9    9e-05   
gb|ABF98709.1|  homeodomain protein JUBEL1, putative, expressed       53.9    1e-04   
ref|XP_002465020.1|  hypothetical protein SORBIDRAFT_01g030620        53.9    1e-04   
ref|XP_008377194.1|  PREDICTED: BEL1-like homeodomain protein 11      53.5    1e-04   
ref|XP_007199727.1|  hypothetical protein PRUPE_ppa002499mg           53.9    1e-04   
ref|XP_003538830.1|  PREDICTED: BEL1-like homeodomain protein 2-like  53.9    1e-04   
gb|KHG00573.1|  BEL1-like homeodomain protein 6                       53.9    1e-04   
ref|XP_008377240.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  53.1    1e-04   
emb|CDY69132.1|  BnaAnng29380D                                        53.9    1e-04   
ref|XP_008784116.1|  PREDICTED: BEL1-like homeodomain protein 1       53.9    1e-04   
emb|CDX77099.1|  BnaC04g38940D                                        53.5    1e-04   
gb|KHN36166.1|  BEL1-like homeodomain protein 2                       53.9    1e-04   
ref|XP_006487349.1|  PREDICTED: BEL1-like homeodomain protein 6-l...  53.9    1e-04   
gb|EPS66848.1|  hypothetical protein M569_07928                       51.2    1e-04   
ref|XP_006423388.1|  hypothetical protein CICLE_v10027952mg           53.9    1e-04   
gb|KDO49465.1|  hypothetical protein CISIN_1g038021mg                 53.9    1e-04   
ref|XP_006487350.1|  PREDICTED: BEL1-like homeodomain protein 6-l...  53.9    1e-04   
ref|XP_004289652.1|  PREDICTED: BEL1-like homeodomain protein 6-like  53.9    1e-04   
ref|XP_003527678.1|  PREDICTED: BEL1-like homeodomain protein 3-l...  53.5    1e-04   
gb|AAK38645.1|AF334758_1  homeodomain protein JUBEL1                  53.9    1e-04   
ref|XP_004509227.1|  PREDICTED: BEL1-like homeodomain protein 2-like  53.9    1e-04   
ref|XP_010243287.1|  PREDICTED: BEL1-like homeodomain protein 2       53.9    1e-04   
ref|XP_004964302.1|  PREDICTED: homeobox protein BEL1 homolog iso...  53.5    1e-04   
gb|EMS47188.1|  BEL1-like homeodomain protein 6                       53.5    1e-04   
ref|XP_008808897.1|  PREDICTED: BEL1-like homeodomain protein 4       53.5    1e-04   
ref|XP_010932672.1|  PREDICTED: BEL1-like homeodomain protein 7       53.5    1e-04   
ref|XP_006651784.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  53.5    1e-04   
ref|XP_010228131.1|  PREDICTED: homeobox protein BEL1 homolog iso...  53.1    1e-04   
ref|XP_009335838.1|  PREDICTED: BEL1-like homeodomain protein 11      53.1    1e-04   
ref|XP_002310774.2|  hypothetical protein POPTR_0007s12170g           53.5    1e-04   
ref|XP_008221348.1|  PREDICTED: BEL1-like homeodomain protein 11      53.1    1e-04   
ref|XP_006838675.1|  hypothetical protein AMTR_s00002p00243900        53.5    1e-04   
ref|XP_010938938.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  53.5    1e-04   
gb|KHN22224.1|  BEL1-like homeodomain protein 3                       53.1    1e-04   
gb|EYU37829.1|  hypothetical protein MIMGU_mgv1a003764mg              53.1    2e-04   
gb|KHG13966.1|  BEL1-like homeodomain protein 2                       53.5    2e-04   
ref|XP_003557261.1|  PREDICTED: homeobox protein BEL1 homolog iso...  53.1    2e-04   
gb|EAY84030.1|  hypothetical protein OsI_39262                        53.1    2e-04   
gb|EMT16587.1|  BEL1-like homeodomain protein 6                       53.5    2e-04   
ref|NP_001067363.1|  Os12g0636200                                     53.1    2e-04   
ref|XP_008796599.1|  PREDICTED: BEL1-like homeodomain protein 7 i...  53.1    2e-04   
ref|XP_008241607.1|  PREDICTED: BEL1-like homeodomain protein 4       53.5    2e-04   
ref|XP_002306123.2|  hypothetical protein POPTR_0004s16660g           53.1    2e-04   
ref|XP_007204284.1|  hypothetical protein PRUPE_ppa001286mg           53.5    2e-04   
gb|KDP41749.1|  hypothetical protein JCGZ_26767                       53.1    2e-04   
ref|XP_003575568.1|  PREDICTED: BEL1-like homeodomain protein 7       53.1    2e-04   
dbj|BAK01775.1|  predicted protein                                    53.1    2e-04   
gb|KHG08101.1|  BEL1-like homeodomain protein 7                       53.1    2e-04   
gb|EYU44317.1|  hypothetical protein MIMGU_mgv1a001716mg              53.1    2e-04   
ref|XP_010029855.1|  PREDICTED: BEL1-like homeodomain protein 4       53.1    2e-04   
ref|XP_010275538.1|  PREDICTED: BEL1-like homeodomain protein 6       53.1    2e-04   
ref|XP_008796600.1|  PREDICTED: BEL1-like homeodomain protein 7 i...  53.1    2e-04   
ref|XP_010936123.1|  PREDICTED: BEL1-like homeodomain protein 4 i...  52.8    2e-04   
ref|XP_010936122.1|  PREDICTED: BEL1-like homeodomain protein 4 i...  52.8    2e-04   
ref|XP_008674921.1|  PREDICTED: bell-like homeodomain protein 3 i...  53.1    2e-04   
ref|XP_004981881.1|  PREDICTED: BEL1-like homeodomain protein 2-l...  53.1    2e-04   
ref|XP_002522396.1|  bel1 homeotic protein, putative                  52.8    2e-04   
emb|CDX73170.1|  BnaC06g36180D                                        52.8    2e-04   
ref|XP_007042091.1|  BEL1-like homeodomain protein 6 isoform 1        53.1    2e-04   
ref|XP_002889024.1|  hypothetical protein ARALYDRAFT_476691           52.8    2e-04   
ref|XP_002313027.2|  hypothetical protein POPTR_0009s12360g           52.8    2e-04   
ref|XP_002436343.1|  hypothetical protein SORBIDRAFT_10g000800        52.8    2e-04   
ref|XP_008388023.1|  PREDICTED: BEL1-like homeodomain protein 11      52.8    2e-04   
ref|XP_004982177.1|  PREDICTED: BEL1-like homeodomain protein 6-l...  52.8    2e-04   
dbj|BAJ88032.1|  predicted protein                                    52.8    2e-04   
ref|XP_006302135.1|  hypothetical protein CARUB_v10020140mg           52.8    2e-04   
ref|XP_010932911.1|  PREDICTED: BEL1-like homeodomain protein 7       52.8    2e-04   
ref|XP_009106194.1|  PREDICTED: BEL1-like homeodomain protein 3       52.8    2e-04   
ref|XP_011088451.1|  PREDICTED: BEL1-like homeodomain protein 7       52.8    2e-04   
ref|XP_010940613.1|  PREDICTED: BEL1-like homeodomain protein 2       52.8    2e-04   
emb|CDY47524.1|  BnaAnng09220D                                        52.8    2e-04   
ref|XP_010905861.1|  PREDICTED: BEL1-like homeodomain protein 9       52.8    2e-04   
gb|AET04003.2|  BEL1-related homeotic protein                         52.8    2e-04   
ref|XP_011085539.1|  PREDICTED: BEL1-like homeodomain protein 4       52.8    2e-04   
ref|XP_010924486.1|  PREDICTED: homeobox protein ATH1-like            52.8    2e-04   
ref|XP_006307208.1|  hypothetical protein CARUB_v10008805mg           52.8    3e-04   
ref|XP_009773433.1|  PREDICTED: BEL1-like homeodomain protein 4       52.8    3e-04   
ref|XP_010256766.1|  PREDICTED: BEL1-like homeodomain protein 9       52.8    3e-04   
ref|XP_006574714.1|  PREDICTED: BEL1-like homeodomain protein 2-like  52.8    3e-04   
ref|XP_006656551.1|  PREDICTED: homeobox protein BEL1 homolog         52.4    3e-04   
ref|XP_002466514.1|  hypothetical protein SORBIDRAFT_01g009130        52.8    3e-04   
ref|NP_001147936.1|  bell-like homeodomain protein 3                  52.8    3e-04   
ref|NP_173400.1|  BEL1-like homeodomain 10                            52.4    3e-04   
ref|XP_010459644.1|  PREDICTED: BEL1-like homeodomain protein 10      52.4    3e-04   
ref|XP_010498393.1|  PREDICTED: BEL1-like homeodomain protein 10      52.4    3e-04   
ref|XP_009372989.1|  PREDICTED: BEL1-like homeodomain protein 6       52.8    3e-04   
ref|XP_009396355.1|  PREDICTED: BEL1-like homeodomain protein 7 i...  52.4    3e-04   
ref|XP_009347845.1|  PREDICTED: BEL1-like homeodomain protein 7       52.4    3e-04   
ref|XP_008787379.1|  PREDICTED: BEL1-like homeodomain protein 9       52.8    3e-04   
ref|XP_002893062.1|  hypothetical protein ARALYDRAFT_472196           52.4    3e-04   
ref|XP_009396357.1|  PREDICTED: BEL1-like homeodomain protein 7 i...  52.4    3e-04   
ref|XP_010459643.1|  PREDICTED: BEL1-like homeodomain protein 10      52.4    3e-04   
ref|XP_003523566.1|  PREDICTED: BEL1-like homeodomain protein 10-...  52.4    3e-04   
ref|XP_008795472.1|  PREDICTED: homeobox protein ATH1-like isofor...  52.4    3e-04   
ref|XP_010477192.1|  PREDICTED: BEL1-like homeodomain protein 10      52.4    3e-04   
ref|XP_008382306.1|  PREDICTED: BEL1-like homeodomain protein 6       52.4    3e-04   
ref|XP_004238216.1|  PREDICTED: BEL1-like homeodomain protein 4       52.4    3e-04   
ref|XP_004499204.1|  PREDICTED: BEL1-like homeodomain protein 10-...  52.4    3e-04   
emb|CDO97015.1|  unnamed protein product                              52.4    3e-04   
ref|XP_008377277.1|  PREDICTED: BEL1-like homeodomain protein 7 i...  52.4    3e-04   
ref|XP_006294234.1|  hypothetical protein CARUB_v10023231mg           52.0    3e-04   
emb|CDY02261.1|  BnaA03g39060D                                        52.0    3e-04   
ref|XP_010028619.1|  PREDICTED: BEL1-like homeodomain protein 7       52.4    3e-04   
ref|XP_002281033.1|  PREDICTED: BEL1-like homeodomain protein 11      52.0    3e-04   
ref|XP_008377278.1|  PREDICTED: BEL1-like homeodomain protein 6 i...  52.4    3e-04   
ref|XP_009378382.1|  PREDICTED: uncharacterized protein LOC103966881  52.4    4e-04   
ref|XP_003562035.1|  PREDICTED: BEL1-like homeodomain protein 7       52.0    4e-04   
ref|XP_010262659.1|  PREDICTED: BEL1-like homeodomain protein 9       52.4    4e-04   
ref|XP_011099269.1|  PREDICTED: BEL1-like homeodomain protein 4       52.4    4e-04   
emb|CDX89711.1|  BnaC03g46250D                                        52.0    4e-04   
ref|XP_008644604.1|  PREDICTED: BEL1-like homeodomain protein 7       52.0    4e-04   
ref|XP_010907730.1|  PREDICTED: BEL1-like homeodomain protein 7       52.0    4e-04   
ref|XP_010110017.1|  BEL1-like homeodomain protein 6                  52.0    4e-04   
gb|KHG14356.1|  BEL1-like homeodomain protein 2                       52.0    4e-04   
ref|XP_009137061.1|  PREDICTED: BEL1-like homeodomain protein 7       51.6    4e-04   
ref|XP_009619241.1|  PREDICTED: BEL1-like homeodomain protein 7 i...  52.0    4e-04   
ref|XP_004136085.1|  PREDICTED: BEL1-like homeodomain protein 3-like  52.0    4e-04   
ref|XP_011047809.1|  PREDICTED: BEL1-like homeodomain protein 7       52.0    4e-04   
ref|XP_009619240.1|  PREDICTED: BEL1-like homeodomain protein 7 i...  52.0    4e-04   
ref|XP_004515685.1|  PREDICTED: BEL1-like homeodomain protein 9-like  52.0    4e-04   
ref|XP_009606015.1|  PREDICTED: BEL1-like homeodomain protein 9       52.0    4e-04   
ref|XP_006283201.1|  hypothetical protein CARUB_v10004235mg           52.0    4e-04   
ref|XP_003561342.1|  PREDICTED: BEL1-like homeodomain protein 7       52.0    4e-04   
ref|XP_009136305.1|  PREDICTED: BEL1-like homeodomain protein 7       51.6    4e-04   
ref|XP_003589334.1|  BEL1-like homeodomain protein                    52.0    5e-04   
ref|XP_004963319.1|  PREDICTED: BEL1-like homeodomain protein 6-l...  52.0    5e-04   
ref|XP_006649449.1|  PREDICTED: BEL1-like homeodomain protein 7-like  52.0    5e-04   
ref|XP_009407152.1|  PREDICTED: BEL1-like homeodomain protein 7       52.0    5e-04   
ref|XP_004985591.1|  PREDICTED: BEL1-like homeodomain protein 7-l...  51.6    5e-04   
ref|XP_007223034.1|  hypothetical protein PRUPE_ppa005361mg           51.6    5e-04   
ref|XP_008461100.1|  PREDICTED: BEL1-like homeodomain protein 7       51.6    5e-04   
ref|XP_010543264.1|  PREDICTED: BEL1-like homeodomain protein 9       51.6    5e-04   
ref|XP_004291836.1|  PREDICTED: BEL1-like homeodomain protein 11-...  51.6    5e-04   
gb|EMT00895.1|  BEL1-like homeodomain protein 6                       51.2    5e-04   
ref|XP_008460982.1|  PREDICTED: BEL1-like homeodomain protein 7       51.6    5e-04   
gb|EYU32892.1|  hypothetical protein MIMGU_mgv1a006708mg              51.6    5e-04   
ref|XP_008812787.1|  PREDICTED: BEL1-like homeodomain protein 7       51.6    5e-04   
ref|XP_006283200.1|  hypothetical protein CARUB_v10004235mg           51.6    5e-04   
ref|XP_009382787.1|  PREDICTED: BEL1-like homeodomain protein 9       51.6    5e-04   
gb|EPS59583.1|  hypothetical protein M569_15223                       50.8    5e-04   
emb|CBI38029.3|  unnamed protein product                              51.6    6e-04   
ref|XP_004150064.1|  PREDICTED: BEL1-like homeodomain protein 6-like  51.6    6e-04   
ref|XP_004173415.1|  PREDICTED: BEL1-like homeodomain protein 6-like  51.6    6e-04   
ref|XP_010548069.1|  PREDICTED: BEL1-like homeodomain protein 6       51.6    6e-04   
ref|XP_006416473.1|  hypothetical protein EUTSA_v10007267mg           51.6    6e-04   
ref|XP_003631586.1|  PREDICTED: BEL1-like homeodomain protein 3       51.6    6e-04   
dbj|BAJ98782.1|  predicted protein                                    51.6    6e-04   
ref|XP_010531191.1|  PREDICTED: BEL1-like homeodomain protein 4       51.6    6e-04   
emb|CAN62866.1|  hypothetical protein VITISV_015924                   51.6    6e-04   
ref|XP_010941926.1|  PREDICTED: BEL1-like homeodomain protein 4       51.2    6e-04   
gb|ACN29213.1|  unknown                                               50.8    6e-04   
ref|NP_001148063.1|  homeodomain protein JUBEL1                       51.6    6e-04   
ref|XP_009128099.1|  PREDICTED: BEL1-like homeodomain protein 3       51.2    6e-04   
tpg|DAA51178.1|  TPA: putative POX domain/homeobox DNA-binding do...  51.6    6e-04   
ref|XP_010672761.1|  PREDICTED: BEL1-like homeodomain protein 7 i...  51.6    6e-04   
ref|XP_004291835.1|  PREDICTED: BEL1-like homeodomain protein 11-...  51.2    6e-04   
gb|EMS60062.1|  BEL1-like homeodomain protein 6                       51.2    7e-04   
ref|XP_011083617.1|  PREDICTED: BEL1-like homeodomain protein 11      51.2    7e-04   
ref|XP_006664239.1|  PREDICTED: BEL1-like homeodomain protein 6-l...  51.2    7e-04   
ref|XP_010672737.1|  PREDICTED: BEL1-like homeodomain protein 3 i...  51.2    7e-04   
ref|XP_008797003.1|  PREDICTED: BEL1-like homeodomain protein 4       51.2    7e-04   



>gb|KDO76309.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
 gb|KDO76310.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
Length=635

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 124/232 (53%), Gaps = 31/232 (13%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSD-----DNGEAAARNLQNPRNDTEDQKP  773
            WFINARVRLWKPMVEEMY+EETKEQ+N +A+SD     D+        QNP  D +  + 
Sbjct  430  WFINARVRLWKPMVEEMYLEETKEQDNNMASSDGATDLDDNSGRPNQTQNPPADQKPTQD  489

Query  772  NLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGP  593
             LVRIDSEC+SSIINNH   D NKN       HH   +  +                FG 
Sbjct  490  QLVRIDSECLSSIINNHDKNDANKNPNKALPSHHMQQNFGS----------------FGA  533

Query  592  VGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaaf  413
            + +DFSSYN ++ G   SY                              G      +   
Sbjct  534  MELDFSSYNQHTVGGV-SY---------ANDSANHQNFNGGSGGVSLTLGLQQHGGSGVS  583

Query  412  ssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
             + +  S SSLFYPRD +EDCQ V YSLLD EGQNLPYRNLMGAQLLHDLAG
Sbjct  584  LAFSPASQSSLFYPRDHIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  635



>gb|KDO76305.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
 gb|KDO76306.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
 gb|KDO76307.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
Length=655

 Score =   163 bits (413),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 124/232 (53%), Gaps = 31/232 (13%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSD-----DNGEAAARNLQNPRNDTEDQKP  773
            WFINARVRLWKPMVEEMY+EETKEQ+N +A+SD     D+        QNP  D +  + 
Sbjct  450  WFINARVRLWKPMVEEMYLEETKEQDNNMASSDGATDLDDNSGRPNQTQNPPADQKPTQD  509

Query  772  NLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGP  593
             LVRIDSEC+SSIINNH   D NKN       HH   +  +                FG 
Sbjct  510  QLVRIDSECLSSIINNHDKNDANKNPNKALPSHHMQQNFGS----------------FGA  553

Query  592  VGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaaf  413
            + +DFSSYN ++ G   SY                              G      +   
Sbjct  554  MELDFSSYNQHTVGGV-SY---------ANDSANHQNFNGGSGGVSLTLGLQQHGGSGVS  603

Query  412  ssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
             + +  S SSLFYPRD +EDCQ V YSLLD EGQNLPYRNLMGAQLLHDLAG
Sbjct  604  LAFSPASQSSLFYPRDHIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  655



>ref|XP_006439494.1| hypothetical protein CICLE_v10019130mg [Citrus clementina]
 gb|ESR52734.1| hypothetical protein CICLE_v10019130mg [Citrus clementina]
Length=690

 Score =   163 bits (413),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 124/232 (53%), Gaps = 31/232 (13%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSD-----DNGEAAARNLQNPRNDTEDQKP  773
            WFINARVRLWKPMVEEMY+EETKEQ+N +A+SD     D+        QNP  D +  + 
Sbjct  485  WFINARVRLWKPMVEEMYLEETKEQDNNMASSDGATDLDDNSGRPNQTQNPPADQKPTQD  544

Query  772  NLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGP  593
             LVRIDSEC+SSIINNH   D NKN       HH   +  +                FG 
Sbjct  545  QLVRIDSECLSSIINNHDKNDANKNPNKALPSHHMQQNFGS----------------FGA  588

Query  592  VGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaaf  413
            + +DFSSYN ++ G   SY                              G      +   
Sbjct  589  MELDFSSYNQHTVGGV-SY---------ANDSANHQNFNGGSGGVSLTLGLQQHGGSGVS  638

Query  412  ssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
             + +  S SSLFYPRD +EDCQ V YSLLD EGQNLPYRNLMGAQLLHDLAG
Sbjct  639  LAFSPASQSSLFYPRDHIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  690



>ref|XP_009800804.1| PREDICTED: homeobox protein BEL1 homolog [Nicotiana sylvestris]
 ref|XP_009800805.1| PREDICTED: homeobox protein BEL1 homolog [Nicotiana sylvestris]
 ref|XP_009800806.1| PREDICTED: homeobox protein BEL1 homolog [Nicotiana sylvestris]
Length=644

 Score =   163 bits (412),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 138/238 (58%), Gaps = 31/238 (13%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDD--------NGEAAARNL-QNPRNDTE  785
            WFINARVRLWKPMVEEMY+EETK+Q+  L + D         NG +  R + QNP+   E
Sbjct  427  WFINARVRLWKPMVEEMYLEETKDQQENLESPDGSKGLDHDMNGISVGRQINQNPQLHIE  486

Query  784  DQKPNLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDH  605
            DQKPNL+RIDSECISSII NHP  +D  NN      ++ +  Q         + G GGDH
Sbjct  487  DQKPNLIRIDSECISSII-NHPEKNDTTNN------NNKNCLQDHHQAHNFHSFGRGGDH  539

Query  604  QFGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaa  425
             FG + +DFSSYNHNS G A +Y            G         G             +
Sbjct  540  SFGAIELDFSSYNHNSTG-AIAY------------GNENVQHNVGGGVSLTLGLNQNGGS  586

Query  424  aaafssaasqsssSLFYPRDQM--EDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
                S+ +  S SSLFYPRD    +DCQ VPYSLLDSE QNLPYRNLMGAQLLHDLAG
Sbjct  587  GMGLSTFSQASQSSLFYPRDDHIDQDCQQVPYSLLDSENQNLPYRNLMGAQLLHDLAG  644



>ref|XP_006476516.1| PREDICTED: homeobox protein BEL1 homolog [Citrus sinensis]
Length=690

 Score =   163 bits (412),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 124/232 (53%), Gaps = 31/232 (13%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSD-----DNGEAAARNLQNPRNDTEDQKP  773
            WFINARVRLWKPMVEEMY+EETKEQ+N +A+SD     D+        QNP  D +  + 
Sbjct  485  WFINARVRLWKPMVEEMYLEETKEQDNNMASSDGATDLDDNSGRPNQTQNPPADQKPTQD  544

Query  772  NLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGP  593
             LVRIDSEC+SSIINNH   D NKN       HH   +  +                FG 
Sbjct  545  QLVRIDSECLSSIINNHDKNDANKNPNKALPSHHMQQNFGS----------------FGA  588

Query  592  VGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaaf  413
            + +DFSSYN ++ G   SY                              G      +   
Sbjct  589  MELDFSSYNQHTVGGV-SY---------ANDSANHQNFNGGSGGVSLTLGLQQHGGSGVS  638

Query  412  ssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
             + +  S SSLFYPRD +EDCQ V YSLLD EGQNLPYRNLMGAQLLHDLAG
Sbjct  639  LAFSPASQSSLFYPRDHIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  690



>gb|KDO76303.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
 gb|KDO76304.1| hypothetical protein CISIN_1g005058mg [Citrus sinensis]
Length=716

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 124/232 (53%), Gaps = 31/232 (13%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSD-----DNGEAAARNLQNPRNDTEDQKP  773
            WFINARVRLWKPMVEEMY+EETKEQ+N +A+SD     D+        QNP  D +  + 
Sbjct  511  WFINARVRLWKPMVEEMYLEETKEQDNNMASSDGATDLDDNSGRPNQTQNPPADQKPTQD  570

Query  772  NLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGP  593
             LVRIDSEC+SSIINNH   D NKN       HH   +  +                FG 
Sbjct  571  QLVRIDSECLSSIINNHDKNDANKNPNKALPSHHMQQNFGS----------------FGA  614

Query  592  VGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaaf  413
            + +DFSSYN ++ G   SY                              G      +   
Sbjct  615  MELDFSSYNQHTVGGV-SY---------ANDSANHQNFNGGSGGVSLTLGLQQHGGSGVS  664

Query  412  ssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
             + +  S SSLFYPRD +EDCQ V YSLLD EGQNLPYRNLMGAQLLHDLAG
Sbjct  665  LAFSPASQSSLFYPRDHIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  716



>ref|XP_002279230.2| PREDICTED: homeobox protein BEL1 homolog [Vitis vinifera]
Length=672

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 131/235 (56%), Gaps = 33/235 (14%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENL-----LATSDDNGEAAARNLQNPRNDTEDQKP  773
            WFINARVRLWKPMVEEMY+EETKEQ+NL         DDNG    R   NP+   EDQKP
Sbjct  463  WFINARVRLWKPMVEEMYLEETKEQDNLGSPDGATDPDDNG----RPNPNPQPRIEDQKP  518

Query  772  N---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQ  602
                LVRIDSEC+SSIINN P  +D+KN     + H HHLH        +          
Sbjct  519  TAEQLVRIDSECLSSIINN-PEKNDSKNGKSLQNPHPHHLHHHQPNFGRVAEA-------  570

Query  601  FGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaa  422
            FG V +DFSSYNH++AGA                    +     G       G      +
Sbjct  571  FGAVELDFSSYNHHTAGAV-------------SFTNDSAHHNFGGSGVSLTLGLQQHGGS  617

Query  421  aafssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
                + +  S SSLFY RD +EDCQ V YSLLD EGQNLPYRNLMGAQLLHDLAG
Sbjct  618  GVSLAFSPASQSSLFYSRDPIEDCQPVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  672



>ref|XP_009604673.1| PREDICTED: homeobox protein BEL1 homolog [Nicotiana tomentosiformis]
 ref|XP_009604675.1| PREDICTED: homeobox protein BEL1 homolog [Nicotiana tomentosiformis]
 ref|XP_009604676.1| PREDICTED: homeobox protein BEL1 homolog [Nicotiana tomentosiformis]
Length=640

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 139/238 (58%), Gaps = 31/238 (13%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDD--------NGEAAARNL-QNPRNDTE  785
            WFINARVRLWKPMVEEMY+EETK+Q+  L + D         NG +  R + QNP+   E
Sbjct  423  WFINARVRLWKPMVEEMYLEETKDQQENLESPDGSKGLDHDMNGISVGRQINQNPQLHIE  482

Query  784  DQKPNLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDH  605
            DQKPNLVRIDSECISSII NHP  +D  NN      ++ +  Q    +  L + G GGDH
Sbjct  483  DQKPNLVRIDSECISSII-NHPEKNDTTNN------NNKNCLQNHHQVHNLHSFGRGGDH  535

Query  604  QFGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaa  425
             FG + +DFSSYNHNS G A +Y            G         G             +
Sbjct  536  SFGAIELDFSSYNHNSTG-AIAY------------GNESVQHNIGGGVSLTLGLNQNGGS  582

Query  424  aaafssaasqsssSLFYPRDQM--EDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
                S+ +  S SSLFYPRD    +DCQ V YSLLDSE QNLPYRNLMGAQLLHDLAG
Sbjct  583  GMGLSTFSQASQSSLFYPRDDHIDQDCQQVQYSLLDSENQNLPYRNLMGAQLLHDLAG  640



>gb|KHN25686.1| Homeobox protein BEL1 like [Glycine soja]
Length=436

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 130/237 (55%), Gaps = 53/237 (22%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRN----------DT  788
            WFINARVRLWKPMVEEMY+EE K+ EN +A+S+  G     N  NP N           +
Sbjct  243  WFINARVRLWKPMVEEMYLEEVKDPENNIASSE--GATDQDNDINPNNVEYPPPPSSSRS  300

Query  787  EDQKPNLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggD  608
            EDQKP+LVRIDSEC SSIINNH +  DNKN+    +                        
Sbjct  301  EDQKPSLVRIDSECASSIINNH-STPDNKNDPKGHEQC----------------------  337

Query  607  HQFGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmgla  428
              FG V +DFSSY H+S+G   SY               GS        Q G S  +GL 
Sbjct  338  --FGSVELDFSSYTHHSSGIV-SY---------------GSNDQNGNNNQSGVSLTLGLQ  379

Query  427  aaaafssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
                  +    + SSL+YPRDQ+EDCQ V YSL D EGQNLPYRNLMGAQLLHDLAG
Sbjct  380  QHGVSLAFPPATQSSLYYPRDQIEDCQPVQYSLFDGEGQNLPYRNLMGAQLLHDLAG  436



>ref|XP_003517476.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Glycine 
max]
 ref|XP_006573786.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Glycine 
max]
Length=646

 Score =   158 bits (399),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 130/237 (55%), Gaps = 53/237 (22%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRN----------DT  788
            WFINARVRLWKPMVEEMY+EE K+ EN +A+S+  G     N  NP N           +
Sbjct  453  WFINARVRLWKPMVEEMYLEEVKDPENNIASSE--GATDQDNDINPNNVEYPPPPSSSRS  510

Query  787  EDQKPNLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggD  608
            EDQKP+LVRIDSEC SSIINNH +  DNKN+    +                        
Sbjct  511  EDQKPSLVRIDSECASSIINNH-STPDNKNDPKGHEQC----------------------  547

Query  607  HQFGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmgla  428
              FG V +DFSSY H+S+G   SY               GS        Q G S  +GL 
Sbjct  548  --FGSVELDFSSYTHHSSGIV-SY---------------GSNDQNGNNNQSGVSLTLGLQ  589

Query  427  aaaafssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
                  +    + SSL+YPRDQ+EDCQ V YSL D EGQNLPYRNLMGAQLLHDLAG
Sbjct  590  QHGVSLAFPPATQSSLYYPRDQIEDCQPVQYSLFDGEGQNLPYRNLMGAQLLHDLAG  646



>ref|XP_003538310.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Glycine 
max]
 ref|XP_006590505.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Glycine 
max]
Length=642

 Score =   157 bits (398),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 133/236 (56%), Gaps = 50/236 (21%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATS----DDNGEAAARNLQNP----RNDTED  782
            WFINARVRLWKPMVEEMY+EE K+ EN +A+S    D + +    N+Q P     + +ED
Sbjct  448  WFINARVRLWKPMVEEMYLEEVKDPENNIASSEGATDQDNDINPNNVQYPPPPLSSRSED  507

Query  781  QKPNLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQ  602
            QKP+LVRIDSEC SSIINNH +  DNKN+    +                          
Sbjct  508  QKPSLVRIDSECASSIINNH-STPDNKNDPKGQEQC------------------------  542

Query  601  FGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaa  422
            FG V +DFSSY H+S+G   SY               GS        Q G S  +GL   
Sbjct  543  FGSVELDFSSYTHHSSGMV-SY---------------GSSDQNGNNNQSGVSLTLGLQQH  586

Query  421  aafssaasqsssSLFYPRDQMEDCQTV-PYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
                +    + SSL+YPRDQ+EDCQ V  YSLLD EGQNLPYRNLMGAQLLHDLAG
Sbjct  587  GVSLAFPPATQSSLYYPRDQIEDCQPVHQYSLLDGEGQNLPYRNLMGAQLLHDLAG  642



>gb|KHN35035.1| Homeobox protein BEL1 like [Glycine soja]
Length=642

 Score =   157 bits (397),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 133/236 (56%), Gaps = 50/236 (21%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATS----DDNGEAAARNLQNP----RNDTED  782
            WFINARVRLWKPMVEEMY+EE K+ EN +A+S    D + +    N+Q P     + +ED
Sbjct  448  WFINARVRLWKPMVEEMYLEEVKDPENNIASSEGATDQDNDINPNNVQYPPPPLSSRSED  507

Query  781  QKPNLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQ  602
            QKP+LVRIDSEC SSIINNH +  DNKN+    +                          
Sbjct  508  QKPSLVRIDSECASSIINNH-STPDNKNDPKGQEQC------------------------  542

Query  601  FGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaa  422
            FG V +DFSSY H+S+G   SY               GS        Q G S  +GL   
Sbjct  543  FGSVELDFSSYTHHSSGMV-SY---------------GSSDQNGNNNQSGVSLTLGLQQH  586

Query  421  aafssaasqsssSLFYPRDQMEDCQTV-PYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
                +    + SSL+YPRDQ+EDCQ V  YSLLD EGQNLPYRNLMGAQLLHDLAG
Sbjct  587  GVSLAFPPATQSSLYYPRDQIEDCQPVHQYSLLDGEGQNLPYRNLMGAQLLHDLAG  642



>ref|XP_002299516.2| hypothetical protein POPTR_0001s09720g [Populus trichocarpa]
 gb|EEE84321.2| hypothetical protein POPTR_0001s09720g [Populus trichocarpa]
Length=663

 Score =   156 bits (395),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/234 (46%), Positives = 126/234 (54%), Gaps = 35/234 (15%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDD----NGEAAARNLQNPRNDTEDQKPN  770
            WFINARVRLWKPMVEEMY+EETKEQ+N +A+SD     +  +  R  QNP   + DQKP 
Sbjct  458  WFINARVRLWKPMVEEMYLEETKEQDNNMASSDGVTDLDENSNGRPNQNP--SSTDQKPT  515

Query  769  ---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQF  599
               LVRIDSEC+SSII+N    D NK+                                F
Sbjct  516  PDQLVRIDSECLSSIISNPDKNDTNKS--------------IKTFQSHHLQHQQQNFGNF  561

Query  598  GPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaa  419
            G + +DFSSYNH++A A  SY                +     G       G      + 
Sbjct  562  GAMELDFSSYNHHTA-AGVSY-----------ANESVNNQNFNGGGVSLTLGLQQHGGSG  609

Query  418  afssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
               + +  S SSLFYPRD +EDCQ V YSLLD EGQNLPYRNLMGAQLLHDLAG
Sbjct  610  VSLAFSPGSQSSLFYPRDHIEDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  663



>gb|KDP25399.1| hypothetical protein JCGZ_20555 [Jatropha curcas]
Length=690

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 127/232 (55%), Gaps = 29/232 (13%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRND--TEDQKPN--  770
            WFINARVRLWKPMVEEMY+EETKEQ+N LA+ D   E        P  +  + DQKP   
Sbjct  483  WFINARVRLWKPMVEEMYLEETKEQDNNLASPDGITELEENINGRPSQNLSSTDQKPTPD  542

Query  769  -LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGP  593
             L+RIDSEC+SSII+N    D +K N     HH H   Q   A              FG 
Sbjct  543  QLIRIDSECLSSIISNPDKNDTSKTNKSFQTHHLHTQQQNFGA--------------FGA  588

Query  592  VGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaaf  413
            V +DFSSYNH +A    SY          G     + +   G       G      +   
Sbjct  589  VELDFSSYNHQNAPGGVSY----------GNDTSANQNFNNGGGVSLTLGLQQHGGSGVS  638

Query  412  ssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
             + +  S SSLFYPRD ++DCQ V YSLLD EGQNLPYRNLMGAQLLHDLAG
Sbjct  639  LAFSPASQSSLFYPRDHIDDCQQVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  690



>ref|XP_011029331.1| PREDICTED: homeobox protein BEL1 homolog [Populus euphratica]
Length=658

 Score =   154 bits (390),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 127/239 (53%), Gaps = 45/239 (19%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDD----NGEAAARNLQNPRNDTEDQKPN  770
            WFINARVRLWKPMVE+MY+EETKEQ+N +A+SD     +     R  QNP   + DQKP 
Sbjct  453  WFINARVRLWKPMVEDMYLEETKEQDNNMASSDGITDLDENINGRPNQNP--SSTDQKPT  510

Query  769  ---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQ-  602
               LVRIDSEC+SSII+N    D NK+                              HQ 
Sbjct  511  PDQLVRIDSECLSSIISNPDKKDTNKS-------------------IKTFQSHHLQPHQQ  551

Query  601  ----FGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmg  434
                FG + +DFSSYNH++A A  SY                +     G       G   
Sbjct  552  NFGNFGAMELDFSSYNHHTA-AGVSY-----------ANDSANSQNFNGGGVSLTLGLQQ  599

Query  433  laaaaafssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
               +    + +  S SSLFYPRD +EDCQ V YS+LD EGQNLPYRNLMGAQLLHDLAG
Sbjct  600  HGGSGVSLAFSPGSHSSLFYPRDHIEDCQQVQYSILDGEGQNLPYRNLMGAQLLHDLAG  658



>ref|XP_006385769.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
 ref|XP_006385771.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
 ref|XP_006385773.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
 gb|ERP63566.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
 gb|ERP63568.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
 gb|ERP63570.1| hypothetical protein POPTR_0003s13120g [Populus trichocarpa]
Length=664

 Score =   152 bits (384),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 130/234 (56%), Gaps = 34/234 (15%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDD----NGEAAARNLQNPRNDTEDQKP-  773
            WFINARVRLWKPMVEEMY+EETKEQ+  +A+SD     +     R  QNP   + DQKP 
Sbjct  458  WFINARVRLWKPMVEEMYLEETKEQDKNMASSDGVTDLDENINGRPNQNP--SSTDQKPT  515

Query  772  --NLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQF  599
              +L+RIDSEC+SSII+N    D N  N        HHL  Q  +              F
Sbjct  516  PDHLIRIDSECLSSIISN---PDKNGTNKSTISFQSHHLQHQQQSFGN-----------F  561

Query  598  GPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaa  419
            G + +DFSSYNH++AG   SY                + +   G       G      + 
Sbjct  562  GSMDLDFSSYNHHAAGGV-SY----------ANDSASNQNFNGGGGVSLTLGLQQHGGSG  610

Query  418  afssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
               + +  S SSLFYPRD +EDCQ V YSLLD EGQNLPYRNLMGAQLLHD+AG
Sbjct  611  VSLAFSPASQSSLFYPRDHIEDCQPVQYSLLDGEGQNLPYRNLMGAQLLHDMAG  664



>ref|XP_007040322.1| POX family protein isoform 1 [Theobroma cacao]
 ref|XP_007040323.1| POX family protein isoform 1 [Theobroma cacao]
 ref|XP_007040324.1| POX family protein isoform 1 [Theobroma cacao]
 ref|XP_007040325.1| POX family protein isoform 1 [Theobroma cacao]
 ref|XP_007040326.1| POX family protein isoform 1 [Theobroma cacao]
 gb|EOY24823.1| POX family protein isoform 1 [Theobroma cacao]
 gb|EOY24824.1| POX family protein isoform 1 [Theobroma cacao]
 gb|EOY24825.1| POX family protein isoform 1 [Theobroma cacao]
 gb|EOY24826.1| POX family protein isoform 1 [Theobroma cacao]
 gb|EOY24827.1| POX family protein isoform 1 [Theobroma cacao]
Length=661

 Score =   151 bits (382),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 124/229 (54%), Gaps = 31/229 (14%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDD--NGEAAARNLQNPRNDTEDQKPNLV  764
            WFINARVRLWKPMVEEMY+EE KE EN +A+SD   +G+   R  QNP  D +     LV
Sbjct  462  WFINARVRLWKPMVEEMYLEEIKEHENNMASSDGATDGDDNGRPNQNPPTDQKPTPDQLV  521

Query  763  RIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGPVGM  584
            R+DSEC+SSI+ N P  +D K+     + H H                      +G + +
Sbjct  522  RVDSECLSSIVTN-PDKNDAKSAKTLQNQHSHQPQNFGT---------------YGAMEL  565

Query  583  DFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaafssa  404
            DFSSY+H++AG   SY            G   +     G       G           + 
Sbjct  566  DFSSYSHHTAGGV-SY------------GSDNANQNFNGGGVSLTLGLQQHGGTGVSLAF  612

Query  403  asqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            +  S S LFYPRD +EDCQ V YSLLD EGQ+LPYRNLMGAQLLHDLAG
Sbjct  613  SPASQSPLFYPRDHIEDCQQVQYSLLDGEGQHLPYRNLMGAQLLHDLAG  661



>ref|XP_007158519.1| hypothetical protein PHAVU_002G159000g [Phaseolus vulgaris]
 gb|ESW30513.1| hypothetical protein PHAVU_002G159000g [Phaseolus vulgaris]
Length=638

 Score =   151 bits (382),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 129/235 (55%), Gaps = 50/235 (21%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSD---DNGEAAARNLQNP---RNDTEDQK  776
            WFINARVRLWKPMVEEMY+EE K+ EN +A+S+   D       N+QNP      +EDQK
Sbjct  446  WFINARVRLWKPMVEEMYLEEVKDHENNMASSEGATDPENDINPNVQNPPPHSARSEDQK  505

Query  775  PNLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFG  596
            P+L+RIDSEC SSIINN+    DNKN+    +                          FG
Sbjct  506  PSLLRIDSECASSIINNNHTL-DNKNDPKGQEQC------------------------FG  540

Query  595  PVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaa  416
             V +DFSSY H+S+G                       +   G  Q G S  +GL     
Sbjct  541  SVELDFSSYTHHSSGMV-----------------SFGSNDQNGNSQSGVSLTLGLQQHGV  583

Query  415  fssaasqsssSLFY--PRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
              +    + SSL+Y  PRDQ+EDCQ V YSLLD EGQNLPYRNLMGAQLLHDLAG
Sbjct  584  SLAFPPPTQSSLYYPNPRDQIEDCQPVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  638



>ref|XP_011022632.1| PREDICTED: homeobox protein BEL1 homolog [Populus euphratica]
Length=665

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 130/234 (56%), Gaps = 34/234 (15%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDD----NGEAAARNLQNPRNDTEDQKP-  773
            WFINARVRLWKPMVEEMY+EETKEQ+N +A+SD     +     R  QNP   + DQKP 
Sbjct  459  WFINARVRLWKPMVEEMYLEETKEQDNNMASSDGVTDLDENINGRPNQNP--SSTDQKPT  516

Query  772  --NLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQF  599
              +L+RIDSEC+SSII+N    D N  N        HHL  Q  +              F
Sbjct  517  PDHLIRIDSECLSSIISN---PDKNGTNKSTISFQSHHLQHQQQSFGN-----------F  562

Query  598  GPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaa  419
            G + +DFSSYNH++AG   SY                + +   G       G      + 
Sbjct  563  GSMDLDFSSYNHHAAGGV-SY----------ANDSASNQNFNSGGGVSLTLGLQQHGGSG  611

Query  418  afssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
               + +  S SSLFY RD +EDCQ V YSLLD EGQNLPYRNLMGAQLLHD+AG
Sbjct  612  VSLAFSPASQSSLFYHRDHIEDCQPVQYSLLDGEGQNLPYRNLMGAQLLHDMAG  665



>ref|XP_002509843.1| bel1 homeotic protein, putative [Ricinus communis]
 gb|EEF51230.1| bel1 homeotic protein, putative [Ricinus communis]
Length=698

 Score =   147 bits (370),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 130/236 (55%), Gaps = 33/236 (14%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSD------DNGEAAARNLQNPRNDTEDQK  776
            WFINARVRLWKPMVEEMY+EETKEQ+N +A+ D      DN    ++NL      + DQK
Sbjct  487  WFINARVRLWKPMVEEMYLEETKEQDNNMASPDGITDLEDNNGRPSQNL-----SSTDQK  541

Query  775  PN---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDH  605
            P    L+R+DSEC+SSII+N    D +K      +HHH H  QQ                
Sbjct  542  PTPDQLIRVDSECLSSIISNPDKNDISKTTKTFQNHHHLHTQQQQQQHNFGA--------  593

Query  604  QFGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaa  425
             FG V +D SSYNH++AG   SY             GG   +   G             +
Sbjct  594  -FGAVELDISSYNHHAAGGV-SY---------ANDHGGNHQNFNGGGVSLTLGLQQHGGS  642

Query  424  aaafssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
                 + +  S SSLFY RD ++DCQ V YSLLD EGQNLPYRNLMGAQLLHDLAG
Sbjct  643  GGVSLAFSPASQSSLFYSRDHIDDCQPVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  698



>ref|XP_008238940.1| PREDICTED: homeobox protein BEL1 homolog [Prunus mume]
Length=716

 Score =   144 bits (363),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 110/240 (46%), Positives = 132/240 (55%), Gaps = 35/240 (15%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE---NLLATSD----DNGEAAARNLQNPRNDTEDQ  779
            WFINARVRLWKPMVEEMY+EETKE+E   N L +SD    D G+ ++R+ QN R   EDQ
Sbjct  499  WFINARVRLWKPMVEEMYLEETKERENNMNNLTSSDGITKDPGD-SSRSGQNIR--PEDQ  555

Query  778  KPN---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggD  608
            KP    LVRIDSEC+SSII N     D++++     +HH H  Q    +           
Sbjct  556  KPTPDQLVRIDSECLSSIITNPDKNHDSRSSKSTLLNHHMHPQQSFGRVNES--------  607

Query  607  HQFGPVGMDFSSYNHNS--AGAAFSYaavggsggknggggggsvsltlglqqqggsggmg  434
              FG + +DFSSYNH+   +G   SY                      G       G   
Sbjct  608  --FGTMELDFSSYNHHQQHSGGTVSY---------ANDHHHNPNQGFNGGGVSLTLGLQQ  656

Query  433  laaaaafssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQN-LPYRNLMGAQLLHDLAG  257
                    + +  S SSLFYPRD +E+CQ V YSLLD EGQN LPYRNLMGAQLLHDLAG
Sbjct  657  HGGNGVSLAFSPASQSSLFYPRDHIEECQPVQYSLLDGEGQNTLPYRNLMGAQLLHDLAG  716



>ref|XP_007210325.1| hypothetical protein PRUPE_ppa002081mg [Prunus persica]
 gb|EMJ11524.1| hypothetical protein PRUPE_ppa002081mg [Prunus persica]
Length=719

 Score =   144 bits (362),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 129/240 (54%), Gaps = 32/240 (13%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLL--ATSDDNGEA----AARNLQNP-RNDTEDQ  779
            WFINARVRLWKPMVEEMY+EETKE+EN +   TS D        ++R+ QNP     ED+
Sbjct  499  WFINARVRLWKPMVEEMYLEETKERENNMNNMTSSDGITTDLGDSSRSGQNPLHTRPEDK  558

Query  778  KPN---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggD  608
            KP    LVRIDSEC+SSII N     D++++     +HH H  Q    +           
Sbjct  559  KPTPDQLVRIDSECLSSIITNPEKNHDSRSSKSTLLNHHMHPQQSFGRVNES--------  610

Query  607  HQFGPVGMDFSSYNHNS--AGAAFSYaavggsggknggggggsvsltlglqqqggsggmg  434
              FG + +DFSSYNH+   +G   SY                      G       G   
Sbjct  611  --FGTMELDFSSYNHHQQHSGGTVSY---------ANDHHHNPNQGFNGGGVSLTLGLQQ  659

Query  433  laaaaafssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQN-LPYRNLMGAQLLHDLAG  257
                    + +  S SSLFYPRD +E+CQ V YSLLD EGQN LPYRNLMGAQLLHDLAG
Sbjct  660  HGGNGVSLAFSPASQSSLFYPRDHIEECQPVQYSLLDGEGQNTLPYRNLMGAQLLHDLAG  719



>ref|XP_010053224.1| PREDICTED: homeobox protein BEL1 homolog [Eucalyptus grandis]
 ref|XP_010053225.1| PREDICTED: homeobox protein BEL1 homolog [Eucalyptus grandis]
 gb|KCW77489.1| hypothetical protein EUGRSUZ_D01826 [Eucalyptus grandis]
Length=723

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/235 (43%), Positives = 124/235 (53%), Gaps = 18/235 (8%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENL-----LATSDDNGEAAARNLQNPRNDTEDQKP  773
            WFINARVRLWKPMVEEMY EET+E +N+      A  +D+G     N +  R   EDQKP
Sbjct  499  WFINARVRLWKPMVEEMYTEETREHDNMGSSDGAADLEDDGRPNNHNREATR--VEDQKP  556

Query  772  N---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQ  602
                LVRIDSEC SSI+ +   +D + ++         + H      Q  G    G    
Sbjct  557  TSDQLVRIDSECFSSIVTSPDKSDQHHHSKMAATRAPQNHHHHHLHPQNSGFGRVGDA--  614

Query  601  FGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaa  422
            +G + +DFSSYNH+   +A  Y                      G+    G    G  + 
Sbjct  615  YGGMEIDFSSYNHHPVTSAAPY------SNDGDASHQNFNGSGGGVSLTLGLQQHGGPSH  668

Query  421  aafssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
                + +S S +SLFYPRD +EDC  V YSLLD EGQ LPYRNLMGAQLLHDLAG
Sbjct  669  GVSLAFSSVSQNSLFYPRDHIEDCHPVQYSLLDGEGQTLPYRNLMGAQLLHDLAG  723



>ref|XP_009363416.1| PREDICTED: homeobox protein BEL1 homolog [Pyrus x bretschneideri]
 ref|XP_009363417.1| PREDICTED: homeobox protein BEL1 homolog [Pyrus x bretschneideri]
 ref|XP_009363418.1| PREDICTED: homeobox protein BEL1 homolog [Pyrus x bretschneideri]
Length=682

 Score =   138 bits (347),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 117/233 (50%), Gaps = 26/233 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPN---L  767
            WFINARVRLWKPMVEEMY+EETKE+EN  + +  +G A   +    R   ED+KP    L
Sbjct  470  WFINARVRLWKPMVEEMYMEETKERENNNSITSSDGIATDPSQHQSR--PEDEKPTHDQL  527

Query  766  VRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGPVG  587
            VRIDSEC+SSII N       KN                                FG + 
Sbjct  528  VRIDSECLSSIITN-----PEKNQYSRSSKSTILSQHMNPQQSFGRVNES-----FGTME  577

Query  586  MDFSSYNHNS--AGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaaf  413
            +DFSSYNH+   +G   SY         N      +     G       G          
Sbjct  578  LDFSSYNHHQQHSGGTVSY--------SNDQHHNPNQGFNGGGGVSLTLGLQQHDGNGVS  629

Query  412  ssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQ-NLPYRNLMGAQLLHDLAG  257
             + +  S SSLFYPRD  E+CQ V YSLLD EGQ NLPYRNLMGAQLLHDLAG
Sbjct  630  LAFSPASQSSLFYPRDNAEECQPVQYSLLDGEGQNNLPYRNLMGAQLLHDLAG  682



>ref|XP_009363409.1| PREDICTED: homeobox protein BEL1 homolog [Pyrus x bretschneideri]
 ref|XP_009363410.1| PREDICTED: homeobox protein BEL1 homolog [Pyrus x bretschneideri]
 ref|XP_009363411.1| PREDICTED: homeobox protein BEL1 homolog [Pyrus x bretschneideri]
Length=682

 Score =   138 bits (347),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 117/233 (50%), Gaps = 26/233 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPN---L  767
            WFINARVRLWKPMVEEMY+EETKE+EN  + +  +G A   +    R   ED+KP    L
Sbjct  470  WFINARVRLWKPMVEEMYMEETKERENNNSITSSDGIATDPSQHQSR--PEDEKPTHDQL  527

Query  766  VRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGPVG  587
            VRIDSEC+SSII N       KN                                FG + 
Sbjct  528  VRIDSECLSSIITN-----PEKNQYSRSSKSTILSQHMNPQQSFGRVNES-----FGTME  577

Query  586  MDFSSYNHNS--AGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaaf  413
            +DFSSYNH+   +G   SY         N      +     G       G          
Sbjct  578  LDFSSYNHHQQHSGGTVSY--------SNDQHHNPNQGFNGGGGVSLTLGLQQHDGNGVS  629

Query  412  ssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQ-NLPYRNLMGAQLLHDLAG  257
             + +  S SSLFYPRD  E+CQ V YSLLD EGQ NLPYRNLMGAQLLHDLAG
Sbjct  630  LAFSPASQSSLFYPRDNAEECQPVQYSLLDGEGQNNLPYRNLMGAQLLHDLAG  682



>ref|XP_008373620.1| PREDICTED: homeobox protein BEL1 homolog [Malus domestica]
 ref|XP_008373687.1| PREDICTED: homeobox protein BEL1 homolog [Malus domestica]
Length=687

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 127/234 (54%), Gaps = 25/234 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSD-DNGEAAARNLQNPRNDTEDQKPN---  770
            WFINARVRLWKPMVEEMY+EETKE+EN +  S+  + +  A +    ++  ED+KP    
Sbjct  472  WFINARVRLWKPMVEEMYMEETKERENNMNISNMTSSDGIATDPSPHQSRPEDEKPTHDQ  531

Query  769  LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGPV  590
            LVR+DSEC+SSII       D++ +      H+ H HQ    +             FG +
Sbjct  532  LVRMDSECLSSIITYPEKNHDSRGSKNTISSHNMHPHQNFGRVNES----------FGTM  581

Query  589  GMDFSSYNHNS--AGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaa  416
             +DFSSYNH+   +G   SY         N      +     G       G         
Sbjct  582  ELDFSSYNHHQQHSGGTVSY--------ANDHHHPSNQGFNAGGGVSLTLGLQQHGGNGV  633

Query  415  fssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQ-NLPYRNLMGAQLLHDLAG  257
              + +  S +SLFYPRD +E+CQ V YSLLD EG+ NLPYRNLMGAQLLHDLAG
Sbjct  634  SLAFSPASQNSLFYPRDHIEECQPVQYSLLDGEGENNLPYRNLMGAQLLHDLAG  687



>ref|XP_011073138.1| PREDICTED: homeobox protein BEL1 homolog [Sesamum indicum]
Length=603

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 118/239 (49%), Gaps = 46/239 (19%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENL-----LATSDDNGEAAARNLQNPRNDTEDQKP  773
            WFINARVRLWKPMVEEMY+E+ KE E++      A   +NG       QNP    +DQKP
Sbjct  399  WFINARVRLWKPMVEEMYLEDLKEGEDMGELDGAANHHENGN------QNPPPGNDDQKP  452

Query  772  N---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQ  602
                L+RIDS+ +SSIINN P  +D K                        +       +
Sbjct  453  TQDQLIRIDSDYLSSIINN-PGKNDPK--------APDKSLGSDHHHHHQESSFSRVGEE  503

Query  601  FG-PVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaa  425
            +G  +  DFSSY+  + GA  SY                                   A+
Sbjct  504  YGTSMQFDFSSYSQQAGGATVSY-------------------GGGSGVSLTLGLQQNGAS  544

Query  424  aaafssaasqsssSLFYPR--DQMEDCQTV-PYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
                 + +  + SSLFYPR  D MEDCQTV  YSLLDSE QNLPYRNLMGAQLLHDLAG
Sbjct  545  GGVSLAFSPATQSSLFYPRSSDNMEDCQTVHQYSLLDSENQNLPYRNLMGAQLLHDLAG  603



>ref|XP_010275694.1| PREDICTED: homeobox protein BEL1 homolog [Nelumbo nucifera]
 ref|XP_010275695.1| PREDICTED: homeobox protein BEL1 homolog [Nelumbo nucifera]
Length=685

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 130/241 (54%), Gaps = 28/241 (12%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENL------LATSDDNGE--AAARNLQNPRNDTED  782
            WFINARVRLWKPMVEEMY+EE KEQ+N+       +   DNG    + ++ QN + ++ED
Sbjct  459  WFINARVRLWKPMVEEMYLEEVKEQDNMASSDGGSSHGGDNGRPNQSHKSNQNAQPNSED  518

Query  781  QKPN---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgargggg  611
             KP    LVR DSE +SSIINN    D +K      +HHH H  QQ         +  G 
Sbjct  519  HKPTHDQLVRDDSESLSSIINNPDKNDHSKAGRNNHNHHHRHEQQQLQQQLQQQQQQLGR  578

Query  610  DHQ-FGPVGMDFSSYN-HNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggm  437
              + FG + +DFS+YN H ++  +F+                G                 
Sbjct  579  VAEPFGAIDLDFSAYNQHTASTVSFT--------------NDGIQQNLGNGVSLTLGLQQ  624

Query  436  glaaaaafssaasqsssSLFYPRDQMEDCQTVPYSL-LDSEGQNLPYRNLMGAQLLHDLA  260
               +    SS +  S +SLF+ RD +EDCQ++ YS+ LD EGQ LPYRNLMGAQLLHDLA
Sbjct  625  HGGSGVNLSSFSPASHNSLFFTRDHIEDCQSIQYSMSLDGEGQTLPYRNLMGAQLLHDLA  684

Query  259  G  257
            G
Sbjct  685  G  685



>ref|XP_004143976.1| PREDICTED: homeobox protein BEL1 homolog [Cucumis sativus]
Length=557

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 126/245 (51%), Gaps = 21/245 (9%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRND-----------  791
            WFINARVRLWKPMVEEMY+EETKEQE  +  S +N    + +     ND           
Sbjct  316  WFINARVRLWKPMVEEMYLEETKEQEEEIDNSFNNNANNSFDGVTDFNDDIDGHRSIATR  375

Query  790  TEDQKPN---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarg  620
             EDQKP    L+RIDSEC+SSII+++    +  N+         + H            G
Sbjct  376  LEDQKPTPDQLLRIDSECLSSIISSN---SEKNNDHSRTIKTMQNHHGHQLHGNHNHTFG  432

Query  619  gggDHQFGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsgg  440
                  FG V +DFSSYNH++     SY     +        G    ++L L  Q  +  
Sbjct  433  RVVGDAFGTVELDFSSYNHHTGSGGVSYHNSSHNNNNQHFNNGSGGGVSLTLGLQQHAAA  492

Query  439  mglaaaaafssaasq----sssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLL  272
             G        + AS       +SLF+ RD ME+CQ V YSLLD E QNLPYRNLMGAQLL
Sbjct  493  GGNGNGGVSIAFASAGPAVGQNSLFFTRDHMEECQPVQYSLLDGETQNLPYRNLMGAQLL  552

Query  271  HDLAG  257
            HDLAG
Sbjct  553  HDLAG  557



>ref|XP_010089065.1| Homeobox protein BEL1-like protein [Morus notabilis]
 gb|EXB37312.1| Homeobox protein BEL1-like protein [Morus notabilis]
Length=678

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 125/239 (52%), Gaps = 23/239 (10%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE---NLLATSDDN-----GEAAARNLQNPRNDTED  782
            WFINARVRLWKPMVEEMYVEETKE     N + +S D      G+ + +  +NP +  +D
Sbjct  450  WFINARVRLWKPMVEEMYVEETKEPSDANNNIGSSSDGVTMELGDPSRQTSRNPPD--QD  507

Query  781  QKPN---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgargggg  611
            QKP    LVRIDSEC+SSI+ N P   D ++++           Q+              
Sbjct  508  QKPTVDQLVRIDSECLSSIVIN-PDKTDMRSSSKSLQIRPSMQVQRQQNFDRFSETA---  563

Query  610  DHQFGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmgl  431
               FG V +DFSSYN +    A +            G   G      G+    G      
Sbjct  564  ---FGTVELDFSSYNQHQPSTAGTV-LYSNDNANAIGFNNGGGGGGGGVSLTLGLQQHAG  619

Query  430  aaaaafssaasqsssSLFYPRD-QMEDCQ-TVPYSLLDSEGQNLPYRNLMGAQLLHDLA  260
            A      + +  S SSLFY RD ++++CQ  V YSLLD EGQNLPYRNLMGAQLLHDLA
Sbjct  620  ANHGVSLAFSPASQSSLFYTRDHEIDECQPAVQYSLLDGEGQNLPYRNLMGAQLLHDLA  678



>gb|KGN50071.1| hypothetical protein Csa_5G152860 [Cucumis sativus]
Length=606

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 126/245 (51%), Gaps = 21/245 (9%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRND-----------  791
            WFINARVRLWKPMVEEMY+EETKEQE  +  S +N    + +     ND           
Sbjct  365  WFINARVRLWKPMVEEMYLEETKEQEEEIDNSFNNNANNSFDGVTDFNDDIDGHRSIATR  424

Query  790  TEDQKPN---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarg  620
             EDQKP    L+RIDSEC+SSII+++    +  N+         + H            G
Sbjct  425  LEDQKPTPDQLLRIDSECLSSIISSN---SEKNNDHSRTIKTMQNHHGHQLHGNHNHTFG  481

Query  619  gggDHQFGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsgg  440
                  FG V +DFSSYNH++     SY     +        G    ++L L  Q  +  
Sbjct  482  RVVGDAFGTVELDFSSYNHHTGSGGVSYHNSSHNNNNQHFNNGSGGGVSLTLGLQQHAAA  541

Query  439  mglaaaaafssaasq----sssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLL  272
             G        + AS       +SLF+ RD ME+CQ V YSLLD E QNLPYRNLMGAQLL
Sbjct  542  GGNGNGGVSIAFASAGPAVGQNSLFFTRDHMEECQPVQYSLLDGETQNLPYRNLMGAQLL  601

Query  271  HDLAG  257
            HDLAG
Sbjct  602  HDLAG  606



>ref|XP_008437318.1| PREDICTED: LOW QUALITY PROTEIN: homeobox protein BEL1 homolog 
[Cucumis melo]
Length=608

 Score =   117 bits (293),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 105/245 (43%), Positives = 129/245 (53%), Gaps = 21/245 (9%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRND-----------  791
            WFINARVRLWKPMVEEMY+EETKEQE  +  S +N    + +     ND           
Sbjct  367  WFINARVRLWKPMVEEMYLEETKEQEEEIDNSFNNNANNSFDGVTDFNDDIDGHRSIATR  426

Query  790  TEDQKPN---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarg  620
             EDQKP    L+RIDSEC+SSII+++   +D+        +HH H           G   
Sbjct  427  LEDQKPTPDQLLRIDSECLSSIISSNSEKNDHSRTIKTMQNHHGHHQLHGNHNHTFGRVV  486

Query  619  gggDHQFGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsgg  440
            G     FG V +DFSSYNH++     SY     +        G    ++L L  Q  +  
Sbjct  487  GDA---FGTVELDFSSYNHHTGSGGVSYHNSSNNNNSQHFNNGSGGGVSLTLGLQQHAAA  543

Query  439  mglaaaaafssaasq----sssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLL  272
             G        + AS       +SLF+ RD ME+CQ V YSLLD E QNLPYRNLMGAQLL
Sbjct  544  GGNGNGGVSIAFASAGPAVGQNSLFFTRDHMEECQPVQYSLLDGETQNLPYRNLMGAQLL  603

Query  271  HDLAG  257
            HDLAG
Sbjct  604  HDLAG  608



>gb|KHN16798.1| Homeobox protein BEL1 like [Glycine soja]
Length=421

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 113/232 (49%), Gaps = 67/232 (29%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPN---L  767
            WFINARVRLWKPMVEEMY+EE KE +N +A+S+  G           N   DQKP    L
Sbjct  246  WFINARVRLWKPMVEEMYLEEEKEHQNDVASSEGGGI----------NILGDQKPTQARL  295

Query  766  VRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGPVG  587
            VRIDSEC+SSI+NN    +D K+     + +                        FG V 
Sbjct  296  VRIDSECMSSIVNNPDDKNDTKSGKTIQNDNQMDA--------------------FGSVE  335

Query  586  MDFSSYNH-----NSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaa  422
            +DF SY H     +S G + +                                     + 
Sbjct  336  LDFWSYTHQYSSGHSGGVSLTL-----------------------------GLQQHGESG  366

Query  421  aafssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHD  266
             + +   + + SS+FYPRDQ+EDCQTV YSL+D +GQN+PYRNLMG  LLHD
Sbjct  367  VSLAFPPAATQSSMFYPRDQIEDCQTVQYSLVDGKGQNMPYRNLMGTHLLHD  418



>ref|XP_010255251.1| PREDICTED: homeobox protein BEL1 homolog [Nelumbo nucifera]
 ref|XP_010255252.1| PREDICTED: homeobox protein BEL1 homolog [Nelumbo nucifera]
 ref|XP_010255253.1| PREDICTED: homeobox protein BEL1 homolog [Nelumbo nucifera]
Length=691

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 132/242 (55%), Gaps = 27/242 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLAT--SDDNGEAAARNL-------QNPRNDTE  785
            WFINARVRLWKPMVEEMY+EETK+ +N+ ++     +G+ A R         Q P+ ++E
Sbjct  462  WFINARVRLWKPMVEEMYLEETKDLDNMTSSEGGTSHGDNAGRRPNQNHNSNQTPQPNSE  521

Query  784  DQKPN---LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggg  614
            DQKP    LVR +SE +SSII+N P  + + +++  +  +    H      Q        
Sbjct  522  DQKPTTDQLVRAESESLSSIISN-PEKNGSSSSSKINGRNDQGDHCHHQQNQQQQLGSSR  580

Query  613  gDHQFGPVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmg  434
                FG V +DFS+YN ++A +  S+              GG     +G       G   
Sbjct  581  VPELFGAVDLDFSAYNQHTAASTISF-----------ANNGGVHHQNIGGGVSLTLGLQQ  629

Query  433  laaaaafssaasqsssSLFYPRDQM-EDCQTV-PYSLLDSEGQ-NLPYRNLMGAQLLHDL  263
               +    S +  S  SLF+PRD + EDCQ++  YS+LD EGQ NLPYRNLMGAQLLHDL
Sbjct  630  HGGSGVSLSFSPASQHSLFFPRDHINEDCQSIHQYSMLDGEGQNNLPYRNLMGAQLLHDL  689

Query  262  AG  257
            AG
Sbjct  690  AG  691



>ref|XP_006580557.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Glycine 
max]
 ref|XP_006580558.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Glycine 
max]
 ref|XP_006580559.1| PREDICTED: homeobox protein BEL1 homolog isoform X3 [Glycine 
max]
Length=635

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 116/232 (50%), Gaps = 72/232 (31%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPN----  770
            WFINARVRLWKPMVEEMY+EE KEQEN +A+SD N               ED+KP     
Sbjct  470  WFINARVRLWKPMVEEMYLEEEKEQENDVASSDIN------------VPEEDEKPTQEAP  517

Query  769  LVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGPV  590
            L+RIDSEC+SSI+N+   +     N  + D                          FG V
Sbjct  518  LLRIDSECMSSIVNDVTKSGKTIQNDNQMDA-------------------------FGSV  552

Query  589  GMDFSSYN--HNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaa  416
             +DFSSY   H+S+G + +                                     +  +
Sbjct  553  ELDFSSYTHAHHSSGVSLTL-----------------------------GLQQHGESGVS  583

Query  415  fssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLA  260
             +   + + SS+FYPRDQ+++CQTV YSLLD+EGQN+P+RN+MG  LLHDL 
Sbjct  584  LAFLPAATQSSMFYPRDQIQECQTVQYSLLDAEGQNMPFRNVMGTHLLHDLV  635



>ref|XP_003532909.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Glycine 
max]
 ref|XP_006584730.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Glycine 
max]
Length=646

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 113/232 (49%), Gaps = 67/232 (29%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPN---L  767
            WFINARVRLWKPMVEEMY+EE KE +N +A+S+  G           N   DQKP    L
Sbjct  471  WFINARVRLWKPMVEEMYLEEEKEHQNDVASSEGGG----------INILGDQKPTQARL  520

Query  766  VRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGPVG  587
            VRIDSEC+SSI+NN    +D K+     + +                        FG V 
Sbjct  521  VRIDSECMSSIVNNPDDKNDTKSGKTIQNDNQMDA--------------------FGSVE  560

Query  586  MDFSSYNH-----NSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaa  422
            +DF SY H     +S G + +                                     + 
Sbjct  561  LDFWSYTHQYSSGHSGGVSLTL-----------------------------GLQQHGESG  591

Query  421  aafssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHD  266
             + +   + + SS+FYPRDQ+EDCQTV YSL+D +GQN+PYRNLMG  LLHD
Sbjct  592  VSLAFPPAATQSSMFYPRDQIEDCQTVQYSLVDGKGQNMPYRNLMGTHLLHD  643



>ref|XP_008807227.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
 ref|XP_008807228.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
Length=607

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 111/245 (45%), Gaps = 57/245 (23%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARN--LQNPRN----------  794
            WFINARVRLWKPMVEEMY+EETKEQ+   +  +++ +  AR   LQ+ RN          
Sbjct  402  WFINARVRLWKPMVEEMYLEETKEQDKQTSNGENSNDNNARTGELQSNRNPNPNSSSLQS  461

Query  793  DTEDQKPNLVRI--DSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarg  620
              EDQKP   ++  DS+ +SSIIN+     D ++              +           
Sbjct  462  HAEDQKPTPGQLLNDSDSLSSIINSSHHRADARD----------PTSSKFPYHDARRHHP  511

Query  619  gggDHQFGPVGMDFSSY----NHNSAGAAFSYaavggsggknggggggsvsltlglqqqg  452
                  FG V +DF+SY    NHN  G                                 
Sbjct  512  VPRAENFGAVDLDFTSYGECSNHNFGGGV-----------------------------SL  542

Query  451  gsggmglaaaaafssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLL  272
              G    +      S +  S   L +  +QMEDCQ   +S++D E QNLPYRNLMGAQ+L
Sbjct  543  TLGLQQHSGRGMSLSFSPASQHPLLFSGEQMEDCQPSQFSIIDGEAQNLPYRNLMGAQML  602

Query  271  HDLAG  257
            HDLAG
Sbjct  603  HDLAG  607



>gb|KEH21114.1| BEL1-related homeotic protein [Medicago truncatula]
Length=620

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 96/236 (41%), Positives = 112/236 (47%), Gaps = 44/236 (19%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDD----NGEAAARNLQNPRNDT---EDQ  779
            WFINARVRLWKPMVEEMY+EE KEQ+    TSD     N E    N+   ++ T   EDQ
Sbjct  419  WFINARVRLWKPMVEEMYLEEEKEQQRNTTTSDGGNNINHEEDNLNVLQNQSQTQPHEDQ  478

Query  778  KPNLVRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQF  599
            KP L+RIDSEC+SSIINN    D N  N                               F
Sbjct  479  KPRLLRIDSECVSSIINNDHKNDANNKNLNHHQLAADA---------------------F  517

Query  598  GPVGMDFSSYN--HNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaa  425
            G V +DFSSYN  H+S+    +Y             G                G      
Sbjct  518  GSVDIDFSSYNTHHSSSDMVAAY-----------TSGESFHQGGSSGGVSLTLGLQQHGG  566

Query  424  aaafssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQN-LPYRNLMGAQLLHDLA  260
                 +    S S +FY RDQ+E+   V YSLLD EG N +PYRNLMG QLLHDLA
Sbjct  567  NGVSLAFPPTSQSPMFYTRDQIEE--PVQYSLLDGEGTNIMPYRNLMGTQLLHDLA  620



>ref|XP_010933991.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
 ref|XP_010933992.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
 ref|XP_010933993.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
Length=596

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 81/239 (34%), Positives = 105/239 (44%), Gaps = 48/239 (20%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRND------TEDQK  776
            WFINARVRLWKPMVEEMY+EE KE++      +++ +          N        EDQK
Sbjct  394  WFINARVRLWKPMVEEMYLEEIKEKDRQTPNEENSNDNNPGPGNPNPNSSSLQLLAEDQK  453

Query  775  PNLVRI--DSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQ  602
            P L ++  DS+ +SSI+N+     D ++          +        +            
Sbjct  454  PTLGQLLNDSDSLSSIVNSSHHRTDGRD--------PTNNKISYRDPRRPHHPAVPRAEN  505

Query  601  FGPVGMDFSSY----NHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmg  434
            FG V +DF+SY    N N  G   S                               G   
Sbjct  506  FGVVDLDFTSYGECSNPNFGGGGVSL----------------------------TLGLQQ  537

Query  433  laaaaafssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
                    S +  S  SL + R+QMEDCQ   +S+LD E QNLPYRNLM AQLLHDLAG
Sbjct  538  HNGGGMSLSFSPASQHSLLFSREQMEDCQPGQFSILDGEAQNLPYRNLMEAQLLHDLAG  596



>ref|XP_006343945.1| PREDICTED: homeobox protein BEL1 homolog [Solanum tuberosum]
Length=633

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 64/83 (77%), Gaps = 5/83 (6%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNL---QNPRNDTEDQKPNL  767
            WFINARVRLWKPMVEEMY+EETKE+EN+   S D  +A   ++   Q+  +  +DQKPNL
Sbjct  444  WFINARVRLWKPMVEEMYIEETKEEENV--GSPDGSKALIDDMTIHQSHIDHHQDQKPNL  501

Query  766  VRIDSECISSIINNHPAADDNKN  698
            VRIDSECISSIIN+HP   +++N
Sbjct  502  VRIDSECISSIINHHPHEKNDQN  524


 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 33/42 (79%), Gaps = 3/42 (7%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            LFYPRD   D Q    SLLDSE QNLPYRNLMGAQLLHDLAG
Sbjct  595  LFYPRD---DDQVQYTSLLDSENQNLPYRNLMGAQLLHDLAG  633



>gb|ACD39462.1| BEL14 protein [Solanum etuberosum]
Length=534

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EETKE+EN+ +     G       Q+  +  +DQKPNLVRI
Sbjct  344  WFINARVRLWKPMVEEMYLEETKEEENVGSPDGSKGLDDMTIHQSHIDHHQDQKPNLVRI  403

Query  757  DSECISSIINNHP  719
            DSECISSIIN+ P
Sbjct  404  DSECISSIINHQP  416


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 29/38 (76%), Gaps = 3/38 (8%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLH  269
            LFYPRD   D Q    SLLDSE QNLPYRNLMGAQLLH
Sbjct  500  LFYPRD---DDQVQYSSLLDSENQNLPYRNLMGAQLLH  534



>gb|ACD39465.1| BEL14 protein [Solanum palustre]
Length=534

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EETKE+EN+ +     G       Q+  +  +DQKPNL RI
Sbjct  344  WFINARVRLWKPMVEEMYLEETKEEENVGSPDGSKGLDDMTIHQSHIDHHQDQKPNLARI  403

Query  757  DSECISSIINNHP  719
            DSECISSIIN+ P
Sbjct  404  DSECISSIINHQP  416


 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 29/38 (76%), Gaps = 3/38 (8%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLH  269
            LFYPRD   D Q    SLLDSE QNLPYRNLMGAQLLH
Sbjct  500  LFYPRD---DDQVQYSSLLDSENQNLPYRNLMGAQLLH  534



>gb|AAN03624.1|AF406700_1 BEL1-related homeotic protein 14 [Solanum tuberosum]
Length=532

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 62/84 (74%), Gaps = 6/84 (7%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTE----DQKPN  770
            WFINARVRLWKPMVEEMY+EETKE+EN+   S D  +A   ++   ++  +    DQKPN
Sbjct  346  WFINARVRLWKPMVEEMYLEETKEEENV--GSPDGSKALIDDMTIHQSHIDHHQADQKPN  403

Query  769  LVRIDSECISSIINNHPAADDNKN  698
            LVRIDSECISSIIN+ P   +++N
Sbjct  404  LVRIDSECISSIINHQPHEKNDQN  427



>ref|XP_004503684.1| PREDICTED: homeobox protein BEL1 homolog [Cicer arietinum]
Length=604

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 88/231 (38%), Positives = 114/231 (49%), Gaps = 40/231 (17%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNL---QNPRNDTEDQKPNL  767
            WFINARVRLWKPMVEEMY+EE KEQ+    TS+        N+   Q+P    ED+KP L
Sbjct  409  WFINARVRLWKPMVEEMYLEEEKEQQRKTTTSEGGNNEENINVIQNQSPTQAHEDEKPRL  468

Query  766  VRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGPVG  587
            VRI+SEC+SSIINN     D+KN A ++ +                         FG V 
Sbjct  469  VRINSECVSSIINNQ----DHKNEANKNMNPQLANDT------------------FGSVD  506

Query  586  MDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaafss  407
            +DFSSY+ +   AA++                 + +   G       G           +
Sbjct  507  IDFSSYHSSDMVAAYT-------------TSDHNHNFHGGSGVSLTLGLQQHGGNGVSLA  553

Query  406  aasqsssSLFYPRDQMEDCQTVPYSLLDS-EGQN-LPYRNLMGAQLLHDLA  260
              S + + +FY RD     + V YSLLD  +G N +PYRNLMG QLLHDLA
Sbjct  554  FPSTTQTPMFYTRDDDHIEEPVQYSLLDGDQGTNIMPYRNLMGTQLLHDLA  604



>ref|XP_004298825.1| PREDICTED: homeobox protein BEL1 homolog [Fragaria vesca subsp. 
vesca]
Length=652

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 55/82 (67%), Gaps = 9/82 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDT---EDQKPN-  770
            WFINARVRLWKPMVEEMY+EETKE EN +  S  +G     +L +P       EDQKP  
Sbjct  446  WFINARVRLWKPMVEEMYMEETKEHENNINMSSSDG-VTTDHLGDPSTHMTRPEDQKPTQ  504

Query  769  ----LVRIDSECISSIINNHPA  716
                LVRIDSEC+SSII N+P 
Sbjct  505  DQLQLVRIDSECLSSIITNNPG  526


 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 2/44 (5%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYS-LLDSEGQN-LPYRNLMGAQLLHDLAG  257
            LFYPRD +E+CQ V YS LLD EGQN LPYRNLMGAQLLHDLAG
Sbjct  609  LFYPRDHIEECQPVQYSSLLDGEGQNNLPYRNLMGAQLLHDLAG  652



>ref|XP_011080922.1| PREDICTED: homeobox protein BEL1 homolog [Sesamum indicum]
Length=648

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 58/86 (67%), Gaps = 21/86 (24%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNL------------QNPRN  794
            WFINARVRLWKPMVEEMY+EE KE+E +      +G +AA NL            QNP +
Sbjct  437  WFINARVRLWKPMVEEMYLEEQKEEEGI-----GDGASAAANLDDNHHDHHGLTIQNP-S  490

Query  793  DTEDQKP---NLVRIDSECISSIINN  725
             T+DQKP    LVRIDSEC+SSIINN
Sbjct  491  RTKDQKPAHDQLVRIDSECLSSIINN  516


 Score = 87.8 bits (216),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            LFYPRD MEDCQTV YSLLDSE QNLPYRNLMGAQLLHDLAG
Sbjct  607  LFYPRDHMEDCQTVQYSLLDSENQNLPYRNLMGAQLLHDLAG  648



>gb|ACU01963.1| bell1-like protein [Comandra umbellata]
Length=342

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 69/135 (51%), Gaps = 26/135 (19%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN---LLATSDDNGEAAARNLQN---PRNDTEDQK  776
            WFINARVRLWKPMVEEMY+EETKEQE    L A  + NG   +R  QN     +  +DQK
Sbjct  120  WFINARVRLWKPMVEEMYLEETKEQEQDHALNANDEHNGNGNSRPKQNHPPHHSQAKDQK  179

Query  775  PN----LVRIDSECISSIIN-NHPAADDNKNNageddhhhhhlhqqaaalqilgargggg  611
            P     + R+DSEC+SSII+  HP +   K+                             
Sbjct  180  PTPDQLVTRMDSECLSSIISPTHPKSLSTKHTKTLQSMGRVAQAANPN------------  227

Query  610  DHQFGPVGMDFSSYN  566
               FG V +DF++YN
Sbjct  228  ---FGAVELDFTNYN  239


 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 33/45 (73%), Gaps = 3/45 (7%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEG---QNLPYRNLMGAQLLHDLAG  257
            L Y R  +EDCQTV YSLLD      QNL YRNLMGAQLLHDLAG
Sbjct  298  LLYSRGHIEDCQTVEYSLLDHSSEAQQNLQYRNLMGAQLLHDLAG  342



>ref|NP_001266274.1| bell-like homeodomain protein 3 [Solanum lycopersicum]
 gb|AEW69798.1| Hop-interacting protein THI035 [Solanum lycopersicum]
Length=624

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAA--RNLQNPRNDTEDQKPNLV  764
            WFINARVRLWKPMVEEMY+EETKE+E     S D  +A      + N ++   DQKPNLV
Sbjct  425  WFINARVRLWKPMVEEMYLEETKEEEEENVGSQDGSKALIDEMTINNHQSSHIDQKPNLV  484

Query  763  RIDSECISSIINNHPAADDNKN  698
            RI+SECISSIIN+HP   +++N
Sbjct  485  RIESECISSIINHHPHDKNDQN  506


 Score = 63.5 bits (153),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 33/42 (79%), Gaps = 2/42 (5%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            LFYPRD  +  Q    SLLDSE QNLPYRNLMGAQLLHDLAG
Sbjct  585  LFYPRDDHDQVQYS--SLLDSENQNLPYRNLMGAQLLHDLAG  624



>ref|XP_010325299.1| PREDICTED: bell-like homeodomain protein 3 isoform X1 [Solanum 
lycopersicum]
Length=644

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 2/82 (2%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAA--RNLQNPRNDTEDQKPNLV  764
            WFINARVRLWKPMVEEMY+EETKE+E     S D  +A      + N ++   DQKPNLV
Sbjct  445  WFINARVRLWKPMVEEMYLEETKEEEEENVGSQDGSKALIDEMTINNHQSSHIDQKPNLV  504

Query  763  RIDSECISSIINNHPAADDNKN  698
            RI+SECISSIIN+HP   +++N
Sbjct  505  RIESECISSIINHHPHDKNDQN  526


 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 33/42 (79%), Gaps = 2/42 (5%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            LFYPRD  +  Q    SLLDSE QNLPYRNLMGAQLLHDLAG
Sbjct  605  LFYPRDDHDQVQYS--SLLDSENQNLPYRNLMGAQLLHDLAG  644



>gb|AAP47023.1|AF375964_1 bell-like homeodomain protein 3 [Solanum lycopersicum]
Length=523

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 59/82 (72%), Gaps = 2/82 (2%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAA--RNLQNPRNDTEDQKPNLV  764
            WFINARVRLWKPMVEEMY+EETKE+E     S D  +A      + N ++    QKPNLV
Sbjct  324  WFINARVRLWKPMVEEMYLEETKEEEEENVGSQDGSKALIDEMTINNHQSSHIVQKPNLV  383

Query  763  RIDSECISSIINNHPAADDNKN  698
            RI+SECISSIIN+HP   +++N
Sbjct  384  RIESECISSIINHHPHDKNDQN  405


 Score = 63.5 bits (153),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 33/42 (79%), Gaps = 2/42 (5%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            LFYPRD  +  Q    SLLDSE QNLPYRNLMGAQLLHDLAG
Sbjct  484  LFYPRDDHDQVQYS--SLLDSENQNLPYRNLMGAQLLHDLAG  523



>emb|CBI34373.3| unnamed protein product [Vitis vinifera]
Length=445

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 61/113 (54%), Gaps = 13/113 (12%)
 Frame = -2

Query  595  PVGMDFSSYNHNSAGAAFSYaavggsggknggggggsvsltlglqqqggsggmglaaaaa  416
            PV +DFSSYNH++AGA                    +     G       G      +  
Sbjct  346  PVELDFSSYNHHTAGAV-------------SFTNDSAHHNFGGSGVSLTLGLQQHGGSGV  392

Query  415  fssaasqsssSLFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
              + +  S SSLFY RD +EDCQ V YSLLD EGQNLPYRNLMGAQLLHDLAG
Sbjct  393  SLAFSPASQSSLFYSRDPIEDCQPVQYSLLDGEGQNLPYRNLMGAQLLHDLAG  445


 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 5/41 (12%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENL-----LATSDDNG  830
            WFINARVRLWKPMVEEMY+EETKEQ+NL         DDNG
Sbjct  297  WFINARVRLWKPMVEEMYLEETKEQDNLGSPDGATDPDDNG  337



>gb|EYU23458.1| hypothetical protein MIMGU_mgv1a002357mg [Erythranthe guttata]
Length=684

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 59/94 (63%), Gaps = 17/94 (18%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATS----------DDNGEAAARNLQNPRNDT  788
            WFINARVRLWKPMVEEMY+EE KE E +              +++G  +++N     + +
Sbjct  471  WFINARVRLWKPMVEEMYLEELKEDEGVAGDGSGGGGGAAVYENDGLMSSQN----HSRS  526

Query  787  EDQKPN---LVRIDSECISSIINNHPAADDNKNN  695
            ED KP+   LVR+DSEC+SSIINN+  A  NK  
Sbjct  527  EDLKPSHDQLVRMDSECLSSIINNNNEAKRNKGG  560



>ref|XP_007160096.1| hypothetical protein PHAVU_002G292000g [Phaseolus vulgaris]
 gb|ESW32090.1| hypothetical protein PHAVU_002G292000g [Phaseolus vulgaris]
Length=647

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLA  260
            +FY RDQ+E+CQTV YSLLD EGQN+PYRNLMG QLLHDL 
Sbjct  607  MFYARDQIEECQTVQYSLLDGEGQNMPYRNLMGTQLLHDLV  647


 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 68/123 (55%), Gaps = 13/123 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EE KE +N +A+S+  G     +   PR D +  +  L+RI
Sbjct  460  WFINARVRLWKPMVEEMYLEEEKEHQNDVASSEGGGANPEGDQNAPREDQKPTQARLLRI  519

Query  757  DSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGPVGMDF  578
            DSE +SS++ +    +D K+  G  + +  +     A               FG V +DF
Sbjct  520  DSESVSSMVTSTDHKNDTKSGKGLQNDNQLNDSSHPAEA-------------FGSVELDF  566

Query  577  SSY  569
            SSY
Sbjct  567  SSY  569



>ref|XP_008783445.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
 ref|XP_008783446.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
 ref|XP_008783447.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
Length=607

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            LF+ R QMEDCQ   +S+LD E QNLPYRNLMGAQLLHDLAG
Sbjct  566  LFFSRAQMEDCQPGQFSILDGEAQNLPYRNLMGAQLLHDLAG  607


 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 50/85 (59%), Gaps = 14/85 (16%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAAR--NLQNPRN----------  794
            WFINARVRLWKPMVEEMY EE KEQ+   +  ++NG    R   LQ+ RN          
Sbjct  402  WFINARVRLWKPMVEEMYSEEIKEQDKQTSQEENNGHNNCRPGELQSKRNPNPNSSSLQL  461

Query  793  DTEDQKPNLVRI--DSECISSIINN  725
              EDQKP    +   S+ +SSI+N+
Sbjct  462  HAEDQKPTPGELLNCSDSLSSIVNS  486



>ref|XP_010919091.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
 ref|XP_010919093.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
 ref|XP_010919094.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
Length=599

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            LF+ R QMEDCQ   +S+LD E QNLPYRNLMGAQLLHDLAG
Sbjct  558  LFFSRAQMEDCQPGQFSILDGETQNLPYRNLMGAQLLHDLAG  599


 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 54/93 (58%), Gaps = 17/93 (18%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLA-------TSDDN--GEAAARNLQNPRNDT-  788
            WFINARVRLWKPMVEEMY+EE KE++   A         +DN  GE  +    NP + + 
Sbjct  396  WFINARVRLWKPMVEEMYLEEIKEKDKQTAQEEEEEEEEEDNRPGEIHSNRNPNPNSSSL  455

Query  787  ----EDQKPNLVRI--DSECISSIIN-NHPAAD  710
                EDQKP    +   S+ +SSI+N +H  AD
Sbjct  456  QLHVEDQKPAPGELLNYSDSLSSIVNSSHHRAD  488



>ref|XP_010934930.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
Length=575

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVE+MY+EE KEQ +  + +   G+    N +   +   DQKP  V++
Sbjct  384  WFINARVRLWKPMVEDMYLEEVKEQNSQSSNATTTGQQDNTNRKPNPDPVLDQKPAPVQL  443

Query  757  --DSECISSIINNHPAAD  710
              DS+ +SSIIN+   +D
Sbjct  444  LNDSDSLSSIINSSHQSD  461


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = -2

Query  382  LFYPRDQMED-CQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            L + R+ ++D  Q V +++LD E Q LPYRN+MGAQLLHDLAG
Sbjct  533  LLFSREHIDDDGQQVQFTILDGEAQTLPYRNMMGAQLLHDLAG  575



>gb|EPS58139.1| hypothetical protein M569_16677, partial [Genlisea aurea]
Length=459

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 59/129 (46%), Gaps = 37/129 (29%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKP---NL  767
            WFINARVRLWKPMVEEMY EE KE E                 ++P     DQKP   + 
Sbjct  295  WFINARVRLWKPMVEEMYREELKESET--------------GQKDP-----DQKPTRQHF  335

Query  766  VRIDSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGP-V  590
             R DSEC+SSIIN    ADD      ++           A               +GP +
Sbjct  336  RRTDSECLSSIIN----ADDKNGGQRKNKEAAAIHQNLTAFSSSS----------YGPQM  381

Query  589  GMDFSSYNH  563
             MDFSSY H
Sbjct  382  EMDFSSYAH  390


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  367  DQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            +QME+CQ   ++LL+SE Q LPYRNLMGAQLLHDLAG
Sbjct  423  EQMEECQNQQFTLLESENQTLPYRNLMGAQLLHDLAG  459



>ref|XP_009384235.1| PREDICTED: homeobox protein BEL1 homolog [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384242.1| PREDICTED: homeobox protein BEL1 homolog [Musa acuminata subsp. 
malaccensis]
Length=558

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 7/74 (9%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNP-RNDTEDQK--PNL  767
            WFINARVRLWKPMVEEMY+EETKE +N      +       +  NP  N + DQK  P  
Sbjct  381  WFINARVRLWKPMVEEMYLEETKELDN----QSNQAANGPEDSDNPNSNLSFDQKPLPAQ  436

Query  766  VRIDSECISSIINN  725
            + +DSE +SSIIN+
Sbjct  437  LLVDSESLSSIINS  450


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLA  260
            L + R+ ++  Q   +S+LD E +NL YRNLMGAQLLHDLA
Sbjct  517  LLFSRETIDGDQQAQFSILDGEAENLRYRNLMGAQLLHDLA  557



>ref|XP_007208166.1| hypothetical protein PRUPE_ppa002583mg [Prunus persica]
 gb|EMJ09365.1| hypothetical protein PRUPE_ppa002583mg [Prunus persica]
Length=655

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 49/87 (56%), Gaps = 16/87 (18%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPR--NDTEDQKPNLV  764
            WFINARVRLWKPMVEEMYVEETKEQE        NG   +RN  N +    T  ++    
Sbjct  401  WFINARVRLWKPMVEEMYVEETKEQEK-------NG---SRNTANYKESGSTTPRESAST  450

Query  763  RIDSECISS----IINNHPAADDNKNN  695
            RID +   S      N HP+ ++  NN
Sbjct  451  RIDDQMFRSTHENFSNQHPSPNEKSNN  477



>ref|XP_008230296.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008230304.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
Length=655

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 47/85 (55%), Gaps = 12/85 (14%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMYVEETKEQE        NG     N +   + T  +  +  RI
Sbjct  401  WFINARVRLWKPMVEEMYVEETKEQEK-------NGSGNNANYKESGSTTPRESAS-TRI  452

Query  757  DSECISS----IINNHPAADDNKNN  695
            D +   S      N HP+ ++  NN
Sbjct  453  DDQMFRSTHENFSNQHPSPNEKSNN  477



>gb|KHG11905.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=653

 Score = 67.0 bits (162),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDD------NGEAAARNLQNP--RNDTED  782
            WFINARVRLWKPMVEEMY+EE KEQE    TSDD      N E +A     P  +N  E+
Sbjct  399  WFINARVRLWKPMVEEMYLEEIKEQEQ-NGTSDDKTSKTENHEDSASKSTAPSCQNPGEN  457

Query  781  QKPNLVRIDSECISSIINN  725
            QK +L+ I +   S +  N
Sbjct  458  QKVSLMSISTASTSPLAGN  476



>gb|KHG11906.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=680

 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDD------NGEAAARNLQNP--RNDTED  782
            WFINARVRLWKPMVEEMY+EE KEQE    TSDD      N E +A     P  +N  E+
Sbjct  426  WFINARVRLWKPMVEEMYLEEIKEQEQ-NGTSDDKTSKTENHEDSASKSTAPSCQNPGEN  484

Query  781  QKPNLVRIDSECISSIINN  725
            QK +L+ I +   S +  N
Sbjct  485  QKVSLMSISTASTSPLAGN  503



>ref|XP_009396189.1| PREDICTED: homeobox protein BEL1 homolog [Musa acuminata subsp. 
malaccensis]
Length=552

 Score = 66.2 bits (160),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPR-NDTEDQKPNLVR  761
            WFINARVR+WKPMVE+MY EET E +   + S   G   + N QNP+ N T ++KP  V+
Sbjct  360  WFINARVRIWKPMVEDMYAEETMELDG-HSNSPTTGHQHSNN-QNPKPNSTLERKPLPVQ  417

Query  760  I--DSECISSIINNHPAADDN  704
            +  DSE +SS+IN+    D N
Sbjct  418  LLDDSESLSSLINSSHHDDQN  438



>ref|XP_008794767.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
 ref|XP_008794768.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
Length=571

 Score = 66.2 bits (160),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 10/82 (12%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENL---LATSDDNGEAAARNLQNP-RNDTEDQKPN  770
            WFINARVRLWKPMVEEMY E+ KEQ+NL    ATS  +   ++    NP  N +  QKP 
Sbjct  383  WFINARVRLWKPMVEEMYSEDMKEQDNLSSHAATSHQDNNTSS----NPNHNSSLSQKPA  438

Query  769  LVRI--DSECISSIINNHPAAD  710
              ++  DS+ +SSIIN    +D
Sbjct  439  PGQLLNDSDSLSSIINGSHRSD  460


 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            L + R+ ++D Q + +++LD E + LPYRN+MGAQLLHDLAG
Sbjct  530  LLFSREHIDDGQQLQFAILDGEARTLPYRNVMGAQLLHDLAG  571



>ref|XP_010676435.1| PREDICTED: homeobox protein BEL1 homolog [Beta vulgaris subsp. 
vulgaris]
Length=731

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 3/44 (7%)
 Frame = -2

Query  382  LFYPRDQMEDCQTV--PYSLLDS-EGQNLPYRNLMGAQLLHDLA  260
            LFYPRD M+DCQ V   YSLLD  +GQNLPYRNLMGAQ+L D A
Sbjct  688  LFYPRDHMDDCQQVHHQYSLLDGDQGQNLPYRNLMGAQVLQDFA  731


 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 51/79 (65%), Gaps = 9/79 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE--NLLATSD--DNGEAAARNLQN-----PRNDTE  785
            WFINARVRLWKPMVE+MY+EETKEQ+  N+ ++SD  D+  +   +L       P  D +
Sbjct  496  WFINARVRLWKPMVEQMYLEETKEQQDKNMGSSSDGTDHQLSCTDHLGGILPPPPPQDQK  555

Query  784  DQKPNLVRIDSECISSIIN  728
                 L+RID   +SSI+N
Sbjct  556  PDPDQLIRIDPGSLSSIVN  574



>ref|XP_011042587.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042589.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042590.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042591.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042592.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042593.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=679

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 6/67 (9%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ-----ENLLATSDDNGEAAARN-LQNPRNDTEDQK  776
            WFINARVRLWKPMVEEMY EE KEQ     E+  + SD N ++A+R+ LQ   + +E+Q 
Sbjct  408  WFINARVRLWKPMVEEMYTEEIKEQEQDGSEDKTSKSDHNEDSASRSVLQEKGSASENQT  467

Query  775  PNLVRID  755
             N   +D
Sbjct  468  RNFKSLD  474



>ref|XP_006373820.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 ref|XP_002323384.2| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 ref|XP_006373821.1| BEL1-like homeodomain 1 family protein [Populus trichocarpa]
 ref|XP_006373822.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|ERP51617.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|EEF05145.2| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|ERP51618.1| BEL1-like homeodomain 1 family protein [Populus trichocarpa]
 gb|ERP51619.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
Length=679

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 6/67 (9%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ-----ENLLATSDDNGEAAARN-LQNPRNDTEDQK  776
            WFINARVRLWKPMVEEMY EE KEQ     E+  + SD N ++A+R+ LQ   + +E+Q 
Sbjct  408  WFINARVRLWKPMVEEMYTEEIKEQEQDGSEDKTSKSDHNEDSASRSVLQEKGSASENQT  467

Query  775  PNLVRID  755
             N   +D
Sbjct  468  RNFKSLD  474



>ref|XP_006649302.1| PREDICTED: homeobox protein BEL1 homolog [Oryza brachyantha]
Length=592

 Score = 63.5 bits (153),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 46/88 (52%), Gaps = 27/88 (31%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPR-------------  797
            WFINARVRLWKPMVEEMYVEE K         D +G +  +   NPR             
Sbjct  383  WFINARVRLWKPMVEEMYVEEMK---------DKDGGSGGQGSLNPRPSCSHASEQLVVG  433

Query  796  --NDTEDQKPN---LVRIDSECISSIIN  728
              +   +QKP    LVR D+  ++S++N
Sbjct  434  DGDAGGEQKPTRAQLVRHDAGSLASVVN  461



>ref|XP_009418083.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=581

 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 58/125 (46%), Gaps = 12/125 (10%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EE  EQE+  +  D++ +  A N  N    +++Q      I
Sbjct  387  WFINARVRLWKPMVEEMYLEEILEQEDQTSLGDNSNDDDAINPPNHPQSSQNQN----SI  442

Query  757  DSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGPVGMDF  578
             + C   I    PAA     ++            +                 FG V +DF
Sbjct  443  YNSCEVDIEEQKPAAGQLLTDSDSLSWIVSSSSARDRISSKSSD--------FGAVDLDF  494

Query  577  SSYNH  563
            SSYNH
Sbjct  495  SSYNH  499


 Score = 60.5 bits (145),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            L Y ++QME+C    +S+LD E QNL YRNLMGAQLL DLAG
Sbjct  540  LVYSKEQMEECHPSQFSILDGEAQNLHYRNLMGAQLLRDLAG  581



>ref|XP_009418082.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=601

 Score = 63.2 bits (152),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 58/125 (46%), Gaps = 12/125 (10%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EE  EQE+  +  D++ +  A N  N    +++Q      I
Sbjct  407  WFINARVRLWKPMVEEMYLEEILEQEDQTSLGDNSNDDDAINPPNHPQSSQNQN----SI  462

Query  757  DSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGPVGMDF  578
             + C   I    PAA     ++            +                 FG V +DF
Sbjct  463  YNSCEVDIEEQKPAAGQLLTDSDSLSWIVSSSSARDRISSKSSD--------FGAVDLDF  514

Query  577  SSYNH  563
            SSYNH
Sbjct  515  SSYNH  519


 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            L Y ++QME+C    +S+LD E QNL YRNLMGAQLL DLAG
Sbjct  560  LVYSKEQMEECHPSQFSILDGEAQNLHYRNLMGAQLLRDLAG  601



>ref|XP_011090301.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
 ref|XP_011090302.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
Length=629

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDN  833
            WFINARVRLWKPMVEEMY+EETK QE + A+ D+ 
Sbjct  405  WFINARVRLWKPMVEEMYLEETKNQEQISASQDNT  439



>ref|XP_008387112.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387113.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387114.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=703

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 6/78 (8%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLAT---SDDNGEAAARNLQNPRNDTEDQKPNL  767
            WFINARVRLWKPMVEEMY+EE KEQE   ++   S  NG++A+++      DTE+Q  + 
Sbjct  429  WFINARVRLWKPMVEEMYMEEVKEQEQNGSSEKMSKSNGDSASKS--TAPQDTENQTTST  486

Query  766  VRIDSE-CISSIINNHPA  716
                 E  ++  +  HP+
Sbjct  487  FNFKQENSVNHNLAAHPS  504



>gb|EMT30798.1| BEL1-like homeodomain protein 1 [Aegilops tauschii]
Length=329

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNG  830
            WFINARVRLWKPMVEEMY+EETKE +      DD G
Sbjct  196  WFINARVRLWKPMVEEMYLEETKEHQQQQDGGDDKG  231



>ref|XP_009389789.1| PREDICTED: homeobox protein BEL1 homolog [Musa acuminata subsp. 
malaccensis]
Length=605

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 52/78 (67%), Gaps = 7/78 (9%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSD--DNGEAAARNL---QNPRNDTEDQKP  773
            WFINARVRLWKPMVEEMY+EETKEQEN  +  +  ++ +   RNL       ++ ED+KP
Sbjct  417  WFINARVRLWKPMVEEMYLEETKEQENQTSQEENYNSSDNVNRNLIYNSCQVDNVEDRKP  476

Query  772  NLVRIDSE--CISSIINN  725
               ++ +E   +S +I+N
Sbjct  477  APGQLLTEPDSLSWVISN  494



>ref|XP_002275098.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=728

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EE K+QE+    S DN   +  N +     T  Q+    R+
Sbjct  450  WFINARVRLWKPMVEEMYLEEIKDQEH--NGSQDNASKSEANKELGSKSTAAQESGATRV  507

Query  757  D  755
            D
Sbjct  508  D  508



>dbj|BAJ88195.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=300

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDN  833
            WFINARVRLWKPMVEEMY+EETKE +      DD 
Sbjct  30   WFINARVRLWKPMVEEMYLEETKEHQQQQDGGDDK  64



>ref|XP_010089795.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXB38411.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=687

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGE  827
            WFINARVRLWKPMVEEMY+EETKEQE    ++  +G+
Sbjct  444  WFINARVRLWKPMVEEMYMEETKEQERNNGSTSQSGQ  480



>emb|CAC82983.1| putative BEL1-like protein [Gnetum gnemon]
Length=376

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPR  797
            WFINARVRLWKPMVEEMY+EE KE E+  + +D   +A A N QN +
Sbjct  32   WFINARVRLWKPMVEEMYMEEIKEAESQASAADS--KATAENEQNKK  76



>gb|EPS62339.1| hypothetical protein M569_12452, partial [Genlisea aurea]
Length=440

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 60/130 (46%), Gaps = 26/130 (20%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY EE KE E      D  G        + R  ++DQ   +  I
Sbjct  270  WFINARVRLWKPMVEEMYREEVKESE----ADDRGGGGGGGRRNDDRKPSQDQL--MTGI  323

Query  757  DSECISSIINNHPAADDNKNNageddhhhhhlhqqaaalqilgarggggDHQFGPVGMDF  578
            DS+C+S IINN  A   NK                 A L         G HQ   VG DF
Sbjct  324  DSDCLSYIINN--AKTKNKG----------------AILHQNPVAFADGGHQM--VGFDF  363

Query  577  SSYNHNSAGA  548
            SSY    A A
Sbjct  364  SSYAGQHAAA  373


 Score = 60.5 bits (145),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  367  DQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLA  260
            DQMEDCQ   +SLLDS+ Q L YRNLMGAQLLHDLA
Sbjct  405  DQMEDCQNAHFSLLDSDNQTLHYRNLMGAQLLHDLA  440



>ref|XP_010093716.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXC39356.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=422

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEA  824
            WFINARVRLWKPMVEEMY+EETKEQE    ++  +G+ 
Sbjct  179  WFINARVRLWKPMVEEMYMEETKEQERNNGSTSQSGQT  216



>ref|XP_009628712.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628714.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628715.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=700

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 62/92 (67%), Gaps = 16/92 (17%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE----NLLATS---DDNGEAAARNL----QNPRND  791
            WFINARVRLWKPMVEEMY+EE KEQE    +L  TS   + N ++ +R++    ++PR+D
Sbjct  417  WFINARVRLWKPMVEEMYLEEIKEQEQNGSDLEKTSKLGEQNEDSTSRSIGPQEKSPRSD  476

Query  790  TEDQKPNLVRIDSECISSIINNHPAADDNKNN  695
            +++ K  L + D    +++ N++PA+   K+N
Sbjct  477  SQN-KSFLSKHD----NNLANHNPASTIPKSN  503



>emb|CAN69527.1| hypothetical protein VITISV_027380 [Vitis vinifera]
Length=728

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EE K+QE+    S DN   +  N +     T  Q+    R+
Sbjct  450  WFINARVRLWKPMVEEMYLEEIKDQEH--NGSQDNXSKSEANKELGSKSTAAQESGATRV  507

Query  757  D  755
            D
Sbjct  508  D  508



>ref|XP_010557446.1| PREDICTED: BEL1-like homeodomain protein 5 isoform X2 [Tarenaya 
hassleriana]
Length=573

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 50/92 (54%), Gaps = 16/92 (17%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNL------QNPRN---DTE  785
            WFINARVRLWKPMVEEMY+EE K QE    T DDN      +       Q P N   D  
Sbjct  377  WFINARVRLWKPMVEEMYLEEMKGQE---ITKDDNLSEEEDDELERSRQQPPSNVQLDIL  433

Query  784  DQKPNLV----RIDSECISSIINNHPAADDNK  701
              +PNL      +  +C SS+++ +  A D++
Sbjct  434  PDRPNLFDNNNNVSDQCSSSMVSTNCLAADSR  465



>ref|XP_010557445.1| PREDICTED: BEL1-like homeodomain protein 5 isoform X1 [Tarenaya 
hassleriana]
Length=574

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 50/92 (54%), Gaps = 16/92 (17%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNL------QNPRN---DTE  785
            WFINARVRLWKPMVEEMY+EE K QE    T DDN      +       Q P N   D  
Sbjct  378  WFINARVRLWKPMVEEMYLEEMKGQE---ITKDDNLSEEEDDELERSRQQPPSNVQLDIL  434

Query  784  DQKPNLV----RIDSECISSIINNHPAADDNK  701
              +PNL      +  +C SS+++ +  A D++
Sbjct  435  PDRPNLFDNNNNVSDQCSSSMVSTNCLAADSR  466



>ref|XP_010941166.1| PREDICTED: homeobox protein BEL1 homolog [Elaeis guineensis]
Length=573

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            L + R+ M+D Q V +S+LD E ++LPYRN+MGAQLLHDLAG
Sbjct  532  LLFSREHMDDGQQVQFSILDGEARSLPYRNMMGAQLLHDLAG  573


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN  857
            WFINARVRLWKPM+EEMY +E  E  N
Sbjct  383  WFINARVRLWKPMIEEMYSQEMNEHNN  409



>ref|XP_006430060.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 ref|XP_006430061.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 gb|ESR43300.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 gb|ESR43301.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
Length=693

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVR  761
            WFINARVRLWKPMVEEMY+EE K+QE     S+D    +  N  +    T  Q+ NLV+
Sbjct  411  WFINARVRLWKPMVEEMYLEEIKDQEQ--NGSEDKTSKSEHNEDSASKSTAAQEKNLVK  467



>ref|NP_198957.1| homeobox protein BEL1 [Arabidopsis thaliana]
 sp|Q38897.2|BEL1_ARATH RecName: Full=Homeobox protein BEL1 homolog [Arabidopsis thaliana]
 dbj|BAB08513.1| homeotic protein BEL1 homolog [Arabidopsis thaliana]
 gb|AAK83580.1| AT5g41410/MYC6_12 [Arabidopsis thaliana]
 gb|AAO11553.1| At5g41410/MYC6_12 [Arabidopsis thaliana]
 gb|AAB05099.2| homeobox protein [Arabidopsis thaliana]
 gb|AED94676.1| homeobox protein BEL1-like protein [Arabidopsis thaliana]
Length=611

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 16/82 (20%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRN-DTEDQKPNLVR  761
            WFINARVRLWKPM+EEMY EET+ ++                + NP   DT+     L+R
Sbjct  441  WFINARVRLWKPMIEEMYCEETRSEQ--------------MEITNPMMIDTKPDPDQLIR  486

Query  760  IDSECISSIINNHPAADDNKNN  695
            ++ E +SSI+ N P +    N+
Sbjct  487  VEPESLSSIVTN-PTSKSGHNS  507



>ref|XP_010447491.1| PREDICTED: homeobox protein BEL1 homolog [Camelina sativa]
Length=617

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 13/72 (18%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRN-DTEDQKPNLVR  761
            WFINARVRLWKPM+EEMY EET+ ++ +  T+            NP   DT+     ++R
Sbjct  438  WFINARVRLWKPMIEEMYCEETRGEQIMEITT------------NPMMIDTKPDPNQIIR  485

Query  760  IDSECISSIINN  725
            ++ E +SSI+ N
Sbjct  486  VEPESLSSIVTN  497



>ref|XP_006481599.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006481600.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Citrus 
sinensis]
Length=693

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVR  761
            WFINARVRLWKPMVEEMY+EE K+QE     S+D    +  N  +    T  Q+ NLV+
Sbjct  411  WFINARVRLWKPMVEEMYLEEIKDQEQ--NGSEDKTSKSEHNEDSASKSTAAQEKNLVK  467



>gb|KDO70617.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70618.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70619.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70620.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
Length=693

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVR  761
            WFINARVRLWKPMVEEMY+EE K+QE     S+D    +  N  +    T  Q+ NLV+
Sbjct  411  WFINARVRLWKPMVEEMYLEEIKDQEQ--NGSEDKTSKSEHNEDSASKSTAAQEKNLVK  467



>gb|ACD39464.1| BEL5 protein [Solanum palustre]
Length=698

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDN  833
            WFINARVRLWKPMVEEMY+EE K QE    TS DN
Sbjct  451  WFINARVRLWKPMVEEMYLEEVKNQEQNSTTSGDN  485



>gb|AAK96704.1| homeotic protein BEL1 homolog [Arabidopsis thaliana]
Length=513

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 16/82 (20%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRN-DTEDQKPNLVR  761
            WFINARVRLWKPM+EEMY EET+ ++                + NP   DT+     L+R
Sbjct  441  WFINARVRLWKPMIEEMYCEETRSEQ--------------MEITNPMMIDTKPDPDQLIR  486

Query  760  IDSECISSIINNHPAADDNKNN  695
            ++ E +SSI+ N P +    N+
Sbjct  487  VEPESLSSIVTN-PTSKSGHNS  507



>gb|ACD39468.1| BEL5 protein [Solanum etuberosum]
Length=698

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDN  833
            WFINARVRLWKPMVEEMY+EE K QE    TS DN
Sbjct  451  WFINARVRLWKPMVEEMYLEEVKNQEQNSTTSGDN  485



>ref|XP_010557975.1| PREDICTED: BEL1-like homeodomain protein 1 [Tarenaya hassleriana]
Length=675

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 35/58 (60%), Gaps = 6/58 (10%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLV  764
            WFINARVRLWKPMVEEMY+EE KE E       +NG +  +   N   D ED  P  V
Sbjct  405  WFINARVRLWKPMVEEMYLEEMKEHE------KNNGSSKKKVNPNEHQDKEDSMPKSV  456



>gb|KEH29763.1| BEL1-related homeotic protein [Medicago truncatula]
Length=711

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/26 (96%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EETKEQE
Sbjct  452  WFINARVRLWKPMVEEMYLEETKEQE  477



>ref|XP_010533636.1| PREDICTED: homeobox protein BEL1 homolog [Tarenaya hassleriana]
 ref|XP_010533637.1| PREDICTED: homeobox protein BEL1 homolog [Tarenaya hassleriana]
Length=588

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 42/72 (58%), Gaps = 9/72 (13%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLV-R  761
            WFINARVRLWKPM+EEMY EET+         +   EA   N +N        +PN + R
Sbjct  442  WFINARVRLWKPMIEEMYSEETR--------GEQKDEANISNQENDMLTGPIHEPNRMNR  493

Query  760  IDSECISSIINN  725
            +D E +SSII N
Sbjct  494  VDPESLSSIITN  505



>ref|XP_003576293.1| PREDICTED: BEL1-like homeodomain protein 1 [Brachypodium distachyon]
 ref|XP_010237922.1| PREDICTED: BEL1-like homeodomain protein 1 [Brachypodium distachyon]
 ref|XP_010237923.1| PREDICTED: BEL1-like homeodomain protein 1 [Brachypodium distachyon]
Length=671

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN  857
            WFINARVRLWKPMVEEMY+EETKEQ+ 
Sbjct  412  WFINARVRLWKPMVEEMYLEETKEQQK  438



>ref|XP_011046419.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046420.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046421.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046422.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046423.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=679

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 5/48 (10%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE-----NLLATSDDNGEAAARNL  809
            WFINARVRLWKPMVEEMY+EE KEQE     +  + S+ N +AA+R++
Sbjct  408  WFINARVRLWKPMVEEMYMEEIKEQEQNGSDDKTSKSEHNEDAASRSV  455



>ref|XP_006381943.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381944.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381945.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_002308323.2| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381946.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381947.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381948.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59740.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59741.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59742.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|EEE91846.2| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59743.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59744.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59745.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
Length=678

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 5/48 (10%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ-----ENLLATSDDNGEAAARNL  809
            WFINARVRLWKPMVEEMY+EE KEQ     E+  + S+ N +AA+R++
Sbjct  407  WFINARVRLWKPMVEEMYMEEIKEQEQNGSEDKTSKSEHNEDAASRSV  454



>ref|XP_009395039.1| PREDICTED: homeobox protein BEL1 homolog [Musa acuminata subsp. 
malaccensis]
Length=516

 Score = 61.2 bits (147),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTE-DQKPNLVR  761
            WFINARVRLWKPMVEEMY+EETKE EN    +    E       NP +    DQKP  V+
Sbjct  344  WFINARVRLWKPMVEEMYLEETKELENQADQAPTGREHNDHPNPNPNSGLSFDQKPLPVQ  403

Query  760  --IDSECI  743
              +DSE +
Sbjct  404  PLVDSESL  411



>ref|XP_009787672.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787673.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787674.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=707

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 46/64 (72%), Gaps = 11/64 (17%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN----LLATS---DDNGEAAARNL----QNPRND  791
            WFINARVRLWKPMVEEMY+EE KEQE     L  TS   + N ++ +R++    ++PR+D
Sbjct  425  WFINARVRLWKPMVEEMYLEEIKEQEQNGSELEKTSKLREQNEDSTSRSIAPQEKSPRSD  484

Query  790  TEDQ  779
            ++++
Sbjct  485  SQNK  488



>ref|XP_008796900.1| PREDICTED: homeobox protein BEL1 homolog [Phoenix dactylifera]
Length=571

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 39/63 (62%), Gaps = 7/63 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPR---NDTEDQKPNL  767
            WFINARVRLWKPMVEEMY+EETKEQ     +   N     ++  NP    N   DQKP  
Sbjct  382  WFINARVRLWKPMVEEMYMEETKEQN----SQSSNATTGQQDDANPNPNLNPGLDQKPAP  437

Query  766  VRI  758
            V++
Sbjct  438  VQL  440


 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDSEGQNLPYRNLMGAQLLHDLAG  257
            L +  + ++D Q V +++LD E Q +PYRN+MGAQLLHDLAG
Sbjct  530  LLFSGEHVDDGQQVQFAILDGEAQTVPYRNMMGAQLLHDLAG  571



>ref|XP_010263012.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010263013.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=739

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 46/81 (57%), Gaps = 8/81 (10%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EETK+QE        NG +  +  ++  N+    K N  + 
Sbjct  461  WFINARVRLWKPMVEEMYLEETKDQE-------QNG-SEDKTSRSEVNEDSGSKSNAAQE  512

Query  757  DSECISSIINNHPAADDNKNN  695
            +S   +  I N  +  DN  N
Sbjct  513  NSPARTDQIKNFSSKQDNTTN  533



>ref|XP_002870636.1| hypothetical protein ARALYDRAFT_493837 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46895.1| hypothetical protein ARALYDRAFT_493837 [Arabidopsis lyrata subsp. 
lyrata]
Length=606

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 16/82 (20%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRN-DTEDQKPNLVR  761
            WFINARVRLWKPM+EEMY EET+ ++                + NP   DT+     L+R
Sbjct  436  WFINARVRLWKPMIEEMYCEETRGEQ--------------MEITNPMMIDTKPDPNQLIR  481

Query  760  IDSECISSIINNHPAADDNKNN  695
            ++ E +SSI+ N P +    N+
Sbjct  482  VEPESLSSIVTN-PTSKTGHNS  502



>ref|XP_002524053.1| bel1 homeotic protein, putative [Ricinus communis]
 gb|EEF38263.1| bel1 homeotic protein, putative [Ricinus communis]
Length=679

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 6/68 (9%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE-----NLLATSDDNGEAAARN-LQNPRNDTEDQK  776
            WFINARVRLWKPMVEEMY+EE KEQE     +  + S+ N  AA ++ LQ   +  E+Q 
Sbjct  406  WFINARVRLWKPMVEEMYLEEIKEQERNGSDDKTSKSEQNENAAPKSVLQEKGSAVENQT  465

Query  775  PNLVRIDS  752
             +   +D 
Sbjct  466  KSFKSLDG  473



>ref|XP_006663234.1| PREDICTED: BEL1-like homeodomain protein 1-like [Oryza brachyantha]
Length=576

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN  857
            WFINARVRLWKPMVEEMY+EETK+QE 
Sbjct  402  WFINARVRLWKPMVEEMYLEETKDQEG  428



>dbj|BAK05542.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85858.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97739.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=666

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDN  833
            WFINARVRLWKPMVEEMY+EETKE +      DD 
Sbjct  396  WFINARVRLWKPMVEEMYLEETKEHQQQQDGGDDK  430



>gb|KHG12855.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=644

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE--NLLATSDDNGEAAARN  812
            WFINARVRLWKPMVEEMY+EE KEQE  N  + S   G   A+N
Sbjct  392  WFINARVRLWKPMVEEMYLEEIKEQEQNNEDSASKSTGPTPAKN  435



>gb|KHG12856.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=763

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 2/44 (5%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE--NLLATSDDNGEAAARN  812
            WFINARVRLWKPMVEEMY+EE KEQE  N  + S   G   A+N
Sbjct  511  WFINARVRLWKPMVEEMYLEEIKEQEQNNEDSASKSTGPTPAKN  554



>ref|XP_010521016.1| PREDICTED: BEL1-like homeodomain protein 1 [Tarenaya hassleriana]
Length=662

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%), Gaps = 5/50 (10%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN----LLATSDDNGE-AAARNLQN  803
            WFINARVRLWKPMVEEMY+EE KEQE     +  T D+N E +A++++ N
Sbjct  423  WFINARVRLWKPMVEEMYLEEMKEQEKNNGPMDKTVDENNEDSASKSMSN  472



>ref|XP_010543869.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X2 [Tarenaya 
hassleriana]
Length=573

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 35/58 (60%), Gaps = 7/58 (12%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLV  764
            WFINARVRLWKPMVEEMYVEETK+Q       D N ++    +    N  ED  P  V
Sbjct  306  WFINARVRLWKPMVEEMYVEETKDQ-------DKNNDSTKEKISPNVNQDEDSMPKSV  356



>ref|XP_010543867.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543868.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X1 [Tarenaya 
hassleriana]
Length=594

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 35/58 (60%), Gaps = 7/58 (12%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLV  764
            WFINARVRLWKPMVEEMYVEETK+Q       D N ++    +    N  ED  P  V
Sbjct  327  WFINARVRLWKPMVEEMYVEETKDQ-------DKNNDSTKEKISPNVNQDEDSMPKSV  377



>emb|CDP15553.1| unnamed protein product [Coffea canephora]
Length=725

 Score = 60.5 bits (145),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 38/65 (58%), Gaps = 9/65 (14%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EETK  E     S+ N E  +         T  ++ N+ RI
Sbjct  453  WFINARVRLWKPMVEEMYLEETKNHEQ--DGSESNKELGS-------TSTTAKENNVARI  503

Query  757  DSECI  743
            D   I
Sbjct  504  DQRSI  508



>ref|XP_010436095.1| PREDICTED: homeobox protein BEL1 homolog [Camelina sativa]
Length=617

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 39/71 (55%), Gaps = 12/71 (17%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPM+EEMY EET+            GE           DT+     ++R+
Sbjct  439  WFINARVRLWKPMIEEMYCEETR------------GEQMESTTNPMMVDTKPDPNQIIRV  486

Query  757  DSECISSIINN  725
            + E +SSI+ N
Sbjct  487  EPESLSSIVTN  497



>gb|AFV46214.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=262

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EETK QE
Sbjct  48   WFINARVRLWKPMVEEMYLEETKNQE  73



>ref|XP_002974618.1| hypothetical protein SELMODRAFT_414952 [Selaginella moellendorffii]
 gb|EFJ24138.1| hypothetical protein SELMODRAFT_414952 [Selaginella moellendorffii]
Length=1125

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 41/70 (59%), Gaps = 9/70 (13%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE------NLLATSDDNGE---AAARNLQNPRNDTE  785
            WFINARVRLWKPMVEEMY EE KEQE       LLA  D+          +L + R+D  
Sbjct  789  WFINARVRLWKPMVEEMYQEEIKEQELGVASARLLADPDERHNHDGVGGDSLTSDRSDRG  848

Query  784  DQKPNLVRID  755
            D    L+++D
Sbjct  849  DMGAGLMQLD  858



>gb|KHG01894.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=634

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 5/71 (7%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ-----ENLLATSDDNGEAAARNLQNPRNDTEDQKP  773
            WFINARVRLWKPMVEEMY+EE KEQ     E   + S +N ++ +++    +  TE+++ 
Sbjct  395  WFINARVRLWKPMVEEMYLEEIKEQEQNGSEKKTSKSHNNEDSTSKSTAPDKTSTENKQD  454

Query  772  NLVRIDSECIS  740
            N +   + C S
Sbjct  455  NNIPNQNGCSS  465



>ref|XP_006283321.1| hypothetical protein CARUB_v10004359mg [Capsella rubella]
 gb|EOA16219.1| hypothetical protein CARUB_v10004359mg [Capsella rubella]
Length=633

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPM+EEMY EET+ ++ +     D        +     DT+     ++R+
Sbjct  438  WFINARVRLWKPMIEEMYCEETRGEQVM-----DITTTTTNPMMMMMIDTKPDPNQMIRV  492

Query  757  DSECISSIINN  725
            + E +SSI+ N
Sbjct  493  EPESLSSIVTN  503



>ref|XP_008391977.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008391978.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=708

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KEQE
Sbjct  434  WFINARVRLWKPMVEEMYLEEAKEQE  459



>ref|XP_009348973.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348980.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348985.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
Length=710

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KEQE
Sbjct  436  WFINARVRLWKPMVEEMYLEEAKEQE  461



>ref|XP_010676226.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=669

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENL  854
            WFINARVRLWKPM+EEMY EE KEQE L
Sbjct  427  WFINARVRLWKPMIEEMYTEELKEQERL  454



>dbj|BAK04585.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=342

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAA  818
            WFINARVRLWKPM+EEMY +E  E  + +++ DD+G AA+
Sbjct  301  WFINARVRLWKPMIEEMYADEFSEDSSAVSSRDDDGAAAS  340



>ref|XP_008360598.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008360599.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=710

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KEQE
Sbjct  436  WFINARVRLWKPMVEEMYLEEAKEQE  461



>ref|XP_010676227.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=627

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENL  854
            WFINARVRLWKPM+EEMY EE KEQE L
Sbjct  427  WFINARVRLWKPMIEEMYTEELKEQERL  454



>ref|XP_004978737.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Setaria 
italica]
 ref|XP_004978738.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Setaria 
italica]
 ref|XP_004978739.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Setaria 
italica]
 ref|XP_004978740.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Setaria 
italica]
 ref|XP_004978741.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X5 [Setaria 
italica]
 ref|XP_004978742.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X6 [Setaria 
italica]
 ref|XP_004978743.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X7 [Setaria 
italica]
 ref|XP_004978744.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X8 [Setaria 
italica]
Length=662

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN  857
            WFINARVRLWKPMVEEMY+EETK+Q+ 
Sbjct  394  WFINARVRLWKPMVEEMYLEETKDQDG  420



>ref|XP_006361091.1| PREDICTED: BEL1-related homeotic protein 5 [Solanum tuberosum]
Length=684

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE-NLLATSDDNGEAAARN  812
            WFINARVRLWKPMVEEMY+EE K QE N   TS DN    A N
Sbjct  441  WFINARVRLWKPMVEEMYLEEVKNQEQNSTNTSGDNKNKEAPN  483



>gb|KFK33010.1| hypothetical protein AALP_AA6G318600 [Arabis alpina]
Length=588

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 40/70 (57%), Gaps = 12/70 (17%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPM+EEMY EET+            GE    N  +   DT+     ++R+
Sbjct  428  WFINARVRLWKPMIEEMYCEETR------------GEQMEMNTNSMLIDTKPDPNQIMRV  475

Query  757  DSECISSIIN  728
            + E +SSI+ 
Sbjct  476  EPESLSSIVT  485


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 2/43 (5%)
 Frame = -2

Query  382  LFYPRDQMED--CQTVPYSLLDSEGQNLPYRNLMGAQLLHDLA  260
            L+Y RD +E+   Q  P  L D + QNLPYRNLMGAQLLHD+ 
Sbjct  546  LYYGRDHIEEGSVQYAPSILDDDQAQNLPYRNLMGAQLLHDMV  588



>ref|XP_010059079.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW90459.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
 gb|KCW90460.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
Length=703

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 35/57 (61%), Gaps = 6/57 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNL  767
            WFINARVRLWKPMVEEMY EE KEQE       + G A  +  ++ R D+  +   L
Sbjct  421  WFINARVRLWKPMVEEMYTEEIKEQE------QNGGGAEEKPSKSEREDSASKSSGL  471



>ref|XP_010247184.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247191.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247201.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247208.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247219.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247226.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247233.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=729

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KEQE
Sbjct  453  WFINARVRLWKPMVEEMYLEEIKEQE  478



>ref|XP_002450321.1| hypothetical protein SORBIDRAFT_05g003750 [Sorghum bicolor]
 gb|EES09309.1| hypothetical protein SORBIDRAFT_05g003750 [Sorghum bicolor]
Length=690

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN  857
            WFINARVRLWKPMVEEMY+EETK+Q+ 
Sbjct  415  WFINARVRLWKPMVEEMYLEETKDQDG  441



>ref|XP_007145789.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
 gb|ESW17783.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
Length=649

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (67%), Gaps = 7/69 (10%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNP--RNDTEDQKPNLV  764
            WFINARVRLWKPMVEEMY+EE KE E  L  S+   E ++++ ++P  +N T  +K    
Sbjct  388  WFINARVRLWKPMVEEMYLEEMKEHE--LNGSE---EKSSKSGEDPAMKNSTPREKHPTS  442

Query  763  RIDSECISS  737
             I+S+  SS
Sbjct  443  EIESKSFSS  451



>ref|XP_010107001.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXC12999.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=441

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KEQE
Sbjct  161  WFINARVRLWKPMVEEMYLEEIKEQE  186



>gb|AFK36785.1| unknown [Lotus japonicus]
Length=274

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 6/66 (9%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE----NLLATSDDNGEAAARNLQNPRNDTEDQKPN  770
            WFINARVRLWKPMVEEMY EE  + E    NLL  S++  +A+  ++Q   N  E+ +  
Sbjct  54   WFINARVRLWKPMVEEMYKEEFGDSEMSSSNLL--SENTPKASREDVQVSGNKREESRDK  111

Query  769  LVRIDS  752
            L  IDS
Sbjct  112  LTTIDS  117



>ref|XP_002313498.2| hypothetical protein POPTR_0009s02250g [Populus trichocarpa]
 gb|EEE87453.2| hypothetical protein POPTR_0009s02250g [Populus trichocarpa]
Length=662

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY EE KEQE
Sbjct  459  WFINARVRLWKPMVEEMYAEEIKEQE  484



>ref|NP_001274921.1| BEL1-related homeotic protein 5 [Solanum tuberosum]
 gb|AAN03621.1|AF406697_1 BEL1-related homeotic protein 5 [Solanum tuberosum]
Length=688

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE-NLLATSDDN  833
            WFINARVRLWKPMVEEMY+EE K QE N   TS DN
Sbjct  442  WFINARVRLWKPMVEEMYLEEVKNQEQNSTNTSGDN  477



>dbj|BAE71188.1| BEL1-like homeodomain transcription factor [Trifolium pratense]
Length=651

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 2/35 (6%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDN  833
            WFINARVRLWKPMVEEMY EE KEQE  +  S+DN
Sbjct  397  WFINARVRLWKPMVEEMYTEEMKEQE--MNGSEDN  429



>ref|XP_004985907.1| PREDICTED: homeobox protein BEL1 homolog isoform X1 [Setaria 
italica]
 ref|XP_004985908.1| PREDICTED: homeobox protein BEL1 homolog isoform X2 [Setaria 
italica]
 ref|XP_004985909.1| PREDICTED: homeobox protein BEL1 homolog isoform X3 [Setaria 
italica]
Length=620

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 5/46 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNP  800
            WFINARVRLWKPMVEEMYVEE K+ +      DD G +  ++  NP
Sbjct  392  WFINARVRLWKPMVEEMYVEEMKDGQ-----LDDGGGSGGQHSVNP  432



>ref|XP_008442920.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=713

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KEQE
Sbjct  431  WFINARVRLWKPMVEEMYMEEIKEQE  456



>ref|XP_001779432.1| predicted protein [Physcomitrella patens]
 gb|EDQ55710.1| predicted protein [Physcomitrella patens]
Length=1060

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQ  779
            WFINARVRLWKPMVEEMYVEE KE     +T+    E  AR+     N+T +Q
Sbjct  710  WFINARVRLWKPMVEEMYVEEQKEYSEDHSTALAQSERMARDQVEIENNTYEQ  762



>ref|XP_008679683.1| PREDICTED: BEL1-like homeodomain protein 1 [Zea mays]
 ref|XP_008679684.1| PREDICTED: BEL1-like homeodomain protein 1 [Zea mays]
 ref|XP_008679685.1| PREDICTED: BEL1-like homeodomain protein 1 [Zea mays]
 gb|AFW65581.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 1 [Zea mays]
 gb|AFW65582.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 2 [Zea mays]
 gb|AFW65583.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 3 [Zea mays]
 gb|AFW65584.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 4 [Zea mays]
 gb|AFW65585.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 5 [Zea mays]
 gb|AFW65586.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 6 [Zea mays]
Length=671

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EETK+Q+
Sbjct  408  WFINARVRLWKPMVEEMYLEETKDQD  433



>gb|KDP36113.1| hypothetical protein JCGZ_08757 [Jatropha curcas]
Length=676

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KEQE
Sbjct  407  WFINARVRLWKPMVEEMYMEEIKEQE  432



>gb|AFW65587.1| putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
Length=635

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EETK+Q+
Sbjct  372  WFINARVRLWKPMVEEMYLEETKDQD  397



>gb|KDO46590.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
 gb|KDO46591.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
 gb|KDO46592.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
Length=671

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KEQE
Sbjct  440  WFINARVRLWKPMVEEMYMEELKEQE  465



>ref|XP_006494895.1| PREDICTED: BEL1-like homeodomain protein 1-like [Citrus sinensis]
Length=672

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KEQE
Sbjct  441  WFINARVRLWKPMVEEMYMEELKEQE  466



>ref|XP_006348466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006348467.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Solanum 
tuberosum]
Length=704

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENL  854
            WFINARVRLWKPMVEEMY+EE KEQ  L
Sbjct  425  WFINARVRLWKPMVEEMYLEEIKEQNGL  452



>ref|XP_003539486.1| PREDICTED: BEL1-like homeodomain protein 1-like, partial [Glycine 
max]
Length=526

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRN  794
            WFINARVRLWKPMVEEMY+EE KE E   A+ +   + +++ L +  N
Sbjct  245  WFINARVRLWKPMVEEMYLEEIKEHEQGNASENTKSKESSKELGSTAN  292



>emb|CDX75085.1| BnaA05g08310D [Brassica napus]
Length=628

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ  863
            WFINARVRLWKPMVEEMYVEE KEQ
Sbjct  385  WFINARVRLWKPMVEEMYVEEMKEQ  409



>ref|XP_003572007.1| PREDICTED: BEL1-like homeodomain protein 4 [Brachypodium distachyon]
Length=606

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 46/88 (52%), Gaps = 21/88 (24%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRND-----------  791
            WFINARVRLWKPMVEEMY EE K++E+    S   GE  +  LQ    D           
Sbjct  379  WFINARVRLWKPMVEEMYAEEMKDKED---GSGGAGEQYSAQLQASSGDQLLGNHNTAAA  435

Query  790  ------TEDQKPNLVRI-DSECISSIIN  728
                    +QKP   ++ D+  ++S+++
Sbjct  436  GSYGGGGGEQKPTRAQLHDAGSLASVVS  463



>ref|XP_008449596.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
 ref|XP_008449597.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=693

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KEQE
Sbjct  436  WFINARVRLWKPMVEEMYLEEIKEQE  461



>ref|XP_004140170.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 ref|XP_004156066.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN48050.1| hypothetical protein Csa_6G426360 [Cucumis sativus]
Length=698

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KEQE
Sbjct  442  WFINARVRLWKPMVEEMYLEEIKEQE  467



>gb|KHN10043.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=431

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 47/80 (59%), Gaps = 7/80 (9%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EE K+ E  L  S+   E +++N ++P   T+   P   R 
Sbjct  161  WFINARVRLWKPMVEEMYLEEMKDHE--LNGSE---EKSSKNGEDP--ATKTSTPQEKRA  213

Query  757  DSECISSIINNHPAADDNKN  698
             SE  S   N+      N+N
Sbjct  214  ASEIESKSFNSKQDVSKNQN  233



>gb|KHN17979.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=517

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRN  794
            WFINARVRLWKPMVEEMY+EE KE E   A+ +   + +++ L +  N
Sbjct  236  WFINARVRLWKPMVEEMYLEEIKEHEQGNASENTKSKESSKELGSTAN  283



>ref|XP_003519115.1| PREDICTED: BEL1-like homeodomain protein 1-like isoformX1 [Glycine 
max]
 ref|XP_006575286.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006575287.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
Length=664

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 47/80 (59%), Gaps = 7/80 (9%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EE K+ E  L  S+   E +++N ++P   T+   P   R 
Sbjct  394  WFINARVRLWKPMVEEMYLEEMKDHE--LNGSE---EKSSKNGEDP--ATKTSTPQEKRA  446

Query  757  DSECISSIINNHPAADDNKN  698
             SE  S   N+      N+N
Sbjct  447  ASEIESKSFNSKQDVSKNQN  466



>ref|XP_006595918.1| PREDICTED: BEL1-like homeodomain protein 3-like isoform X1 [Glycine 
max]
 ref|XP_006595919.1| PREDICTED: BEL1-like homeodomain protein 3-like isoform X2 [Glycine 
max]
 gb|KHN20947.1| BEL1-like homeodomain protein 10 [Glycine soja]
Length=636

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 4/64 (6%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE---NLLATSDDNGEAAARNLQNPRNDTEDQKPNL  767
            WFINARVRLWKPMVEEMY EE  + E   NLL +S++  +A   ++Q   N  E+ + NL
Sbjct  429  WFINARVRLWKPMVEEMYKEEFGDSEMSSNLL-SSENTLKAPRDDVQASDNKREESQDNL  487

Query  766  VRID  755
            + +D
Sbjct  488  INVD  491



>ref|XP_006664357.1| PREDICTED: BEL1-like homeodomain protein 1-like [Oryza brachyantha]
Length=406

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLA  848
            WFINARVRLWKPMVEEMY EETK +E  +A
Sbjct  187  WFINARVRLWKPMVEEMYAEETKAKEGPVA  216



>emb|CDX84171.1| BnaC04g09330D [Brassica napus]
Length=588

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/25 (96%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ  863
            WFINARVRLWKPMVEEMYVEE KEQ
Sbjct  346  WFINARVRLWKPMVEEMYVEEMKEQ  370



>ref|XP_011003835.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003836.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003838.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003839.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003840.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003841.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=734

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMYVEE K QE
Sbjct  458  WFINARVRLWKPMVEEMYVEEIKGQE  483



>ref|NP_001065164.1| Os10g0534900 [Oryza sativa Japonica Group]
 gb|AAM88627.1| putative homeodomain protein [Oryza sativa Japonica Group]
 gb|AAP54799.1| Associated with HOX family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27078.1| Os10g0534900 [Oryza sativa Japonica Group]
 dbj|BAG90718.1| unnamed protein product [Oryza sativa Japonica Group]
Length=586

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 25/88 (28%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAA-ARNLQNP-------------  800
            WFINARVRLWKPMVEEMY EE K++E        +G++  A N QNP             
Sbjct  374  WFINARVRLWKPMVEEMYAEEMKDEEG-------SGQSTQASNPQNPNPSSYTSEVRGGG  426

Query  799  --RNDTEDQKPNLVRI--DSECISSIIN  728
                D  +QKP+  ++  D+  ++S+++
Sbjct  427  GGGEDRGEQKPSRAQLLHDAGSLASVVS  454



>ref|XP_002299773.2| hypothetical protein POPTR_0001s22430g [Populus trichocarpa]
 gb|EEE84578.2| hypothetical protein POPTR_0001s22430g [Populus trichocarpa]
Length=732

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 5/42 (12%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARN  812
            WFINARVRLWKPMVEEMY+EE KE+E      D + E+  +N
Sbjct  456  WFINARVRLWKPMVEEMYLEEIKEREK-----DGSEESGGKN  492



>ref|NP_001234599.1| bell-like homeodomain protein 2 [Solanum lycopersicum]
 ref|XP_010322314.1| PREDICTED: bell-like homeodomain protein 2 isoform X1 [Solanum 
lycopersicum]
 gb|AAP47025.1|AF375966_1 bell-like homeodomain protein 2 [Solanum lycopersicum]
Length=699

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE-NLLATSDDN  833
            WFINARVRLWKPMVEEMY+EE K QE N   TS DN
Sbjct  454  WFINARVRLWKPMVEEMYLEEVKNQEQNSSNTSGDN  489



>ref|XP_006424091.1| hypothetical protein CICLE_v10027955mg [Citrus clementina]
 gb|ESR37331.1| hypothetical protein CICLE_v10027955mg [Citrus clementina]
Length=671

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 28/38 (74%), Gaps = 7/38 (18%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEA  824
            WFINARVRLWKPMVEEMY+EE KEQ       D NG A
Sbjct  440  WFINARVRLWKPMVEEMYMEELKEQ-------DKNGSA  470



>gb|ACU01965.1| bell1-like protein [Santalum album]
Length=285

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDS--EGQNLPYRNLMGAQLLHDLAG  257
            LFY R  +ED  +V Y +L+   + QNLPYRNLMGAQLLHDLAG
Sbjct  242  LFYSRGHIEDRGSVQYPILEGANDTQNLPYRNLMGAQLLHDLAG  285


 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRND  791
            WFINARVRLWKPMVEEMY+EETK+ +    TS  +     ++L+ P+ D
Sbjct  106  WFINARVRLWKPMVEEMYLEETKDHQQPPETSSPSNAKPTQDLK-PKPD  153



>ref|XP_010545511.1| PREDICTED: homeobox protein BEL1 homolog [Tarenaya hassleriana]
Length=612

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 8/71 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPM+EEMY EET+         + NG    R       D + +   ++R+
Sbjct  437  WFINARVRLWKPMIEEMYSEETR--------GERNGNIINRQENVMLTDPKPEPNPMIRV  488

Query  757  DSECISSIINN  725
            D E +S +I N
Sbjct  489  DPESLSYMITN  499



>gb|ACU01957.1| aintegumenta-like protein [Santalum album]
Length=299

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDS--EGQNLPYRNLMGAQLLHDLAG  257
            LFY R  +ED  +V Y +L+   + QNLPYRNLMGAQLLHDLAG
Sbjct  256  LFYSRGHIEDRGSVQYPILEGANDTQNLPYRNLMGAQLLHDLAG  299


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRND  791
            WFINARVRLWKPMVEEMY+EETK+ +    TS  +     ++L+ P+ D
Sbjct  120  WFINARVRLWKPMVEEMYLEETKDHQQPPETSSPSNAKPTQDLK-PKPD  167



>gb|EEE51314.1| hypothetical protein OsJ_32275 [Oryza sativa Japonica Group]
Length=592

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 25/88 (28%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAA-ARNLQNP-------------  800
            WFINARVRLWKPMVEEMY EE K++E        +G++  A N QNP             
Sbjct  380  WFINARVRLWKPMVEEMYAEEMKDEEG-------SGQSTQASNPQNPNPSSYTSEVRGGG  432

Query  799  --RNDTEDQKPNLVRI--DSECISSIIN  728
                D  +QKP+  ++  D+  ++S+++
Sbjct  433  GGGEDRGEQKPSRAQLLHDAGSLASVVS  460



>gb|EEE51686.1| hypothetical protein OsJ_33045 [Oryza sativa Japonica Group]
Length=641

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ  863
            WFINARVRLWKPMVEEMY+EETK+Q
Sbjct  390  WFINARVRLWKPMVEEMYLEETKDQ  414



>emb|CDY44476.1| BnaCnng11290D [Brassica napus]
Length=568

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 13/81 (16%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPR-NDTEDQKPNLVR  761
            WFINARVRLWKPM+EEMY EET+ +E                + NP   DT+     ++R
Sbjct  403  WFINARVRLWKPMIEEMYCEETRGEEE-----------QQMEITNPMFMDTKPDPNQIMR  451

Query  760  IDSECISSIINNHPAADDNKN  698
            ++ E +SS++       DN N
Sbjct  452  VEPESLSSVVTK-TGHKDNSN  471



>ref|XP_010230386.1| PREDICTED: BEL1-like homeodomain protein 4 [Brachypodium distachyon]
Length=797

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 4/50 (8%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLA----TSDDNGEAAARNLQNP  800
            WFINARVRLWKPM+EEMY +ETKE E   A     +D +G  AA  + +P
Sbjct  607  WFINARVRLWKPMIEEMYQQETKELEGSSAPESGNNDPSGAGAADEMHSP  656



>ref|XP_010031566.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW50924.1| hypothetical protein EUGRSUZ_J00574 [Eucalyptus grandis]
Length=693

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARN  812
            WFINARVRLWKPMVEEMY+EETK +E   + +     AA ++
Sbjct  422  WFINARVRLWKPMVEEMYLEETKSREQAGSENGTTRRAATKS  463



>ref|XP_006856142.1| hypothetical protein AMTR_s00059p00164750 [Amborella trichopoda]
 gb|ERN17609.1| hypothetical protein AMTR_s00059p00164750 [Amborella trichopoda]
Length=371

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 4/46 (9%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNP  800
            WFINARVRLWKPMVEEMY EE+KE+    A +  +G A A+N   P
Sbjct  209  WFINARVRLWKPMVEEMYQEESKEE----AQAQASGPAQAQNQSKP  250



>ref|XP_009404911.1| PREDICTED: BEL1-like homeodomain protein 1 [Musa acuminata subsp. 
malaccensis]
Length=674

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE K+QE
Sbjct  417  WFINARVRLWKPMVEEMYLEEIKDQE  442



>ref|NP_001065808.2| Os11g0158600 [Oryza sativa Japonica Group]
 gb|ABA91569.1| Associated with HOX family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEC67717.1| hypothetical protein OsI_35198 [Oryza sativa Indica Group]
 dbj|BAF27653.2| Os11g0158600 [Oryza sativa Japonica Group]
Length=678

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ  863
            WFINARVRLWKPMVEEMY+EETK+Q
Sbjct  412  WFINARVRLWKPMVEEMYLEETKDQ  436



>ref|XP_010505121.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=675

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDN  833
            WFINARVRLWKPMVEEMY EE KEQ   + + + N
Sbjct  431  WFINARVRLWKPMVEEMYTEEMKEQGKNMGSMEKN  465



>ref|XP_007015671.1| BEL1 homeodomain 1, putative [Theobroma cacao]
 gb|EOY33290.1| BEL1 homeodomain 1, putative [Theobroma cacao]
Length=732

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 2/36 (6%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNG  830
            WFINARVRLWKPMVEEMY+EE KE+E     S++NG
Sbjct  455  WFINARVRLWKPMVEEMYLEEVKERER--NGSEENG  488



>ref|XP_011021429.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011021430.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011021431.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=732

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 2/36 (6%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNG  830
            WFINARVRLWKPMVEEMY+EE KE+E     S+D+G
Sbjct  456  WFINARVRLWKPMVEEMYLEEIKEREK--DGSEDSG  489



>ref|XP_009140091.1| PREDICTED: homeobox protein BEL1 homolog [Brassica rapa]
Length=593

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 13/81 (16%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPR-NDTEDQKPNLVR  761
            WFINARVRLWKPM+EEMY EET+ +E                + NP   DT+     ++R
Sbjct  428  WFINARVRLWKPMIEEMYCEETRGEEE-----------QQMEITNPMFMDTKPDPNQIMR  476

Query  760  IDSECISSIINNHPAADDNKN  698
            ++ E +SS++       DN N
Sbjct  477  VEPESLSSVVTK-TGHKDNSN  496



>ref|XP_010441306.1| PREDICTED: homeobox protein BEL1 homolog [Camelina sativa]
Length=613

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 14/72 (19%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRN-DTEDQKPNLVR  761
            WFINARVRLWKPM+EEMY EET+ ++  + T             NP   DT+     ++ 
Sbjct  435  WFINARVRLWKPMIEEMYCEETRGEQMDITT-------------NPMMIDTKPDPNQIIG  481

Query  760  IDSECISSIINN  725
            ++ E +SSI+ N
Sbjct  482  VEPESLSSIVTN  493



>ref|XP_003543416.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006594920.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006594921.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
 ref|XP_006594922.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Glycine 
max]
Length=702

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQ  779
            WFINARVRLWKPMVEEMY+EE KE E    + +   + +++ L +  N   D 
Sbjct  429  WFINARVRLWKPMVEEMYLEEIKEHEQGNGSENTKSKESSKELASTANVALDH  481



>gb|KEH24245.1| BEL1-related homeotic protein [Medicago truncatula]
Length=660

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/26 (92%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMYVEE KE E
Sbjct  408  WFINARVRLWKPMVEEMYVEEMKENE  433



>ref|XP_006405354.1| hypothetical protein EUTSA_v10027690mg [Eutrema salsugineum]
 dbj|BAJ33952.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46807.1| hypothetical protein EUTSA_v10027690mg [Eutrema salsugineum]
Length=597

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 16/81 (20%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPR-NDTEDQKPNLVR  761
            WFINARVRLWKPM+EEMY EET+ ++                + NP   DT+     ++R
Sbjct  433  WFINARVRLWKPMIEEMYCEETRGEQ--------------MEVTNPTFIDTKPDPNQIIR  478

Query  760  IDSECISSIINNHPAADDNKN  698
            ++ E +SSI+       DN N
Sbjct  479  VEPESLSSIVTK-TGHKDNSN  498


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = -2

Query  382  LFYPRDQMEDCQTVPYSLLDS-EGQNLPYRNLMGAQLLHDLA  260
            L+Y RD ME       S+LD  + QNLPYRNLMGAQLLHD+ 
Sbjct  556  LYYGRDHMEGSVQYTASMLDGDQAQNLPYRNLMGAQLLHDMV  597



>ref|XP_007027982.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027983.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027984.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08484.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08485.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08486.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
Length=668

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  401  WFINARVRLWKPMVEEMYLEEVKEHE  426



>ref|NP_001051171.2| Os03g0732800 [Oryza sativa Japonica Group]
 gb|AAT77873.1| putative homeodomain protein [Oryza sativa Japonica Group]
 dbj|BAF13085.2| Os03g0732800 [Oryza sativa Japonica Group]
Length=203

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDD  836
            WFINARVRLWKPM+EEMY +E KE E      DD
Sbjct  24   WFINARVRLWKPMIEEMYQQECKELEGSSGAGDD  57



>ref|XP_008799712.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008799713.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=673

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE K+QE
Sbjct  414  WFINARVRLWKPMVEEMYLEEMKDQE  439



>ref|XP_008241058.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241059.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241060.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241062.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
Length=710

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  433  WFINARVRLWKPMVEEMYLEEVKEHE  458



>emb|CBI24428.3| unnamed protein product [Vitis vinifera]
Length=573

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN  857
            WFINARVRLWKPMVEEMY+EE K+QE+
Sbjct  379  WFINARVRLWKPMVEEMYLEEIKDQEH  405



>ref|XP_003535815.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006588872.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=661

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 7/71 (10%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EE KE E  L  S+   E ++++ ++P   T+   P   R 
Sbjct  389  WFINARVRLWKPMVEEMYLEEMKEHE--LNGSE---EKSSKSGEDP--ATKTTSPQEKRT  441

Query  757  DSECISSIINN  725
             SE  S   N+
Sbjct  442  SSEIESKSFNS  452



>emb|CBI22785.3| unnamed protein product [Vitis vinifera]
Length=489

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 6/72 (8%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EE K+ E      + +GE  +++  N   D+  Q       
Sbjct  378  WFINARVRLWKPMVEEMYMEEVKDHEE-----NGSGEKTSKSEDNNLEDS-FQIQTRQSH  431

Query  757  DSECISSIINNH  722
            + EC SS +N H
Sbjct  432  EQECSSSDLNGH  443



>gb|KHN48417.1| BEL1-like homeodomain protein 1, partial [Glycine soja]
Length=471

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 7/71 (10%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPMVEEMY+EE KE E  L  S+   E ++++ ++P   T    P   R 
Sbjct  199  WFINARVRLWKPMVEEMYLEEMKEHE--LNGSE---EKSSKSGEDPATKTTS--PQEKRT  251

Query  757  DSECISSIINN  725
             SE  S   N+
Sbjct  252  SSEIESKSFNS  262



>gb|ACC77468.1| BEL1 [Kalanchoe x houghtonii]
Length=641

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN  857
            WFINARVRLWKPMVEEMY EE KEQ+N
Sbjct  392  WFINARVRLWKPMVEEMYNEEVKEQDN  418



>ref|XP_007204250.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 ref|XP_007204251.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05449.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05450.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
Length=707

 Score = 58.2 bits (139),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  430  WFINARVRLWKPMVEEMYLEEVKEHE  455



>ref|XP_009420594.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Musa acuminata subsp. malaccensis]
Length=669

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE K+QE
Sbjct  412  WFINARVRLWKPMVEEMYLEELKDQE  437



>dbj|BAJ89622.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90323.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=600

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 48/95 (51%), Gaps = 14/95 (15%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEA-AARNLQNP---------RNDT  788
            WFINARVRLWKPMVEEMY EE K++E           A  A +L NP             
Sbjct  390  WFINARVRLWKPMVEEMYAEEMKDKEEGSGGDGGGQPALQAGDLANPSPAAAGSYASEGR  449

Query  787  EDQKPNLVRI----DSECISSIINNHPAADDNKNN  695
             +QKP   ++    D+  ++S+++   +AD    N
Sbjct  450  GEQKPTRAQLHQLHDAGSLASVVSIGQSADPQGLN  484



>ref|XP_007160717.1| hypothetical protein PHAVU_001G011100g [Phaseolus vulgaris]
 gb|ESW32711.1| hypothetical protein PHAVU_001G011100g [Phaseolus vulgaris]
Length=638

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 6/74 (8%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEE--TKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLV  764
            WFINARVRLWKPMVEE+Y EE    E  + L +S++  +A   ++Q+  +  E+   NL+
Sbjct  431  WFINARVRLWKPMVEEIYKEEFGVSEMSSNLLSSENTLKAPRDDVQSSDSKREESLDNLI  490

Query  763  RIDSECISSIINNH  722
            ++D     S+I +H
Sbjct  491  KVD----DSVIQHH  500



>ref|XP_004136516.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
Length=716

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE K+QE
Sbjct  431  WFINARVRLWKPMVEEMYMEEIKDQE  456



>ref|XP_009395654.1| PREDICTED: BEL1-like homeodomain protein 4 [Musa acuminata subsp. 
malaccensis]
Length=701

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN  857
            WFINARVRLWKPMVEEMY++E+KE+E 
Sbjct  540  WFINARVRLWKPMVEEMYLQESKEEEG  566



>gb|AGU36601.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
Length=198

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  74   WFINARVRLWKPMVEEMYLEECKEHE  99



>ref|XP_004171976.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN59214.1| hypothetical protein Csa_3G782620 [Cucumis sativus]
Length=716

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE K+QE
Sbjct  431  WFINARVRLWKPMVEEMYMEEIKDQE  456



>gb|AGU36605.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
Length=198

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  74   WFINARVRLWKPMVEEMYLEECKEHE  99



>gb|AGU36610.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36611.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36612.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36613.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36614.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36615.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36616.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36617.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36618.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36619.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36620.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36621.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36622.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36623.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
Length=198

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  74   WFINARVRLWKPMVEEMYLEECKEHE  99



>gb|AGU36609.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
Length=198

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  74   WFINARVRLWKPMVEEMYLEECKEHE  99



>gb|AGU36603.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
Length=198

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  74   WFINARVRLWKPMVEEMYLEECKEHE  99



>emb|CDY45383.1| BnaC06g42380D [Brassica napus]
Length=263

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 13/81 (16%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPR-NDTEDQKPNLVR  761
            WFINA VRLWKPM+EEMY EET+            GE     + NP   DT+     +++
Sbjct  117  WFINATVRLWKPMIEEMYCEETR-----------GGEEQQMEIINPMFVDTKPDPDQIIQ  165

Query  760  IDSECISSIINNHPAADDNKN  698
            ++ E +SSI+      +DN N
Sbjct  166  VEPESLSSIVTK-TGHNDNSN  185



>gb|AGU36604.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
Length=198

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  74   WFINARVRLWKPMVEEMYLEECKEHE  99



>ref|XP_007160715.1| hypothetical protein PHAVU_001G011000g [Phaseolus vulgaris]
 ref|XP_007160716.1| hypothetical protein PHAVU_001G011000g [Phaseolus vulgaris]
 gb|ESW32709.1| hypothetical protein PHAVU_001G011000g [Phaseolus vulgaris]
 gb|ESW32710.1| hypothetical protein PHAVU_001G011000g [Phaseolus vulgaris]
Length=637

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 8/75 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE---NLLATSDDNGEAAARNLQNPRNDTEDQKPNL  767
            WFINARVRLWKPMVEEMY EE  + E   NLL  S++  +A   ++Q+  +  E+ + N+
Sbjct  431  WFINARVRLWKPMVEEMYKEEFGDSEISSNLLP-SENTLKAPRDDVQSSDSKREESQDNI  489

Query  766  VRIDSECISSIINNH  722
            + +D     S+I +H
Sbjct  490  ITVD----DSVIQHH  500



>ref|NP_001131173.1| uncharacterized protein LOC100192481 [Zea mays]
 ref|XP_008677487.1| PREDICTED: uncharacterized protein LOC100192481 isoform X1 [Zea 
mays]
 gb|ACF79473.1| unknown [Zea mays]
 tpg|DAA47673.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
 gb|AIB05098.1| HB transcription factor, partial [Zea mays]
Length=668

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTED  782
            WFINARVRLWKPM+E+MY EET + E    +S DN  A ++       D ED
Sbjct  434  WFINARVRLWKPMIEDMYKEETGDIEQDSNSSSDNAPAGSKAKTASSRDKED  485



>gb|AGU36602.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36606.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
 gb|AGU36607.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
Length=198

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  74   WFINARVRLWKPMVEEMYLEECKEHE  99



>ref|XP_010685441.1| PREDICTED: BEL1-like homeodomain protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=747

 Score = 57.8 bits (138),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE K QE
Sbjct  462  WFINARVRLWKPMVEEMYLEEIKTQE  487



>gb|AGU36600.1| BEL1-related homeotic protein 29, partial [Helianthus petiolaris]
Length=198

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  74   WFINARVRLWKPMVEEMYLEECKEHE  99



>ref|XP_004506223.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=636

 Score = 57.8 bits (138),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN  857
            WFINARVRLWKPMVEEMY+EE K+QE+
Sbjct  421  WFINARVRLWKPMVEEMYLEEIKDQEH  447



>ref|XP_010558342.1| PREDICTED: BEL1-like homeodomain protein 9 isoform X1 [Tarenaya 
hassleriana]
Length=515

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 3/53 (6%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARN---LQNPRNDT  788
            WFINARVRLWKPMVEE+++ ET++ +   + S   GE  A++   L+  RND 
Sbjct  375  WFINARVRLWKPMVEEIHMLETRQSQKSASQSGGGGEKPAQHTSLLKRARNDV  427



>dbj|BAJ91914.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=477

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 30/46 (65%), Gaps = 7/46 (15%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNP  800
            WFINARVRLWKPM+EEMY EET +        DDNG +  R   +P
Sbjct  325  WFINARVRLWKPMIEEMYAEETIQH-------DDNGASGGRGEPSP  363



>dbj|BAJ85202.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=477

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 30/46 (65%), Gaps = 7/46 (15%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNP  800
            WFINARVRLWKPM+EEMY EET +        DDNG +  R   +P
Sbjct  325  WFINARVRLWKPMIEEMYAEETIQH-------DDNGASGGRGEPSP  363



>ref|XP_004228612.1| PREDICTED: BEL1-like homeodomain protein 1 [Solanum lycopersicum]
Length=700

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  431  WFINARVRLWKPMVEEMYLEEIKEHE  456



>ref|NP_001048808.1| Os03g0124000 [Oryza sativa Japonica Group]
 gb|ABF93732.1| Associated with HOX family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10722.1| Os03g0124000 [Oryza sativa Japonica Group]
Length=591

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 45/84 (54%), Gaps = 14/84 (17%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE-----------NLLATSDDNGEA-AARNLQNPRN  794
            WFINARVRLWKPMVEEMYVEE K Q+           N   T     EA   + L     
Sbjct  374  WFINARVRLWKPMVEEMYVEEMKGQDGGDGSGGQGSLNPKPTCSHASEARGGQQLVVGDG  433

Query  793  DTEDQKPNL--VRIDSECISSIIN  728
            D  +QKP    +R D+  ++S++N
Sbjct  434  DGGEQKPTRAQLRHDAGSLASVVN  457



>emb|CDY40420.1| BnaA04g20970D [Brassica napus]
Length=632

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ  863
            WFINARVRLWKPMVEEMY EE KEQ
Sbjct  381  WFINARVRLWKPMVEEMYTEEMKEQ  405



>ref|XP_009141535.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141536.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141537.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
Length=675

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ  863
            WFINARVRLWKPMVEEMY EE KEQ
Sbjct  424  WFINARVRLWKPMVEEMYTEEMKEQ  448



>ref|XP_010097899.1| BEL1-like homeodomain protein 2 [Morus notabilis]
 gb|EXB72726.1| BEL1-like homeodomain protein 2 [Morus notabilis]
Length=970

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 4/35 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDN  833
            WFINARVRLWKPMVEEMY +ETKE++    TS+DN
Sbjct  714  WFINARVRLWKPMVEEMYQQETKEED----TSEDN  744



>emb|CDX79646.1| BnaC03g19820D [Brassica napus]
Length=691

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ  863
            WFINARVRLWKPMVEEMY EE KEQ
Sbjct  440  WFINARVRLWKPMVEEMYAEEMKEQ  464



>gb|AAN03626.1|AF406702_1 BEL1-related homeotic protein 29, partial [Solanum tuberosum]
Length=567

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  286  WFINARVRLWKPMVEEMYLEEIKEHE  311



>ref|XP_009133059.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Brassica rapa]
Length=658

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ  863
            WFINARVRLWKPMVEEMY EE KEQ
Sbjct  409  WFINARVRLWKPMVEEMYAEEMKEQ  433



>gb|KHF99976.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=693

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  449  WFINARVRLWKPMVEEMYLEEMKEHE  474



>emb|CDY32069.1| BnaC04g44970D [Brassica napus]
Length=636

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ  863
            WFINARVRLWKPMVEEMY EE KEQ
Sbjct  384  WFINARVRLWKPMVEEMYTEEMKEQ  408



>gb|ACD39469.1| BEL29 protein [Solanum etuberosum]
Length=516

 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  229  WFINARVRLWKPMVEEMYLEEIKEHE  254



>ref|XP_009395309.1| PREDICTED: homeobox protein BEL1 homolog [Musa acuminata subsp. 
malaccensis]
Length=510

 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 44/74 (59%), Gaps = 18/74 (24%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTE---DQKPNL  767
            WFINARVR+WKPMVEEMY EE KE +             A++ QNP  ++      KP L
Sbjct  350  WFINARVRIWKPMVEEMYSEEMKELD-------------AKSNQNPNPNSALSLVHKPFL  396

Query  766  VRIDSECISSIINN  725
               DSE +SSIIN+
Sbjct  397  N--DSESLSSIINS  408



>emb|CDX84585.1| BnaA03g16450D [Brassica napus]
Length=671

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ  863
            WFINARVRLWKPMVEEMY EE KEQ
Sbjct  422  WFINARVRLWKPMVEEMYAEEMKEQ  446



>ref|XP_007162972.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
 gb|ESW34966.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
Length=679

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 7/58 (12%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE-------NLLATSDDNGEAAARNLQNPRNDTE  785
            WFINARVRLWKPMVEEMY+EE K+ E       +  +  D + + AA   + P N+TE
Sbjct  412  WFINARVRLWKPMVEEMYLEEMKDHEQNGSEDKSSKSNEDSSTKMAAPPERGPSNETE  469



>ref|XP_010544329.1| PREDICTED: BEL1-like homeodomain protein 5 [Tarenaya hassleriana]
 ref|XP_010544330.1| PREDICTED: BEL1-like homeodomain protein 5 [Tarenaya hassleriana]
Length=594

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 37/59 (63%), Gaps = 6/59 (10%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATS-----DDNGEAAARNLQNPRN-DTEDQ  779
            WFINARVRLWKPMVEEMY EE K Q N    +     +D+ E    + + PRN D+ DQ
Sbjct  377  WFINARVRLWKPMVEEMYSEEMKVQANAKNDTTNEEDNDDLELGVSSSKQPRNHDSSDQ  435



>ref|XP_004303380.1| PREDICTED: BEL1-like homeodomain protein 1-like [Fragaria vesca 
subsp. vesca]
Length=704

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  425  WFINARVRLWKPMVEEMYLEEIKENE  450



>emb|CDP10596.1| unnamed protein product [Coffea canephora]
Length=680

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY EE KE E
Sbjct  448  WFINARVRLWKPMVEEMYTEEMKEHE  473



>ref|XP_001777380.1| predicted protein [Physcomitrella patens]
 gb|EDQ57784.1| predicted protein [Physcomitrella patens]
Length=1288

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/24 (96%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKE  866
            WFINARVRLWKPMVEEMYVEE KE
Sbjct  938  WFINARVRLWKPMVEEMYVEEQKE  961



>ref|XP_004494251.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=686

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+EE KE E
Sbjct  416  WFINARVRLWKPMVEEMYLEEMKENE  441



>gb|EMT11923.1| Homeobox BEL1-like protein [Aegilops tauschii]
Length=307

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 46/89 (52%), Gaps = 13/89 (15%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEA-AARNLQNP--------RNDTE  785
            WFINARVRLWKPMVEEMY EE K++E           A  A +L NP             
Sbjct  102  WFINARVRLWKPMVEEMYAEEMKDKEEGSGGDGGGQSAQQAGDLANPNPVAGSYASEGRG  161

Query  784  DQKPNLVRI----DSECISSIINNHPAAD  710
            +QKP   ++    D+  ++S+++   + D
Sbjct  162  EQKPTRAQLHQLHDAGSLASVVSIGQSTD  190



>gb|EAY88336.1| hypothetical protein OsI_09793 [Oryza sativa Indica Group]
Length=591

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 45/84 (54%), Gaps = 14/84 (17%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE-----------NLLATSDDNGEA-AARNLQNPRN  794
            WFINARVRLWKPMVEEMYVEE K Q+           N   T     EA   + L     
Sbjct  374  WFINARVRLWKPMVEEMYVEEMKGQDGGDGSGGQGSLNPKPTCSHASEARGGQQLVVGDG  433

Query  793  DTEDQKPNL--VRIDSECISSIIN  728
            D  +QKP    +R D+  ++S++N
Sbjct  434  DDGEQKPTRAQLRHDAGSLASVVN  457



>ref|XP_003540818.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006592357.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=741

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 2/42 (5%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARN  812
            WFINARVRLWKPMVEEMY+EE K++ N   +S DN      N
Sbjct  473  WFINARVRLWKPMVEEMYLEEVKQEPN--NSSQDNNNTKGSN  512



>gb|ACN27211.1| unknown [Zea mays]
Length=275

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPN  770
            WFINARVRLWKPM+E+MY EE  E E    +S DNG+       +P  + + Q P 
Sbjct  56   WFINARVRLWKPMIEDMYKEEIGEAELDSNSSSDNGQRNKDKAPSPEENEDLQTPT  111



>ref|XP_007132496.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 ref|XP_007132497.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 gb|ESW04490.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 gb|ESW04491.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
Length=733

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN  857
            WFINARVRLWKPMVEEMY+EE K++ N
Sbjct  468  WFINARVRLWKPMVEEMYLEEVKQEPN  494



>gb|KHN21192.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=584

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 2/42 (5%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARN  812
            WFINARVRLWKPMVEEMY+EE K++ N   +S DN      N
Sbjct  316  WFINARVRLWKPMVEEMYLEEVKQEPN--NSSQDNNNTKGSN  355



>ref|XP_010553534.1| PREDICTED: homeobox protein BEL1 homolog [Tarenaya hassleriana]
Length=655

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 8/73 (11%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARN--LQNPRNDTEDQKPNLV  764
            WFINARVRLWKPM+EEMY EET+ + N    S ++ E    N  L +P+ +     P + 
Sbjct  470  WFINARVRLWKPMIEEMYSEETRGERN---ESINHQENIMVNPVLTDPKPEL---NPIMN  523

Query  763  RIDSECISSIINN  725
            R D   +SSII N
Sbjct  524  RADPGSLSSIITN  536



>gb|ABF98710.1| homeodomain protein JUBEL1, putative, expressed [Oryza sativa 
Japonica Group]
Length=321

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDD  836
            WFINARVRLWKPM+EEMY +E KE E      DD
Sbjct  142  WFINARVRLWKPMIEEMYQQECKELEGSSGAGDD  175



>ref|XP_008794017.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008794018.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008794019.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X2 [Phoenix 
dactylifera]
Length=671

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 16/94 (17%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ--------ENLLATSDDNGEAAAR-NLQNPRNDT-  788
            WFINARVRLWKPM+EEMY EE  E         EN+  + D+ G +  R + ++P  +  
Sbjct  462  WFINARVRLWKPMIEEMYKEEIGETEMDSNSSLENIPKSRDETGSSEEREHSKSPATEGC  521

Query  787  ------EDQKPNLVRIDSECISSIINNHPAADDN  704
                  E  K N+  +D+   ++   N  +ADD 
Sbjct  522  HTSQLNESSKSNISSMDAGGTAAGFPNEASADDT  555



>ref|XP_008794014.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008794015.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008794016.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Phoenix 
dactylifera]
Length=696

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 16/94 (17%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQ--------ENLLATSDDNGEAAAR-NLQNPRNDT-  788
            WFINARVRLWKPM+EEMY EE  E         EN+  + D+ G +  R + ++P  +  
Sbjct  487  WFINARVRLWKPMIEEMYKEEIGETEMDSNSSLENIPKSRDETGSSEEREHSKSPATEGC  546

Query  787  ------EDQKPNLVRIDSECISSIINNHPAADDN  704
                  E  K N+  +D+   ++   N  +ADD 
Sbjct  547  HTSQLNESSKSNISSMDAGGTAAGFPNEASADDT  580



>gb|EEC67362.1| hypothetical protein OsI_34463 [Oryza sativa Indica Group]
Length=587

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 8/47 (17%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAA-ARNLQNP  800
            WFINARVRLWKPMVEEMY EE K++E        +G++  A N QNP
Sbjct  374  WFINARVRLWKPMVEEMYAEEMKDEEG-------SGQSTQASNPQNP  413



>ref|XP_003539151.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006591059.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006591060.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
Length=764

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN  857
            WFINARVRLWKPMVEEMY+EE K++ N
Sbjct  474  WFINARVRLWKPMVEEMYLEEVKQEPN  500



>ref|XP_002281889.1| PREDICTED: BEL1-like homeodomain protein 4 [Vitis vinifera]
Length=676

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 37/55 (67%), Gaps = 4/55 (7%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKP  773
            WFINARVRLWKPMVEEMY ++ KE+E   A S ++ EA  +N Q  +N    Q P
Sbjct  501  WFINARVRLWKPMVEEMYQQDAKEEE--AAASSEDREANPQNHQ--KNSISAQTP  551



>gb|KHN19925.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=767

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQEN  857
            WFINARVRLWKPMVEEMY+EE K++ N
Sbjct  474  WFINARVRLWKPMVEEMYLEEVKQEPN  500



>ref|XP_006435065.1| hypothetical protein CICLE_v10000508mg [Citrus clementina]
 gb|ESR48305.1| hypothetical protein CICLE_v10000508mg [Citrus clementina]
Length=673

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKE-QENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVR  761
            WFINARVRLWKPM+EEMY EE  + +EN  +  ++  +A+++N   P N  E+ + +L  
Sbjct  458  WFINARVRLWKPMIEEMYKEEFGDTEENSKSCLENANKASSQNSSAPENRGEELQDSLSS  517

Query  760  IDSECISSIINNH-PAADDNK  701
                 I  +++++ P  + NK
Sbjct  518  KSGRSIHDVMSDYVPDVEMNK  538



>ref|XP_006473564.1| PREDICTED: BEL1-like homeodomain protein 3-like isoform X1 [Citrus 
sinensis]
 ref|XP_006473565.1| PREDICTED: BEL1-like homeodomain protein 3-like isoform X2 [Citrus 
sinensis]
Length=673

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKE-QENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVR  761
            WFINARVRLWKPM+EEMY EE  + +EN  +  ++  +A+++N   P N  E+ + +L  
Sbjct  458  WFINARVRLWKPMIEEMYKEEFGDTEENSKSCLENANKASSQNSSAPENRGEELQDSLSS  517

Query  760  IDSECISSIINNH-PAADDNK  701
                 I  +++++ P  + NK
Sbjct  518  KSGRSIHDVMSDYIPDVEMNK  538



>gb|AGU36608.1| BEL1-related homeotic protein 29, partial [Helianthus annuus]
Length=198

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQE  860
            WFINARVRLWKPMVEEMY+E+ KE E
Sbjct  74   WFINARVRLWKPMVEEMYLEKCKEHE  99



>gb|KDO84667.1| hypothetical protein CISIN_1g005863mg [Citrus sinensis]
Length=673

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKE-QENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVR  761
            WFINARVRLWKPM+EEMY EE  + +EN  +  ++  +A+++N   P N  E+ + +L  
Sbjct  458  WFINARVRLWKPMIEEMYKEEFGDTEENSKSCLENANKASSQNSSAPENRGEELQDSLSS  517

Query  760  IDSECISSIINNH-PAADDNK  701
                 I  +++++ P  + NK
Sbjct  518  KSGRSIHDVMSDYIPDVEMNK  538



>gb|EMS65600.1| Homeobox protein BEL1-like protein [Triticum urartu]
Length=457

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 40/78 (51%), Gaps = 10/78 (13%)
 Frame = -2

Query  937  WFINARVRLWKPMVEEMYVEETKEQENLLATSDDNGEAAARNLQNPRNDTEDQKPNLVRI  758
            WFINARVRLWKPM+EEMY EET +        DD G ++ R    P   T+    NL   
Sbjct  304  WFINARVRLWKPMIEEMYAEETIQH-------DDGGTSSGRGEPAP---TDHHNNNLAAC  353

Query  757  DSECISSIINNHPAADDN  704
             +  I+   N H  +  N
Sbjct  354  TTVTITGDQNCHRLSGRN  371



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1997200541776