BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19223_g2_i1 len=1435 path=[2216:0-393 372:394-434 2650:435-1434]

Length=1435
                                                                      Score     E

ref|XP_009780009.1|  PREDICTED: exosome complex component RRP43         437   7e-148   
ref|XP_009597188.1|  PREDICTED: exosome complex component RRP43         436   8e-148   
ref|XP_006351314.1|  PREDICTED: exosome complex component RRP43         435   4e-147   
ref|XP_004241263.1|  PREDICTED: exosome complex component RRP43-l...    429   8e-145   
gb|EYU20751.1|  hypothetical protein MIMGU_mgv1a010701mg                428   1e-144   
ref|XP_007028731.1|  3'-5'-exoribonuclease family protein               427   4e-144   
ref|NP_001275445.1|  3'-5'-exoribonuclease/RNA binding-like protein     426   1e-143   
ref|NP_001275073.1|  3'-5'-exoribonuclease/RNA binding protein-li...    425   3e-143   
ref|XP_011048048.1|  PREDICTED: exosome complex component RRP43-like    424   8e-143   
ref|XP_006365748.1|  PREDICTED: exosome complex component RRP43 i...    423   1e-142   
ref|XP_006381009.1|  hypothetical protein POPTR_0006s04970g             421   2e-141   
ref|XP_002532079.1|  exosome complex exonuclease rrp43, putative        420   2e-141   Ricinus communis
gb|KDP26052.1|  hypothetical protein JCGZ_21085                         417   2e-140   
emb|CDP08415.1|  unnamed protein product                                411   7e-138   
ref|XP_011078906.1|  PREDICTED: LOW QUALITY PROTEIN: exosome comp...    411   8e-138   
ref|XP_011033330.1|  PREDICTED: exosome complex component RRP43-like    408   1e-136   
ref|XP_002284088.1|  PREDICTED: exosome complex component RRP43         408   1e-136   Vitis vinifera
ref|XP_008460772.1|  PREDICTED: exosome complex component RRP43 i...    406   1e-135   
ref|XP_008460773.1|  PREDICTED: exosome complex component RRP43 i...    405   2e-135   
ref|XP_003531860.1|  PREDICTED: exosome complex component RRP43-like    404   3e-135   
ref|XP_009341214.1|  PREDICTED: exosome complex component RRP43-like    403   1e-134   
ref|XP_010043326.1|  PREDICTED: exosome complex component RRP43         403   1e-134   
gb|KHN14032.1|  Exosome complex component RRP43                         403   1e-134   
ref|XP_008222119.1|  PREDICTED: exosome complex component RRP43         402   2e-134   
ref|XP_002308947.1|  3' exoribonuclease domain 1-containing famil...    403   2e-134   Populus trichocarpa [western balsam poplar]
ref|XP_003544676.1|  PREDICTED: exosome complex component RRP43-l...    401   6e-134   
ref|XP_007202373.1|  hypothetical protein PRUPE_ppa009278mg             401   7e-134   
ref|XP_008394199.1|  PREDICTED: exosome complex component RRP43         400   1e-133   
ref|XP_010269779.1|  PREDICTED: exosome complex component RRP43 i...    400   1e-133   
ref|XP_004149399.1|  PREDICTED: exosome complex component RRP43-like    400   2e-133   
ref|XP_006421389.1|  hypothetical protein CICLE_v10005512mg             400   2e-133   
emb|CBI29839.3|  unnamed protein product                                399   4e-133   
ref|XP_006373782.1|  hypothetical protein POPTR_0016s05590g             399   9e-133   
ref|XP_006489986.1|  PREDICTED: exosome complex component RRP43-l...    398   1e-132   
ref|XP_010104428.1|  hypothetical protein L484_001482                   395   3e-131   
ref|XP_006596183.1|  PREDICTED: exosome complex component RRP43-l...    394   4e-131   
ref|XP_004304353.1|  PREDICTED: exosome complex component RRP43-l...    393   8e-131   
ref|XP_010322398.1|  PREDICTED: exosome complex component RRP43-l...    390   4e-130   
ref|XP_010322397.1|  PREDICTED: exosome complex component RRP43-l...    390   4e-130   
ref|XP_002322717.1|  3' exoribonuclease domain 1-containing famil...    395   1e-129   Populus trichocarpa [western balsam poplar]
ref|XP_009408387.1|  PREDICTED: exosome complex component RRP43         385   1e-127   
gb|KFK40817.1|  hypothetical protein AALP_AA2G045200                    382   1e-126   
ref|XP_006392186.1|  hypothetical protein EUTSA_v10023611mg             381   4e-126   
ref|XP_004498461.1|  PREDICTED: exosome complex component RRP43-like    381   5e-126   
ref|XP_002886636.1|  predicted protein                                  380   8e-126   
ref|XP_010907648.1|  PREDICTED: exosome complex component RRP43         380   2e-125   
ref|XP_007133470.1|  hypothetical protein PHAVU_011G181200g             379   3e-125   
ref|XP_010473200.1|  PREDICTED: exosome complex component RRP43-like    379   3e-125   
gb|AES58671.2|  exosome complex exonuclease RRP46                       379   5e-125   
ref|NP_176216.1|  3'-5'-exoribonuclease family protein                  378   5e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417956.1|  PREDICTED: exosome complex component RRP43-like    378   6e-125   
ref|XP_010510973.1|  PREDICTED: exosome complex component RRP43-l...    377   1e-124   
ref|XP_010553639.1|  PREDICTED: exosome complex component RRP43         377   5e-124   
ref|XP_006302607.1|  hypothetical protein CARUB_v10020713mg             372   1e-122   
ref|XP_009113252.1|  PREDICTED: exosome complex component RRP43         370   8e-122   
emb|CDY63123.1|  BnaA09g53310D                                          369   1e-121   
emb|CDY56983.1|  BnaCnng31490D                                          369   2e-121   
ref|XP_008807566.1|  PREDICTED: exosome complex component RRP43 i...    369   3e-121   
ref|XP_008807564.1|  PREDICTED: exosome complex component RRP43 i...    367   4e-120   
ref|XP_010510972.1|  PREDICTED: exosome complex component RRP43-l...    365   2e-119   
ref|XP_004304352.1|  PREDICTED: exosome complex component RRP43-l...    357   2e-116   
gb|KEH39712.1|  exosome complex exonuclease RRP46                       347   4e-113   
dbj|BAJ86846.1|  predicted protein                                      342   9e-111   
ref|XP_006850813.1|  hypothetical protein AMTR_s00025p00117140          342   1e-110   
gb|ABG22460.1|  3' exoribonuclease family domain 1-containing pro...    340   3e-110   
ref|XP_003576076.1|  PREDICTED: exosome complex component RRP43         340   5e-110   
gb|EMT20573.1|  Exosome complex exonuclease RRP43                       337   4e-109   
ref|XP_010041250.1|  PREDICTED: LOW QUALITY PROTEIN: exosome comp...    337   7e-109   
ref|XP_010269781.1|  PREDICTED: exosome complex component RRP43 i...    335   1e-108   
ref|XP_006660434.1|  PREDICTED: exosome complex component RRP43-like    334   1e-107   
ref|XP_004979199.1|  PREDICTED: exosome complex component RRP43-like    333   2e-107   
gb|ADE76485.1|  unknown                                                 333   3e-107   
gb|KFK38444.1|  hypothetical protein AALP_AA3G114300                    327   5e-105   
ref|NP_001067758.1|  Os11g0311300                                       326   1e-104   Oryza sativa Japonica Group [Japonica rice]
gb|KHG09789.1|  Exosome complex component RRP43                         323   3e-104   
ref|XP_002445804.1|  hypothetical protein SORBIDRAFT_07g026060          322   7e-103   Sorghum bicolor [broomcorn]
ref|NP_001131768.1|  exosome complex exonuclease RRP43                  321   1e-102   Zea mays [maize]
gb|ACN26814.1|  unknown                                                 317   6e-101   Zea mays [maize]
ref|NP_001148711.1|  exosome complex exonuclease RRP43                  315   3e-100   Zea mays [maize]
ref|XP_008647516.1|  PREDICTED: exosome complex exonuclease RRP43...    310   4e-98    
gb|KCW87872.1|  hypothetical protein EUGRSUZ_A00267                     291   1e-91    
gb|KCW87684.1|  hypothetical protein EUGRSUZ_A00069                     293   1e-91    
ref|XP_001755996.1|  predicted protein                                  282   2e-87    
gb|KCW87680.1|  hypothetical protein EUGRSUZ_A00063                     275   1e-85    
ref|XP_010064525.1|  PREDICTED: exosome complex component RRP43-like    262   4e-81    
ref|XP_002979580.1|  hypothetical protein SELMODRAFT_233365             265   6e-81    
ref|XP_002977693.1|  hypothetical protein SELMODRAFT_176463             264   7e-81    
emb|CAN82224.1|  hypothetical protein VITISV_011872                     285   1e-80    Vitis vinifera
gb|KCW87870.1|  hypothetical protein EUGRSUZ_A00265                     263   1e-80    
gb|EMS53021.1|  Exosome complex component RRP43                         249   6e-76    
gb|KHG03654.1|  Exosome complex component RRP43                         243   3e-74    
gb|KHG05848.1|  Exosome complex component RRP43                         241   2e-73    
gb|KCW87871.1|  hypothetical protein EUGRSUZ_A00266                     243   2e-73    
ref|XP_003588420.1|  Exosome complex exonuclease RRP43                  240   4e-73    
gb|KHG16153.1|  Exosome complex component RRP43                         240   4e-73    
ref|XP_006602939.1|  PREDICTED: exosome complex component RRP43 i...    240   9e-73    
gb|EPS68495.1|  hypothetical protein M569_06274                         225   1e-66    
emb|CDP19205.1|  unnamed protein product                                218   9e-65    
gb|ACF81482.1|  unknown                                                 216   2e-63    Zea mays [maize]
ref|XP_006664830.1|  PREDICTED: exosome complex component RRP43-like    214   5e-63    
gb|AAX95370.1|  3' exoribonuclease family, domain 1, putative           212   3e-62    Oryza sativa Japonica Group [Japonica rice]
gb|KCW87868.1|  hypothetical protein EUGRSUZ_A00263                     208   7e-61    
gb|KGN53842.1|  hypothetical protein Csa_4G165870                       205   1e-58    
emb|CDP19206.1|  unnamed protein product                                195   3e-56    
ref|XP_010671593.1|  PREDICTED: exosome complex component RRP43-like    194   7e-56    
ref|XP_010063946.1|  PREDICTED: exosome complex component RRP43-like    192   3e-54    
ref|XP_007954490.1|  PREDICTED: exosome complex component RRP43         191   4e-53    
ref|XP_006879609.1|  PREDICTED: exosome complex component RRP43         191   6e-53    
ref|XP_001511768.1|  PREDICTED: exosome complex component RRP43 i...    191   7e-53    Ornithorhynchus anatinus [duck-billed platypus]
ref|NP_001276207.1|  uncharacterized protein LOC100812139               187   9e-53    
ref|XP_004604690.1|  PREDICTED: exosome complex component RRP43         190   1e-52    
ref|XP_010043138.1|  PREDICTED: exosome complex component RRP43-l...    186   1e-52    
ref|XP_010043016.1|  PREDICTED: exosome complex component RRP43-l...    185   3e-52    
ref|XP_010633525.1|  PREDICTED: exosome complex component RRP43 i...    188   5e-52    
ref|XP_004659921.1|  PREDICTED: exosome complex component RRP43         188   7e-52    
ref|XP_003412693.1|  PREDICTED: exosome complex component RRP43 i...    187   2e-51    
ref|XP_010633526.1|  PREDICTED: exosome complex component RRP43 i...    187   2e-51    
ref|XP_007666729.1|  PREDICTED: exosome complex component RRP43 i...    187   2e-51    
ref|XP_004680270.1|  PREDICTED: exosome complex component RRP43         186   3e-51    
ref|XP_006837716.1|  PREDICTED: exosome complex component RRP43         186   5e-51    
ref|XP_010590964.1|  PREDICTED: exosome complex component RRP43 i...    186   5e-51    
ref|XP_006085631.1|  PREDICTED: exosome complex component RRP43         186   6e-51    
ref|XP_010633527.1|  PREDICTED: exosome complex component RRP43 i...    186   6e-51    
ref|XP_010740770.1|  PREDICTED: exosome complex component RRP43         185   6e-51    
ref|XP_002720651.1|  PREDICTED: exosome complex component RRP43         185   1e-50    Oryctolagus cuniculus [domestic rabbit]
ref|XP_004631152.1|  PREDICTED: exosome complex component RRP43         184   1e-50    
ref|XP_006915858.1|  PREDICTED: exosome complex component RRP43         184   2e-50    
ref|XP_004399964.1|  PREDICTED: exosome complex component RRP43         184   2e-50    
ref|XP_002946572.1|  hypothetical protein VOLCADRAFT_86657              185   2e-50    
ref|XP_004390018.1|  PREDICTED: exosome complex component RRP43         184   2e-50    
ref|XP_003270334.1|  PREDICTED: exosome complex component RRP43         184   3e-50    
ref|XP_007229825.1|  PREDICTED: exosome complex component RRP43         184   3e-50    
ref|XP_007097738.1|  PREDICTED: exosome complex component RRP43         184   3e-50    
gb|EHH58538.1|  Exosome complex exonuclease RRP43                       184   3e-50    
ref|XP_008690479.1|  PREDICTED: exosome complex component RRP43         184   3e-50    
ref|XP_002930910.1|  PREDICTED: exosome complex exonuclease RRP43...    184   3e-50    
gb|KFV87215.1|  Exosome complex component RRP43                         183   3e-50    
ref|XP_005387722.1|  PREDICTED: exosome complex component RRP43 i...    183   3e-50    
ref|XP_003477480.1|  PREDICTED: exosome complex component RRP43 i...    183   3e-50    
ref|XP_004770814.1|  PREDICTED: exosome complex component RRP43 i...    183   4e-50    
ref|XP_004453371.1|  PREDICTED: exosome complex component RRP43 i...    184   4e-50    
ref|XP_006734088.1|  PREDICTED: exosome complex component RRP43         183   4e-50    
ref|XP_010043072.1|  PREDICTED: exosome complex component RRP43-l...    179   4e-50    
ref|XP_006757907.1|  PREDICTED: exosome complex component RRP43         184   5e-50    
ref|XP_008047100.1|  PREDICTED: exosome complex component RRP43         183   5e-50    
ref|XP_003803149.1|  PREDICTED: exosome complex component RRP43         183   5e-50    
ref|NP_001187695.1|  exosome complex exonuclease rrp43                  183   5e-50    
ref|NP_852480.1|  exosome complex component RRP43                       183   5e-50    Homo sapiens [man]
ref|XP_007433299.1|  PREDICTED: exosome complex component RRP43 i...    183   5e-50    
ref|XP_004854777.1|  PREDICTED: exosome complex component RRP43 i...    184   6e-50    
pdb|2NN6|C  Chain C, Structure Of The Human Rna Exosome Composed ...    183   6e-50    
ref|NP_001247467.1|  exosome component 8                                182   7e-50    
ref|XP_003216847.1|  PREDICTED: exosome complex component RRP43         182   7e-50    
gb|EHH28956.1|  Exosome complex exonuclease RRP43                       182   7e-50    
ref|XP_002112521.1|  hypothetical protein TRIADDRAFT_25085              182   9e-50    Trichoplax adhaerens
ref|XP_534492.2|  PREDICTED: exosome complex component RRP43 isof...    182   9e-50    Canis lupus familiaris [dogs]
ref|XP_003512044.2|  PREDICTED: exosome complex component RRP43 i...    182   1e-49    
ref|XP_004886213.1|  PREDICTED: exosome complex component RRP43 i...    183   1e-49    
ref|XP_006154251.1|  PREDICTED: exosome complex component RRP43         182   1e-49    
ref|XP_005646128.1|  3'-5'-exoribonuclease/RNA binding-like protein     182   1e-49    
ref|XP_006977629.1|  PREDICTED: exosome complex component RRP43         182   1e-49    
ref|XP_004577581.1|  PREDICTED: exosome complex component RRP43         182   1e-49    
ref|XP_004711301.1|  PREDICTED: exosome complex component RRP43         181   2e-49    
ref|XP_005344037.1|  PREDICTED: exosome complex component RRP43 i...    181   2e-49    
ref|XP_008845351.1|  PREDICTED: exosome complex component RRP43         181   3e-49    
ref|XP_008158328.1|  PREDICTED: exosome complex component RRP43         181   3e-49    
ref|XP_006232394.1|  PREDICTED: exosome complex component RRP43 i...    181   3e-49    
ref|XP_522661.2|  PREDICTED: exosome complex component RRP43 isof...    181   3e-49    Pan troglodytes
ref|XP_003934463.1|  PREDICTED: exosome complex component RRP43         181   3e-49    
ref|XP_004854779.1|  PREDICTED: exosome complex component RRP43 i...    181   3e-49    
ref|XP_008583528.1|  PREDICTED: exosome complex component RRP43 i...    181   3e-49    
ref|XP_004435395.1|  PREDICTED: exosome complex component RRP43         181   4e-49    
ref|XP_004657185.1|  PREDICTED: exosome complex component RRP43-like    181   4e-49    
ref|XP_005808491.1|  PREDICTED: exosome complex component RRP43-like    181   4e-49    
ref|XP_005635498.1|  PREDICTED: exosome complex component RRP43 i...    181   4e-49    
gb|EDL35278.1|  exosome component 8, isoform CRA_f                      181   5e-49    
ref|XP_002824217.1|  PREDICTED: exosome complex component RRP43         180   5e-49    
ref|XP_004886215.1|  PREDICTED: exosome complex component RRP43 i...    180   6e-49    
ref|XP_005877028.1|  PREDICTED: exosome complex component RRP43         180   6e-49    
ref|XP_010381377.1|  PREDICTED: exosome complex component RRP43         180   6e-49    
ref|XP_002749024.2|  PREDICTED: exosome complex component RRP43         181   6e-49    Callithrix jacchus [common marmoset]
ref|XP_001495596.1|  PREDICTED: exosome complex component RRP43         180   6e-49    Equus caballus [domestic horse]
ref|NP_081424.3|  exosome complex component RRP43 isoform 2             180   8e-49    Mus musculus [mouse]
ref|XP_007555234.1|  PREDICTED: exosome complex component RRP43 i...    179   9e-49    
ref|XP_005906823.1|  PREDICTED: exosome complex component RRP43         179   9e-49    
ref|XP_005635497.1|  PREDICTED: exosome complex component RRP43 i...    181   1e-48    
ref|XP_002733208.1|  PREDICTED: exosome complex component RRP43-like    179   1e-48    Saccoglossus kowalevskii
ref|XP_004054442.1|  PREDICTED: exosome complex component RRP43         179   1e-48    
gb|AAH59089.1|  Exosome component 8                                     179   1e-48    Mus musculus [mouse]
ref|XP_007555095.1|  PREDICTED: exosome complex component RRP43-like    179   1e-48    
ref|XP_004770813.1|  PREDICTED: exosome complex component RRP43 i...    180   1e-48    
ref|XP_007526590.1|  PREDICTED: exosome complex component RRP43         179   1e-48    
ref|XP_007555228.1|  PREDICTED: exosome complex component RRP43 i...    179   1e-48    
ref|XP_006182701.1|  PREDICTED: exosome complex component RRP43         179   2e-48    
ref|XP_001368047.1|  PREDICTED: exosome complex component RRP43         179   2e-48    Monodelphis domestica
ref|NP_001073074.1|  exosome complex component RRP43                    179   2e-48    Bos taurus [bovine]
ref|XP_008425514.1|  PREDICTED: exosome complex component RRP43         178   3e-48    
ref|XP_005007102.1|  PREDICTED: exosome complex component RRP43 i...    178   3e-48    
ref|XP_008302217.1|  PREDICTED: exosome complex component RRP43         178   3e-48    
ref|XP_005387721.1|  PREDICTED: exosome complex component RRP43 i...    178   3e-48    
ref|XP_007128934.1|  PREDICTED: exosome complex component RRP43         178   3e-48    
ref|XP_004854778.1|  PREDICTED: exosome complex component RRP43 i...    179   4e-48    
gb|KFW78516.1|  Exosome complex component RRP43                         177   4e-48    
ref|XP_003764575.1|  PREDICTED: exosome complex component RRP43         177   5e-48    
ref|XP_009684893.1|  PREDICTED: exosome complex component RRP43         180   5e-48    
dbj|BAD90152.1|  mKIAA4013 protein                                      179   5e-48    Mus musculus [mouse]
ref|XP_008583527.1|  PREDICTED: exosome complex component RRP43 i...    177   5e-48    
ref|XP_007433303.1|  PREDICTED: exosome complex component RRP43 i...    177   6e-48    
ref|XP_004886214.1|  PREDICTED: exosome complex component RRP43 i...    179   6e-48    
gb|KFO28691.1|  Exosome complex component RRP43                         179   7e-48    
ref|XP_006267502.1|  PREDICTED: exosome complex component RRP43         177   7e-48    
ref|NP_001079391.1|  exosome component 8                                177   7e-48    Xenopus laevis [clawed frog]
gb|AAH67250.1|  Exosc8 protein                                          177   9e-48    Mus musculus [mouse]
ref|XP_007630918.1|  PREDICTED: exosome complex component RRP43 i...    177   1e-47    
gb|ELR48345.1|  Exosome complex exonuclease RRP43                       177   1e-47    
ref|XP_005286629.1|  PREDICTED: exosome complex component RRP43         177   1e-47    
ref|XP_004012165.1|  PREDICTED: exosome complex component RRP43         176   1e-47    
gb|ELK34704.1|  Exosome complex component RRP43                         177   1e-47    
gb|KDQ64066.1|  hypothetical protein JAAARDRAFT_166025                  176   2e-47    
gb|AAC39558.1|  Opa-interacting protein OIP2                            176   2e-47    Homo sapiens [man]
gb|EAX08581.1|  exosome component 8, isoform CRA_c                      176   2e-47    Homo sapiens [man]
ref|XP_009901127.1|  PREDICTED: exosome complex component RRP43         176   2e-47    
ref|XP_006028450.1|  PREDICTED: exosome complex component RRP43         177   2e-47    
ref|XP_007070973.1|  PREDICTED: exosome complex component RRP43         176   2e-47    
ref|XP_005344036.1|  PREDICTED: exosome complex component RRP43 i...    176   2e-47    
ref|XP_007193718.1|  PREDICTED: exosome complex component RRP43         176   2e-47    
ref|XP_010901892.1|  PREDICTED: exosome complex component RRP43         176   3e-47    
ref|NP_001007919.1|  exosome component 8                                176   3e-47    Xenopus tropicalis [western clawed frog]
ref|XP_007392456.1|  hypothetical protein PHACADRAFT_181840             176   4e-47    
ref|XP_007464290.1|  PREDICTED: exosome complex component RRP43         175   4e-47    
ref|XP_004405325.1|  PREDICTED: exosome complex component RRP43-like    175   4e-47    
ref|XP_006120599.1|  PREDICTED: exosome complex component RRP43         175   4e-47    
ref|XP_004282280.1|  PREDICTED: exosome complex component RRP43         175   4e-47    
gb|ACO52081.1|  Exosome complex exonuclease RRP43                       175   5e-47    Rana catesbeiana [bullfrog]
ref|XP_005876038.1|  PREDICTED: exosome complex component RRP43-like    175   6e-47    
gb|AAX96113.1|  expressed protein                                       171   7e-47    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001157042.1|  exosome complex component RRP43 isoform 1          175   7e-47    Mus musculus [mouse]
ref|XP_009510212.1|  PREDICTED: exosome complex component RRP43         173   2e-46    
ref|XP_004550171.1|  PREDICTED: exosome complex component RRP43-l...    173   2e-46    
ref|XP_005482498.1|  PREDICTED: exosome complex component RRP43         173   2e-46    
gb|EAX08579.1|  exosome component 8, isoform CRA_a                      174   3e-46    
ref|XP_010791674.1|  PREDICTED: exosome complex component RRP43         172   4e-46    
gb|EMD40344.1|  hypothetical protein CERSUDRAFT_148276                  173   4e-46    
ref|NP_001279869.1|  exosome component 8                                172   5e-46    
ref|XP_005852012.1|  hypothetical protein CHLNCDRAFT_132943             172   7e-46    
ref|XP_002196618.1|  PREDICTED: exosome complex component RRP43         172   7e-46    Taeniopygia guttata
ref|XP_005516377.1|  PREDICTED: exosome complex component RRP43         172   7e-46    
ref|XP_006800170.1|  PREDICTED: exosome complex component RRP43-like    172   9e-46    
ref|NP_001088781.1|  uncharacterized protein LOC496046                  171   1e-45    Xenopus laevis [clawed frog]
ref|XP_006927312.1|  PREDICTED: exosome complex component RRP43         171   1e-45    
ref|XP_007862017.1|  hypothetical protein GLOTRDRAFT_69878              171   1e-45    
emb|CCM05533.1|  predicted protein                                      171   1e-45    
gb|KFV69117.1|  Exosome complex component RRP43                         171   2e-45    
ref|XP_004076251.1|  PREDICTED: exosome complex component RRP43-like    171   2e-45    
ref|XP_004641962.1|  PREDICTED: exosome complex component RRP43-like    171   2e-45    
gb|KDQ15468.1|  hypothetical protein BOTBODRAFT_158330                  171   2e-45    
ref|XP_009074397.1|  PREDICTED: exosome complex component RRP43         170   3e-45    
ref|XP_003640625.1|  PREDICTED: exosome complex component RRP43         170   3e-45    
ref|XP_008935303.1|  PREDICTED: exosome complex component RRP43         170   3e-45    
ref|XP_006628282.1|  PREDICTED: exosome complex component RRP43-like    169   6e-45    
ref|XP_005018404.1|  PREDICTED: LOW QUALITY PROTEIN: exosome comp...    169   7e-45    
ref|XP_010151888.1|  PREDICTED: exosome complex component RRP43         169   8e-45    
ref|NP_001002865.1|  exosome complex component RRP43                    169   9e-45    Danio rerio [leopard danio]
gb|AAH95236.1|  Exosome component 8                                     169   1e-44    Danio rerio [leopard danio]
ref|XP_007317089.1|  hypothetical protein SERLADRAFT_464533             169   1e-44    
ref|XP_010398772.1|  PREDICTED: exosome complex component RRP43         169   2e-44    
ref|XP_010086432.1|  PREDICTED: exosome complex component RRP43         168   2e-44    
ref|XP_001690534.1|  hypothetical protein CHLREDRAFT_114378             169   2e-44    Chlamydomonas reinhardtii
ref|XP_005668405.1|  PREDICTED: LOW QUALITY PROTEIN: exosome comp...    167   2e-44    
ref|XP_006719826.1|  PREDICTED: exosome complex component RRP43 i...    168   4e-44    
ref|XP_009083879.1|  PREDICTED: exosome complex component RRP43         167   4e-44    
gb|AAI65543.1|  Exosc8 protein                                          167   5e-44    
ref|XP_010172234.1|  PREDICTED: exosome complex component RRP43         166   5e-44    
ref|XP_006005268.1|  PREDICTED: exosome complex component RRP43 i...    166   6e-44    
ref|XP_005038044.1|  PREDICTED: exosome complex component RRP43         166   6e-44    
ref|XP_008932515.1|  PREDICTED: exosome complex component RRP43-like    167   6e-44    
ref|XP_009642762.1|  PREDICTED: exosome complex component RRP43         167   6e-44    
gb|KFW07139.1|  Exosome complex component RRP43                         167   6e-44    
ref|XP_006005267.1|  PREDICTED: exosome complex component RRP43 i...    166   7e-44    
ref|XP_003458313.1|  PREDICTED: exosome complex component RRP43-like    166   7e-44    
ref|XP_009936453.1|  PREDICTED: exosome complex component RRP43         167   7e-44    
ref|XP_005420899.1|  PREDICTED: exosome complex component RRP43         166   8e-44    
ref|XP_005077640.1|  PREDICTED: LOW QUALITY PROTEIN: exosome comp...    167   8e-44    
gb|KFW76611.1|  Exosome complex component RRP43                         166   8e-44    
gb|KDQ29761.1|  hypothetical protein PLEOSDRAFT_1038433                 166   8e-44    
ref|XP_003062358.1|  3' exoribonuclease                                 167   1e-43    
ref|XP_008501387.1|  PREDICTED: exosome complex component RRP43         166   1e-43    
ref|XP_002683063.1|  exosome complex exonuclease RRP43                  166   1e-43    
dbj|BAE41329.1|  unnamed protein product                                165   1e-43    
ref|XP_007433305.1|  PREDICTED: exosome complex component RRP43 i...    165   1e-43    
ref|XP_005512058.1|  PREDICTED: exosome complex component RRP43         167   2e-43    
ref|XP_008950519.1|  PREDICTED: exosome complex component RRP43 i...    166   2e-43    
ref|XP_009866582.1|  PREDICTED: exosome complex component RRP43         166   2e-43    
gb|KFQ56846.1|  Exosome complex component RRP43                         165   2e-43    
ref|XP_009425177.1|  PREDICTED: exosome complex component RRP43 i...    166   3e-43    
ref|XP_010126385.1|  PREDICTED: exosome complex component RRP43         167   3e-43    
ref|XP_010571073.1|  PREDICTED: exosome complex component RRP43         165   3e-43    
ref|XP_009566989.1|  PREDICTED: exosome complex component RRP43         165   3e-43    
ref|XP_005387723.1|  PREDICTED: exosome complex component RRP43 i...    164   3e-43    
ref|XP_009926534.1|  PREDICTED: exosome complex component RRP43         165   3e-43    
ref|XP_008331430.1|  PREDICTED: exosome complex component RRP43         165   3e-43    
ref|XP_001626253.1|  predicted protein                                  164   4e-43    
ref|XP_010189869.1|  PREDICTED: exosome complex component RRP43         165   4e-43    
ref|XP_009996671.1|  PREDICTED: exosome complex component RRP43         164   5e-43    
ref|XP_009326128.1|  PREDICTED: exosome complex component RRP43         165   5e-43    
gb|KFO57372.1|  Exosome complex component RRP43                         164   6e-43    
ref|XP_007308819.1|  hypothetical protein STEHIDRAFT_171488             164   6e-43    
ref|XP_005147750.1|  PREDICTED: exosome complex component RRP43         164   7e-43    
ref|XP_009461399.1|  PREDICTED: exosome complex component RRP43         165   7e-43    
ref|XP_009990948.1|  PREDICTED: exosome complex component RRP43         163   7e-43    
ref|XP_004329220.1|  PREDICTED: LOW QUALITY PROTEIN: exosome comp...    164   8e-43    
gb|ELK09269.1|  Exosome complex exonuclease RRP43                       164   9e-43    
ref|XP_009886727.1|  PREDICTED: exosome complex component RRP43         163   1e-42    
ref|XP_005241225.1|  PREDICTED: exosome complex component RRP43         163   1e-42    
gb|KFP87679.1|  Exosome complex component RRP43                         163   1e-42    
gb|AAI52249.1|  MGC174638 protein                                       163   2e-42    
ref|XP_009957260.1|  PREDICTED: exosome complex component RRP43         162   2e-42    
ref|XP_005446586.1|  PREDICTED: exosome complex component RRP43         162   2e-42    
gb|KFV07395.1|  Exosome complex component RRP43                         162   2e-42    
ref|XP_010285549.1|  PREDICTED: exosome complex component RRP43         163   2e-42    
ref|XP_009815856.1|  PREDICTED: exosome complex component RRP43         162   3e-42    
gb|KFW69686.1|  Exosome complex component RRP43                         162   3e-42    
ref|XP_010311856.1|  PREDICTED: exosome complex component RRP43         162   3e-42    
ref|XP_009478442.1|  PREDICTED: exosome complex component RRP43         162   3e-42    
gb|KFQ75723.1|  Exosome complex component RRP43                         161   5e-42    
gb|EPT00821.1|  hypothetical protein FOMPIDRAFT_1030258                 162   6e-42    
ref|XP_009967346.1|  PREDICTED: exosome complex component RRP43         161   6e-42    
gb|KFQ40250.1|  Exosome complex component RRP43                         161   6e-42    
ref|XP_010223581.1|  PREDICTED: exosome complex component RRP43         160   7e-42    
ref|XP_010590965.1|  PREDICTED: exosome complex component RRP43 i...    160   7e-42    
ref|XP_008034908.1|  hypothetical protein TRAVEDRAFT_35012              161   8e-42    
gb|KGL96063.1|  Exosome complex component RRP43                         160   9e-42    
gb|KFP08017.1|  Exosome complex component RRP43                         160   1e-41    
gb|EMC80708.1|  Exosome complex exonuclease RRP43                       160   2e-41    
ref|XP_004550170.1|  PREDICTED: exosome complex component RRP43-l...    160   2e-41    
ref|XP_007382540.1|  hypothetical protein PUNSTDRAFT_142893             160   3e-41    
ref|XP_007364895.1|  ribosomal protein S5 domain 2-like protein         160   3e-41    
gb|KFV42688.1|  Exosome complex component RRP43                         159   3e-41    
gb|KFP59059.1|  Exosome complex component RRP43                         159   5e-41    
gb|KFO81913.1|  Exosome complex component RRP43                         159   5e-41    
emb|CAG00433.1|  unnamed protein product                                158   6e-41    
gb|KFV05852.1|  Exosome complex component RRP43                         157   7e-41    
ref|XP_007268980.1|  hypothetical protein FOMMEDRAFT_88508              158   1e-40    
gb|KFU90164.1|  Exosome complex component RRP43                         157   2e-40    
gb|EPB90506.1|  hypothetical protein HMPREF1544_02715                   157   2e-40    
ref|XP_006675068.1|  hypothetical protein BATDEDRAFT_9008               157   2e-40    
ref|XP_796992.1|  PREDICTED: exosome complex component RRP43-like       157   3e-40    
ref|XP_003971367.1|  PREDICTED: exosome complex component RRP43-like    157   3e-40    
ref|XP_009288537.1|  PREDICTED: exosome complex component RRP43         156   6e-40    
ref|XP_009050238.1|  hypothetical protein LOTGIDRAFT_201434             155   7e-40    
gb|ELW67422.1|  Exosome complex component RRP43                         154   8e-40    
ref|XP_008927365.1|  PREDICTED: LOW QUALITY PROTEIN: exosome comp...    160   1e-39    
gb|KGN53844.1|  hypothetical protein Csa_4G165890                       150   1e-39    
gb|KFO08386.1|  Exosome complex component RRP43                         155   2e-39    
ref|XP_007845833.1|  exosome component 8                                155   2e-39    
gb|EOB02133.1|  Exosome complex exonuclease RRP43                       153   3e-39    
ref|XP_783510.2|  PREDICTED: exosome complex component RRP43-like       153   5e-39    
ref|XP_002158932.2|  PREDICTED: exosome complex component RRP43-like    153   5e-39    
ref|XP_010138226.1|  PREDICTED: exosome complex component RRP43         152   7e-39    
ref|XP_009551912.1|  hypothetical protein HETIRDRAFT_329543             153   7e-39    
ref|XP_008915086.1|  hypothetical protein PPTG_18668                    152   2e-38    
gb|ETM31369.1|  hypothetical protein L914_21049                         152   2e-38    
ref|XP_009702646.1|  PREDICTED: exosome complex component RRP43         152   3e-38    
gb|EFN72375.1|  Exosome complex exonuclease RRP43                       151   4e-38    
ref|XP_009572471.1|  PREDICTED: exosome complex component RRP43         150   4e-38    
gb|EUC66237.1|  exosome complex component RRP43                         151   4e-38    
gb|EPS60631.1|  hypothetical protein M569_14171                         144   1e-37    
gb|KDR23812.1|  Exosome complex exonuclease RRP43                       149   1e-37    
gb|KEP47144.1|  exosome complex component RRP43                         149   2e-37    
gb|EXX66290.1|  Rrp45p                                                  149   2e-37    
gb|ETK71450.1|  hypothetical protein L915_21309                         149   2e-37    
gb|EGI63647.1|  Exosome complex exonuclease RRP43                       148   3e-37    
gb|KFO92086.1|  Exosome complex component RRP43                         147   4e-37    
gb|KFP67092.1|  Exosome complex component RRP43                         147   5e-37    
gb|KFH65208.1|  hypothetical protein MVEG_08689                         148   5e-37    
gb|EKC33499.1|  Exosome complex exonuclease RRP43                       148   6e-37    
ref|XP_972667.1|  PREDICTED: exosome complex component RRP43            147   6e-37    
ref|XP_007338885.1|  hypothetical protein AURDEDRAFT_110988             147   9e-37    
emb|CCA70939.1|  related to Exosome complex exonuclease RRP43           147   9e-37    
ref|XP_003588422.1|  Exosome complex exonuclease RRP43                  142   1e-36    
ref|XP_008546920.1|  PREDICTED: exosome complex component RRP43-like    146   1e-36    
gb|KFM02313.1|  Exosome complex component RRP43                         146   1e-36    
gb|KFV89032.1|  Exosome complex component RRP43                         145   2e-36    
gb|KDR77342.1|  hypothetical protein GALMADRAFT_66688                   147   3e-36    
ref|XP_011057318.1|  PREDICTED: exosome complex component RRP43-like    145   3e-36    
gb|EZA50937.1|  Exosome complex component RRP43                         145   3e-36    
ref|XP_001649768.1|  exosome complex exonuclease rrp43 (ribosomal...    145   4e-36    
ref|XP_007770277.1|  hypothetical protein CONPUDRAFT_166613             145   4e-36    
ref|XP_320154.3|  AGAP012402-PA                                         145   4e-36    
gb|ERL83540.1|  hypothetical protein D910_00610                         145   5e-36    
gb|EFA80660.1|  hypothetical protein PPL_06243                          145   6e-36    
gb|KFQ75130.1|  Exosome complex component RRP43                         144   9e-36    
gb|KFP09913.1|  Exosome complex component RRP43                         144   1e-35    
gb|KFP95436.1|  Exosome complex component RRP43                         144   1e-35    
ref|XP_001847547.1|  exosome complex exonuclease RRP43                  143   2e-35    
gb|ELT94047.1|  hypothetical protein CAPTEDRAFT_173435                  143   2e-35    
ref|XP_001864258.1|  exosome complex exonuclease RRP43                  142   3e-35    
gb|EFN85487.1|  Exosome complex exonuclease RRP43                       142   4e-35    
ref|XP_004333620.1|  exosc8 protein                                     142   5e-35    
emb|CAI46226.1|  hypothetical protein                                   141   5e-35    
ref|XP_002904050.1|  exosome complex exonuclease RRP43, putative        142   7e-35    
ref|XP_005090783.1|  PREDICTED: exosome complex component RRP43-like    141   1e-34    
ref|NP_596385.1|  exosome subunit Rrp43 (predicted)                     140   1e-34    
emb|CBJ29102.1|  similar to exosome component 6                         140   2e-34    
gb|EPY50664.1|  exosome subunit Rrp43                                   140   2e-34    
ref|XP_007003813.1|  hypothetical protein TREMEDRAFT_23063              139   3e-34    
ref|XP_003032967.1|  hypothetical protein SCHCODRAFT_76318              140   3e-34    
gb|KDE05761.1|  hypothetical protein MVLG_03852                         140   3e-34    
emb|CEG71427.1|  hypothetical protein RMATCC62417_07162                 139   4e-34    
gb|ETN63236.1|  exosome complex exonuclease rrp43                       140   4e-34    
ref|XP_003703797.1|  PREDICTED: exosome complex component RRP43-like    139   4e-34    
gb|EPX72336.1|  exosome subunit Rrp43                                   139   4e-34    
ref|XP_001876876.1|  predicted protein                                  139   5e-34    
ref|XP_009537303.1|  hypothetical protein PHYSODRAFT_529521             139   8e-34    
gb|ESA21150.1|  hypothetical protein GLOINDRAFT_343288                  137   1e-33    
ref|XP_006623160.1|  PREDICTED: exosome complex component RRP43-like    138   1e-33    
ref|XP_003697074.1|  PREDICTED: exosome complex component RRP43-like    138   1e-33    
ref|XP_624000.1|  PREDICTED: exosome complex component RRP43-like       137   3e-33    
emb|CCA14404.1|  exosome complex exonuclease RRP43 putative             137   3e-33    
ref|XP_006456898.1|  hypothetical protein AGABI2DRAFT_195867            138   4e-33    
ref|XP_007872368.1|  hypothetical protein PNEG_00482                    135   1e-32    
gb|KFZ50779.1|  Exosome complex component RRP43                         132   1e-32    
ref|NP_001280288.1|  uncharacterized protein LOC100162344               134   2e-32    
ref|XP_003393272.1|  PREDICTED: exosome complex component RRP43-like    134   2e-32    
ref|XP_003494065.1|  PREDICTED: exosome complex component RRP43-like    134   2e-32    
gb|ELU45348.1|  Opa-interacting protein OIP2                            135   2e-32    
gb|KFB49953.1|  AGAP012402-PA-like protein                              134   3e-32    
gb|KFP24467.1|  Exosome complex component RRP43                         133   3e-32    
ref|XP_002120565.1|  PREDICTED: exosome complex component RRP43-like    134   4e-32    
gb|EGU13446.1|  hypothetical protein RTG_00162                          134   7e-32    
emb|CDI55940.1|  related to Exosome complex exonuclease RRP43           134   8e-32    
emb|CDS10743.1|  hypothetical protein LRAMOSA11229                      132   9e-32    
ref|XP_010194750.1|  PREDICTED: exosome complex component RRP43         133   1e-31    
gb|EMS21936.1|  exosome complex component RRP43                         132   2e-31    
gb|EFW43767.2|  opa-interacting protein 2                               133   3e-31    
emb|CEF97115.1|  Exoribonuclease, phosphorolytic domain 2               131   5e-31    
emb|CCI41072.1|  unnamed protein product                                138   5e-31    
ref|XP_007328869.1|  hypothetical protein AGABI1DRAFT_38968             132   7e-31    
dbj|GAC97762.1|  hypothetical protein PHSY_005349                       130   1e-30    
emb|CDH52860.1|  exosome component 8                                    131   1e-30    
gb|EFX69223.1|  hypothetical protein DAPPUDRAFT_301019                  129   1e-30    
ref|XP_010727256.1|  PREDICTED: exosome complex component RRP43         129   2e-30    
gb|EST08276.1|  hypothetical protein PSEUBRA_SCAF17g04273               130   2e-30    
ref|XP_008915087.1|  hypothetical protein, variant                      128   2e-30    
ref|XP_002424432.1|  Exosome complex exonuclease RRP43, putative        128   3e-30    
ref|XP_002175205.1|  exosome subunit Rrp43                              127   7e-30    
dbj|GAA95876.1|  hypothetical protein E5Q_02533                         127   1e-29    
gb|ELW47562.1|  Exosome complex component RRP43                         122   1e-29    
ref|XP_005717964.1|  unnamed protein product                            127   1e-29    
gb|ETM31370.1|  hypothetical protein, variant                           125   1e-29    
ref|XP_008470564.1|  PREDICTED: exosome complex component RRP43-like    125   1e-29    
ref|XP_004987948.1|  hypothetical protein PTSG_11024                    126   2e-29    
gb|ETK71451.1|  hypothetical protein, variant                           125   2e-29    
ref|XP_010013384.1|  PREDICTED: exosome complex component RRP43         124   3e-29    
gb|KFQ42614.1|  Exosome complex component RRP43                         124   3e-29    
gb|ACZ26287.1|  putative exosome complex exonuclease                    125   5e-29    
ref|XP_003286615.1|  hypothetical protein DICPUDRAFT_31155              124   9e-29    
emb|CDY33620.1|  BnaC01g28510D                                          121   2e-28    
ref|WP_011018750.1|  RNA-binding protein                                122   3e-28    
ref|XP_001600402.1|  PREDICTED: exosome complex component RRP43-like    122   3e-28    
gb|AEE62451.1|  unknown                                                 119   5e-28    
gb|EXX66291.1|  Rrp45p                                                  122   6e-28    
gb|AFR92984.2|  exosome complex component RRP43                         122   7e-28    
gb|KFM24062.1|  Exosome complex component RRP43                         121   9e-28    
ref|XP_004357731.1|  hypothetical protein DFA_00014                     121   1e-27    
gb|ETS65151.1|  hypothetical protein PaG_00212                          122   1e-27    
dbj|GAK67137.1|  exosome component 8                                    121   1e-27    
dbj|GAC75510.1|  exosomal 3'-5' exoribonuclease complex, subunit ...    121   1e-27    
gb|ENN81038.1|  hypothetical protein YQE_02557                          120   2e-27    
emb|CBQ69873.1|  related to Exosome complex exonuclease RRP43           121   2e-27    
emb|CCJ29382.1|  unnamed protein product                                120   3e-27    
ref|WP_013335950.1|  3'-exoribonuclease                                 120   3e-27    
gb|KGB75252.1|  opa-interacting protein OIP2                            120   4e-27    
gb|EHJ77019.1|  hypothetical protein KGM_00061                          124   9e-27    
emb|CDO77202.1|  hypothetical protein BN946_scf184747.g15               117   1e-26    
ref|XP_004927841.1|  PREDICTED: exosome complex component RRP43-like    118   2e-26    
ref|XP_004453372.1|  PREDICTED: exosome complex component RRP43 i...    114   2e-26    
emb|CCF50258.1|  related to Exosome complex exonuclease RRP43           118   3e-26    
gb|EPZ35281.1|  Exoribonuclease, phosphorolytic 1 domain-containi...    115   7e-26    
gb|AAX95368.1|  3' exoribonuclease family, domain 2, putative           111   1e-25    
ref|XP_001416940.1|  predicted protein                                  115   2e-25    
ref|XP_009270056.1|  Exosome complex component RRP43                    113   6e-25    
ref|XP_761615.1|  hypothetical protein UM05468.1                        114   6e-25    
ref|WP_013605045.1|  3'-exoribonuclease                                 113   9e-25    
ref|WP_012310012.1|  RNA-binding protein                                112   1e-24    
gb|EDL35272.1|  exosome component 8, isoform CRA_a                      108   1e-24    
gb|KFM67344.1|  Exosome complex component RRP43                         113   2e-24    
ref|WP_020864655.1|  exosome complex component RRP42                    111   3e-24    
ref|XP_629574.1|  hypothetical protein DDB_G0292692                     111   3e-24    
ref|WP_013898461.1|  RNA-binding protein                                110   4e-24    
gb|EJT46109.1|  hypothetical protein A1Q1_05320                         111   6e-24    
ref|XP_006957190.1|  ribosomal protein S5 domain 2-like protein         112   1e-23    
ref|XP_007880913.1|  hypothetical protein PFL1_05193                    110   1e-23    
ref|WP_014405464.1|  RNA-binding protein                                108   2e-23    
gb|EDL35273.1|  exosome component 8, isoform CRA_b                      107   2e-23    
ref|WP_022532971.1|  probable exosome complex exonuclease 2             108   3e-23    
ref|WP_015504197.1|  Ribonuclease PH                                    108   3e-23    
ref|XP_008863898.1|  hypothetical protein H310_02233                    108   4e-23    
ref|XP_009824524.1|  hypothetical protein H257_02540                    108   4e-23    
ref|WP_014587689.1|  RNA-binding protein                                107   4e-23    



>ref|XP_009780009.1| PREDICTED: exosome complex component RRP43 [Nicotiana sylvestris]
 ref|XP_009780016.1| PREDICTED: exosome complex component RRP43 [Nicotiana sylvestris]
 ref|XP_009780020.1| PREDICTED: exosome complex component RRP43 [Nicotiana sylvestris]
 ref|XP_009780025.1| PREDICTED: exosome complex component RRP43 [Nicotiana sylvestris]
Length=303

 Score =   437 bits (1123),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 234/307 (76%), Positives = 263/307 (86%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   NGS DLSS+ME+DAFRRLFPLR+HE +L +S+RPD R LG AR TT+ LG+VASAD
Sbjct  1     MAAVNGSSDLSSEMEVDAFRRLFPLRYHEYHLLKSVRPDARKLGSARDTTLALGAVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTP+ + PDEGSIA+EFHMPPICS LVRPGRPAEAA VIS
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPTVECPDEGSIAIEFHMPPICSPLVRPGRPAEAAEVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SSGMIDLKELCL  GKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHL IP
Sbjct  121   KQLSDTIFSSGMIDLKELCLVGGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHLNIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V SLNDDGR+VL     +++ V     +    +EKRKL LNS PFSL+C+LHKNYILADP
Sbjct  181   VVSLNDDGRIVL----VSEDNVRGKLEKEPVNKEKRKLKLNSPPFSLTCILHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+METV+ VVLDS YQLVSLYKPGGP LA TSVIQDCVAL ++RV +L+N+L+EA
Sbjct  237   TAEEESIMETVVTVVLDSYYQLVSLYKPGGPVLAHTSVIQDCVALARRRVKELQNVLNEA  296

Query  1034  ISDMDVD  1054
             ISDM+VD
Sbjct  297   ISDMEVD  303



>ref|XP_009597188.1| PREDICTED: exosome complex component RRP43 [Nicotiana tomentosiformis]
Length=303

 Score =   436 bits (1122),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 232/307 (76%), Positives = 264/307 (86%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   NGS +LSS+ME+DAFRRLFPLR+HE +L +S+RPD R LG AR TT+ LG+V+SAD
Sbjct  1     MAAVNGSSELSSEMEVDAFRRLFPLRYHEYHLLKSVRPDARKLGSARDTTLALGAVSSAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTP+ + PDEGSIA+EFHMPPICS LVRPGRPAE A VIS
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPTMECPDEGSIAIEFHMPPICSPLVRPGRPAETATVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SSGMIDLKELCL  GKAAWMAYLDIYC+DADGALFDAALLSAVAAFSHL IP
Sbjct  121   KQLSDTIFSSGMIDLKELCLVGGKAAWMAYLDIYCMDADGALFDAALLSAVAAFSHLNIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V SLNDDGR+VL     +++ V     +    +EKRKL LNS PFSL+C+LHKNYILADP
Sbjct  181   VVSLNDDGRIVL----VSEDNVRGKLEKEPVNKEKRKLKLNSPPFSLTCILHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+METV+ VVLDSSYQLVSLYKPGGP LA TSVIQDCVALT++RV +L+N+L+EA
Sbjct  237   TAEEESIMETVVTVVLDSSYQLVSLYKPGGPVLAHTSVIQDCVALTRRRVKELQNVLNEA  296

Query  1034  ISDMDVD  1054
             ISDM+VD
Sbjct  297   ISDMEVD  303



>ref|XP_006351314.1| PREDICTED: exosome complex component RRP43 [Solanum tuberosum]
Length=303

 Score =   435 bits (1118),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 230/307 (75%), Positives = 262/307 (85%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M  ANGS DLSS+ME+DAFRRLFPLRFHE +L +S+RPD R LG AR TT+ LG+VASAD
Sbjct  1     MAAANGSSDLSSEMEVDAFRRLFPLRFHEHHLLKSVRPDARKLGSARDTTLALGAVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTP  + PDEGSIA+EFHMPPICS LVRPGRPAEAA VIS
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPIVECPDEGSIAIEFHMPPICSPLVRPGRPAEAASVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SSGMIDLKELCL  GKAAWMAYLDIYCLDADGALFD ALLSAVAAFSHL IP
Sbjct  121   KQLSDTILSSGMIDLKELCLVGGKAAWMAYLDIYCLDADGALFDTALLSAVAAFSHLNIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V SLNDDGR+VL     +++ V     +     EKRKL LNS+PFSL+C+LHKNYILADP
Sbjct  181   VVSLNDDGRIVL----VSEDTVRLKLEKEPVNTEKRKLKLNSLPFSLTCILHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET++ +VLDSSYQLVSL KPGGP L+ TSVIQDC+AL ++RV +L+++L+EA
Sbjct  237   TAEEESIMETIVTMVLDSSYQLVSLNKPGGPVLSHTSVIQDCIALARRRVKELQSVLNEA  296

Query  1034  ISDMDVD  1054
             ISDM+VD
Sbjct  297   ISDMEVD  303



>ref|XP_004241263.1| PREDICTED: exosome complex component RRP43-like isoform X1 [Solanum 
lycopersicum]
Length=303

 Score =   429 bits (1103),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 227/307 (74%), Positives = 261/307 (85%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M  ANGS DL S+ME+DAFRRLFPLR+HE++L +S+RPD R LG AR TT+ LG+VASA+
Sbjct  1     MAAANGSSDLYSEMEVDAFRRLFPLRYHEQHLLKSVRPDARKLGSARDTTLALGAVASAE  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+E+MTP+ + PDEGSIA+EFHMPPICS LVRPGRPAEAA VIS
Sbjct  61    GSALAKIGSTTMLAAIKMEIMTPTVECPDEGSIAIEFHMPPICSPLVRPGRPAEAASVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SSGMIDLKELCL  GKAAWMAYLDIYCLDADG+LFDAALLSAVAAFSHL IP
Sbjct  121   KQLSDTILSSGMIDLKELCLVGGKAAWMAYLDIYCLDADGSLFDAALLSAVAAFSHLNIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V SLN+DGR+VL     +++       +     EKRKL LNS PFSL+C+LHKNYILADP
Sbjct  181   VVSLNEDGRIVL----VSEDNNQLKLEKQPVNTEKRKLKLNSPPFSLTCLLHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET + VVLDSSYQLVSLYKPGGP  A TSVIQDCVAL K+RV +L+++L+EA
Sbjct  237   TAEEESIMETAVTVVLDSSYQLVSLYKPGGPVHAHTSVIQDCVALAKRRVKELQSVLNEA  296

Query  1034  ISDMDVD  1054
             ISDM+V+
Sbjct  297   ISDMEVE  303



>gb|EYU20751.1| hypothetical protein MIMGU_mgv1a010701mg [Erythranthe guttata]
 gb|EYU20752.1| hypothetical protein MIMGU_mgv1a010701mg [Erythranthe guttata]
Length=304

 Score =   428 bits (1101),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 228/307 (74%), Positives = 260/307 (85%), Gaps = 3/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   +G  DLSS+ME+DAFRRLFPLRFHER+L ES+RPDGR LG AR TT++LG+VASA+
Sbjct  1     MAVTSGPNDLSSEMEVDAFRRLFPLRFHERHLLESLRPDGRPLGRARDTTLMLGAVASAN  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSA+ KIGSTTMLAAIK+EVMTP+A++PDEG IA+EFHMPPICS LVRPGRPAE APVIS
Sbjct  61    GSAMAKIGSTTMLAAIKMEVMTPTAEAPDEGCIAIEFHMPPICSPLVRPGRPAEVAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SSGMIDLKELCL  GKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHL+IP
Sbjct  121   KQLSDTILSSGMIDLKELCLVGGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V SLNDDGR+V+       N     + +    +EK KL L SVPFSL+CVLHK YILADP
Sbjct  181   VVSLNDDGRIVI---ISEDNNGGAMKEKEPVNKEKIKLKLKSVPFSLTCVLHKKYILADP  237

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             T+EEES+MET L VVLDSS+QLVSL KPGGP L ++S IQDCV LT+QRV +L+ IL+EA
Sbjct  238   TSEEESIMETFLTVVLDSSFQLVSLNKPGGPGLTNSSAIQDCVTLTRQRVKELQKILNEA  297

Query  1034  ISDMDVD  1054
             ISDM+VD
Sbjct  298   ISDMEVD  304



>ref|XP_007028731.1| 3'-5'-exoribonuclease family protein [Theobroma cacao]
 gb|EOY09233.1| 3'-5'-exoribonuclease family protein [Theobroma cacao]
Length=302

 Score =   427 bits (1098),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 224/307 (73%), Positives = 258/307 (84%), Gaps = 5/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   N SGDLS+++E+DAFRRLFPLRF+E++L ESIRPD R LG AR TT+ LG+VASA+
Sbjct  1     MGLPNASGDLSTEVEVDAFRRLFPLRFYEKHLSESIRPDARPLGRARDTTIALGAVASAN  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTPS ++PDEG +A++FHMPPICS +VRPGRPAEAAPV+S
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPSTETPDEGCVAIDFHMPPICSPIVRPGRPAEAAPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SSGMI LKELCL SGKAAWMAYLDIYCLDADGALFD ALLSAVAAFSHLEIP
Sbjct  121   KQLSDTILSSGMISLKELCLVSGKAAWMAYLDIYCLDADGALFDTALLSAVAAFSHLEIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V SLNDDG++VL        E           +EKRKL L S+PFSL+C+LHKNYILADP
Sbjct  181   VVSLNDDGKIVL-----LSEEQEGMSEREPVNKEKRKLTLCSIPFSLTCILHKNYILADP  235

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET++ +VLDSS QLVSLYKPGGP LA TS IQDC+A+T+QRV +L+ IL EA
Sbjct  236   TAEEESIMETLVTIVLDSSSQLVSLYKPGGPVLAYTSAIQDCIAITRQRVKELQKILEEA  295

Query  1034  ISDMDVD  1054
             IS M+VD
Sbjct  296   ISVMEVD  302



>ref|NP_001275445.1| 3'-5'-exoribonuclease/RNA binding-like protein [Solanum tuberosum]
 ref|XP_006365747.1| PREDICTED: exosome complex component RRP43 isoform X2 [Solanum 
tuberosum]
 gb|ABC01901.1| 3'-5'-exoribonuclease/RNA binding-like protein [Solanum tuberosum]
Length=303

 Score =   426 bits (1094),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 225/307 (73%), Positives = 260/307 (85%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M  ANGS DL S+ME+DAFRRLFPLR+HE++L +S+RPD R LG AR TT+ LG+VASA+
Sbjct  1     MAAANGSSDLYSEMEVDAFRRLFPLRYHEQHLLKSVRPDARKLGSARDTTLALGAVASAE  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+E+MTP+ + PDEGSIA+EFHMPPICS LVRPGRPAE A VIS
Sbjct  61    GSALAKIGSTTMLAAIKMEIMTPTVECPDEGSIAIEFHMPPICSPLVRPGRPAEVASVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SSGMIDLKELCL  GKAAWMAYLDIYCLDADG+LFDAALLS VAAFSHL IP
Sbjct  121   KQLSDTILSSGMIDLKELCLVGGKAAWMAYLDIYCLDADGSLFDAALLSTVAAFSHLNIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V SLN+DGR+VL     +++ +     +     EKRKL LNS PFSL+C+LHKNYILADP
Sbjct  181   VVSLNEDGRIVL----VSEDNIQLKLEKQPVNTEKRKLKLNSPPFSLTCLLHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET + VVLDSSYQLVSLYKPGGP  A TSVIQDCVAL K+RV +L+++L+EA
Sbjct  237   TAEEESIMETAVTVVLDSSYQLVSLYKPGGPVHAHTSVIQDCVALAKRRVKELQSVLNEA  296

Query  1034  ISDMDVD  1054
             ISDM+V+
Sbjct  297   ISDMEVE  303



>ref|NP_001275073.1| 3'-5'-exoribonuclease/RNA binding protein-like protein [Solanum 
tuberosum]
 gb|ABC01886.1| 3'-5'-exoribonuclease/RNA binding protein-like protein [Solanum 
tuberosum]
Length=314

 Score =   425 bits (1093),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 225/306 (74%), Positives = 259/306 (85%), Gaps = 4/306 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M  ANGS DLSS+ME+DAFRRLFPLR+HE +L +S+RPD R LG AR TT+ LG+VASAD
Sbjct  1     MAAANGSSDLSSEMEVDAFRRLFPLRYHEHHLLKSVRPDARKLGSARDTTLALGAVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTP+ + PDEGSIA+EFHMPPICS LVRPGRPAEAA VIS
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPTVECPDEGSIAIEFHMPPICSPLVRPGRPAEAASVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SSGMIDLKELCL  GKAAWMAYLDIYCLDADGALFD ALLSAVAAFSHL IP
Sbjct  121   KQLSDTILSSGMIDLKELCLVGGKAAWMAYLDIYCLDADGALFDTALLSAVAAFSHLNIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V SLNDDGR+VL     +++ V     +     EKRKL LNS+PFSL+C+LHKNYILADP
Sbjct  181   VVSLNDDGRIVL----VSEDTVRLKLEKEPVNTEKRKLKLNSLPFSLTCILHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEE +MET++ VVLDSS+QLVSL KPGGP L+ TSVIQDC+ L ++R  +L+++L+EA
Sbjct  237   TAEEEPIMETIVTVVLDSSHQLVSLNKPGGPVLSHTSVIQDCIGLARRRAKELQSVLNEA  296

Query  1034  ISDMDV  1051
             ISDM+V
Sbjct  297   ISDMEV  302



>ref|XP_011048048.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica]
 ref|XP_011048049.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica]
Length=303

 Score =   424 bits (1089),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 223/307 (73%), Positives = 262/307 (85%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + SGDLSS+ME+DAFRRLFPLR+ ER+L ESIRPD R LG AR TT+ LG+VASA 
Sbjct  1     MGVPDASGDLSSEMEVDAFRRLFPLRYFERHLSESIRPDARPLGRARDTTLALGAVASAH  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTPS +SPDEGSIA++FHMPPICS +VRPGRPAEAAPVIS
Sbjct  61    GSALAKIGSTTMLAAIKLEVMTPSTESPDEGSIAIDFHMPPICSPIVRPGRPAEAAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI+SSGMI+LKEL L SGKAAWMAYLDIYCLDADGALFDAALLSA++AFSHL+IP
Sbjct  121   KQLSDTISSSGMINLKELSLVSGKAAWMAYLDIYCLDADGALFDAALLSAISAFSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             + SLNDDG++VL     ++ +      +    +EKRKL L+S+PFSL+C+LHKNYILADP
Sbjct  181   IVSLNDDGKIVL----VSEEDDGTKLEDEPVNKEKRKLTLSSIPFSLTCILHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET++ VVLDSS +LVS YKPGGP LA TS +QDCVALT+QRV +L++IL E 
Sbjct  237   TAEEESIMETLVTVVLDSSSRLVSFYKPGGPVLAQTSAVQDCVALTRQRVKELQDILDET  296

Query  1034  ISDMDVD  1054
             IS MD+D
Sbjct  297   ISGMDID  303



>ref|XP_006365748.1| PREDICTED: exosome complex component RRP43 isoform X3 [Solanum 
tuberosum]
Length=302

 Score =   423 bits (1088),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 224/305 (73%), Positives = 258/305 (85%), Gaps = 4/305 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M  ANGS DL S+ME+DAFRRLFPLR+HE++L +S+RPD R LG AR TT+ LG+VASA+
Sbjct  1     MAAANGSSDLYSEMEVDAFRRLFPLRYHEQHLLKSVRPDARKLGSARDTTLALGAVASAE  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+E+MTP+ + PDEGSIA+EFHMPPICS LVRPGRPAE A VIS
Sbjct  61    GSALAKIGSTTMLAAIKMEIMTPTVECPDEGSIAIEFHMPPICSPLVRPGRPAEVASVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SSGMIDLKELCL  GKAAWMAYLDIYCLDADG+LFDAALLS VAAFSHL IP
Sbjct  121   KQLSDTILSSGMIDLKELCLVGGKAAWMAYLDIYCLDADGSLFDAALLSTVAAFSHLNIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V SLN+DGR+VL     +++ +     +     EKRKL LNS PFSL+C+LHKNYILADP
Sbjct  181   VVSLNEDGRIVL----VSEDNIQLKLEKQPVNTEKRKLKLNSPPFSLTCLLHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET + VVLDSSYQLVSLYKPGGP  A TSVIQDCVAL K+RV +L+++L+EA
Sbjct  237   TAEEESIMETAVTVVLDSSYQLVSLYKPGGPVHAHTSVIQDCVALAKRRVKELQSVLNEA  296

Query  1034  ISDMD  1048
             ISDM+
Sbjct  297   ISDME  301



>ref|XP_006381009.1| hypothetical protein POPTR_0006s04970g [Populus trichocarpa]
 gb|ERP58806.1| hypothetical protein POPTR_0006s04970g [Populus trichocarpa]
Length=303

 Score =   421 bits (1081),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 223/307 (73%), Positives = 261/307 (85%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + SGDLSS+ME+DAFRRLFPLR+ ER+L ESIRPD R LG AR TT+ LG+VASA 
Sbjct  1     MGVPDASGDLSSEMEVDAFRRLFPLRYFERHLSESIRPDARPLGRARDTTLALGAVASAH  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTPS +SP+EGSIA++FHMPPICS +VRPGRPAEAAPVIS
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPSTESPEEGSIAIDFHMPPICSPIVRPGRPAEAAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI+SSGMI+LKEL L SGKAAWMAYLDIYCLDADGALFDAALLSAV AFSHL+IP
Sbjct  121   KQLSDTISSSGMINLKELSLVSGKAAWMAYLDIYCLDADGALFDAALLSAVGAFSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             + SLNDDG++VL     ++ +      E    +EKRKL L+S+PFSL+C+LHKNYILADP
Sbjct  181   IVSLNDDGKIVL----VSEEDDGTKLEEEPVNKEKRKLTLSSIPFSLTCILHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET++ VVLDSS +LVS YKPGGP LA TS +QDCVALT+QRV +L++IL E 
Sbjct  237   TAEEESIMETLVTVVLDSSSRLVSFYKPGGPVLAQTSAVQDCVALTRQRVKELQDILDET  296

Query  1034  ISDMDVD  1054
             IS M++D
Sbjct  297   ISGMEID  303



>ref|XP_002532079.1| exosome complex exonuclease rrp43, putative [Ricinus communis]
 gb|EEF30313.1| exosome complex exonuclease rrp43, putative [Ricinus communis]
Length=303

 Score =   420 bits (1080),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 221/307 (72%), Positives = 257/307 (84%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   N SGDLS++ME DAFRRLFPL FHER+L ESIRPDGR+LG AR TT+ LG+V SAD
Sbjct  1     MGLPNVSGDLSTEMEADAFRRLFPLLFHERHLAESIRPDGRSLGRARDTTLALGAVVSAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSA+ KIGSTTM+AAIK+EVMTPS++SPDEG IA++FHMPPICS LVRPGRPAEAAPV+S
Sbjct  61    GSAIAKIGSTTMMAAIKMEVMTPSSESPDEGCIAIDFHMPPICSPLVRPGRPAEAAPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SS MIDLKEL L SGKAAWMAYLDIYCLDADG+LFDAAL SAVAAF++L+IP
Sbjct  121   KQLSDTIMSSAMIDLKELSLVSGKAAWMAYLDIYCLDADGSLFDAALFSAVAAFTNLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             + SLNDDG+VV+     +         +    +EKRKL L S+PFSL+CVLHKNYILADP
Sbjct  181   IVSLNDDGKVVV----VSDENEGGKREKEAVNKEKRKLTLRSLPFSLTCVLHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET++ VVLDSS +LVS YKPGGP LA TS +QDCVALT+QRV +L+NIL EA
Sbjct  237   TAEEESIMETLVTVVLDSSARLVSFYKPGGPVLAYTSAVQDCVALTRQRVKELQNILDEA  296

Query  1034  ISDMDVD  1054
             +S M +D
Sbjct  297   LSGMQID  303



>gb|KDP26052.1| hypothetical protein JCGZ_21085 [Jatropha curcas]
Length=305

 Score =   417 bits (1073),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 222/307 (72%), Positives = 259/307 (84%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   N SGDLSS+ME+DAFRRLFPLR++ER+L ESIRPD R LG AR TT+ LG+VASAD
Sbjct  1     MGLPNVSGDLSSEMEVDAFRRLFPLRYYERHLAESIRPDARPLGSARDTTLALGAVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTPS DSPDEG IA++FHMPPICS LVRPGRPAEAAPV++
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPSTDSPDEGCIAIDFHMPPICSPLVRPGRPAEAAPVVA  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SSGMI+LKEL L SGKAAWMAYLDIYCLDADGALFDAAL S VAAFSHL+IP
Sbjct  121   KQLSDTILSSGMINLKELSLVSGKAAWMAYLDIYCLDADGALFDAALFSVVAAFSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             + SLNDDG++V+     ++ +      +    +EKRKL L+S+PFSL+ +LHKNYILADP
Sbjct  181   IVSLNDDGKIVV----LSEEDEIGRSEKKPVNQEKRKLTLSSLPFSLTFILHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET++ VVLDSS +LVS YKPGGP LA TS +QDCVALT+QRV +L+ IL EA
Sbjct  237   TAEEESIMETLVTVVLDSSARLVSFYKPGGPVLAYTSAVQDCVALTRQRVKELQGILDEA  296

Query  1034  ISDMDVD  1054
             IS M++D
Sbjct  297   ISGMEID  303



>emb|CDP08415.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   411 bits (1057),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 223/315 (71%), Positives = 264/315 (84%), Gaps = 13/315 (4%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M  A+GS DLSS+ME+DAFRRLFPL FHER+L +SIRPDGR LG+AR T + LG+V SA+
Sbjct  1     MAAASGS-DLSSEMEVDAFRRLFPLHFHERHLLKSIRPDGRTLGKARDTIISLGAVTSAN  59

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIG TTMLAAIK+EVMTP+ +SPDEG IA++FHMPPICS +VRPGRPA+AAPV++
Sbjct  60    GSALTKIGCTTMLAAIKLEVMTPTVESPDEGCIAIDFHMPPICSPIVRPGRPADAAPVVA  119

Query  494   KQLSDTI--------ASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVA  649
             KQLSDTI         +SGMIDLKEL L SGKAAWMAYLDIYCLDADG+LFDAALLSAVA
Sbjct  120   KQLSDTILRQLRYLWKNSGMIDLKELSLVSGKAAWMAYLDIYCLDADGSLFDAALLSAVA  179

Query  650   AFSHLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLH  829
             AFSHL+IPV SLND+GR+VL     +++       +    +EKRKL+L ++PFSL+CVLH
Sbjct  180   AFSHLQIPVVSLNDEGRIVL----VSEDNGGGKLEKEPVNKEKRKLNLATIPFSLTCVLH  235

Query  830   KNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQ  1009
             KNYILADPTAEEES+MET++ VVLDSS QLVSLYKPGGP LA TS IQDCVALT+QR+ +
Sbjct  236   KNYILADPTAEEESIMETLVTVVLDSSSQLVSLYKPGGPVLAHTSAIQDCVALTRQRLKE  295

Query  1010  LKNILSEAISDMDVD  1054
             L+ IL+EAISDM+VD
Sbjct  296   LQKILNEAISDMEVD  310



>ref|XP_011078906.1| PREDICTED: LOW QUALITY PROTEIN: exosome complex component RRP43 
[Sesamum indicum]
Length=304

 Score =   411 bits (1056),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 221/308 (72%), Positives = 258/308 (84%), Gaps = 5/308 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVV-LGSVASA  310
             M +  G  DLSS+MELDAFRRLFP+ FHER+L ESIRPDGRALG A+  T   +G+VASA
Sbjct  1     MASMGGPNDLSSEMELDAFRRLFPICFHERHLLESIRPDGRALGXAKSPTFXNIGAVASA  60

Query  311   DGSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVI  490
             +GSAL KIG TTMLAAIK+EVMTP+A++PDEG IA++FHMPPICS LVRPGRPAE APVI
Sbjct  61    NGSALAKIGCTTMLAAIKLEVMTPTAEAPDEGCIAIDFHMPPICSPLVRPGRPAELAPVI  120

Query  491   SKQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEI  670
             SKQLSDTI SSGMI+LK+LCL SGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHL+I
Sbjct  121   SKQLSDTILSSGMINLKDLCLVSGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHLQI  180

Query  671   PVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILAD  850
             PV S NDDGR+VL     + +     + +    +EK KL LN++PFSL+C+LHKNYILAD
Sbjct  181   PVVSFNDDGRIVL----ISDDNSGAMKEKEPVNKEKIKLKLNNLPFSLTCILHKNYILAD  236

Query  851   PTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSE  1030
             PT+EEES+MET L VVLDSS+QLVSL KPGGP LA TS IQ+C+ LT+QRV +++ IL E
Sbjct  237   PTSEEESIMETFLTVVLDSSFQLVSLNKPGGPGLAHTSSIQECITLTRQRVKEVQKILQE  296

Query  1031  AISDMDVD  1054
             AISDM+VD
Sbjct  297   AISDMEVD  304



>ref|XP_011033330.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica]
 ref|XP_011033331.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica]
 ref|XP_011033332.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica]
 ref|XP_011033333.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica]
Length=302

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 223/307 (73%), Positives = 256/307 (83%), Gaps = 5/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + SGDLSS+ME+DAFRRLFPLR+ ER+L ESIRPD R LG AR TT+ LG+VASA 
Sbjct  1     MGVPDASGDLSSEMEVDAFRRLFPLRYFERHLSESIRPDARPLGRARDTTLALGAVASAH  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTPS DSPDEG IA++FHMPPICS +VRPGRPAE APVIS
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPSTDSPDEGCIAIDFHMPPICSPIVRPGRPAEVAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI+SS MI+LKEL L SGKAAWMAYLDIYCLDADGAL DAALLSAVAAFSHL+IP
Sbjct  121   KQLSDTISSSSMINLKELSLVSGKAAWMAYLDIYCLDADGALLDAALLSAVAAFSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             + SLNDDG++VL        E    + E    +EKRKL L+S+PFSL+C+LHKNYILADP
Sbjct  181   IVSLNDDGKIVL-----VSEEDEGAKLEEPVNKEKRKLTLSSIPFSLTCILHKNYILADP  235

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET++ VVLDSS +LVS YKPGG  LA TS +QDCVALT+QRV +L+ IL EA
Sbjct  236   TAEEESIMETLVTVVLDSSARLVSFYKPGGSVLAYTSTVQDCVALTRQRVKELQEILDEA  295

Query  1034  ISDMDVD  1054
             IS M++D
Sbjct  296   ISGMEID  302



>ref|XP_002284088.1| PREDICTED: exosome complex component RRP43 [Vitis vinifera]
 ref|XP_010653776.1| PREDICTED: exosome complex component RRP43 [Vitis vinifera]
Length=303

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 223/307 (73%), Positives = 261/307 (85%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M +AN SGDLSS+ME+DAFRRLFPLR+HER+L +SIRPD R LG AR T++ LG+VASAD
Sbjct  1     MVSANVSGDLSSEMEVDAFRRLFPLRYHERFLLDSIRPDARPLGRARDTSLALGAVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIG TTMLAA+K+EVMTP  +SPDEGSIA+EF+MPPICS LVRPGRPAE APV+S
Sbjct  61    GSALAKIGCTTMLAAVKMEVMTPPKESPDEGSIAIEFYMPPICSPLVRPGRPAEEAPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SSGMI+LKEL L SGKAAWMAYLDIYCLDADG+LFDAALL+AVAAFSHL IP
Sbjct  121   KQLSDTILSSGMINLKELSLVSGKAAWMAYLDIYCLDADGSLFDAALLAAVAAFSHLRIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V SLN++GRVV      ++        +    + KRKL L+S+PFSL+C+LHKNYILADP
Sbjct  181   VVSLNEEGRVV----VVSEENEEGKSEKEPVNKGKRKLTLSSLPFSLTCILHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET++ VVLDSS QLVSLYKPGGP LA  S +QDC+ALT+QRV +LK+IL+EA
Sbjct  237   TAEEESIMETLVTVVLDSSGQLVSLYKPGGPVLAYASAVQDCIALTRQRVKELKSILNEA  296

Query  1034  ISDMDVD  1054
             ISDM+VD
Sbjct  297   ISDMEVD  303



>ref|XP_008460772.1| PREDICTED: exosome complex component RRP43 isoform X1 [Cucumis 
melo]
Length=316

 Score =   406 bits (1043),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 223/301 (74%), Positives = 258/301 (86%), Gaps = 4/301 (1%)
 Frame = +2

Query  152   SGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVK  331
             SGDLSSQME+DAFRRLFP++F+ER+L ESIRPDGRALG+AR TT+ LG V+SA+GSAL K
Sbjct  20    SGDLSSQMEVDAFRRLFPIQFYERHLAESIRPDGRALGKARDTTIALGPVSSANGSALAK  79

Query  332   IGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDT  511
             IGSTTMLAAIK+EVMTPS +SPDEG IA++FHMPP+CS +VRPGRPAEAAPVISKQLSDT
Sbjct  80    IGSTTMLAAIKMEVMTPSVESPDEGCIALDFHMPPVCSPIVRPGRPAEAAPVISKQLSDT  139

Query  512   IASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLND  691
             I+SSGMIDL+EL L  GKAAWMAYLDIYCLDADG+LFDAALLSA AAFSHL+IPV +LND
Sbjct  140   ISSSGMIDLRELSLVKGKAAWMAYLDIYCLDADGSLFDAALLSAAAAFSHLQIPVVALND  199

Query  692   DGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEES  871
             DGRVV      ++ E  E   +    +EKRKL LNSVPFSL+C+LHK YILADPTAEEES
Sbjct  200   DGRVVF----VSEEEGGENFEKEPVNKEKRKLKLNSVPFSLTCLLHKKYILADPTAEEES  255

Query  872   VMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDV  1051
             VMET++ VVLDSS QLVS YKPGG  LA TS +QDC+ALT+QR  +L+ IL EAIS M++
Sbjct  256   VMETIVTVVLDSSGQLVSFYKPGGSVLAYTSAVQDCIALTRQRSKELQIILDEAISGMEI  315

Query  1052  D  1054
             D
Sbjct  316   D  316



>ref|XP_008460773.1| PREDICTED: exosome complex component RRP43 isoform X2 [Cucumis 
melo]
 ref|XP_008460774.1| PREDICTED: exosome complex component RRP43 isoform X2 [Cucumis 
melo]
Length=304

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 223/301 (74%), Positives = 258/301 (86%), Gaps = 4/301 (1%)
 Frame = +2

Query  152   SGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVK  331
             SGDLSSQME+DAFRRLFP++F+ER+L ESIRPDGRALG+AR TT+ LG V+SA+GSAL K
Sbjct  8     SGDLSSQMEVDAFRRLFPIQFYERHLAESIRPDGRALGKARDTTIALGPVSSANGSALAK  67

Query  332   IGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDT  511
             IGSTTMLAAIK+EVMTPS +SPDEG IA++FHMPP+CS +VRPGRPAEAAPVISKQLSDT
Sbjct  68    IGSTTMLAAIKMEVMTPSVESPDEGCIALDFHMPPVCSPIVRPGRPAEAAPVISKQLSDT  127

Query  512   IASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLND  691
             I+SSGMIDL+EL L  GKAAWMAYLDIYCLDADG+LFDAALLSA AAFSHL+IPV +LND
Sbjct  128   ISSSGMIDLRELSLVKGKAAWMAYLDIYCLDADGSLFDAALLSAAAAFSHLQIPVVALND  187

Query  692   DGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEES  871
             DGRVV      ++ E  E   +    +EKRKL LNSVPFSL+C+LHK YILADPTAEEES
Sbjct  188   DGRVVF----VSEEEGGENFEKEPVNKEKRKLKLNSVPFSLTCLLHKKYILADPTAEEES  243

Query  872   VMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDV  1051
             VMET++ VVLDSS QLVS YKPGG  LA TS +QDC+ALT+QR  +L+ IL EAIS M++
Sbjct  244   VMETIVTVVLDSSGQLVSFYKPGGSVLAYTSAVQDCIALTRQRSKELQIILDEAISGMEI  303

Query  1052  D  1054
             D
Sbjct  304   D  304



>ref|XP_003531860.1| PREDICTED: exosome complex component RRP43-like [Glycine max]
Length=302

 Score =   404 bits (1039),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 216/307 (70%), Positives = 257/307 (84%), Gaps = 5/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   N S DLSS+ME+DAFRRLFPLR+ ER+L ESIRPDGR LG+AR T++ LG+VASA+
Sbjct  1     MGLPNVSEDLSSEMEVDAFRRLFPLRYFERHLAESIRPDGRPLGKARETSIFLGAVASAN  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSALVKIGSTT+L AIK+EVMTPS +SPDEG +A++FHMPPICS +VRPGRPAEA+PV+S
Sbjct  61    GSALVKIGSTTILTAIKMEVMTPSLESPDEGCLAIDFHMPPICSPIVRPGRPAEASPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI+SS MIDLKEL L SGKAAWMAYLDIYCLDADGALFDAALLSAVA+ SHL+IP
Sbjct  121   KQLSDTISSSKMIDLKELSLVSGKAAWMAYLDIYCLDADGALFDAALLSAVASLSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V ++NDDG++VL        E  +   +    +EKRKL L S+PFSL+C+LHKNYILADP
Sbjct  181   VVAMNDDGKIVL-----VSEEDGQKREQEPVNKEKRKLTLRSIPFSLTCILHKNYILADP  235

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET + VVLD+S QL+SLYKPGGP LA TS IQDC ALT+QRV +LK+ L +A
Sbjct  236   TAEEESIMETHVTVVLDTSGQLISLYKPGGPVLAYTSAIQDCAALTRQRVKELKSFLDKA  295

Query  1034  ISDMDVD  1054
              S M+V+
Sbjct  296   NSAMEVE  302



>ref|XP_009341214.1| PREDICTED: exosome complex component RRP43-like [Pyrus x bretschneideri]
 ref|XP_009349889.1| PREDICTED: exosome complex component RRP43-like [Pyrus x bretschneideri]
 ref|XP_009349892.1| PREDICTED: exosome complex component RRP43-like [Pyrus x bretschneideri]
Length=299

 Score =   403 bits (1035),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 253/307 (82%), Gaps = 8/307 (3%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   +GSGDL S+M+ DAFRRLFPL+F+E +  +S RPDGR+L EAR T+  LG+VASAD
Sbjct  1     MGLPDGSGDLLSEMDGDAFRRLFPLQFYESHFVKSTRPDGRSLTEARETSSALGAVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSALVKIGSTTMLAAIK+EVMTP  +SPDEG IA++FHMPPICS  VRPGRPA+AAPV+S
Sbjct  61    GSALVKIGSTTMLAAIKMEVMTPPTESPDEGCIAIDFHMPPICSPTVRPGRPADAAPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SSG+I+LKEL L SGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHL+IP
Sbjct  121   KQLSDTILSSGLINLKELSLISGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V S+ND+G+VV+           E   +      KRKL L+S+PFSL+C+LHK YILADP
Sbjct  181   VVSMNDEGKVVV--------MSEEQGGKEAVNNGKRKLTLSSIPFSLTCILHKKYILADP  232

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET++ VVLDSS QLVSLYKPGGP LA TS IQDCVALT+QR  +L+ IL EA
Sbjct  233   TAEEESIMETLVTVVLDSSGQLVSLYKPGGPVLAYTSAIQDCVALTRQRARELQAILDEA  292

Query  1034  ISDMDVD  1054
             IS M+VD
Sbjct  293   ISGMEVD  299



>ref|XP_010043326.1| PREDICTED: exosome complex component RRP43 [Eucalyptus grandis]
 gb|KCW87678.1| hypothetical protein EUGRSUZ_A00059 [Eucalyptus grandis]
Length=303

 Score =   403 bits (1035),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 219/307 (71%), Positives = 252/307 (82%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M T N  GD SS+ME+ AFRRLFPL ++ER+L ESIRPD R L  AR T V LG+VAS+D
Sbjct  1     MGTPNAVGDWSSEMEVSAFRRLFPLHYYERHLSESIRPDARPLKRARDTIVSLGAVASSD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTPS D PDEGSIAVEFHMPPICS +VRPGRPAE APVIS
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPSVDLPDEGSIAVEFHMPPICSPVVRPGRPAEVAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQL D++ SSGMIDLKEL L  GKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHL IP
Sbjct  121   KQLFDSLLSSGMIDLKELSLIKGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHLRIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V SLND+GR+V+     +K    E  ++    +E+RKL L S+PFSL+C+LHKNYILADP
Sbjct  181   VVSLNDEGRMVM----VSKELEGEKLDKEPVDKERRKLSLKSIPFSLTCILHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             T EEES+MET + VVL+SS QLVSLYKPGGP LA TS IQ+CVALT+QR+ +L+ I+ EA
Sbjct  237   TFEEESIMETFITVVLNSSGQLVSLYKPGGPVLAHTSAIQECVALTRQRMKELEEIIDEA  296

Query  1034  ISDMDVD  1054
             IS M++D
Sbjct  297   ISTMEID  303



>gb|KHN14032.1| Exosome complex component RRP43 [Glycine soja]
Length=302

 Score =   403 bits (1035),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 215/307 (70%), Positives = 256/307 (83%), Gaps = 5/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   N S DLSS+ME+DAFRRLFPLR+ ER+L ESIRPDGR LG+AR T++ LG+VASA+
Sbjct  1     MGLPNVSEDLSSEMEVDAFRRLFPLRYFERHLAESIRPDGRPLGKARETSIFLGAVASAN  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSALVKIGSTT+L AIK+EVMTPS +SPDEG +A++FHMPPICS +VRPGRPAEA+PV+S
Sbjct  61    GSALVKIGSTTILTAIKMEVMTPSLESPDEGCLAIDFHMPPICSPIVRPGRPAEASPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDT +SS MIDLKEL L SGKAAWMAYLDIYCLDADGALFDAALLSAVA+ SHL+IP
Sbjct  121   KQLSDTFSSSKMIDLKELSLVSGKAAWMAYLDIYCLDADGALFDAALLSAVASLSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V ++NDDG++VL        E  +   +    +EKRKL L S+PFSL+C+LHKNYILADP
Sbjct  181   VVAMNDDGKIVL-----VSEEDGQKREQEPVNKEKRKLTLRSIPFSLTCILHKNYILADP  235

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET + VVLD+S QL+SLYKPGGP LA TS IQDC ALT+QRV +LK+ L +A
Sbjct  236   TAEEESIMETHVTVVLDTSGQLISLYKPGGPVLAYTSAIQDCAALTRQRVKELKSFLDKA  295

Query  1034  ISDMDVD  1054
              S M+V+
Sbjct  296   NSAMEVE  302



>ref|XP_008222119.1| PREDICTED: exosome complex component RRP43 [Prunus mume]
 ref|XP_008222120.1| PREDICTED: exosome complex component RRP43 [Prunus mume]
Length=299

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 218/303 (72%), Positives = 251/303 (83%), Gaps = 8/303 (3%)
 Frame = +2

Query  146   NGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSAL  325
             + SGD+ S+M++DAFRRLFPLRF E +L +S RPDGR+L EAR T+  LG+VASADGSAL
Sbjct  5     DASGDVLSEMDVDAFRRLFPLRFFETHLVKSTRPDGRSLAEARETSSALGAVASADGSAL  64

Query  326   VKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLS  505
             VKIGST MLAAIK+EVMTPS +SPDEG IA++FHMPPICS  VRPGRPAEAAPV+SKQLS
Sbjct  65    VKIGSTRMLAAIKMEVMTPSKESPDEGCIAIDFHMPPICSPTVRPGRPAEAAPVVSKQLS  124

Query  506   DTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASL  685
             DTI S GMI+LKEL L SGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHL+IPV S+
Sbjct  125   DTILSCGMINLKELSLISGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHLQIPVVSM  184

Query  686   NDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEE  865
             NDDG+VV+           +   +    + KRKL L+S+PFSL+C+LHKNYILADPTAEE
Sbjct  185   NDDGKVVV--------LSGDHGGKEPVNKGKRKLTLSSIPFSLTCLLHKNYILADPTAEE  236

Query  866   ESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             ESVMET++ VVLDSS QLVSLYKPGGP LA TS IQDCVALT+QR  +L+ IL E  S M
Sbjct  237   ESVMETLVTVVLDSSGQLVSLYKPGGPVLAYTSAIQDCVALTRQRARELQTILDEVTSGM  296

Query  1046  DVD  1054
             +VD
Sbjct  297   EVD  299



>ref|XP_002308947.1| 3' exoribonuclease domain 1-containing family protein [Populus 
trichocarpa]
 gb|EEE92470.1| 3' exoribonuclease domain 1-containing family protein [Populus 
trichocarpa]
Length=318

 Score =   403 bits (1036),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 261/322 (81%), Gaps = 19/322 (6%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + SGDLSS+ME+DAFRRLFPLR+ ER+L ESIRPD R LG AR TT+ LG+VASA 
Sbjct  1     MGVPDASGDLSSEMEVDAFRRLFPLRYFERHLSESIRPDARPLGRARDTTLALGAVASAH  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTPS +SP+EGSIA++FHMPPICS +VRPGRPAEAAPVIS
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPSTESPEEGSIAIDFHMPPICSPIVRPGRPAEAAPVIS  120

Query  494   KQLSDTIA---SSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSH-  661
             KQLSDTI+   +SGMI+LKEL L SGKAAWMAYLDIYCLDADGALFDAALLSAV AFSH 
Sbjct  121   KQLSDTISRQVNSGMINLKELSLVSGKAAWMAYLDIYCLDADGALFDAALLSAVGAFSHS  180

Query  662   -----------LEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPF  808
                        ++IP+ SLNDDG++VL     ++ +      E    +EKRKL L+S+PF
Sbjct  181   AFIYYRSLICAVQIPIVSLNDDGKIVL----VSEEDDGTKLEEEPVNKEKRKLTLSSIPF  236

Query  809   SLSCVLHKNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVAL  988
             SL+C+LHKNYILADPTAEEES+MET++ VVLDSS +LVS YKPGGP LA TS +QDCVAL
Sbjct  237   SLTCILHKNYILADPTAEEESIMETLVTVVLDSSSRLVSFYKPGGPVLAQTSAVQDCVAL  296

Query  989   TKQRVNQLKNILSEAISDMDVD  1054
             T+QRV +L++IL E IS M++D
Sbjct  297   TRQRVKELQDILDETISGMEID  318



>ref|XP_003544676.1| PREDICTED: exosome complex component RRP43-like isoform X1 [Glycine 
max]
 ref|XP_006596185.1| PREDICTED: exosome complex component RRP43-like isoform X4 [Glycine 
max]
 gb|KHN28404.1| Exosome complex component RRP43 [Glycine soja]
Length=299

 Score =   401 bits (1030),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 214/306 (70%), Positives = 254/306 (83%), Gaps = 9/306 (3%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M  +N S DLSS+ME+DAFRRLFPLR+ ER+L ESIRPDGR LG+AR T++ LG+VASA+
Sbjct  1     MGLSNASEDLSSEMEVDAFRRLFPLRYFERHLAESIRPDGRPLGKARETSIFLGAVASAN  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSALVKIGSTTML AIK+EVMTPS +SPDEG +A++FHMPPICS +VRPGRPAEA+PV+S
Sbjct  61    GSALVKIGSTTMLTAIKMEVMTPSLESPDEGCLAIDFHMPPICSPIVRPGRPAEASPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI+SS MIDLKEL L  GKAAWMAYLDIYCLDADGALFDAAL+SAVAA SHL+IP
Sbjct  121   KQLSDTISSSRMIDLKELSLVGGKAAWMAYLDIYCLDADGALFDAALISAVAALSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
               ++NDDG++VL         V   + +    +EKRKL L S+PFSL+C+LHKNYILADP
Sbjct  181   AVAMNDDGKIVL---------VSGEDGQKPVNKEKRKLTLRSIPFSLTCILHKNYILADP  231

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET + +VLD+S QL+SLYKPGGPALA TS IQDCV LT QRV +LK+ L + 
Sbjct  232   TAEEESIMETHVTIVLDTSGQLISLYKPGGPALAYTSAIQDCVGLTGQRVKELKSYLDKE  291

Query  1034  ISDMDV  1051
              S M+V
Sbjct  292   NSAMEV  297



>ref|XP_007202373.1| hypothetical protein PRUPE_ppa009278mg [Prunus persica]
 gb|EMJ03572.1| hypothetical protein PRUPE_ppa009278mg [Prunus persica]
Length=299

 Score =   401 bits (1030),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 217/303 (72%), Positives = 251/303 (83%), Gaps = 8/303 (3%)
 Frame = +2

Query  146   NGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSAL  325
             + SGD+ S+M++DAFRRLFPLRF E +L +S RPDGR+L EAR T+  LG+VASADGSAL
Sbjct  5     DASGDVLSEMDVDAFRRLFPLRFFETHLVKSTRPDGRSLAEARETSSALGAVASADGSAL  64

Query  326   VKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLS  505
             VKIGST MLAAIK+EVMTPS +SPDEG IA++FHMPPICS  VRPGRPAEAAPV+SKQLS
Sbjct  65    VKIGSTRMLAAIKMEVMTPSKESPDEGCIAIDFHMPPICSPTVRPGRPAEAAPVVSKQLS  124

Query  506   DTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASL  685
             DTI+S GMI+LKEL L S KAAWMAYLDIYCLDADGALFDAALLSAVAAFSHL+IPV S+
Sbjct  125   DTISSCGMINLKELSLISRKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHLQIPVVSM  184

Query  686   NDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEE  865
             NDDG+VV+           +   +    + KRKL L+S+PFSL+C+LHKNYILADPTAEE
Sbjct  185   NDDGKVVV--------LSGDHGGKEPVNKGKRKLTLSSIPFSLTCLLHKNYILADPTAEE  236

Query  866   ESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             ESVMET++ VVLDSS QLVSLYKPGGP LA TS IQDCVALT+QR  +L+ IL E  S M
Sbjct  237   ESVMETLVTVVLDSSGQLVSLYKPGGPVLAYTSAIQDCVALTRQRARELQTILDEVTSSM  296

Query  1046  DVD  1054
             +VD
Sbjct  297   EVD  299



>ref|XP_008394199.1| PREDICTED: exosome complex component RRP43 [Malus domestica]
Length=299

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 251/307 (82%), Gaps = 8/307 (3%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   +GSGDL S M+ DAFRRLFPL+F+E +  +S RPDGR+L EAR T+  LG+VASAD
Sbjct  1     MGLPDGSGDLLSXMDGDAFRRLFPLQFYESHFVKSTRPDGRSLTEARETSSALGAVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSALVKIGSTTMLAAIK+EVMTP  +SPDEG IA++FHMPPICS  VRPGRPA+AAPV+S
Sbjct  61    GSALVKIGSTTMLAAIKMEVMTPPTESPDEGCIAIDFHMPPICSPTVRPGRPADAAPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI SSGM +LKEL L SGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHL+IP
Sbjct  121   KQLSDTILSSGMXNLKELSLISGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V S+ND+G+VV+           E   +      KRKL L+S+PFSL+C+LHK YILADP
Sbjct  181   VVSMNDEGKVVV--------MXEEQGGKEAVNNGKRKLTLSSIPFSLTCILHKKYILADP  232

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET++ VVLDSS QLVSLYKPGGP LA TS IQDCVALT+QR  +L+ IL EA
Sbjct  233   TAEEESIMETLVTVVLDSSGQLVSLYKPGGPVLAYTSXIQDCVALTRQRARELQAILDEA  292

Query  1034  ISDMDVD  1054
             IS M+VD
Sbjct  293   ISGMEVD  299



>ref|XP_010269779.1| PREDICTED: exosome complex component RRP43 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010269780.1| PREDICTED: exosome complex component RRP43 isoform X1 [Nelumbo 
nucifera]
Length=303

 Score =   400 bits (1029),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 218/307 (71%), Positives = 254/307 (83%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M ++  SGDLS +ME+DAFRRLFPLRF+ER+L ES+RPD R LG AR TTV LG+VA+AD
Sbjct  1     MGSSGASGDLSGEMEVDAFRRLFPLRFYERHLLESVRPDARPLGRARDTTVALGAVATAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSA+ KIG TTMLAAIK+EVMTP  DS DEGS+A++FHMPPICS +VRPGRPAE APV+S
Sbjct  61    GSAMAKIGCTTMLAAIKLEVMTPPLDSSDEGSVAIDFHMPPICSPIVRPGRPAEVAPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSD I SSGMI+LKEL L SGKAAWMAYLDIYCLDADGALFDAALL+AVAAFSHL+IP
Sbjct  121   KQLSDAIISSGMINLKELSLVSGKAAWMAYLDIYCLDADGALFDAALLAAVAAFSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
               ++NDDGRVV+     +         +    +EKRKL L  +PFSL+C+LHKNYILADP
Sbjct  181   AVTVNDDGRVVI----MSGENEEGKLLKDPVNKEKRKLTLTCIPFSLTCILHKNYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEESVMET + VVLDSS +LVSLYKPGGP LA  S +QDCVALT+QRV +L+ ILS+A
Sbjct  237   TAEEESVMETPVTVVLDSSSRLVSLYKPGGPVLAYMSAVQDCVALTRQRVKELQKILSDA  296

Query  1034  ISDMDVD  1054
             ISDM+VD
Sbjct  297   ISDMEVD  303



>ref|XP_004149399.1| PREDICTED: exosome complex component RRP43-like [Cucumis sativus]
 ref|XP_004162184.1| PREDICTED: exosome complex component RRP43-like [Cucumis sativus]
Length=304

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 219/301 (73%), Positives = 256/301 (85%), Gaps = 4/301 (1%)
 Frame = +2

Query  152   SGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVK  331
             SGDLSSQME+DAFRRLFP++F+ER+L ESIRPDGR+LG+AR TT+ LG V+SA+GSAL K
Sbjct  8     SGDLSSQMEVDAFRRLFPIQFYERHLTESIRPDGRSLGKARDTTIALGPVSSANGSALAK  67

Query  332   IGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDT  511
             IGSTTMLAAIK+EVMTPS +SPDEG IA++FHMPP+CS +VRPGRPAEAAPVISKQLSDT
Sbjct  68    IGSTTMLAAIKMEVMTPSVESPDEGCIALDFHMPPVCSPIVRPGRPAEAAPVISKQLSDT  127

Query  512   IASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLND  691
             I+SSGMIDL+EL L  GKAAWMAYLDIYCLDADG+LFDAALLSA AAFSHL+IPV +LND
Sbjct  128   ISSSGMIDLRELSLVKGKAAWMAYLDIYCLDADGSLFDAALLSAAAAFSHLQIPVVALND  187

Query  692   DGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEES  871
             DG+VV       + E  E   +    +E RKL LNS+PFSL+C+LHK YILADPTAEEES
Sbjct  188   DGKVVF----VCEEEGGENFEKEPVNKENRKLKLNSIPFSLTCLLHKKYILADPTAEEES  243

Query  872   VMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDV  1051
             VMET++ VVLDSS QLVS YKPGG  LA TS +QDC+ALT+QR  +L+ IL EAIS M++
Sbjct  244   VMETIVTVVLDSSGQLVSFYKPGGSVLAYTSAVQDCIALTRQRSKELQIILDEAISGMEI  303

Query  1052  D  1054
             D
Sbjct  304   D  304



>ref|XP_006421389.1| hypothetical protein CICLE_v10005512mg [Citrus clementina]
 ref|XP_006421390.1| hypothetical protein CICLE_v10005512mg [Citrus clementina]
 gb|ESR34629.1| hypothetical protein CICLE_v10005512mg [Citrus clementina]
 gb|ESR34630.1| hypothetical protein CICLE_v10005512mg [Citrus clementina]
 gb|KDO41222.1| hypothetical protein CISIN_1g022140mg [Citrus sinensis]
Length=302

 Score =   400 bits (1027),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 214/307 (70%), Positives = 254/307 (83%), Gaps = 5/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   N S DLSS+ME+DAFRRLFPLR+ ER+L ESIRPD R+L  AR TT+ +G+VASAD
Sbjct  1     MGLPNASEDLSSEMEVDAFRRLFPLRYFERHLAESIRPDARSLSRARNTTISMGAVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTPS +SPDEG ++++FHMPPICS LVRPGRPAEAAPV++
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPSLESPDEGCVSIDFHMPPICSPLVRPGRPAEAAPVVA  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI+SSGMI+LKEL L  GKAAWM YLDIYCLDADGALFDAALLSAVAAFS+L+IP
Sbjct  121   KQLSDTISSSGMINLKELSLVGGKAAWMVYLDIYCLDADGALFDAALLSAVAAFSNLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
               SL DDG++V+      + +  E   +    +EKRKL L  +PFSL+C+LHKNYILADP
Sbjct  181   TVSL-DDGKIVM----LPEEQKEENSEKEPVNKEKRKLTLGGIPFSLTCILHKNYILADP  235

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             T+EEES+MET++ VVLDSS QLVSLYKPGG  LA TS +QDC+ALT+QRV +L  IL EA
Sbjct  236   TSEEESIMETLVTVVLDSSNQLVSLYKPGGAVLAYTSAVQDCIALTRQRVKELHQILEEA  295

Query  1034  ISDMDVD  1054
             IS M++D
Sbjct  296   ISGMEID  302



>emb|CBI29839.3| unnamed protein product [Vitis vinifera]
Length=311

 Score =   399 bits (1026),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 261/315 (83%), Gaps = 12/315 (4%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M +AN SGDLSS+ME+DAFRRLFPLR+HER+L +SIRPD R LG AR T++ LG+VASAD
Sbjct  1     MVSANVSGDLSSEMEVDAFRRLFPLRYHERFLLDSIRPDARPLGRARDTSLALGAVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIG TTMLAA+K+EVMTP  +SPDEGSIA+EF+MPPICS LVRPGRPAE APV+S
Sbjct  61    GSALAKIGCTTMLAAVKMEVMTPPKESPDEGSIAIEFYMPPICSPLVRPGRPAEEAPVVS  120

Query  494   KQLSDTI--------ASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVA  649
             KQLSDTI        + SGMI+LKEL L SGKAAWMAYLDIYCLDADG+LFDAALL+AVA
Sbjct  121   KQLSDTILRHVNVVTSFSGMINLKELSLVSGKAAWMAYLDIYCLDADGSLFDAALLAAVA  180

Query  650   AFSHLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLH  829
             AFSHL IPV SLN++GRVV      ++        +    + KRKL L+S+PFSL+C+LH
Sbjct  181   AFSHLRIPVVSLNEEGRVV----VVSEENEEGKSEKEPVNKGKRKLTLSSLPFSLTCILH  236

Query  830   KNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQ  1009
             KNYILADPTAEEES+MET++ VVLDSS QLVSLYKPGGP LA  S +QDC+ALT+QRV +
Sbjct  237   KNYILADPTAEEESIMETLVTVVLDSSGQLVSLYKPGGPVLAYASAVQDCIALTRQRVKE  296

Query  1010  LKNILSEAISDMDVD  1054
             LK+IL+EAISDM+VD
Sbjct  297   LKSILNEAISDMEVD  311



>ref|XP_006373782.1| hypothetical protein POPTR_0016s05590g [Populus trichocarpa]
 gb|ERP51579.1| hypothetical protein POPTR_0016s05590g [Populus trichocarpa]
Length=323

 Score =   399 bits (1025),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 219/327 (67%), Positives = 256/327 (78%), Gaps = 24/327 (7%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + SGDLSS+ME+DAFR LFPLR+ ER+L ESIRPD R LG AR TT+ LG+VASA 
Sbjct  1     MGVPDASGDLSSEMEVDAFRHLFPLRYFERHLSESIRPDARPLGRARDTTLALGAVASAH  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTPS +SPDEG IA++FHMPPICS +VRPGRPAEAAPVIS
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPSTESPDEGCIAIDFHMPPICSPIVRPGRPAEAAPVIS  120

Query  494   KQLSDTIAS--------------------SGMIDLKELCLASGKAAWMAYLDIYCldadg  613
             KQLSDTI+                     SGMI+LKEL L SGKAAWMAYLDIYCLDADG
Sbjct  121   KQLSDTISRQVKFSASIDSPQRLILHAEISGMINLKELSLVSGKAAWMAYLDIYCLDADG  180

Query  614   alfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHL  793
             ALFDAALLSAVAAFSHL+IP+ SLNDDG++VL     ++ +      +    +EKRKL L
Sbjct  181   ALFDAALLSAVAAFSHLQIPIVSLNDDGKIVL----VSEEDEGAKLEKEPVNKEKRKLTL  236

Query  794   NSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQ  973
             +S+PFSL+C+LHKNYILADPTAEEES+MET++ VVLDSS +LVS YKPGG   A TS ++
Sbjct  237   SSIPFSLTCILHKNYILADPTAEEESIMETLVTVVLDSSARLVSFYKPGGSVFAYTSAVK  296

Query  974   DCVALTKQRVNQLKNILSEAISDMDVD  1054
             DCVALT+QRV +L+ IL EAIS M+ D
Sbjct  297   DCVALTRQRVKELQEILDEAISGMETD  323



>ref|XP_006489986.1| PREDICTED: exosome complex component RRP43-like isoform X1 [Citrus 
sinensis]
 ref|XP_006489987.1| PREDICTED: exosome complex component RRP43-like isoform X2 [Citrus 
sinensis]
Length=302

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 214/307 (70%), Positives = 253/307 (82%), Gaps = 5/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   N S DLSS+ME+DAFRRLFPLR+ ER+L ESIRPD R L  AR TT+ +G+VASAD
Sbjct  1     MGLPNASEDLSSEMEVDAFRRLFPLRYFERHLAESIRPDARPLSRARDTTISMGAVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTPS +SPDEG ++++FHMPPICS LVRPGRPAEAAPV++
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPSLESPDEGCVSIDFHMPPICSPLVRPGRPAEAAPVVA  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI+SSGMI+LKEL L  GKAAWM YLDIYCLDADGALFDAALLSAVAAFS+L+IP
Sbjct  121   KQLSDTISSSGMINLKELSLVGGKAAWMVYLDIYCLDADGALFDAALLSAVAAFSNLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
               SL DDG++V+      + +  E   +    +EKRKL L  +PFSL+C+LHKNYILADP
Sbjct  181   TVSL-DDGKIVM----LPEEQKEENSEKEPVNKEKRKLTLGGIPFSLTCILHKNYILADP  235

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             T+EEES+MET++ VVLDSS QLVSLYKPGG  LA TS +QDC+ALT+QRV +L  IL EA
Sbjct  236   TSEEESIMETLVTVVLDSSNQLVSLYKPGGAVLAYTSAVQDCIALTRQRVKELHQILEEA  295

Query  1034  ISDMDVD  1054
             IS M++D
Sbjct  296   ISGMEID  302



>ref|XP_010104428.1| hypothetical protein L484_001482 [Morus notabilis]
 gb|EXC00696.1| hypothetical protein L484_001482 [Morus notabilis]
Length=319

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 214/327 (65%), Positives = 256/327 (78%), Gaps = 28/327 (9%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M  +N SGDLSS+ME+DAFRRLFPLRF+E +L ESIRPDGRALG+AR TT+ LG+VASAD
Sbjct  1     MGHSNASGDLSSEMEVDAFRRLFPLRFYEHHLAESIRPDGRALGKARDTTIELGAVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIG TTMLAAIK+EVMTPS +SPDEG IA++FHMPPICS LVRPGRPAEA PV+S
Sbjct  61    GSALAKIGLTTMLAAIKMEVMTPSKESPDEGCIAIDFHMPPICSPLVRPGRPAEAEPVVS  120

Query  494   KQLSDTIAS--------------------SGMIDLKELCLASGKAAWMAYLDIYCldadg  613
             KQL+DTI                      SGMIDLK+L L SGKAAWM YLDIYCLDADG
Sbjct  121   KQLADTILRHVKHFYGHSLLLDYFFKVLYSGMIDLKDLSLVSGKAAWMVYLDIYCLDADG  180

Query  614   alfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHL  793
             +LFDAALLSA+AAFSHL+IPV S+NDDG++++           E   + +  +EKRKL L
Sbjct  181   SLFDAALLSAIAAFSHLQIPVVSMNDDGKLIV--------VSEENGEKDIVNKEKRKLSL  232

Query  794   NSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQ  973
             N +PFSL+CVLHKNYILADPTAEEE++ ET++ VVLD+  QLV LYKPGG  LA TS +Q
Sbjct  233   NRIPFSLTCVLHKNYILADPTAEEETIFETLVTVVLDTFDQLVYLYKPGGLVLAFTSSVQ  292

Query  974   DCVALTKQRVNQLKNILSEAISDMDVD  1054
             DC+ALT+QR+ +L+ IL E++S M+VD
Sbjct  293   DCIALTRQRLKELQKILDESVSGMEVD  319



>ref|XP_006596183.1| PREDICTED: exosome complex component RRP43-like isoform X2 [Glycine 
max]
 ref|XP_006596184.1| PREDICTED: exosome complex component RRP43-like isoform X3 [Glycine 
max]
Length=307

 Score =   394 bits (1012),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 214/314 (68%), Positives = 254/314 (81%), Gaps = 17/314 (5%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M  +N S DLSS+ME+DAFRRLFPLR+ ER+L ESIRPDGR LG+AR T++ LG+VASA+
Sbjct  1     MGLSNASEDLSSEMEVDAFRRLFPLRYFERHLAESIRPDGRPLGKARETSIFLGAVASAN  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSALVKIGSTTML AIK+EVMTPS +SPDEG +A++FHMPPICS +VRPGRPAEA+PV+S
Sbjct  61    GSALVKIGSTTMLTAIKMEVMTPSLESPDEGCLAIDFHMPPICSPIVRPGRPAEASPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYL--------DIYCldadgalfdaallSAVA  649
             KQLSDTI+SS MIDLKEL L  GKAAWMAYL        DIYCLDADGALFDAAL+SAVA
Sbjct  121   KQLSDTISSSRMIDLKELSLVGGKAAWMAYLNAAFSIMQDIYCLDADGALFDAALISAVA  180

Query  650   AFSHLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLH  829
             A SHL+IP  ++NDDG++VL         V   + +    +EKRKL L S+PFSL+C+LH
Sbjct  181   ALSHLQIPAVAMNDDGKIVL---------VSGEDGQKPVNKEKRKLTLRSIPFSLTCILH  231

Query  830   KNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQ  1009
             KNYILADPTAEEES+MET + +VLD+S QL+SLYKPGGPALA TS IQDCV LT QRV +
Sbjct  232   KNYILADPTAEEESIMETHVTIVLDTSGQLISLYKPGGPALAYTSAIQDCVGLTGQRVKE  291

Query  1010  LKNILSEAISDMDV  1051
             LK+ L +  S M+V
Sbjct  292   LKSYLDKENSAMEV  305



>ref|XP_004304353.1| PREDICTED: exosome complex component RRP43-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=300

 Score =   393 bits (1009),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 213/307 (69%), Positives = 254/307 (83%), Gaps = 7/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + SG L S++++DAFRRLFPLRF+E +L +S RPDGR+L +AR T+  LG+VASAD
Sbjct  1     MGLPDSSGGLLSELDVDAFRRLFPLRFYESHLVKSTRPDGRSLDKARETSSALGAVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSALVKIGSTTMLAAIK+EV TPS + PDEG IA+EFHMPPICS +VRPGRPAEAAPV+S
Sbjct  61    GSALVKIGSTTMLAAIKMEVTTPSQELPDEGRIAIEFHMPPICSPIVRPGRPAEAAPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI+SSGMI++KEL L SGKAAWM YLDIYCLDADGALFDAALLSAVAAFSHL+IP
Sbjct  121   KQLSDTISSSGMINVKELSLISGKAAWMVYLDIYCLDADGALFDAALLSAVAAFSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V S+N++G+VV+               +    +EKRKL L S+PFSL+C+L+KN+ILADP
Sbjct  181   VVSMNNEGKVVV-------MSEENEGGKEPVNKEKRKLTLCSIPFSLTCILYKNFILADP  233

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET++ VVLDSS QLVSLYKPGGP LA TS IQDCVALT+QRV +L+ IL EA
Sbjct  234   TAEEESIMETLVTVVLDSSGQLVSLYKPGGPVLAYTSAIQDCVALTRQRVRELQMILDEA  293

Query  1034  ISDMDVD  1054
              + M+VD
Sbjct  294   SAGMEVD  300



>ref|XP_010322398.1| PREDICTED: exosome complex component RRP43-like isoform X3 [Solanum 
lycopersicum]
Length=280

 Score =   390 bits (1003),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 210/280 (75%), Positives = 236/280 (84%), Gaps = 4/280 (1%)
 Frame = +2

Query  134  MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
            M  ANGS DL S+ME+DAFRRLFPLR+HE++L +S+RPD R LG AR TT+ LG+VASA+
Sbjct  1    MAAANGSSDLYSEMEVDAFRRLFPLRYHEQHLLKSVRPDARKLGSARDTTLALGAVASAE  60

Query  314  GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
            GSAL KIGSTTMLAAIK+E+MTP+ + PDEGSIA+EFHMPPICS LVRPGRPAEAA VIS
Sbjct  61   GSALAKIGSTTMLAAIKMEIMTPTVECPDEGSIAIEFHMPPICSPLVRPGRPAEAASVIS  120

Query  494  KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
            KQLSDTI SSGMIDLKELCL  GKAAWMAYLDIYCLDADG+LFDAALLSAVAAFSHL IP
Sbjct  121  KQLSDTILSSGMIDLKELCLVGGKAAWMAYLDIYCLDADGSLFDAALLSAVAAFSHLNIP  180

Query  674  VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
            V SLN+DGR+VL     +++       +     EKRKL LNS PFSL+C+LHKNYILADP
Sbjct  181  VVSLNEDGRIVL----VSEDNNQLKLEKQPVNTEKRKLKLNSPPFSLTCLLHKNYILADP  236

Query  854  TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQ  973
            TAEEES+MET + VVLDSSYQLVSLYKPGGP  A TSVIQ
Sbjct  237  TAEEESIMETAVTVVLDSSYQLVSLYKPGGPVHAHTSVIQ  276



>ref|XP_010322397.1| PREDICTED: exosome complex component RRP43-like isoform X2 [Solanum 
lycopersicum]
Length=286

 Score =   390 bits (1003),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 210/280 (75%), Positives = 236/280 (84%), Gaps = 4/280 (1%)
 Frame = +2

Query  134  MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
            M  ANGS DL S+ME+DAFRRLFPLR+HE++L +S+RPD R LG AR TT+ LG+VASA+
Sbjct  1    MAAANGSSDLYSEMEVDAFRRLFPLRYHEQHLLKSVRPDARKLGSARDTTLALGAVASAE  60

Query  314  GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
            GSAL KIGSTTMLAAIK+E+MTP+ + PDEGSIA+EFHMPPICS LVRPGRPAEAA VIS
Sbjct  61   GSALAKIGSTTMLAAIKMEIMTPTVECPDEGSIAIEFHMPPICSPLVRPGRPAEAASVIS  120

Query  494  KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
            KQLSDTI SSGMIDLKELCL  GKAAWMAYLDIYCLDADG+LFDAALLSAVAAFSHL IP
Sbjct  121  KQLSDTILSSGMIDLKELCLVGGKAAWMAYLDIYCLDADGSLFDAALLSAVAAFSHLNIP  180

Query  674  VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
            V SLN+DGR+VL     +++       +     EKRKL LNS PFSL+C+LHKNYILADP
Sbjct  181  VVSLNEDGRIVL----VSEDNNQLKLEKQPVNTEKRKLKLNSPPFSLTCLLHKNYILADP  236

Query  854  TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQ  973
            TAEEES+MET + VVLDSSYQLVSLYKPGGP  A TSVIQ
Sbjct  237  TAEEESIMETAVTVVLDSSYQLVSLYKPGGPVHAHTSVIQ  276



>ref|XP_002322717.1| 3' exoribonuclease domain 1-containing family protein [Populus 
trichocarpa]
 gb|EEF04478.1| 3' exoribonuclease domain 1-containing family protein [Populus 
trichocarpa]
Length=439

 Score =   395 bits (1015),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 217/322 (67%), Positives = 253/322 (79%), Gaps = 24/322 (7%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + SGDLSS+ME+DAFR LFPLR+ ER+L ESIRPD R LG AR TT+ LG+VASA 
Sbjct  1     MGVPDASGDLSSEMEVDAFRHLFPLRYFERHLSESIRPDARPLGRARDTTLALGAVASAH  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTPS +SPDEG IA++FHMPPICS +VRPGRPAEAAPVIS
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPSTESPDEGCIAIDFHMPPICSPIVRPGRPAEAAPVIS  120

Query  494   KQLSDTIAS--------------------SGMIDLKELCLASGKAAWMAYLDIYCldadg  613
             KQLSDTI+                     SGMI+LKEL L SGKAAWMAYLDIYCLDADG
Sbjct  121   KQLSDTISRQVKFSASIDSPQRLILHAEISGMINLKELSLVSGKAAWMAYLDIYCLDADG  180

Query  614   alfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHL  793
             ALFDAALLSAVAAFSHL+IP+ SLNDDG++VL     ++ +      +    +EKRKL L
Sbjct  181   ALFDAALLSAVAAFSHLQIPIVSLNDDGKIVL----VSEEDEGAKLEKEPVNKEKRKLTL  236

Query  794   NSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQ  973
             +S+PFSL+C+LHKNYILADPTAEEES+MET++ VVLDSS +LVS YKPGG   A TS ++
Sbjct  237   SSIPFSLTCILHKNYILADPTAEEESIMETLVTVVLDSSARLVSFYKPGGSVFAYTSAVK  296

Query  974   DCVALTKQRVNQLKNILSEAIS  1039
             DCVALT+QRV +L+ IL EAIS
Sbjct  297   DCVALTRQRVKELQEILDEAIS  318



>ref|XP_009408387.1| PREDICTED: exosome complex component RRP43 [Musa acuminata subsp. 
malaccensis]
Length=313

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 202/294 (69%), Positives = 248/294 (84%), Gaps = 5/294 (2%)
 Frame = +2

Query  170   QMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTM  349
             +ME++A+RRLFPL F+ER+L +S+RPD R L  AR T++ LG VASADGSALVKIG TTM
Sbjct  24    EMEVEAYRRLFPLPFYERHLLDSVRPDARPLHRARDTSIALGPVASADGSALVKIGDTTM  83

Query  350   LAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGM  529
             LAAIK+EVMTPSAD+PDEGS+A+EFHMPPICS +VRPGRPAE APV+SKQLSD I SSGM
Sbjct  84    LAAIKLEVMTPSADAPDEGSLAIEFHMPPICSPIVRPGRPAEVAPVVSKQLSDVIMSSGM  143

Query  530   IDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVL  709
             I+LKEL L +GKAAWMAYLDIYCL+ADG+LFDAALLSA+AAFSHL+IP+ SL+DDGRVV 
Sbjct  144   INLKELSLITGKAAWMAYLDIYCLNADGSLFDAALLSAIAAFSHLQIPLVSLSDDGRVV-  202

Query  710   GtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETVL  889
                     ++ E E+ P    ++RKL L+S+PFSL+C+LHK YILADPTAEEES+MET +
Sbjct  203   ----AVSGDLLEDESTPELVNKERKLLLHSIPFSLTCILHKKYILADPTAEEESIMETSI  258

Query  890   NVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDV  1051
              VVLDSS +LVS+YKPGGP LA TS ++DC+ LTK R+ +L+NIL E++S M+V
Sbjct  259   TVVLDSSERLVSIYKPGGPVLAHTSTVKDCIVLTKHRMKELQNILEESLSAMEV  312



>gb|KFK40817.1| hypothetical protein AALP_AA2G045200 [Arabis alpina]
Length=300

 Score =   382 bits (982),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 208/303 (69%), Positives = 249/303 (82%), Gaps = 5/303 (2%)
 Frame = +2

Query  149   GSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALV  328
              S DLSS++E+DAFRR+FPLRF ER+L ES+RPD R LG+AR TTV LG V+SADGSAL 
Sbjct  2     ASQDLSSEVEVDAFRRIFPLRFFERHLSESLRPDARPLGKARDTTVNLGLVSSADGSALA  61

Query  329   KIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSD  508
             KIGSTTMLAAI++EVMTPS +SPD+G +AVEFHMPPICS +VRPGRP EAAPVISK+LSD
Sbjct  62    KIGSTTMLAAIRMEVMTPSTESPDDGCLAVEFHMPPICSPIVRPGRPVEAAPVISKRLSD  121

Query  509   TIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLN  688
             TI SSGMIDLKELCL SGKAAWMAYLDIYCLDADGALFDAALLSAVAAFS+LEIPV +LN
Sbjct  122   TILSSGMIDLKELCLVSGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSNLEIPVVALN  181

Query  689   DDGRVV-LGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEE  865
             D+GR+V +  +K+ +        +    +EKRKL L ++P SL+C+LHKNYILADPTAEE
Sbjct  182   DNGRIVAITGEKEEQENNASITKKEAVNKEKRKLTLKNIPCSLTCILHKNYILADPTAEE  241

Query  866   ESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             ES+M+T++ V+LDSS Q+VS YK GG ALA +S I+ CV L ++RV +L  IL E    M
Sbjct  242   ESIMDTLVTVILDSSDQMVSFYKSGGNALAYSSSIKSCVELARKRVKELNQILGE----M  297

Query  1046  DVD  1054
             D+D
Sbjct  298   DID  300



>ref|XP_006392186.1| hypothetical protein EUTSA_v10023611mg [Eutrema salsugineum]
 gb|ESQ29472.1| hypothetical protein EUTSA_v10023611mg [Eutrema salsugineum]
Length=302

 Score =   381 bits (978),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 210/307 (68%), Positives = 246/307 (80%), Gaps = 5/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + S DLSS+ME+DAFR++FPLRF ER+L ES+RPDGR LG+AR T V LG V+SAD
Sbjct  1     MGLPDSSQDLSSEMEVDAFRKIFPLRFFERHLSESLRPDGRPLGKARDTIVNLGLVSSAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIG TTMLAAI++EVMTPS DSPDEG IAVEFHMPPICS  VRPGRPA+AAPVIS
Sbjct  61    GSALAKIGYTTMLAAIRMEVMTPSTDSPDEGCIAVEFHMPPICSPTVRPGRPADAAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             K+L DTI+S  MIDLKELCL SGKAAWM YLDIYCLDADGALFDAALLSAVAAFS+L+IP
Sbjct  121   KRLLDTISSCNMIDLKELCLVSGKAAWMGYLDIYCLDADGALFDAALLSAVAAFSNLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V +LND+GR+V     + K +      +    +E+RKL L ++PFSL+C+LHKNYILADP
Sbjct  181   VVALNDNGRIV-AITGEEKQDNASITEKEAVNKERRKLTLKNIPFSLTCILHKNYILADP  239

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+M+T++ VVLDSS Q+VS  K GG ALA TS I+ CV L K+R N+LK IL E 
Sbjct  240   TAEEESIMDTLVTVVLDSSDQIVSFNKSGGNALAHTSAIKSCVELAKKRGNELKQILGE-  298

Query  1034  ISDMDVD  1054
                MDVD
Sbjct  299   ---MDVD  302



>ref|XP_004498461.1| PREDICTED: exosome complex component RRP43-like [Cicer arietinum]
Length=302

 Score =   381 bits (978),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 208/307 (68%), Positives = 255/307 (83%), Gaps = 5/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M  +N + DLSS+ME+DAFRRLFPLR+ ER+L ESIRPDGR LG+AR T++ LG+VASA+
Sbjct  1     MGFSNTTEDLSSEMEVDAFRRLFPLRYFERHLAESIRPDGRPLGKARDTSIFLGAVASAN  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSALVKIGSTTML AIK+E+MTPS +SPDEG +A++FHMPPICS +VRPGRPAEA PV+S
Sbjct  61    GSALVKIGSTTMLTAIKMEIMTPSLESPDEGCLAIDFHMPPICSPIVRPGRPAEAEPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI+SSGMIDLKEL L SGKAAWMAYLD+YCLDADGALFDAALLSAVAA SH +  
Sbjct  121   KQLSDTISSSGMIDLKELSLVSGKAAWMAYLDVYCLDADGALFDAALLSAVAALSHCKXX  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
               ++NDDG++VL       +E  + +++    +EK+KL L S P SL+C+LHKNYILADP
Sbjct  181   XVAMNDDGKIVL-----MSDEDGQKQSKEQVNKEKKKLTLRSTPLSLTCILHKNYILADP  235

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+MET + +VLD+S QL+SLYKPGGP LA TS IQDCVALT+QR+ +LK+ L + 
Sbjct  236   TAEEESIMETHVTIVLDTSGQLISLYKPGGPVLAYTSAIQDCVALTRQRIKELKSFLDKE  295

Query  1034  ISDMDVD  1054
              S M+V+
Sbjct  296   NSAMEVE  302



>ref|XP_002886636.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62895.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=302

 Score =   380 bits (976),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 205/307 (67%), Positives = 244/307 (79%), Gaps = 5/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + S DLS++ME+DAFRR+FPLRF ER+L ES+RPDGR LG+AR T V LG V++AD
Sbjct  1     MGLQDSSQDLSTEMEVDAFRRIFPLRFFERHLSESLRPDGRQLGKARDTIVNLGLVSTAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAI++EVMTPS DSPDEG IA+EFHMPPICS  VRPGRPA+AAPVIS
Sbjct  61    GSALAKIGSTTMLAAIRMEVMTPSTDSPDEGCIALEFHMPPICSPTVRPGRPADAAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             K+LSDTI SSGMIDLKELCL SGKAAWM YLDIYCLDADGALFDAALLSAVAAFS+L+IP
Sbjct  121   KRLSDTILSSGMIDLKELCLVSGKAAWMGYLDIYCLDADGALFDAALLSAVAAFSNLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V +LND+GR+V         +      +    +EKRKL L ++PFSL+C+LHK YILADP
Sbjct  181   VVALNDNGRIV-AITGGKDQDNASITEKEAVNKEKRKLTLKNIPFSLTCILHKTYILADP  239

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             T EEES+M+T++ VVLDSS Q+VS YK GG ALA +  I+ CV L ++R  ++K IL E 
Sbjct  240   TTEEESIMDTLVTVVLDSSDQMVSFYKSGGTALAYSPAIKSCVELARKRAKEVKQILGE-  298

Query  1034  ISDMDVD  1054
                MD+D
Sbjct  299   ---MDID  302



>ref|XP_010907648.1| PREDICTED: exosome complex component RRP43 [Elaeis guineensis]
Length=303

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 244/307 (79%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M+++ G+G LS ++E++A+RRLFPL F+ER+L ES+RPD R L  AR TT+ LG VASAD
Sbjct  1     MESSEGTGGLSGEIEVEAYRRLFPLPFYERHLLESVRPDARPLNRARDTTIALGPVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSALVKIG TTMLAAIK+EVMTPS D+PDEGS+A+EF MPPICS  VRPGRPAE A VIS
Sbjct  61    GSALVKIGDTTMLAAIKLEVMTPSTDAPDEGSLAIEFQMPPICSPSVRPGRPAEVASVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSD + SS MI+LKEL L SGKAAWMAYLDIYCL ADG LFDAALLSA+AAFSHL+IP
Sbjct  121   KQLSDVMMSSEMINLKELSLISGKAAWMAYLDIYCLSADGCLFDAALLSAIAAFSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             + S+NDDGRV+                  +  +EKRKL L S PFSL+C+LH+ YILADP
Sbjct  181   LVSVNDDGRVI----AVFGELPEAKLKLELVNKEKRKLSLGSKPFSLTCILHEEYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
              AEEES+M+T + VVLDS  QLVS+YKPGG ALA+ S I+ C+ALTK RV +L NILSE+
Sbjct  237   NAEEESIMDTFVTVVLDSLGQLVSIYKPGGAALANMSTIKACIALTKSRVKELNNILSES  296

Query  1034  ISDMDVD  1054
             +S+M+VD
Sbjct  297   LSEMEVD  303



>ref|XP_007133470.1| hypothetical protein PHAVU_011G181200g [Phaseolus vulgaris]
 gb|ESW05464.1| hypothetical protein PHAVU_011G181200g [Phaseolus vulgaris]
Length=301

 Score =   379 bits (972),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 208/306 (68%), Positives = 253/306 (83%), Gaps = 5/306 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   N   DLSS+ME+DAFRRLFPLR+ ER+L ESIRPDGR LG+AR T++ LG+V++A 
Sbjct  1     MGLPNTFEDLSSEMEVDAFRRLFPLRYFERHLAESIRPDGRPLGKARETSIFLGAVSTAH  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSALVKIGSTTMLAA+K+EVM+PS +SPDEG +AV+F MPPICS +VRPGRPAEA+PV+S
Sbjct  61    GSALVKIGSTTMLAAVKMEVMSPSLESPDEGCLAVDFFMPPICSPIVRPGRPAEASPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSDTI+SS MIDLKEL L SGKAAWM YLDIYCLDADG+L+DAALLSAVAA SHL+IP
Sbjct  121   KQLSDTISSSKMIDLKELSLVSGKAAWMTYLDIYCLDADGSLYDAALLSAVAALSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
               ++NDDG++VL       +E  +   +    +EKRKL L S+PFSL+C+LHKNYILADP
Sbjct  181   AVAMNDDGKIVL-----VSDEDGQKRAQEPVNKEKRKLTLRSIPFSLTCILHKNYILADP  235

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES++ET L +VLD+S QL+SLYKPGG  LA TS IQDCVALT+QRV +LK++L + 
Sbjct  236   TAEEESIVETHLTIVLDTSGQLISLYKPGGQVLAYTSAIQDCVALTRQRVKELKSLLDKE  295

Query  1034  ISDMDV  1051
              S M+V
Sbjct  296   NSAMEV  301



>ref|XP_010473200.1| PREDICTED: exosome complex component RRP43-like [Camelina sativa]
 ref|XP_010473201.1| PREDICTED: exosome complex component RRP43-like [Camelina sativa]
Length=302

 Score =   379 bits (972),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 204/307 (66%), Positives = 244/307 (79%), Gaps = 5/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + S DLS++ME+DAFRR+FPLRF ER+L ES+RPD R LG+AR T V  G V++AD
Sbjct  1     MGLPDSSQDLSTEMEVDAFRRIFPLRFFERHLSESLRPDARPLGKARDTIVNPGLVSTAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAI++EVMTPS DSPDEG IA+EFHMPPICS  VRPGRPA+AAPVIS
Sbjct  61    GSALAKIGSTTMLAAIRMEVMTPSTDSPDEGCIALEFHMPPICSPTVRPGRPADAAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             K+L+DTI SSGMIDLKELCL SGKAAWM YLDIYCL+ADGALFDAALLSAVAAFS+LEIP
Sbjct  121   KRLTDTILSSGMIDLKELCLVSGKAAWMGYLDIYCLNADGALFDAALLSAVAAFSNLEIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V +LND+GR+V         +      +    +EKRKL L ++PFSL+C+LHKNYILADP
Sbjct  181   VVALNDNGRIV-AISGGKDEDNASIIEKKAVNKEKRKLTLKNIPFSLTCILHKNYILADP  239

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             T EEES+M+T++ VVLD+S QLVSLYK GG  LA +S ++ CV L ++R  +LK IL E 
Sbjct  240   TTEEESIMDTLVTVVLDASDQLVSLYKSGGTVLAYSSAVKSCVELARKRAKELKQILGE-  298

Query  1034  ISDMDVD  1054
                MD+D
Sbjct  299   ---MDID  302



>gb|AES58671.2| exosome complex exonuclease RRP46 [Medicago truncatula]
Length=304

 Score =   379 bits (972),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 207/305 (68%), Positives = 251/305 (82%), Gaps = 5/305 (2%)
 Frame = +2

Query  140   TANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGS  319
              A  + DLSS+ME+DAFRRLFPLR+ ER+L ESIR DGR L EAR T++ LG+VASA+GS
Sbjct  5     NAAATEDLSSEMEVDAFRRLFPLRYFERHLAESIRSDGRPLREARDTSIFLGAVASANGS  64

Query  320   ALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQ  499
             ALVKIGSTTML AIK+EVM PS +SPDEG +A++FHMPPICS +VRPGRPAEA PV+SKQ
Sbjct  65    ALVKIGSTTMLTAIKMEVMIPSLESPDEGCLAIDFHMPPICSPIVRPGRPAEAEPVVSKQ  124

Query  500   LSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVA  679
             LSDTI SSGMIDL+EL L  GKAAWMAYLDIYCLDADG+LFDAALLSAVAA SHL+IP  
Sbjct  125   LSDTITSSGMIDLRELSLVGGKAAWMAYLDIYCLDADGSLFDAALLSAVAALSHLQIPAV  184

Query  680   SLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTA  859
             ++NDDG++VL       +E  + + +    +EKRKL L S+P SL+C+LHKNYILADPTA
Sbjct  185   AMNDDGKIVL-----MSDEDGQKQAKEQVNKEKRKLTLKSIPLSLTCILHKNYILADPTA  239

Query  860   EEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
             EEES++ET + ++LD+S QL+SLYKPGGP LA TS IQDCVALT+QRV +LK+ L +  S
Sbjct  240   EEESIVETHVTIILDTSGQLISLYKPGGPVLAYTSAIQDCVALTRQRVKELKSFLDKENS  299

Query  1040  DMDVD  1054
              M+V+
Sbjct  300   AMEVE  304



>ref|NP_176216.1| 3'-5'-exoribonuclease family protein [Arabidopsis thaliana]
 gb|AAD14485.1| Similar to gb|AF025438 Opa-interacting protein (OIP2) from Homo 
sapiens [Arabidopsis thaliana]
 gb|AAO42860.1| At1g60080 [Arabidopsis thaliana]
 dbj|BAE99938.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33657.1| 3'-5'-exoribonuclease family protein [Arabidopsis thaliana]
Length=302

 Score =   378 bits (971),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 206/307 (67%), Positives = 247/307 (80%), Gaps = 5/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + + DLS++ME+DAFRR+FPLRF ER+L ES+RPDGR LG+AR T V LG V++AD
Sbjct  1     MGIPDAAQDLSTEMEVDAFRRIFPLRFFERHLSESLRPDGRQLGKARDTIVNLGLVSTAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAI++EVMTPS DSPDEG IA+EFHMPPICS  VRPGRPAEAAPVIS
Sbjct  61    GSALAKIGSTTMLAAIRMEVMTPSTDSPDEGCIAIEFHMPPICSPTVRPGRPAEAAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             K+LSDTI SSGMIDLKELCL SGKAAWM YLDIYCLDADGALFDAALL+AVAAFS+L+IP
Sbjct  121   KRLSDTILSSGMIDLKELCLVSGKAAWMGYLDIYCLDADGALFDAALLAAVAAFSNLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             + +LND+GR+V     +   +      +    +EKRKL L ++PFSL+C+LHKNYILADP
Sbjct  181   IVALNDNGRIV-AVTGEKDQDNALITEKEAVNKEKRKLTLKNIPFSLTCILHKNYILADP  239

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             T EEES+M+T++ VVLDSS Q+VS YK GG ALA +S I+ CV L ++R  +LK IL E 
Sbjct  240   TTEEESIMDTLVTVVLDSSDQMVSFYKSGGAALAYSSAIKSCVELARKRAKELKQILGE-  298

Query  1034  ISDMDVD  1054
                MD+D
Sbjct  299   ---MDID  302



>ref|XP_010417956.1| PREDICTED: exosome complex component RRP43-like [Camelina sativa]
Length=302

 Score =   378 bits (971),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 244/307 (79%), Gaps = 5/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + S DLS++ME+DAFRR+FPLRF ER+L ES+RPD R LG+AR T V  G V++AD
Sbjct  1     MGLPDSSQDLSTEMEVDAFRRIFPLRFFERHLSESLRPDARPLGKARDTIVNPGLVSTAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAI++EVMTPS DSPDEG IA+EFHMPPICS  VRPGRPA+AAPVIS
Sbjct  61    GSALAKIGSTTMLAAIRMEVMTPSTDSPDEGCIALEFHMPPICSPTVRPGRPADAAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             K+LSDTI SSGM+DLKELCL SGKAAWM YLDIYCL+ADGALFDAALLSAVAAFS+LEIP
Sbjct  121   KRLSDTILSSGMVDLKELCLVSGKAAWMGYLDIYCLNADGALFDAALLSAVAAFSNLEIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V +LND+GR+V         +      +    +EKRKL L ++PFSL+C+LHKNYILADP
Sbjct  181   VVALNDNGRIV-AISGGKDEDNASIIEKKAVNKEKRKLTLKNIPFSLTCILHKNYILADP  239

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             T EEES+M+T++ VVLD+S Q+VSLYK GG  LA +S ++ CV L ++R  +LK IL E 
Sbjct  240   TTEEESIMDTLVTVVLDASDQMVSLYKSGGTVLAYSSAVKSCVELARKRAKELKQILGE-  298

Query  1034  ISDMDVD  1054
                MD+D
Sbjct  299   ---MDID  302



>ref|XP_010510973.1| PREDICTED: exosome complex component RRP43-like isoform X2 [Camelina 
sativa]
Length=302

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 204/307 (66%), Positives = 243/307 (79%), Gaps = 5/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + S DLS++ME+DAFRR+FPLRF ER+L ES+RPD R LG+AR T V  G V++AD
Sbjct  1     MGLPDSSQDLSTEMEVDAFRRIFPLRFFERHLSESLRPDARPLGKARDTIVNPGLVSTAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAI++EVMTPS DSPDEG IA+EFHMPPICS  VRPGRPA+AAPVIS
Sbjct  61    GSALAKIGSTTMLAAIRMEVMTPSTDSPDEGCIALEFHMPPICSPTVRPGRPADAAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             K+LSDTI SSGMIDLKELCL SGKAAWM YLDIYCL+ADGALFDAALLSAVAAFS+LEIP
Sbjct  121   KRLSDTILSSGMIDLKELCLVSGKAAWMGYLDIYCLNADGALFDAALLSAVAAFSNLEIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V +LND+GR+V         +      +    +EKRKL L ++PFSL+C+LHK YILADP
Sbjct  181   VVALNDNGRIV-AISGGKDEDNASIIEKKAVNKEKRKLTLKNIPFSLTCILHKKYILADP  239

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             T EEES+M+T++ VVLDSS Q+VSLYK GG  LA +S ++ CV L ++R  +LK IL E 
Sbjct  240   TTEEESIMDTLVTVVLDSSDQMVSLYKSGGTVLAYSSAVKSCVELARKRAKELKQILGE-  298

Query  1034  ISDMDVD  1054
                MD+D
Sbjct  299   ---MDID  302



>ref|XP_010553639.1| PREDICTED: exosome complex component RRP43 [Tarenaya hassleriana]
Length=342

 Score =   377 bits (968),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 207/302 (69%), Positives = 247/302 (82%), Gaps = 5/302 (2%)
 Frame = +2

Query  152   SGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVK  331
             S DLSS+ME+DAFRRLFPLRF ER+  ES+RPD R LG+AR T V LG VASADGSAL K
Sbjct  45    SQDLSSEMEVDAFRRLFPLRFFERHFVESVRPDARPLGKARDTVVNLGLVASADGSALAK  104

Query  332   IGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDT  511
             IGSTTMLAAI++EVMTP  DSP+EG IAVEFHMPPICS +VRPGRPAEAAPVI+K+LSDT
Sbjct  105   IGSTTMLAAIRMEVMTPYKDSPEEGCIAVEFHMPPICSPIVRPGRPAEAAPVIAKRLSDT  164

Query  512   IASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLND  691
             I SSGM+DLKELCL  GKAAWMAYLDIYCLDADGALFDAALLSAVAAFS+LEIPV +LN+
Sbjct  165   ILSSGMVDLKELCLVKGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSNLEIPVVALNN  224

Query  692   DGRVV-LGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEE  868
             DG++V +  +++ + +      + V  +EKRKL L ++PFSL+C+LHKNYILADPTAEEE
Sbjct  225   DGKIVTVTEEEEEEEDAAAMPEKEVVNKEKRKLKLANIPFSLTCILHKNYILADPTAEEE  284

Query  869   SVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMD  1048
             S+M+T++ VVLD S Q+VS+YK GG  LA +S I+ CV L +QR  +L  IL E    MD
Sbjct  285   SIMDTLVTVVLDMSDQIVSIYKAGGTFLAYSSAIKGCVELARQRAKELNQILGE----MD  340

Query  1049  VD  1054
             +D
Sbjct  341   ID  342



>ref|XP_006302607.1| hypothetical protein CARUB_v10020713mg [Capsella rubella]
 gb|EOA35505.1| hypothetical protein CARUB_v10020713mg [Capsella rubella]
Length=302

 Score =   372 bits (956),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 204/298 (68%), Positives = 242/298 (81%), Gaps = 5/298 (2%)
 Frame = +2

Query  161   LSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGS  340
             LS++ME+DAFRR+FPLRF ER+L ES+RPD R LG+AR T V LG V++ADGSAL KIGS
Sbjct  10    LSTEMEVDAFRRIFPLRFFERHLSESLRPDARPLGKARDTIVNLGLVSTADGSALAKIGS  69

Query  341   TTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIAS  520
             TTMLAAI++EVMTPSADSPDEGSIA+EFHMPPICS  VRPGRPA+AAPVISK+LSDTI S
Sbjct  70    TTMLAAIRMEVMTPSADSPDEGSIALEFHMPPICSPTVRPGRPADAAPVISKRLSDTILS  129

Query  521   SGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGR  700
             SGMIDLKELCL SGKAAWM YLDIYCLDADGALFDAALL+AVAAFS+L+IPV +LND+GR
Sbjct  130   SGMIDLKELCLVSGKAAWMGYLDIYCLDADGALFDAALLAAVAAFSNLQIPVVALNDNGR  189

Query  701   VVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVME  880
             +V         +      +    +EKRKL LN++PFSL+C+LHKNYILADPT EEE++M+
Sbjct  190   IV-AITGGKDQDNASIIEKKAVNKEKRKLTLNNIPFSLTCILHKNYILADPTTEEETIMD  248

Query  881   TVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             T++ VVLDSS  +VS YK GG  LAS+S I+ CV L + R  +LK IL E    MD+D
Sbjct  249   TLVTVVLDSSDHMVSFYKSGGTVLASSSAIKSCVELARTRAKELKQILGE----MDID  302



>ref|XP_009113252.1| PREDICTED: exosome complex component RRP43 [Brassica rapa]
 ref|XP_009113253.1| PREDICTED: exosome complex component RRP43 [Brassica rapa]
Length=301

 Score =   370 bits (950),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 204/307 (66%), Positives = 242/307 (79%), Gaps = 6/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + S DLS++ME+DAFRRLFPLRF ER+L ES+RPDGR LG AR T V LG V+SAD
Sbjct  1     MGLPDSSQDLSTEMEVDAFRRLFPLRFFERHLSESLRPDGRPLGTARDTIVNLGLVSSAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAI++EVM+PS DSPDEG IAVEFHMPPICS  VRPGRPA+ APVIS
Sbjct  61    GSALAKIGSTTMLAAIRMEVMSPSTDSPDEGCIAVEFHMPPICSPTVRPGRPADEAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             K+LSD  +S  MIDLKELCL SGKAAWM YLDIYCLDADGALFDAALLSAVAAFS+L+IP
Sbjct  121   KRLSDIFSSCDMIDLKELCLVSGKAAWMGYLDIYCLDADGALFDAALLSAVAAFSNLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V +LND+GR+V       + E    + +    +EKRKL L ++PF+L+C+LHK YILADP
Sbjct  181   VVALNDNGRIV--AINGEQEENASIKEKEAVNKEKRKLTLKNIPFALTCILHKKYILADP  238

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+M+T++ VVLDSS Q+VS  K GG ALA +S I+ CV L ++R  +LK IL E 
Sbjct  239   TAEEESIMDTLVTVVLDSSDQIVSFNKSGGNALAGSSAIKSCVELARKRGKELKQILGE-  297

Query  1034  ISDMDVD  1054
                MD+D
Sbjct  298   ---MDID  301



>emb|CDY63123.1| BnaA09g53310D [Brassica napus]
Length=301

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 242/307 (79%), Gaps = 6/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + S DLS++ME+DAFRRLFPLRF ER+L ES+RPDGR LG+AR T V LG V+SAD
Sbjct  1     MGLPDSSQDLSTEMEVDAFRRLFPLRFFERHLSESLRPDGRPLGKARDTIVNLGLVSSAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAI++EVM+PS DSPDEG IAVEFHMPPICS  VRPGRPA+ APVIS
Sbjct  61    GSALAKIGSTTMLAAIRMEVMSPSTDSPDEGCIAVEFHMPPICSPTVRPGRPADEAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             K+LSD  +S  MIDLKELCL SGKAAWM YLDIYCLDADGALFDAALLSAVAAFS+L+IP
Sbjct  121   KRLSDIFSSCDMIDLKELCLVSGKAAWMGYLDIYCLDADGALFDAALLSAVAAFSNLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
               +LND+GR+V       + E    + +    +EKRKL L ++PF+L+C+LHK YILADP
Sbjct  181   AVALNDNGRIV--AINGEQEENASIKEKEAVNKEKRKLTLKNIPFALTCILHKKYILADP  238

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+M+T++ VVLDSS Q+VS  K GG ALA +S I+ CV L ++R  +LK IL E 
Sbjct  239   TAEEESIMDTLVTVVLDSSDQIVSFNKSGGNALAGSSAIKSCVELARKRGKELKQILGE-  297

Query  1034  ISDMDVD  1054
                MD+D
Sbjct  298   ---MDID  301



>emb|CDY56983.1| BnaCnng31490D [Brassica napus]
Length=301

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 243/307 (79%), Gaps = 6/307 (2%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M   + S DLS++M++DAFRRLFPLRF ER+L ES+RPDGR LG+AR T V LG V+SAD
Sbjct  1     MGLPDSSQDLSTEMDVDAFRRLFPLRFFERHLSESLRPDGRPLGKARDTIVNLGLVSSAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAI++EVM+PS DSPDEG IAVEFHMPPICS  VRPGRPA+ APVIS
Sbjct  61    GSALAKIGSTTMLAAIRMEVMSPSTDSPDEGCIAVEFHMPPICSPTVRPGRPADEAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             K+LSD  +S  MIDLKELCL SGKAAWM YLDIYCLDADGALFDAALLSAVAAFS+L+IP
Sbjct  121   KRLSDIFSSCDMIDLKELCLVSGKAAWMGYLDIYCLDADGALFDAALLSAVAAFSNLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V +LND+GR+V       + E    + +    +EKRKL L ++PF+L+C+LHK YILADP
Sbjct  181   VVALNDNGRIV--AINGEQEENASIKEKEAVNKEKRKLTLKNIPFALTCILHKKYILADP  238

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             TAEEES+M+T++ VVLDSS Q+VS  K GG ALA +S I+ CV L ++R  +LK IL E 
Sbjct  239   TAEEESIMDTLVTVVLDSSDQIVSFNKSGGNALAGSSAIKSCVELARKRGKELKQILGE-  297

Query  1034  ISDMDVD  1054
                MD+D
Sbjct  298   ---MDID  301



>ref|XP_008807566.1| PREDICTED: exosome complex component RRP43 isoform X3 [Phoenix 
dactylifera]
Length=303

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 243/307 (79%), Gaps = 4/307 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M+++ G+  L+ ++E++A+RRLFPL F+ER+L ES+RPD R L  AR TTV LG VASAD
Sbjct  1     MESSKGTEGLAGEIEVEAYRRLFPLPFYERHLLESVRPDARPLNRARDTTVALGPVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSALVKIG TTMLAAIK+EVM PSAD+PDEGS+A+EFHMPPICS  VR GRPAE APVIS
Sbjct  61    GSALVKIGDTTMLAAIKLEVMIPSADAPDEGSLAIEFHMPPICSPSVRSGRPAEVAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             ++LSD I SS MI+L EL L SGKAAWMAYLDIYCL+ADG LFDAALLSAVAAFSHL+IP
Sbjct  121   QRLSDVITSSEMINLNELSLISGKAAWMAYLDIYCLNADGCLFDAALLSAVAAFSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             + S+NDDGRVV      +           +  +EKRKL L S PFSL+C+LH+ YILADP
Sbjct  181   LVSVNDDGRVV----AVSGELTEGKSKLELVNKEKRKLSLRSKPFSLTCILHEKYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
              +EEES+M+T + VVLDS  QLVS+YKPGG  LA+ S I+ C+A+ K RV +L NIL+E+
Sbjct  237   NSEEESIMDTFVTVVLDSWGQLVSIYKPGGAVLANMSTIKACIAVAKSRVKELNNILNES  296

Query  1034  ISDMDVD  1054
             +S+M+VD
Sbjct  297   LSEMEVD  303



>ref|XP_008807564.1| PREDICTED: exosome complex component RRP43 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807565.1| PREDICTED: exosome complex component RRP43 isoform X2 [Phoenix 
dactylifera]
Length=333

 Score =   367 bits (941),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 242/306 (79%), Gaps = 4/306 (1%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M+++ G+  L+ ++E++A+RRLFPL F+ER+L ES+RPD R L  AR TTV LG VASAD
Sbjct  1     MESSKGTEGLAGEIEVEAYRRLFPLPFYERHLLESVRPDARPLNRARDTTVALGPVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSALVKIG TTMLAAIK+EVM PSAD+PDEGS+A+EFHMPPICS  VR GRPAE APVIS
Sbjct  61    GSALVKIGDTTMLAAIKLEVMIPSADAPDEGSLAIEFHMPPICSPSVRSGRPAEVAPVIS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             ++LSD I SS MI+L EL L SGKAAWMAYLDIYCL+ADG LFDAALLSAVAAFSHL+IP
Sbjct  121   QRLSDVITSSEMINLNELSLISGKAAWMAYLDIYCLNADGCLFDAALLSAVAAFSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             + S+NDDGRVV      +           +  +EKRKL L S PFSL+C+LH+ YILADP
Sbjct  181   LVSVNDDGRVV----AVSGELTEGKSKLELVNKEKRKLSLRSKPFSLTCILHEKYILADP  236

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
              +EEES+M+T + VVLDS  QLVS+YKPGG  LA+ S I+ C+A+ K RV +L NIL+E+
Sbjct  237   NSEEESIMDTFVTVVLDSWGQLVSIYKPGGAVLANMSTIKACIAVAKSRVKELNNILNES  296

Query  1034  ISDMDV  1051
             +S+M+V
Sbjct  297   LSEMEV  302



>ref|XP_010510972.1| PREDICTED: exosome complex component RRP43-like isoform X1 [Camelina 
sativa]
Length=330

 Score =   365 bits (936),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 204/335 (61%), Positives = 244/335 (73%), Gaps = 33/335 (10%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTV---------  286
             M   + S DLS++ME+DAFRR+FPLRF ER+L ES+RPD R LG+AR T V         
Sbjct  1     MGLPDSSQDLSTEMEVDAFRRIFPLRFFERHLSESLRPDARPLGKARDTIVNPGKIIYNL  60

Query  287   -------------------VLGSVASADGSALVKIGSTTMLAAIKVEVMTPSADSPDEGS  409
                                 +G V++ADGSAL KIGSTTMLAAI++EVMTPS DSPDEG 
Sbjct  61    TLIKVKLFETCHLVCIFFVCIGLVSTADGSALAKIGSTTMLAAIRMEVMTPSTDSPDEGC  120

Query  410   IAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASGKAAWMAYLD  589
             IA+EFHMPPICS  VRPGRPA+AAPVISK+LSDTI SSGMIDLKELCL SGKAAWM YLD
Sbjct  121   IALEFHMPPICSPTVRPGRPADAAPVISKRLSDTILSSGMIDLKELCLVSGKAAWMGYLD  180

Query  590   IYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevpepenepvtk  769
             IYCL+ADGALFDAALLSAVAAFS+LEIPV +LND+GR+V         +      +    
Sbjct  181   IYCLNADGALFDAALLSAVAAFSNLEIPVVALNDNGRIV-AISGGKDEDNASIIEKKAVN  239

Query  770   eekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPA  949
             +EKRKL L ++PFSL+C+LHK YILADPT EEES+M+T++ VVLDSS Q+VSLYK GG  
Sbjct  240   KEKRKLTLKNIPFSLTCILHKKYILADPTTEEESIMDTLVTVVLDSSDQMVSLYKSGGTV  299

Query  950   LASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             LA +S ++ CV L ++R  +LK IL E    MD+D
Sbjct  300   LAYSSAVKSCVELARKRAKELKQILGE----MDID  330



>ref|XP_004304352.1| PREDICTED: exosome complex component RRP43-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=328

 Score =   357 bits (917),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/280 (70%), Positives = 232/280 (83%), Gaps = 7/280 (3%)
 Frame = +2

Query  134  MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
            M   + SG L S++++DAFRRLFPLRF+E +L +S RPDGR+L +AR T+  LG+VASAD
Sbjct  1    MGLPDSSGGLLSELDVDAFRRLFPLRFYESHLVKSTRPDGRSLDKARETSSALGAVASAD  60

Query  314  GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
            GSALVKIGSTTMLAAIK+EV TPS + PDEG IA+EFHMPPICS +VRPGRPAEAAPV+S
Sbjct  61   GSALVKIGSTTMLAAIKMEVTTPSQELPDEGRIAIEFHMPPICSPIVRPGRPAEAAPVVS  120

Query  494  KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
            KQLSDTI+SSGMI++KEL L SGKAAWM YLDIYCLDADGALFDAALLSAVAAFSHL+IP
Sbjct  121  KQLSDTISSSGMINVKELSLISGKAAWMVYLDIYCLDADGALFDAALLSAVAAFSHLQIP  180

Query  674  VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
            V S+N++G+VV+               +    +EKRKL L S+PFSL+C+L+KN+ILADP
Sbjct  181  VVSMNNEGKVVV-------MSEENEGGKEPVNKEKRKLTLCSIPFSLTCILYKNFILADP  233

Query  854  TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQ  973
            TAEEES+MET++ VVLDSS QLVSLYKPGGP LA TS IQ
Sbjct  234  TAEEESIMETLVTVVLDSSGQLVSLYKPGGPVLAYTSAIQ  273



>gb|KEH39712.1| exosome complex exonuclease RRP46 [Medicago truncatula]
Length=284

 Score =   347 bits (891),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 192/278 (69%), Positives = 230/278 (83%), Gaps = 5/278 (2%)
 Frame = +2

Query  140  TANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGS  319
             A  + DLSS+ME+DAFRRLFPLR+ ER+L ESIR DGR L EAR T++ LG+VASA+GS
Sbjct  5    NAAATEDLSSEMEVDAFRRLFPLRYFERHLAESIRSDGRPLREARDTSIFLGAVASANGS  64

Query  320  ALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQ  499
            ALVKIGSTTML AIK+EVM PS +SPDEG +A++FHMPPICS +VRPGRPAEA PV+SKQ
Sbjct  65   ALVKIGSTTMLTAIKMEVMIPSLESPDEGCLAIDFHMPPICSPIVRPGRPAEAEPVVSKQ  124

Query  500  LSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVA  679
            LSDTI SSGMIDL+EL L  GKAAWMAYLDIYCLDADG+LFDAALLSAVAA SHL+IP  
Sbjct  125  LSDTITSSGMIDLRELSLVGGKAAWMAYLDIYCLDADGSLFDAALLSAVAALSHLQIPAV  184

Query  680  SLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTA  859
            ++NDDG++VL       +E  + + +    +EKRKL L S+P SL+C+LHKNYILADPTA
Sbjct  185  AMNDDGKIVL-----MSDEDGQKQAKEQVNKEKRKLTLKSIPLSLTCILHKNYILADPTA  239

Query  860  EEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQ  973
            EEES++ET + ++LD+S QL+SLYKPGGP LA TS IQ
Sbjct  240  EEESIVETHVTIILDTSGQLISLYKPGGPVLAYTSAIQ  277



>dbj|BAJ86846.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score =   342 bits (877),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 183/304 (60%), Positives = 232/304 (76%), Gaps = 7/304 (2%)
 Frame = +2

Query  143   ANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSA  322
             A   G L+ +ME++A+RRLFPL F ER+L ES+RPD R L EAR TTV LG+V+SA GSA
Sbjct  7     ATAPGGLAGEMEVEAYRRLFPLAFLERHLRESVRPDARRLAEARPTTVALGAVSSAHGSA  66

Query  323   LVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQL  502
             LV++G T MLA+IK+EVM+P A++PD+GS+AVEFHMPPICS LVRPGRPAEAAPVISK L
Sbjct  67    LVRLGDTAMLASIKLEVMSPPAETPDQGSVAVEFHMPPICSPLVRPGRPAEAAPVISKAL  126

Query  503   SDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVAS  682
              D + SSGM++LKELCL SGKA+W+AYLD+YCL+ADG+LFDAAL+S VAAF+HLEIP+ S
Sbjct  127   EDVLMSSGMLNLKELCLISGKASWVAYLDVYCLNADGSLFDAALISVVAAFTHLEIPLVS  186

Query  683   LNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAE  862
             + DDGRV                   +   EKRKL L  +PF L+C LHK+ IL DPTAE
Sbjct  187   VGDDGRVF------TVGGNEGKTKYELVNREKRKLTLGDIPFPLTCALHKDSILVDPTAE  240

Query  863   EESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISD  1042
             EES++ET + VVLDSS +LVS+ KPGG  + S + I+ C+ L K+R  +LK IL+++I  
Sbjct  241   EESIIETSVTVVLDSSGRLVSIQKPGG-GVTSMAAIKACIGLAKERGQKLKEILTDSIEA  299

Query  1043  MDVD  1054
             M+VD
Sbjct  300   MEVD  303



>ref|XP_006850813.1| hypothetical protein AMTR_s00025p00117140 [Amborella trichopoda]
 gb|ERN12394.1| hypothetical protein AMTR_s00025p00117140 [Amborella trichopoda]
Length=306

 Score =   342 bits (876),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 183/289 (63%), Positives = 232/289 (80%), Gaps = 1/289 (0%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
             A+RRLFPL+F+ER+L +S+RPD R L +AR T++V   + SAD SA+VKIG+TTML+ IK
Sbjct  16    AYRRLFPLQFYERHLSDSVRPDARPLNKARPTSIVPAPLPSADASAMVKIGNTTMLSGIK  75

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
             +E+M PS+DSPDEG IA++FHMPPICS +VRPGRPAEAAPVIS+QL++ I SS +IDLKE
Sbjct  76    LEIMFPSSDSPDEGCIAIDFHMPPICSPMVRPGRPAEAAPVISQQLNNVIMSSKLIDLKE  135

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             L +ASGKAAWM YL+IYCLDADGALFDAALLSAVAA +HLEIP   LN++GRVV  ++ +
Sbjct  136   LSIASGKAAWMVYLEIYCLDADGALFDAALLSAVAAIAHLEIPPVCLNEEGRVV-SSQGQ  194

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLD  904
              +       N   +  EKRKL L S+PFSL+C+LHK Y+L DPT EEES+M ++L VVLD
Sbjct  195   AETNTDNNGNTNNSNTEKRKLTLGSIPFSLTCLLHKQYLLVDPTDEEESIMPSLLTVVLD  254

Query  905   SSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDV  1051
             +S  L+SLYKPGGP LA TS  ++CVAL  +RV +L+ IL EA+S+MDV
Sbjct  255   TSGHLISLYKPGGPVLAYTSTTKNCVALATRRVKELEKILKEALSEMDV  303



>gb|ABG22460.1| 3' exoribonuclease family domain 1-containing protein, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAG93362.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95771.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68068.1| hypothetical protein OsI_35924 [Oryza sativa Indica Group]
 gb|EEE52027.1| hypothetical protein OsJ_33746 [Oryza sativa Japonica Group]
Length=306

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 181/300 (60%), Positives = 232/300 (77%), Gaps = 7/300 (2%)
 Frame = +2

Query  155   GDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKI  334
             G L+ +ME++A+RRLFPL F ER+L ES+RPD R   EAR TTV L +V+SA GSALV++
Sbjct  11    GGLAGEMEVEAYRRLFPLAFLERHLRESVRPDARRPAEARPTTVALAAVSSAHGSALVRL  70

Query  335   GSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTI  514
             G T MLA+IK+EVM+PS ++PDEGSIAVEFHMPPICS LVRPGRPAE APVISK L D +
Sbjct  71    GDTAMLASIKLEVMSPSGEAPDEGSIAVEFHMPPICSPLVRPGRPAEVAPVISKNLEDIL  130

Query  515   ASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDD  694
              SSGM++LKELCL SGKA+W+AYLD+YCL+ADG+LFDAAL+SAVAAF+HLEIP+ S+ DD
Sbjct  131   MSSGMLNLKELCLISGKASWLAYLDVYCLNADGSLFDAALISAVAAFTHLEIPLVSVGDD  190

Query  695   GRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESV  874
             GRV                   +   EKRKL + +VPFSL+C LHK+ +LADPTAEEES+
Sbjct  191   GRVF------TVGGNEGKAKYELVNREKRKLTITNVPFSLTCALHKDNVLADPTAEEESI  244

Query  875   METVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             +ET + +VLDSS Q+VS+ KPGG A+ S + I++C++L K R  +L+ IL + +  M+VD
Sbjct  245   IETSVTIVLDSSDQIVSIQKPGG-AVTSMTTIKECISLAKDRRRKLREILMDNVEAMEVD  303



>ref|XP_003576076.1| PREDICTED: exosome complex component RRP43 [Brachypodium distachyon]
Length=307

 Score =   340 bits (872),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 179/303 (59%), Positives = 232/303 (77%), Gaps = 7/303 (2%)
 Frame = +2

Query  146   NGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSAL  325
               SG L+ +ME++A+RRLFPL F ER+L ES+RPD R L EAR TTV LG+V+SA GSAL
Sbjct  9     TASGGLAGEMEVEAYRRLFPLAFLERHLRESVRPDARRLAEARPTTVALGAVSSAHGSAL  68

Query  326   VKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLS  505
             +++G T MLA+IK+EVM+P  ++PDEGS+AVEFHMPPICS LVRPGRPAE APV+SK L 
Sbjct  69    IRLGDTAMLASIKLEVMSPPTETPDEGSVAVEFHMPPICSPLVRPGRPAEMAPVLSKALE  128

Query  506   DTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASL  685
             D + SSGMI+LKELCL SGKA+W+AYLD+YCL+ADG+LFDAAL+SAVAAF+HLEIP+ S+
Sbjct  129   DVLMSSGMINLKELCLISGKASWLAYLDVYCLNADGSLFDAALISAVAAFTHLEIPLVSV  188

Query  686   NDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEE  865
              DDGRV                   +   EKRKL L  +PF+L+C LHK+ +LADPTAEE
Sbjct  189   GDDGRVF------TVGGNEGKTKYELVNREKRKLTLKDIPFALTCALHKDNVLADPTAEE  242

Query  866   ESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             ES++ET + V LDSS +LVS+ KPGG  + S + I+ C+ L K+R ++L+ IL +++  M
Sbjct  243   ESIIETFVTVALDSSDRLVSIQKPGG-GVTSMATIKTCITLAKERRHKLQEILMDSVEAM  301

Query  1046  DVD  1054
             +VD
Sbjct  302   EVD  304



>gb|EMT20573.1| Exosome complex exonuclease RRP43 [Aegilops tauschii]
Length=290

 Score =   337 bits (865),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 180/294 (61%), Positives = 228/294 (78%), Gaps = 7/294 (2%)
 Frame = +2

Query  173   MELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTML  352
             ME++A+RRLFPL F ER+L ES+RPD R L EAR TTV LG+V+SA GSALV++G T ML
Sbjct  1     MEVEAYRRLFPLAFLERHLRESVRPDARRLAEARPTTVALGAVSSAHGSALVRLGDTAML  60

Query  353   AAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMI  532
             A+IK+EVM+P A++PD+GS+AVEFHMPPICS LVRPGRPAEAAPVISK L D + SSGM+
Sbjct  61    ASIKLEVMSPPAETPDQGSVAVEFHMPPICSPLVRPGRPAEAAPVISKALEDVLMSSGML  120

Query  533   DLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLG  712
             +LKELCL SGKA+W+AYLD+YCL+ADG+LFDAAL+S VAAF+HLEIP+ S+ DDGRV   
Sbjct  121   NLKELCLISGKASWVAYLDVYCLNADGSLFDAALISVVAAFTHLEIPLVSVGDDGRVF--  178

Query  713   tkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETVLN  892
                             +   EKRKL L  +PF L+C LHK+ ILADPTAEEES++ET + 
Sbjct  179   ----TVGGNEGKTKYELVNREKRKLTLGDIPFPLTCALHKDSILADPTAEEESIIETSVT  234

Query  893   VVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             VVLDSS +LVS+ KPGG  + S + I+ C+ L K+R  +LK IL++++  M+VD
Sbjct  235   VVLDSSGRLVSIQKPGG-GVTSMATIKACIGLAKERGQKLKEILTDSVEAMEVD  287



>ref|XP_010041250.1| PREDICTED: LOW QUALITY PROTEIN: exosome complex component RRP43-like 
[Eucalyptus grandis]
Length=314

 Score =   337 bits (865),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 201/320 (63%), Positives = 238/320 (74%), Gaps = 19/320 (6%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M T N +GD SS+ME++AFRRLFP+ ++ER+L ESIRP      + R T V LG+VAS+D
Sbjct  1     MGTPNAAGDWSSEMEVNAFRRLFPVHYYERHLSESIRPMLDPWKKTRDTIVSLGAVASSD  60

Query  314   GSALVKIGST---------TMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGR  466
             GS L KIGST         TMLAAIK+EVMTP   SP EGSIAVEFHMPPICS +VRPGR
Sbjct  61    GSLLAKIGSTMSFSPLQSLTMLAAIKIEVMTP-VYSPGEGSIAVEFHMPPICSPVVRPGR  119

Query  467   PAEAAPVISKQL----SDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaal  634
             PAEAAPV SKQL          SGMIDLKEL L  G+AAWM YLDIY LDADGALFDAAL
Sbjct  120   PAEAAPVTSKQLLTLYXGMXNCSGMIDLKELFLIKGEAAWMVYLDIYSLDADGALFDAAL  179

Query  635   lSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSL  814
             LSAVAAFSH+ IP  SLND+GR+V+     ++    E  ++    +E+RKL L S+PFSL
Sbjct  180   LSAVAAFSHVRIPGVSLNDEGRMVM----VSEELEGEKLDKEPVDKERRKLLLKSIPFSL  235

Query  815   SCVLHKNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTK  994
              C+LHKN+ILADPT EE S++ET + VVL+SS QLVSLYKPGGP LA TS IQ+CVALT 
Sbjct  236   ICILHKNHILADPTFEE-SILETFMTVVLNSSGQLVSLYKPGGPVLAHTSAIQECVALTG  294

Query  995   QRVNQLKNILSEAISDMDVD  1054
             QR+ +LK I+ EAIS M++D
Sbjct  295   QRMKELKEIIDEAISTMEID  314



>ref|XP_010269781.1| PREDICTED: exosome complex component RRP43 isoform X2 [Nelumbo 
nucifera]
Length=264

 Score =   335 bits (858),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 195/307 (64%), Positives = 227/307 (74%), Gaps = 43/307 (14%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M ++  SGDLS +ME+DAFRRLFPLRF+ER+L ES+RPD R LG AR TTV LG+VA+AD
Sbjct  1     MGSSGASGDLSGEMEVDAFRRLFPLRFYERHLLESVRPDARPLGRARDTTVALGAVATAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSA+ KIG TTMLAAIK+EVMTP  DS DEGS+A++FHMPPICS +VRPGRPAE APV+S
Sbjct  61    GSAMAKIGCTTMLAAIKLEVMTPPLDSSDEGSVAIDFHMPPICSPIVRPGRPAEVAPVVS  120

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQLSD I SSGMI+LKEL L SGKAAWMAYLDIYCLDADGALFDAALL+AVAAFSHL+IP
Sbjct  121   KQLSDAIISSGMINLKELSLVSGKAAWMAYLDIYCLDADGALFDAALLAAVAAFSHLQIP  180

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
               ++NDDGRVV+                                           +  + 
Sbjct  181   AVTVNDDGRVVI-------------------------------------------MSGEN  197

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
               EEESVMET + VVLDSS +LVSLYKPGGP LA  S +QDCVALT+QRV +L+ ILS+A
Sbjct  198   EEEEESVMETPVTVVLDSSSRLVSLYKPGGPVLAYMSAVQDCVALTRQRVKELQKILSDA  257

Query  1034  ISDMDVD  1054
             ISDM+VD
Sbjct  258   ISDMEVD  264



>ref|XP_006660434.1| PREDICTED: exosome complex component RRP43-like [Oryza brachyantha]
Length=309

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 182/304 (60%), Positives = 233/304 (77%), Gaps = 9/304 (3%)
 Frame = +2

Query  143   ANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSA  322
             A  +G L+ +ME++A+RRLFPL F ER+L ES+RPD R   EAR  TV LG+V+SA GSA
Sbjct  7     ATETGGLAGEMEVEAYRRLFPLAFLERHLRESVRPDARRTDEARPITVALGAVSSAHGSA  66

Query  323   LVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQL  502
             LV++G T MLA+IK+EVM+PS ++PDEGS+AVEFHMPPICS +VRPGRPAE APVISK L
Sbjct  67    LVRLGDTAMLASIKLEVMSPSYEAPDEGSVAVEFHMPPICSPVVRPGRPAEVAPVISKTL  126

Query  503   SDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVAS  682
              D + SSGM++LKELCL SGKA+W+AYLD+YCL+ADG+LFDAAL+SAVAAF+HLEIP+ S
Sbjct  127   EDILMSSGMLNLKELCLISGKASWLAYLDVYCLNADGSLFDAALISAVAAFTHLEIPLVS  186

Query  683   LNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAE  862
             + DDGRV                   V   EKRK+ + ++PFSL+C LHK+ ILADPTAE
Sbjct  187   VGDDGRVF------TVGGNEGKIKYEVVNREKRKITVTNIPFSLTCALHKDNILADPTAE  240

Query  863   EESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISD  1042
             EES++ET + VVLDSS Q+VS+ K GG A+ S + I+DC++L K R  +L+ ILS  +  
Sbjct  241   EESIIETSMTVVLDSSDQIVSIQKFGG-AVTSMATIKDCISLAKDRRKKLRGILS--VEA  297

Query  1043  MDVD  1054
             M+VD
Sbjct  298   MEVD  301



>ref|XP_004979199.1| PREDICTED: exosome complex component RRP43-like [Setaria italica]
Length=308

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 176/298 (59%), Positives = 233/298 (78%), Gaps = 7/298 (2%)
 Frame = +2

Query  161   LSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGS  340
             L+ +ME++A+RRLFPL F ER+LGES+RPD R L EAR TTV LG+V+SA GSALV++G 
Sbjct  15    LAGEMEVEAYRRLFPLAFLERHLGESVRPDARRLCEARPTTVALGAVSSAHGSALVRLGD  74

Query  341   TTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIAS  520
             T MLA++K+EVM+P A+SPDEGS+AVEFHMPPICS LVRPGRP + APVISK L D + S
Sbjct  75    TAMLASVKLEVMSPPAESPDEGSLAVEFHMPPICSPLVRPGRPVDVAPVISKALEDVLMS  134

Query  521   SGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGR  700
             SG+++LK+LCL SGKA+W+AYLDIYCL+ DG+LFDAAL+SAVAAF+HLEIP+ S+ DDGR
Sbjct  135   SGVLNLKQLCLISGKASWLAYLDIYCLNVDGSLFDAALISAVAAFTHLEIPLVSIGDDGR  194

Query  701   VVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVME  880
             +                   +   EKRKL L ++PFSL+C LHK+ ILADPT+EEESV+E
Sbjct  195   LF------TVGGNEGKTKFELVNREKRKLTLGNIPFSLTCALHKDSILADPTSEEESVIE  248

Query  881   TVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             T + VV+DSS ++VS+ K GG A+ S   I++C++L K+R  +L+ IL++++  M+VD
Sbjct  249   TYVTVVVDSSDRIVSIQKLGG-AVTSMEAIKECISLAKERRRKLREILTDSVEAMEVD  305



>gb|ADE76485.1| unknown [Picea sitchensis]
Length=302

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 177/296 (60%), Positives = 237/296 (80%), Gaps = 2/296 (1%)
 Frame = +2

Query  161   LSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGS  340
             L+ ++E++AFRRL+PL+F+ER+L +++RPD R LG AR T++ LG+V +ADGSA+ KIG 
Sbjct  7     LAGEIEVEAFRRLYPLQFYERHLNDNVRPDARPLGRARATSLALGTVPTADGSAMAKIGH  66

Query  341   TTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIAS  520
             TTMLA +K+EVMTP+A++ DEG IAV+F MPPICS  VRPGRP +AA VIS+QLS+ +AS
Sbjct  67    TTMLAGVKLEVMTPAAEALDEGRIAVDFQMPPICSPDVRPGRPVDAAAVISEQLSNVLAS  126

Query  521   SGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGR  700
             SG+I+LKEL ++ G+AAWMAYLDIYCLDADGALFDAALL+A+ AF+HL  P  S+ ++G+
Sbjct  127   SGVINLKELSISKGQAAWMAYLDIYCLDADGALFDAALLAAIGAFAHLRFPAVSMTEEGK  186

Query  701   VVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVME  880
             V+      +       + +P  +E++++L L  VPFSL+C+L+K +ILADPTAEEESV +
Sbjct  187   VI--PLSGDTVLEDGNKEQPKVQEQRQQLTLGKVPFSLTCMLYKKHILADPTAEEESVFQ  244

Query  881   TVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMD  1048
             T + VVLD S +LVS YKPGG ALASTS IQDCVALTK RV +L+ IL EA+S+M+
Sbjct  245   TTITVVLDPSGRLVSFYKPGGSALASTSTIQDCVALTKYRVKELQKILDEALSEME  300



>gb|KFK38444.1| hypothetical protein AALP_AA3G114300 [Arabis alpina]
Length=290

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 187/299 (63%), Positives = 228/299 (76%), Gaps = 10/299 (3%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M  ++ S DL S++E+DA RR+FPL F E +L ES+RPDGR LG+AR T V LG V+SA+
Sbjct  1     MGVSDSSQDLWSEVEVDALRRIFPLGFFEHHLSESLRPDGRPLGKARDTIVKLGLVSSAN  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLA+I +EVMTP  DSPD+G IA+EFHMPPICS  V        APVIS
Sbjct  61    GSALAKIGSTTMLASITMEVMTPCIDSPDQGCIALEFHMPPICSPTVE-----TVAPVIS  115

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             K+LSDTI S GM DL ELCL SGKAAWM  LDI+CLDADGALFDAALLSAVAAFS+L+IP
Sbjct  116   KRLSDTILSCGMFDLNELCLVSGKAAWMCCLDIHCLDADGALFDAALLSAVAAFSNLQIP  175

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             + +LND+GR+V         E  E EN+    +EKRKL + ++PFSL+C+LHKNYIL DP
Sbjct  176   LVALNDNGRIV-----AITGEKEEHENKEAVNKEKRKLMIKNIPFSLTCILHKNYILPDP  230

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSE  1030
             TAEEES+M+T++ VVLDSS Q+VS YK GG ALA +S I+ CV L ++R  +LK IL +
Sbjct  231   TAEEESIMDTLVTVVLDSSDQMVSFYKSGGNALAYSSAIKSCVELARERAKELKQILGD  289



>ref|NP_001067758.1| Os11g0311300 [Oryza sativa Japonica Group]
 dbj|BAF28121.1| Os11g0311300, partial [Oryza sativa Japonica Group]
Length=300

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/287 (61%), Positives = 221/287 (77%), Gaps = 7/287 (2%)
 Frame = +2

Query  194   RLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVEV  373
             RLFPL F ER+L ES+RPD R   EAR TTV L +V+SA GSALV++G T MLA+IK+EV
Sbjct  18    RLFPLAFLERHLRESVRPDARRPAEARPTTVALAAVSSAHGSALVRLGDTAMLASIKLEV  77

Query  374   MTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCL  553
             M+PS ++PDEGSIAVEFHMPPICS LVRPGRPAE APVISK L D + SSGM++LKELCL
Sbjct  78    MSPSGEAPDEGSIAVEFHMPPICSPLVRPGRPAEVAPVISKNLEDILMSSGMLNLKELCL  137

Query  554   ASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknkn  733
              SGKA+W+AYLD+YCL+ADG+LFDAAL+SAVAAF+HLEIP+ S+ DDGRV          
Sbjct  138   ISGKASWLAYLDVYCLNADGSLFDAALISAVAAFTHLEIPLVSVGDDGRVF------TVG  191

Query  734   evpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLDSSY  913
                      +   EKRKL + +VPFSL+C LHK+ +LADPTAEEES++ET + +VLDSS 
Sbjct  192   GNEGKAKYELVNREKRKLTITNVPFSLTCALHKDNVLADPTAEEESIIETSVTIVLDSSD  251

Query  914   QLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             Q+VS+ KPGG A+ S + I++C++L K R  +L+ IL + +  M+VD
Sbjct  252   QIVSIQKPGG-AVTSMTTIKECISLAKDRRRKLREILMDNVEAMEVD  297



>gb|KHG09789.1| Exosome complex component RRP43 [Gossypium arboreum]
Length=257

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 177/253 (70%), Positives = 210/253 (83%), Gaps = 13/253 (5%)
 Frame = +2

Query  296   SVASADGSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAE  475
             +VASA+GSAL KIGSTTMLAAIK+EVMTPS ++PDEG IA++FHMPPICS +VRPGRPAE
Sbjct  18    AVASANGSALAKIGSTTMLAAIKMEVMTPSLETPDEGCIAIDFHMPPICSPIVRPGRPAE  77

Query  476   AAPVISKQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAF  655
              APV++KQ S      GMI+LKEL L SGKAAWMAYLDIYCLDADGALFD ALLSAVAAF
Sbjct  78    GAPVVAKQFS------GMINLKELSLVSGKAAWMAYLDIYCLDADGALFDTALLSAVAAF  131

Query  656   SHLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKN  835
             SHLEIPV SLNDDG++VL  ++   +  P  + +       RK++L+S+PFSL+CVLHKN
Sbjct  132   SHLEIPVVSLNDDGKIVLSEEQGLSDREPVNKEK-------RKINLSSIPFSLTCVLHKN  184

Query  836   YILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLK  1015
             YILADPTAEEES+M+T++ VVLDSS QLVSL+KPGG  LA TS IQDC+ALT+QRV +L+
Sbjct  185   YILADPTAEEESIMDTIVTVVLDSSSQLVSLHKPGGTVLAYTSAIQDCIALTRQRVKELQ  244

Query  1016  NILSEAISDMDVD  1054
              IL EAIS M+VD
Sbjct  245   KILEEAISGMEVD  257



>ref|XP_002445804.1| hypothetical protein SORBIDRAFT_07g026060 [Sorghum bicolor]
 gb|EES15299.1| hypothetical protein SORBIDRAFT_07g026060 [Sorghum bicolor]
Length=306

 Score =   322 bits (824),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 173/298 (58%), Positives = 229/298 (77%), Gaps = 7/298 (2%)
 Frame = +2

Query  161   LSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGS  340
             ++ +ME++A+RRLFP+ F ER+LGES+R D R L EAR TT+ LG+V+SA GSALV++G 
Sbjct  13    VAGEMEVEAYRRLFPVAFLERHLGESVRIDARRLREARPTTIALGAVSSAHGSALVRLGD  72

Query  341   TTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIAS  520
             T MLA++K+EVM+P A+ PDEGS+AVEFHMPPICS LVRPGR AE APVISK L D + S
Sbjct  73    TAMLASVKLEVMSPPAEHPDEGSVAVEFHMPPICSPLVRPGRSAEVAPVISKALEDVLMS  132

Query  521   SGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGR  700
             SGM++LK+LCL +GKA+W+AYLDIYCL+ADG+LFDAAL+SAVAAF+HLEIP+ S+ DDGR
Sbjct  133   SGMLNLKDLCLITGKASWLAYLDIYCLNADGSLFDAALISAVAAFTHLEIPLVSVGDDGR  192

Query  701   VVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVME  880
             +                   +   EKRKL L  +P SL+C LHK+ ILADPT+EEES++E
Sbjct  193   LF------TVGGNDGKNKFELVNREKRKLTLCDIPLSLTCALHKDSILADPTSEEESIIE  246

Query  881   TVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             T + VV+DSS +LVSL K GG A+ S + I++C++L K+R   L+ IL +++  M+VD
Sbjct  247   TYVTVVVDSSDRLVSLQKVGG-AVTSMATIKECISLAKERRQSLREILIDSVKAMEVD  303



>ref|NP_001131768.1| exosome complex exonuclease RRP43 [Zea mays]
 gb|ACF80326.1| unknown [Zea mays]
 gb|ACG33807.1| exosome complex exonuclease RRP43 [Zea mays]
 tpg|DAA48245.1| TPA: exosome complex exonuclease RRP43 [Zea mays]
Length=306

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 175/304 (58%), Positives = 231/304 (76%), Gaps = 8/304 (3%)
 Frame = +2

Query  143   ANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSA  322
             A  SG ++ +ME++A+RRLFP+ F ER+LGES+R D R L EAR TTV LG+V+SA GSA
Sbjct  8     AAASG-VAGEMEVEAYRRLFPVAFLERHLGESVRIDARRLREARPTTVALGAVSSAHGSA  66

Query  323   LVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQL  502
             L ++G T MLA++K+EVM+P A+ PDEGS+AVEFHMPPICS LVRPGRP + APVISK L
Sbjct  67    LARLGDTAMLASVKLEVMSPPAEHPDEGSVAVEFHMPPICSPLVRPGRPTDVAPVISKAL  126

Query  503   SDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVAS  682
              D + SSGM++LK+LCL +GKA+W+AYLDIYCL+ADG+LFDAAL+SAVAAF+HLEIP+ S
Sbjct  127   EDVLTSSGMLNLKDLCLITGKASWLAYLDIYCLNADGSLFDAALISAVAAFTHLEIPLVS  186

Query  683   LNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAE  862
             + DDGR+                   +   EKRKL L ++P SL+C LHK+ ILADPT+E
Sbjct  187   VGDDGRLF------TVGGNDGKNKFELVNREKRKLTLGAIPLSLTCALHKDEILADPTSE  240

Query  863   EESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISD  1042
             EES++ET + VV+DSS +LVSL K GG A+   + I++C++L K+R   L+ IL ++I  
Sbjct  241   EESIIETYVTVVVDSSDRLVSLQKLGG-AVTCMATIKECISLAKERRRSLREILLDSIKA  299

Query  1043  MDVD  1054
             M+VD
Sbjct  300   MEVD  303



>gb|ACN26814.1| unknown [Zea mays]
 gb|AFW61608.1| exosome complex exonuclease RRP43 [Zea mays]
Length=306

 Score =   317 bits (811),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 170/298 (57%), Positives = 227/298 (76%), Gaps = 7/298 (2%)
 Frame = +2

Query  161   LSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGS  340
             ++ +ME++A+RRLFP+ F ER+LGES+R D R L EAR TTV LG+V+SA GSALV++G 
Sbjct  13    VAGEMEVEAYRRLFPVAFLERHLGESVRIDARRLREARTTTVALGAVSSAHGSALVRVGD  72

Query  341   TTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIAS  520
             T MLA++K+EVM+PSA+ PDEGS++VEFHMPPICS LVRPGR AE APVISK L D + S
Sbjct  73    TAMLASVKLEVMSPSAEYPDEGSVSVEFHMPPICSPLVRPGRSAEVAPVISKALEDVLMS  132

Query  521   SGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGR  700
             S M++LK+LCL +GKA+W+AYLDIYCL+ADG+LFDAAL+SAVAAF+HLEIP+ S+ DDG+
Sbjct  133   SRMLNLKDLCLITGKASWLAYLDIYCLNADGSLFDAALISAVAAFTHLEIPLVSVGDDGK  192

Query  701   VVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVME  880
             +                   +   EKRKL L  +P SL+C LHK  IL DPT+EEES++E
Sbjct  193   LF------TVGGNDGKNKFELVNREKRKLTLGDIPLSLTCALHKGSILTDPTSEEESIIE  246

Query  881   TVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             T + VV+DSS +LVSL K GG  + S + I++C++L K+R  +L+ IL +++  M+VD
Sbjct  247   TYVTVVVDSSDRLVSLQKVGG-TVTSMATIKECISLAKERRLRLREILIDSVKAMEVD  303



>ref|NP_001148711.1| exosome complex exonuclease RRP43 [Zea mays]
 gb|ACG32619.1| exosome complex exonuclease RRP43 [Zea mays]
Length=306

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 169/298 (57%), Positives = 227/298 (76%), Gaps = 7/298 (2%)
 Frame = +2

Query  161   LSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGS  340
             ++ +ME++A+RRLFP+ F ER+LGES+R D R L EAR TTV LG+V+SA GSALV++G 
Sbjct  13    VAGEMEVEAYRRLFPVAFLERHLGESVRIDARRLREARTTTVALGAVSSAHGSALVRVGD  72

Query  341   TTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIAS  520
             T MLA++K+EVM+PSA+ PDEGS++VEFHMPPICS LVRPGR AE APVISK L D + S
Sbjct  73    TAMLASVKLEVMSPSAEYPDEGSVSVEFHMPPICSPLVRPGRSAEVAPVISKALEDVLMS  132

Query  521   SGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGR  700
             S M++LK+LCL +GKA+W+AYLDIYCL+ADG+LFDAAL+SAV+AF+HLEIP+ S+ DDG+
Sbjct  133   SRMLNLKDLCLITGKASWLAYLDIYCLNADGSLFDAALISAVSAFTHLEIPLVSVGDDGK  192

Query  701   VVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVME  880
             +                   +   EKRKL L  +P SL+C LHK  IL DPT+EEES++E
Sbjct  193   LF------TVGGNDGKNKFELVNREKRKLTLGDIPLSLTCALHKGCILTDPTSEEESIIE  246

Query  881   TVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             T + VV+DSS +LVSL K GG  + S + I++C++L K+R  +L+ IL +++  M+VD
Sbjct  247   TYVTVVVDSSDRLVSLQKVGG-TVTSMATIKECISLAKERRLRLREILIDSVKAMEVD  303



>ref|XP_008647516.1| PREDICTED: exosome complex exonuclease RRP43 isoform X1 [Zea 
mays]
Length=324

 Score =   310 bits (794),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 175/322 (54%), Positives = 231/322 (72%), Gaps = 26/322 (8%)
 Frame = +2

Query  143   ANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSA  322
             A  SG ++ +ME++A+RRLFP+ F ER+LGES+R D R L EAR TTV LG+V+SA GSA
Sbjct  8     AAASG-VAGEMEVEAYRRLFPVAFLERHLGESVRIDARRLREARPTTVALGAVSSAHGSA  66

Query  323   LVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQL  502
             L ++G T MLA++K+EVM+P A+ PDEGS+AVEFHMPPICS LVRPGRP + APVISK L
Sbjct  67    LARLGDTAMLASVKLEVMSPPAEHPDEGSVAVEFHMPPICSPLVRPGRPTDVAPVISKAL  126

Query  503   SDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHL------  664
              D + SSGM++LK+LCL +GKA+W+AYLDIYCL+ADG+LFDAAL+SAVAAF+HL      
Sbjct  127   EDVLTSSGMLNLKDLCLITGKASWLAYLDIYCLNADGSLFDAALISAVAAFTHLFRLVVK  186

Query  665   ------------EIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPF  808
                         EIP+ S+ DDGR+                   +   EKRKL L ++P 
Sbjct  187   LSALLCSPLQIMEIPLVSVGDDGRLF------TVGGNDGKNKFELVNREKRKLTLGAIPL  240

Query  809   SLSCVLHKNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVAL  988
             SL+C LHK+ ILADPT+EEES++ET + VV+DSS +LVSL K GG A+   + I++C++L
Sbjct  241   SLTCALHKDEILADPTSEEESIIETYVTVVVDSSDRLVSLQKLGG-AVTCMATIKECISL  299

Query  989   TKQRVNQLKNILSEAISDMDVD  1054
              K+R   L+ IL ++I  M+VD
Sbjct  300   AKERRRSLREILLDSIKAMEVD  321



>gb|KCW87872.1| hypothetical protein EUGRSUZ_A00267 [Eucalyptus grandis]
Length=262

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 165/313 (53%), Positives = 200/313 (64%), Gaps = 57/313 (18%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M T N  GD SS+ME++AFRRLFPLR++ER+L ESIRPD R L +AR T V LG+VAS+D
Sbjct  1     MGTPNAVGDWSSEMEVNAFRRLFPLRYYERHLSESIRPDARPLKKARDTIVSLGTVASSD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTP  DSPD G IAVEFHMP IC  +VRPG PAE APVIS
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTPFVDSPDGGRIAVEFHMPSICYPVVRPGGPAEVAPVIS  120

Query  494   KQLSDT------IASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAF  655
             KQL D+      + +SGMIDLKEL L   KAAWMAYL I                +V+AF
Sbjct  121   KQLFDSLLRHVKLVNSGMIDLKELSLIRRKAAWMAYLVIL------------HARSVSAF  168

Query  656   SHLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKN  835
             SHL IPV S ND+GR+V+                                  +S  L   
Sbjct  169   SHLHIPVVSSNDEGRMVM----------------------------------VSEELEGE  194

Query  836   YILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLK  1015
              +  +P     S+MET + +VL+SS +LVSLYKPGGP LA TS IQ+ VAL +QR+ +L+
Sbjct  195   KLDKEP-----SIMETFMTMVLNSSGRLVSLYKPGGPVLAHTSAIQEGVALMRQRMKELQ  249

Query  1016  NILSEAISDMDVD  1054
              I+ EAIS M++D
Sbjct  250   EIIDEAISTMEID  262



>gb|KCW87684.1| hypothetical protein EUGRSUZ_A00069 [Eucalyptus grandis]
Length=310

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 182/322 (57%), Positives = 225/322 (70%), Gaps = 27/322 (8%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M T N +GD SS+ME++AFRRLFP+ ++ER+L ESIRP      + R T V LG+VAS+D
Sbjct  1     MGTPNAAGDWSSEMEVNAFRRLFPVHYYERHLSESIRPMLDPWKKTRDTIVSLGAVASSD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGR---------  466
             GS L      TMLAAIK+EVMTP   SP EGSIAVEFHMPPICS + R  +         
Sbjct  61    GSLL------TMLAAIKIEVMTP-VYSPGEGSIAVEFHMPPICSPVGRWRKDHSLFQCDL  113

Query  467   ------PAEAAPVISKQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfda  628
                      +  +++  L   +  SGMIDLKEL L  G+AAWM YLDIY LDADGALFDA
Sbjct  114   HFMEMSALHSFNLVADTLRVHLEGSGMIDLKELFLIKGEAAWMVYLDIYSLDADGALFDA  173

Query  629   allSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPF  808
             ALLSAVAAFSH+ IP  SLND+GR+V+     ++    E  ++    +E+RKL L S+PF
Sbjct  174   ALLSAVAAFSHVRIPGVSLNDEGRMVM----VSEELEGEKLDKEPVDKERRKLLLKSIPF  229

Query  809   SLSCVLHKNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVAL  988
             SL C+LHKN+ILADPT EE S++ET + VVL+SS QLVSLYKPGGP LA TS IQ+CVAL
Sbjct  230   SLICILHKNHILADPTFEE-SILETFMTVVLNSSGQLVSLYKPGGPVLAHTSAIQECVAL  288

Query  989   TKQRVNQLKNILSEAISDMDVD  1054
             T QR+ +LK I+ EAIS M++D
Sbjct  289   TGQRMKELKEIIDEAISTMEID  310



>ref|XP_001755996.1| predicted protein [Physcomitrella patens]
 gb|EDQ79281.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/297 (51%), Positives = 225/297 (76%), Gaps = 4/297 (1%)
 Frame = +2

Query  164   SSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGST  343
             S+ ME++A++RL+PL+F+ER+L   +RPDGR L  AR T+V LGS+A+ADGSALVKIG+T
Sbjct  14    SATMEVEAYKRLYPLQFYERHLDSDVRPDGRPLTRARPTSVNLGSIATADGSALVKIGNT  73

Query  344   TMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASS  523
             TMLA +K+EV+TPS  SP++G +AV+F MP ICS LVRPGRPAEAA V+S+QLS+ + SS
Sbjct  74    TMLAGVKLEVITPSTASPNQGQVAVDFQMPSICSPLVRPGRPAEAAWVVSEQLSNALVSS  133

Query  524   GMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRV  703
               ++L++LC+  GKAAW+AY+D+YCLDADG+L DAALL+AVAA +HL++P   + + GRV
Sbjct  134   NFVNLQQLCIVPGKAAWIAYVDVYCLDADGSLLDAALLAAVAALTHLQLPAVKVTETGRV  193

Query  704   V----LGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEES  871
             V           + +    +NE    + +++L  +S+P +L+CV H+ ++LADP+AEEES
Sbjct  194   VPLKNHNGDAGQEVDSIAKKNEDQIVKSRQRLERSSMPIALTCVSHRKHLLADPSAEEES  253

Query  872   VMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISD  1042
             +++  L V++D+S +L+S YKPGG   A+++ ++DC+ LTK+RV ++ +I  EA  +
Sbjct  254   ILQMSLTVIMDTSGRLISFYKPGGAVAATSATVKDCIELTKKRVAEVNSIFEEAYEE  310



>gb|KCW87680.1| hypothetical protein EUGRSUZ_A00063 [Eucalyptus grandis]
Length=234

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 157/280 (56%), Positives = 186/280 (66%), Gaps = 46/280 (16%)
 Frame = +2

Query  134  MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
            M+T N  GD SS+ME++AFRRLFPLR++ER+L ESIRPD R L +AR T+V LG+VAS+D
Sbjct  1    METPNAVGDWSSEMEVNAFRRLFPLRYYERHLYESIRPDARPLKKARDTSVSLGAVASSD  60

Query  314  GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
            GSAL KIGSTTMLAAIK+EVMTP  +SP++GSIAVEFHMPPIC  L+RPGRPAE APVIS
Sbjct  61   GSALAKIGSTTMLAAIKMEVMTPPVNSPEDGSIAVEFHMPPICLPLMRPGRPAEVAPVIS  120

Query  494  KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
            K     + +SGMIDLKEL L  GKAAWM YL I               ++VAAFSHL I 
Sbjct  121  K-----LVNSGMIDLKELSLIKGKAAWMVYLLIL-------------HASVAAFSHLHIA  162

Query  674  VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
            V SLND+GR+ + ++                        L          LH    LADP
Sbjct  163  VVSLNDEGRMRMVSE-----------------------ELEGEKLDKEPELH----LADP  195

Query  854  TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQ  973
              +EES+MET +  VL+SS QLVSLYKPGGP LA TS IQ
Sbjct  196  PFKEESIMETFMT-VLNSSGQLVSLYKPGGPVLAHTSAIQ  234



>ref|XP_010064525.1| PREDICTED: exosome complex component RRP43-like [Eucalyptus grandis]
Length=205

 Score =   262 bits (669),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 173/209 (83%), Gaps = 4/209 (2%)
 Frame = +2

Query  428   MPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYClda  607
             MPPICS +VRPGRPAE APVISKQL D++ SSGMIDLKEL L  GKAAWMAYLDIYCLDA
Sbjct  1     MPPICSPVVRPGRPAEVAPVISKQLFDSLLSSGMIDLKELSLIKGKAAWMAYLDIYCLDA  60

Query  608   dgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKL  787
             DGALFDAALLSAVAAFSHL IPV SLND+GR+V+     +K    E  ++    +E+RKL
Sbjct  61    DGALFDAALLSAVAAFSHLRIPVVSLNDEGRMVM----VSKELEGEKLDKEPVDKERRKL  116

Query  788   HLNSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSV  967
              L S+PFSL+C+LHKNYILADPT EEES+MET + VVL+SS QLVSLYKPGGP LA TSV
Sbjct  117   SLKSIPFSLTCILHKNYILADPTFEEESIMETFITVVLNSSGQLVSLYKPGGPVLAHTSV  176

Query  968   IQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             IQ+CVALT+QR+ +L+ I+ EAIS M++D
Sbjct  177   IQECVALTRQRMKELEEIIDEAISTMEID  205



>ref|XP_002979580.1| hypothetical protein SELMODRAFT_233365 [Selaginella moellendorffii]
 gb|EFJ19469.1| hypothetical protein SELMODRAFT_233365 [Selaginella moellendorffii]
Length=291

 Score =   265 bits (676),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 143/292 (49%), Positives = 214/292 (73%), Gaps = 6/292 (2%)
 Frame = +2

Query  161   LSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGS  340
             ++  +E+DAF+RL+P +F ERYL  S+RPDGR L  +R T+V   +V+SADGSALVKIG+
Sbjct  1     MADDVEVDAFKRLYPAQFLERYLDASVRPDGRPLTRSRPTSVSFNAVSSADGSALVKIGN  60

Query  341   TTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIAS  520
             TTMLA  K+E M P+AD+PD+G ++V+F MPPICS  VRPGRPAE A VI++QL + + S
Sbjct  61    TTMLAGAKLETMEPAADTPDQGCLSVDFVMPPICSPRVRPGRPAEEAYVITEQLQNALLS  120

Query  521   SGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGR  700
             SG++DL+EL + SGKAAWM YLD+YCLDADG+L DAALL++VAA +HL++P   +  +G+
Sbjct  121   SGVVDLRELSIVSGKAAWMIYLDVYCLDADGSLLDAALLASVAALAHLQVPAICVRSEGK  180

Query  701   VVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVME  880
             +             +  ++ +   + R+L+L   PF+L+  +++  ++ADPTAEEE++++
Sbjct  181   IT------KAPPDAQASSDGIEFTQPRRLNLGEFPFALTVAMNQKSLIADPTAEEEAILD  234

Query  881   TVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAI  1036
             T + V+L+SS ++++L+K GG   AST+ IQDC+AL  +R   L+ +L EA+
Sbjct  235   TKMIVILNSSQKIIALHKAGGSTTASTATIQDCLALAMRRRKTLQKVLEEAL  286



>ref|XP_002977693.1| hypothetical protein SELMODRAFT_176463 [Selaginella moellendorffii]
 gb|EFJ21031.1| hypothetical protein SELMODRAFT_176463 [Selaginella moellendorffii]
Length=291

 Score =   264 bits (675),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 143/292 (49%), Positives = 214/292 (73%), Gaps = 6/292 (2%)
 Frame = +2

Query  161   LSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGS  340
             ++  +E+DAF+RL+P +F ERYL  S+RPDGR L  +R T+V   +V+SADGSALVKIG+
Sbjct  1     MADDVEVDAFKRLYPAQFLERYLDASVRPDGRPLTRSRPTSVSFNAVSSADGSALVKIGN  60

Query  341   TTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIAS  520
             TTMLA  K+E M P+AD+PD+G ++V+F MPPICS  VRPGRPAE A VI++QL + + S
Sbjct  61    TTMLAGAKLETMEPAADTPDQGCLSVDFVMPPICSPRVRPGRPAEEAYVITEQLQNALLS  120

Query  521   SGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGR  700
             SG++DL+EL + SGKAAWM YLD+YCLDADG+L DAALL++VAA +HL++P   +  +G+
Sbjct  121   SGVVDLRELSIVSGKAAWMIYLDVYCLDADGSLLDAALLASVAALAHLQVPAICVRSEGK  180

Query  701   VVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVME  880
             +             +  ++ +   + R+L+L   PF+L+  +++  ++ADPTAEEE++++
Sbjct  181   IT------KAPPDAQASSDGIEFTQPRRLNLGEFPFALTVAMNQKSLIADPTAEEEAILD  234

Query  881   TVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAI  1036
             T + V+L+SS ++++L+K GG   AST+ IQDC+AL  +R   L+ +L EA+
Sbjct  235   TKMIVILNSSQKIIALHKAGGSTTASTATIQDCLALAMRRRKTLQKVLEEAL  286



>emb|CAN82224.1| hypothetical protein VITISV_011872 [Vitis vinifera]
Length=1621

 Score =   285 bits (728),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 177/310 (57%), Positives = 216/310 (70%), Gaps = 13/310 (4%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M +AN SGDLSS+ME+DAFRRLFPLR+HER+L +SIRPD R LG AR T++ LG+VASAD
Sbjct  1     MVSANVSGDLSSEMEVDAFRRLFPLRYHERFLLDSIRPDARPLGRARDTSLALGAVASAD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPG-----RPAEA  478
             GSAL KIG T      + +                 +    I      PG       A+ 
Sbjct  61    GSALAKIGCTQN----ECQYGGERGLGLCGXGXLQYYLCVGIFGHFWGPGPHGTITNADF  116

Query  479   APVISKQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFS  658
                +    +  +  SGMI+LKEL L SGKAAWMAYLDIYCLDADG+LFDAALL+AVAAFS
Sbjct  117   TKAVVPYWASVLQGSGMINLKELSLVSGKAAWMAYLDIYCLDADGSLFDAALLAAVAAFS  176

Query  659   HLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNY  838
             HL IPV SLN++GRVV      ++        +    + KRKL L+S+PFSL+C+LHKNY
Sbjct  177   HLRIPVVSLNEEGRVV----VVSEENEEGKSEKEPVNKGKRKLTLSSLPFSLTCILHKNY  232

Query  839   ILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKN  1018
             ILADPTAEEES+MET++ VVLDSS QLVSLYKPGGP LA  S +QDC+ALT+QRV +LK+
Sbjct  233   ILADPTAEEESIMETLVTVVLDSSGQLVSLYKPGGPVLAYASAVQDCIALTRQRVKELKS  292

Query  1019  ILSEAISDMD  1048
             IL+EAISDM+
Sbjct  293   ILNEAISDME  302



>gb|KCW87870.1| hypothetical protein EUGRSUZ_A00265 [Eucalyptus grandis]
Length=266

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 160/314 (51%), Positives = 195/314 (62%), Gaps = 55/314 (18%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M T N  GD SS+ME+ AFRRLFPLR++ER+L ESIRPD R+L  AR T V LG+VAS+D
Sbjct  1     MGTPNAVGDWSSEMEVSAFRRLFPLRYYERHLSESIRPDARSLKRARDTIVSLGAVASSD  60

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
             GSAL KIGSTTMLAAIK+EVMTP  DSPD G IAVEFHMP IC  +VRPG PAE APVIS
Sbjct  61    GSALAKIGSTTMLAAIKMEVMTP-VDSPDGGRIAVEFHMPSICYPVVRPGGPAEVAPVIS  119

Query  494   KQLSDT------IASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAF  655
             KQL D+      + +SGMIDLKEL L  GKAAWMAYL I                +VAAF
Sbjct  120   KQLFDSLLRHVKLVNSGMIDLKELSLIKGKAAWMAYLVIL------------HARSVAAF  167

Query  656   SHLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKN  835
             SHL IPV SLND+GR+V+     ++    E  ++    +E+RKL L S+PFSL+C+LH+N
Sbjct  168   SHLHIPVVSLNDEGRMVM----VSEELEGEKLDKEPVDKERRKLLLKSIPFSLTCILHRN  223

Query  836   YILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDC-VALTKQRVNQL  1012
             YIL                      Y   S++            + DC      QR  +L
Sbjct  224   YILP---------------------YFRRSVHNGN---------VHDCGFEFIWQRRKKL  253

Query  1013  KNILSEAISDMDVD  1054
             + I +EAIS M++D
Sbjct  254   QEI-NEAISTMEID  266



>gb|EMS53021.1| Exosome complex component RRP43 [Triticum urartu]
Length=223

 Score =   249 bits (636),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 173/227 (76%), Gaps = 7/227 (3%)
 Frame = +2

Query  374   MTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCL  553
             M+PSA++PD+GS+AVEFHMPPICS LVRPGRPAEAAPVISK L D + SSGM++LKELCL
Sbjct  1     MSPSAETPDQGSVAVEFHMPPICSPLVRPGRPAEAAPVISKALEDVLMSSGMLNLKELCL  60

Query  554   ASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknkn  733
              SGKA+W+AYLD+YCL+ADG+LFDAAL+S VAAF+HLEIP+ S+ DDGRV          
Sbjct  61    ISGKASWVAYLDVYCLNADGSLFDAALISVVAAFTHLEIPLVSVGDDGRVF------TVG  114

Query  734   evpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLDSSY  913
                      +   EKRKL L  +PF L+C LHK+ ILADPTAEEES++ET + VVLDSS 
Sbjct  115   GNEGKTKYELVNREKRKLTLGDIPFPLTCALHKDSILADPTAEEESIIETSVTVVLDSSG  174

Query  914   QLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             +LVS+ KPGG  + S + I+ C+ L K+R  +LK IL++++  M+VD
Sbjct  175   RLVSIQKPGG-GVTSMATIKACIGLAKERGQKLKEILTDSVEAMEVD  220



>gb|KHG03654.1| Exosome complex component RRP43 [Gossypium arboreum]
Length=181

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 152/178 (85%), Gaps = 6/178 (3%)
 Frame = +2

Query  134  MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
            M   N SGDLS+++E+DAFRRLFPLRF+E++L ESIRPD R LG AR TT+ LG+VASA+
Sbjct  1    MGLPNASGDLSTEVEVDAFRRLFPLRFYEKHLLESIRPDARPLGRARETTIALGAVASAN  60

Query  314  GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
            GSAL KIGSTTMLAAIK+EVMTPS ++PDEG IA++FHMPPICS +VRPGRPAE APV++
Sbjct  61   GSALAKIGSTTMLAAIKMEVMTPSLETPDEGCIAIDFHMPPICSPIVRPGRPAEGAPVVA  120

Query  494  KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLE  667
            KQ       SGMI+LKEL L SGKAAWMAYLDIYCLDADGALFD ALLSAVAAFSH +
Sbjct  121  KQF------SGMINLKELSLVSGKAAWMAYLDIYCLDADGALFDTALLSAVAAFSHCK  172



>gb|KHG05848.1| Exosome complex component RRP43 [Gossypium arboreum]
Length=174

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 151/176 (86%), Gaps = 6/176 (3%)
 Frame = +2

Query  134  MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
            M  +N SGDLS+++E+DAFR LFPLRF+E++L ESIRPD R LG AR TT+ LG+VASA+
Sbjct  1    MGLSNASGDLSTEVEVDAFRCLFPLRFYEKHLLESIRPDARPLGRARETTIALGAVASAN  60

Query  314  GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
            GSAL KIGSTTMLAAIK+EVMTPS ++PDEG IA++FHMPPICS +VRPGRPAE APV++
Sbjct  61   GSALAKIGSTTMLAAIKMEVMTPSLETPDEGCIAIDFHMPPICSPIVRPGRPAEGAPVVA  120

Query  494  KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSH  661
            KQ       SGMI+LKEL L SGKAAWMAYLDIYCLDADGALFD ALLSAVAAFSH
Sbjct  121  KQF------SGMINLKELSLVSGKAAWMAYLDIYCLDADGALFDTALLSAVAAFSH  170



>gb|KCW87871.1| hypothetical protein EUGRSUZ_A00266 [Eucalyptus grandis]
Length=249

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 150/307 (49%), Positives = 189/307 (62%), Gaps = 58/307 (19%)
 Frame = +2

Query  134   MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
             M T N +GD SS+ME++AFRRLFP+ ++ER+L ESIRP             +L      +
Sbjct  1     MGTLNAAGDWSSEMEVNAFRRLFPVHYYERHLSESIRP-------------MLDPWKKPE  47

Query  314   GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
                 +++  +TMLAAIK+EVMTPS DSPD G I            ++RPG PAE APVIS
Sbjct  48    ----IRLCPSTMLAAIKMEVMTPSVDSPDGGRI------------VMRPGGPAEVAPVIS  91

Query  494   KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIP  673
             KQL D++ SSGMIDLKEL L  GKAAWM  L I                +VAAFSHL I 
Sbjct  92    KQLFDSLLSSGMIDLKELSLIKGKAAWMVSLVIL------------HARSVAAFSHLHIL  139

Query  674   VASLNDDGRVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADP  853
             V SLND+GR+V+     ++    E  ++    +E+RKL L S+PFSL+C+LH+NYI   P
Sbjct  140   VVSLNDEGRMVM----VSEELEGEKLDKEPVDKERRKLLLKSIPFSLTCILHRNYIFC-P  194

Query  854   TAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEA  1033
             T EEES+MET + VVL+SS QLVSLYKPGGP LA TS IQ       Q +N       EA
Sbjct  195   TFEEESIMETFMTVVLNSSGQLVSLYKPGGPVLAHTSAIQKL-----QEIN-------EA  242

Query  1034  ISDMDVD  1054
             IS M++D
Sbjct  243   ISRMEID  249



>ref|XP_003588420.1| Exosome complex exonuclease RRP43 [Medicago truncatula]
Length=180

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +2

Query  140  TANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGS  319
             A  + DLSS+ME+DAFRRLFPLR+ ER+L ESIR DGR L EAR T++ LG+VASA+GS
Sbjct  5    NAAATEDLSSEMEVDAFRRLFPLRYFERHLAESIRSDGRPLREARDTSIFLGAVASANGS  64

Query  320  ALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQ  499
            ALVKIGSTTML AIK+EVM PS +SPDEG +A++FHMPPICS +VRPGRPAEA PV+SKQ
Sbjct  65   ALVKIGSTTMLTAIKMEVMIPSLESPDEGCLAIDFHMPPICSPIVRPGRPAEAEPVVSKQ  124

Query  500  LSDTIASSGMIDLKELCLASGKAAWMAYLDIYC  598
            LSDTI SSGMIDL+EL L  GKAAWMAYLDIYC
Sbjct  125  LSDTITSSGMIDLRELSLVGGKAAWMAYLDIYC  157



>gb|KHG16153.1| Exosome complex component RRP43 [Gossypium arboreum]
Length=181

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 152/178 (85%), Gaps = 6/178 (3%)
 Frame = +2

Query  134  MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
            M  +N SGDLS+++E+DAFR LFPLRF+E++L ESIRPD R LG AR TT+ LG+VASA+
Sbjct  1    MGLSNASGDLSTEVEVDAFRCLFPLRFYEKHLLESIRPDARPLGRARETTIALGAVASAN  60

Query  314  GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
            GSAL KIGSTTMLAAIK+EVMTPS ++PDEG IA++FHMPPICS +VRPGRPAE APV++
Sbjct  61   GSALAKIGSTTMLAAIKMEVMTPSLETPDEGCIAIDFHMPPICSPIVRPGRPAEGAPVVA  120

Query  494  KQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLE  667
            KQ       SGMI+LKEL L SGKAAWMAYLDIYCLDADGALFD ALLSAVAAFSH +
Sbjct  121  KQF------SGMINLKELSLVSGKAAWMAYLDIYCLDADGALFDTALLSAVAAFSHCK  172



>ref|XP_006602939.1| PREDICTED: exosome complex component RRP43 isoform X1 [Glycine 
max]
 ref|XP_006602940.1| PREDICTED: exosome complex component RRP43 isoform X2 [Glycine 
max]
Length=203

 Score =   240 bits (613),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = +2

Query  428   MPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASGKAAWMAYLDIYClda  607
             MPPICS +VRPGRPAEA+P++SKQLS+TI+SS M DLKEL L SGKAAWMAYLDIYCLDA
Sbjct  1     MPPICSPIVRPGRPAEASPMVSKQLSNTISSSRMTDLKELSLVSGKAAWMAYLDIYCLDA  60

Query  608   dgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevpepenepvtkeekRKL  787
             DGALFDAALLSA+AA SHL+IP  ++NDDG++VL       +E  +   +    +EKRKL
Sbjct  61    DGALFDAALLSAIAALSHLQIPSIAMNDDGKIVL-----VSDEDGQKRAQEPVNKEKRKL  115

Query  788   HLNSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSV  967
              L S+PFSL+C+LHKNYILADPTAEEES+MET + VVLD+S QL+SLYKPGGP LA TS 
Sbjct  116   TLRSIPFSLTCILHKNYILADPTAEEESIMETHVTVVLDTSGQLISLYKPGGPVLAYTSA  175

Query  968   IQDCVALTKQRVNQLKNILSEAISDMDV  1051
             IQDC ALT+QRV +L N L +A S M+V
Sbjct  176   IQDCAALTRQRVKELNNFLDKANSAMEV  203



>gb|EPS68495.1| hypothetical protein M569_06274, partial [Genlisea aurea]
Length=214

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 164/224 (73%), Gaps = 20/224 (9%)
 Frame = +2

Query  413   AVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSG---------MIDLKELCLASGK  565
             A++FHMP ICS LVRPGR AEAAPVISKQLSDTI   G         MI++++LCL SGK
Sbjct  1     AIDFHMPCICSPLVRPGREAEAAPVISKQLSDTILRQGIIFFIIETSMINMEDLCLVSGK  60

Query  566   AAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevpe  745
             AAWMAYLD+YCLDADGALFDAAL SAVAAFS LEIP  SLND+GRVV+            
Sbjct  61    AAWMAYLDVYCLDADGALFDAALFSAVAAFSSLEIPTVSLNDEGRVVI----------VV  110

Query  746   penepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETVLNVV-LDSSYQLV  922
             P        E +KL+L ++PFSL+C+LHKNYI+ADPTAEEESVMET L VV   S+ +L+
Sbjct  111   PGEGEPINGENKKLNLKTLPFSLTCLLHKNYIVADPTAEEESVMETYLTVVLDSSTSRLL  170

Query  923   SLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             SL KPGG  LA  + IQ+CV    +RV +LK IL+EAISDMDVD
Sbjct  171   SLSKPGGSGLAQKAEIQECVEFAGKRVKELKKILNEAISDMDVD  214



>emb|CDP19205.1| unnamed protein product [Coffea canephora]
Length=172

 Score =   218 bits (556),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 147/176 (84%), Gaps = 4/176 (2%)
 Frame = +2

Query  527   MIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVV  706
             MIDLKEL L SGKAAWMAYLDIYCLDADG+LFDAALLSAVAAFSHL+IPV SLND+GR+V
Sbjct  1     MIDLKELSLVSGKAAWMAYLDIYCLDADGSLFDAALLSAVAAFSHLQIPVVSLNDEGRIV  60

Query  707   LGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETV  886
             L     +++       +    +EKRKL L ++P SL+C+LHKNYILADPTAEEES+MET+
Sbjct  61    L----ISEDNGGGKLEKEPVNKEKRKLKLATIPLSLTCILHKNYILADPTAEEESIMETL  116

Query  887   LNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             + VVLDSS QLVSLYKPGGP LA TS IQDCVALT+QR+ +L+ IL+EAISDM+VD
Sbjct  117   VTVVLDSSSQLVSLYKPGGPVLAQTSAIQDCVALTRQRLKELQKILNEAISDMEVD  172



>gb|ACF81482.1| unknown [Zea mays]
 tpg|DAA48246.1| TPA: hypothetical protein ZEAMMB73_220271 [Zea mays]
Length=218

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 160/215 (74%), Gaps = 7/215 (3%)
 Frame = +2

Query  410   IAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASGKAAWMAYLD  589
             +AVEFHMPPICS LVRPGRP + APVISK L D + SSGM++LK+LCL +GKA+W+AYLD
Sbjct  8     VAVEFHMPPICSPLVRPGRPTDVAPVISKALEDVLTSSGMLNLKDLCLITGKASWLAYLD  67

Query  590   IYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevpepenepvtk  769
             IYCL+ADG+LFDAAL+SAVAAF+HLEIP+ S+ DDGR+                   +  
Sbjct  68    IYCLNADGSLFDAALISAVAAFTHLEIPLVSVGDDGRLF------TVGGNDGKNKFELVN  121

Query  770   eekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPA  949
              EKRKL L ++P SL+C LHK+ ILADPT+EEES++ET + VV+DSS +LVSL K GG A
Sbjct  122   REKRKLTLGAIPLSLTCALHKDEILADPTSEEESIIETYVTVVVDSSDRLVSLQKLGG-A  180

Query  950   LASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             +   + I++C++L K+R   L+ IL ++I  M+VD
Sbjct  181   VTCMATIKECISLAKERRRSLREILLDSIKAMEVD  215



>ref|XP_006664830.1| PREDICTED: exosome complex component RRP43-like [Oryza brachyantha]
Length=189

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = +2

Query  143  ANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSA  322
            A  +G L+ +ME++A+RRLFPL F ER+L +S+RPD R   +AR TTV LG+V+SA GSA
Sbjct  7    ATEAGGLAGEMEVEAYRRLFPLVFLERHLRKSVRPDARRTDKARPTTVALGTVSSAHGSA  66

Query  323  LVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQL  502
            LV++G T MLA+I +EVM+P  ++PDEG++A EFHMPPICS LVRPGRPAE APVIS+ L
Sbjct  67   LVRLGDTAMLASINLEVMSPFCEAPDEGTVAGEFHMPPICSPLVRPGRPAEVAPVISRTL  126

Query  503  SDTIASSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSH  661
             D + SS M++LKELCL SGK +W+AYLD+YCL+ADG+LF+AAL+SAV+AF+H
Sbjct  127  EDILMSSRMLNLKELCLISGKVSWLAYLDVYCLNADGSLFNAALISAVSAFTH  179



>gb|AAX95370.1| 3' exoribonuclease family, domain 1, putative [Oryza sativa Japonica 
Group]
Length=185

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  155  GDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKI  334
            G L+ +ME++A+RRLFPL F ER+L ES+RPD R   EAR TTV L +V+SA GSALV++
Sbjct  11   GGLAGEMEVEAYRRLFPLAFLERHLRESVRPDARRPAEARPTTVALAAVSSAHGSALVRL  70

Query  335  GSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTI  514
            G T MLA+IK+EVM+PS ++PDEGSIAVEFHMPPICS LVRPGRPAE APVISK L D +
Sbjct  71   GDTAMLASIKLEVMSPSGEAPDEGSIAVEFHMPPICSPLVRPGRPAEVAPVISKNLEDIL  130

Query  515  ASSGMIDLKELCLASGKAAWMAYLDIYC  598
             SSGM++LKELCL SGKA+W+AYL  + 
Sbjct  131  MSSGMLNLKELCLISGKASWLAYLAYWA  158



>gb|KCW87868.1| hypothetical protein EUGRSUZ_A00263 [Eucalyptus grandis]
Length=172

 Score =   208 bits (529),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 144/176 (82%), Gaps = 4/176 (2%)
 Frame = +2

Query  527   MIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVV  706
             MIDLKEL L  GKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHL IPV SLND+GR+V
Sbjct  1     MIDLKELSLIKGKAAWMAYLDIYCLDADGALFDAALLSAVAAFSHLRIPVVSLNDEGRMV  60

Query  707   LGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETV  886
             +     +K    E  ++    +E+RKL L S+PFSL+C+LHKNYILADPT EEES+MET 
Sbjct  61    M----VSKELEGEKLDKEPVDKERRKLSLKSIPFSLTCILHKNYILADPTFEEESIMETF  116

Query  887   LNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             + VVL+SS QLVSLYKPGGP LA TSVIQ+CVALT+QR+ +L+ I+ EAIS M++D
Sbjct  117   ITVVLNSSGQLVSLYKPGGPVLAHTSVIQECVALTRQRMKELEEIIDEAISTMEID  172



>gb|KGN53842.1| hypothetical protein Csa_4G165870 [Cucumis sativus]
Length=265

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  149  GSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALV  328
             SGDLSSQME+DAFRRLFP++F+ER+L ESIRPDGR+LG+AR TT+ LG V+SA+GSAL 
Sbjct  112  ASGDLSSQMEVDAFRRLFPIQFYERHLTESIRPDGRSLGKARDTTIALGPVSSANGSALA  171

Query  329  KIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSD  508
            KIGSTTMLAAIK+EVMTPS +SPDEG IA++FHMPP+CS +VRPGRPAEAAPVISKQLSD
Sbjct  172  KIGSTTMLAAIKMEVMTPSVESPDEGCIALDFHMPPVCSPIVRPGRPAEAAPVISKQLSD  231

Query  509  TIA  517
            TI+
Sbjct  232  TIS  234



>emb|CDP19206.1| unnamed protein product [Coffea canephora]
Length=134

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = +2

Query  134  MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
            M  A+GS DLSS+ME+DAFRRLFPL FHER+L +SIRPDGR LG+AR T + LG+V SA+
Sbjct  1    MAAASGS-DLSSEMEVDAFRRLFPLSFHERHLLKSIRPDGRTLGKARDTIISLGAVTSAN  59

Query  314  GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
            GSAL KIG TTMLAAIK+EVMTP+ +SPDEG IA++FHMPPICS +VRPGRPAEAAPV++
Sbjct  60   GSALTKIGCTTMLAAIKLEVMTPTVESPDEGCIAIDFHMPPICSPIVRPGRPAEAAPVVA  119

Query  494  KQLSDTI  514
            KQLS TI
Sbjct  120  KQLSGTI  126



>ref|XP_010671593.1| PREDICTED: exosome complex component RRP43-like [Beta vulgaris 
subsp. vulgaris]
Length=135

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 116/135 (86%), Gaps = 3/135 (2%)
 Frame = +2

Query  173  MELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTML  352
            M++DAFRRLFPL+F+ER+  +S+R D R L  AR TT+ LG+V+SA+GSALVK+G TTML
Sbjct  1    MKVDAFRRLFPLQFYERHFVKSLRLDARPLSSARDTTISLGAVSSANGSALVKVGCTTML  60

Query  353  AAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIA---SS  523
            AAIK+E+MTPS +SPDEG++A+EFHMPPICS +VRPGRPA+ APVISKQL+DTI+    +
Sbjct  61   AAIKMEIMTPSTESPDEGNVAIEFHMPPICSPIVRPGRPADTAPVISKQLADTISRQVDA  120

Query  524  GMIDLKELCLASGKA  568
            GMI+LKELCL SG +
Sbjct  121  GMINLKELCLVSGSS  135



>ref|XP_010063946.1| PREDICTED: exosome complex component RRP43-like [Eucalyptus grandis]
Length=208

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 140/179 (78%), Gaps = 5/179 (3%)
 Frame = +2

Query  518   SSGMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDG  697
             SSGMIDLKEL L  G+AAWM YLDIYCLDADG LFDAALLSAVAAFSH+ IP  SLND+G
Sbjct  35    SSGMIDLKELSLIKGEAAWMVYLDIYCLDADGTLFDAALLSAVAAFSHVRIPGVSLNDEG  94

Query  698   RVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVM  877
             R+V+     ++    E  ++    +E+RKL L S+PFSL C+LHKN+ILADPT EE S+M
Sbjct  95    RMVM----VSEELEGEKLDKEPVDKERRKLLLKSIPFSLICILHKNHILADPTFEE-SIM  149

Query  878   ETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             ET + VVL+SS QLVSLYKPGGP LA TS IQ+CVALT+QR+ +L+ I+ EAIS M+ D
Sbjct  150   ETFMTVVLNSSGQLVSLYKPGGPVLAHTSAIQECVALTRQRMKELQEIIDEAISIMETD  208



>ref|XP_007954490.1| PREDICTED: exosome complex component RRP43 [Orycteropus afer 
afer]
Length=282

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 166/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  10    GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  69

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   PS D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  70    AEFAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEKAQVASQFIADVIENSQIIQKED  129

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  130   LCISQGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  179

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K HLN  + P + S  +     ++ DPT EEE +    L +
Sbjct  180   ---------TALAEVNLKKKSHLNIRNYPVATSFAIFDDTLLIVDPTGEEEHLATGTLTI  230

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D+  +L  LYKPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  231   VMDTGGKLCCLYKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIQSM  279



>ref|XP_006879609.1| PREDICTED: exosome complex component RRP43 [Elephantulus edwardii]
Length=276

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 166/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E  TP  D+PD+G I     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFTTPPTDAPDKGYIVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQVIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISQGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K HLN  + P + S  +     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSHLNIRNYPVATSFAIFDDTLLIVDPTGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L  T  +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEGGRLCCLHKPGGSGLTGTK-LQDCMSRAVTRHKEVKKLMDEVIHSM  273



>ref|XP_001511768.1| PREDICTED: exosome complex component RRP43 isoform X2 [Ornithorhynchus 
anatinus]
Length=276

 Score =   191 bits (484),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 108/286 (38%), Positives = 169/286 (59%), Gaps = 19/286 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+P++G +     +PP+CSS  RPG P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFTAPPGDAPNKGYVVPNVDLPPLCSSRFRPGPPGEEAQVASQFINDVIENSQLIAKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++          
Sbjct  124   LCISKGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPAVVINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYIL-ADPTAEEESVMETVLNVVL  901
                         V  ++K  L++ + P + S  +  N IL  DPT EEE++    L VV+
Sbjct  174   -------TGLAEVNFKQKTPLNIRAYPIATSFAIFDNTILIVDPTGEEENLATGTLTVVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
             D   +L  L+KPGG ALA T  +QDC++    R  ++K ++ E I 
Sbjct  227   DEEGKLCCLHKPGGSALAGTK-LQDCLSRAVTRHKEVKVLMDEVIQ  271



>ref|NP_001276207.1| uncharacterized protein LOC100812139 [Glycine max]
 gb|ACU22692.1| unknown [Glycine max]
Length=170

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 138/175 (79%), Gaps = 5/175 (3%)
 Frame = +2

Query  527   MIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVV  706
             M DLKEL L SGKAAWMAYLDIYCLDADGALFDAALLSA+AA SHL+IP  ++NDDG++V
Sbjct  1     MTDLKELSLVSGKAAWMAYLDIYCLDADGALFDAALLSAIAALSHLQIPSIAMNDDGKIV  60

Query  707   LGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETV  886
             L       +E  +   +    +EKRKL L S+PFSL+C+LHKNYILADPTAEEES+MET 
Sbjct  61    L-----VSDEDGQKRAQEPVNKEKRKLTLRSIPFSLTCILHKNYILADPTAEEESIMETH  115

Query  887   LNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDV  1051
             + VVLD+S QL+SLYKPGGP LA TS IQDC ALT+QRV +L N L +A S M+V
Sbjct  116   VTVVLDTSGQLISLYKPGGPVLAYTSAIQDCAALTRQRVKELNNFLDKANSAMEV  170



>ref|XP_004604690.1| PREDICTED: exosome complex component RRP43, partial [Sorex araneus]
Length=272

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/289 (38%), Positives = 168/289 (58%), Gaps = 19/289 (7%)
 Frame = +2

Query  188   FRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKV  367
             FR + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK 
Sbjct  1     FRTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIKA  60

Query  368   EVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKEL  547
             E   PSAD+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++L
Sbjct  61    EFAAPSADTPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFVADVIENSQIIQKEDL  120

Query  548   CLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkkn  727
             C++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++           
Sbjct  121   CISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE-----------  169

Query  728   knevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVLD  904
                        V  ++K  L++ + P + S  V     ++ DPT EEE +    L VV+D
Sbjct  170   ------TALAEVNLKKKHFLNIKTHPIATSFAVFDDTLLIVDPTGEEEHLATGTLTVVMD  223

Query  905   SSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDV  1051
                +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M V
Sbjct  224   EEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSMKV  271



>ref|XP_010043138.1| PREDICTED: exosome complex component RRP43-like isoform X3 [Eucalyptus 
grandis]
Length=154

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  134  MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
            M+T N  GD SS+ME++AFRRLFPLR++ER+L ESIRPD R L +AR T+V LG+VAS+D
Sbjct  1    METPNAVGDWSSEMEVNAFRRLFPLRYYERHLYESIRPDARPLKKARDTSVSLGAVASSD  60

Query  314  GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
            GSAL KIGSTTMLAAIK+EVMTP  +SP++GSIAVEFHMPPIC  L+RPGRPAE APVIS
Sbjct  61   GSALAKIGSTTMLAAIKMEVMTPPVNSPEDGSIAVEFHMPPICLPLMRPGRPAEVAPVIS  120

Query  494  K  496
            K
Sbjct  121  K  121



>ref|XP_010043016.1| PREDICTED: exosome complex component RRP43-like isoform X1 [Eucalyptus 
grandis]
Length=162

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +2

Query  134  MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
            M+T N  GD SS+ME++AFRRLFPLR++ER+L ESIRPD R L +AR T+V LG+VAS+D
Sbjct  1    METPNAVGDWSSEMEVNAFRRLFPLRYYERHLYESIRPDARPLKKARDTSVSLGAVASSD  60

Query  314  GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
            GSAL KIGSTTMLAAIK+EVMTP  +SP++GSIAVEFHMPPIC  L+RPGRPAE APVIS
Sbjct  61   GSALAKIGSTTMLAAIKMEVMTPPVNSPEDGSIAVEFHMPPICLPLMRPGRPAEVAPVIS  120

Query  494  K  496
            K
Sbjct  121  K  121



>ref|XP_010633525.1| PREDICTED: exosome complex component RRP43 isoform X1 [Fukomys 
damarensis]
Length=276

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/291 (37%), Positives = 168/291 (58%), Gaps = 19/291 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P AD+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAVPPADAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++SGK AW+ Y D+ CLD DG + DA   + +AA  ++++P  S+N++          
Sbjct  124   LCISSGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVSINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++K  L++ + P + S  V     ++ DPT EEE +    L VV+
Sbjct  174   -------TALAEVNLKKKNYLNIRNHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M  +
Sbjct  227   DEEGRLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSMKTE  276



>ref|XP_004659921.1| PREDICTED: exosome complex component RRP43 [Jaculus jaculus]
Length=291

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 110/292 (38%), Positives = 166/292 (57%), Gaps = 23/292 (8%)
 Frame = +2

Query  179   LDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAA  358
              + FR + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  
Sbjct  17    FECFRTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICG  76

Query  359   IKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDL  538
             +K E  TP  D+PD+G I     +PP+CSS  R G P E A V S+ ++D I +S +I  
Sbjct  77    VKAEFATPPTDAPDKGYIVPNVDLPPLCSSRFRAGPPGEEAQVTSQFIADVIENSQVIQK  136

Query  539   KELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtk  718
             ++LC++ GK AW+ Y D+ CLD DG + DA   + +AA   +++P  ++N++        
Sbjct  137   EDLCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKDVQLPEVTINEE--------  188

Query  719   kknknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVL  889
                                K+K +LN  + P + S  V     +L DPTAEEE +    L
Sbjct  189   -----------TALAEVNLKKKSYLNIGTHPVATSFAVFDDTLLLVDPTAEEEHLATGTL  237

Query  890   NVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
              VV+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  238   TVVMDEKGRLCCLHKPGGSGLNGAK-LQDCMSRAVTRHKEVKKLMEEVIKSM  288



>ref|XP_003412693.1| PREDICTED: exosome complex component RRP43 isoform X2 [Loxodonta 
africana]
Length=282

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  10    GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  69

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G I     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  70    AEFAAPPTDAPDKGYIVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  129

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA+  + +AA  ++++P  ++N++          
Sbjct  130   LCISQGKLAWVLYCDLICLDYDGNILDASTFALLAALKNVQLPEVNINEE----------  179

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K HLN  + P + S  +     ++ DPT EEE +    L V
Sbjct  180   ---------TALAEVNLKKKTHLNIRNYPVATSFAIFDDTLLIVDPTGEEEHLATGTLTV  230

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  231   VTDEGGRLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIQSM  279



>ref|XP_010633526.1| PREDICTED: exosome complex component RRP43 isoform X2 [Fukomys 
damarensis]
Length=282

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 167/289 (58%), Gaps = 19/289 (7%)
 Frame = +2

Query  191   RRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVE  370
             R + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK E
Sbjct  12    RTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIKAE  71

Query  371   VMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELC  550
                P AD+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++LC
Sbjct  72    FAVPPADAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLC  131

Query  551   LASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknk  730
             ++SGK AW+ Y D+ CLD DG + DA   + +AA  ++++P  S+N++            
Sbjct  132   ISSGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVSINEE------------  179

Query  731   nevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVLDS  907
                       V  ++K  L++ + P + S  V     ++ DPT EEE +    L VV+D 
Sbjct  180   -----TALAEVNLKKKNYLNIRNHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVMDE  234

Query  908   SYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
               +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M  +
Sbjct  235   EGRLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSMKTE  282



>ref|XP_007666729.1| PREDICTED: exosome complex component RRP43 isoform X1 [Ornithorhynchus 
anatinus]
Length=297

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/280 (38%), Positives = 167/280 (60%), Gaps = 19/280 (7%)
 Frame = +2

Query  203   PLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVEVMTP  382
             PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K E   P
Sbjct  31    PLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFTAP  90

Query  383   SADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASG  562
               D+P++G +     +PP+CSS  RPG P E A V S+ ++D I +S +I  ++LC++ G
Sbjct  91    PGDAPNKGYVVPNVDLPPLCSSRFRPGPPGEEAQVASQFINDVIENSQLIAKEDLCISKG  150

Query  563   KAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevp  742
             K AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++  +             
Sbjct  151   KLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPAVVINEETGLA------------  198

Query  743   epenepvtkeekRKLHLNSVPFSLSCVLHKNYIL-ADPTAEEESVMETVLNVVLDSSYQL  919
                   V  ++K  L++ + P + S  +  N IL  DPT EEE++    L VV+D   +L
Sbjct  199   -----EVNFKQKTPLNIRAYPIATSFAIFDNTILIVDPTGEEENLATGTLTVVMDEEGKL  253

Query  920   VSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
               L+KPGG ALA T  +QDC++    R  ++K ++ E I 
Sbjct  254   CCLHKPGGSALAGTK-LQDCLSRAVTRHKEVKVLMDEVIQ  292



>ref|XP_004680270.1| PREDICTED: exosome complex component RRP43 [Condylura cristata]
Length=276

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 165/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TT+ +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTINIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E  TP  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFATPPTDTPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  S+N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVSINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGRLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_006837716.1| PREDICTED: exosome complex component RRP43 [Chrysochloris asiatica]
Length=276

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 161/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSITTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  DSPD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDSPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK  W+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISQGKLTWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K HLN  S P + S  +     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSHLNIRSYPVATSFAIFDDTLLIVDPTGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L  T  +QDC+     R  ++K ++ E    M
Sbjct  225   VMDERGKLDCLHKPGGSGLTGTK-LQDCMNRAMTRHKEVKKLMDEVFQSM  273



>ref|XP_010590964.1| PREDICTED: exosome complex component RRP43 isoform X1 [Loxodonta 
africana]
Length=283

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 107/291 (37%), Positives = 165/291 (57%), Gaps = 24/291 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  10    GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  69

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G I     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  70    AEFAAPPTDAPDKGYIVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  129

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA+  + +AA  ++++P  ++N++          
Sbjct  130   LCISQGKLAWVLYCDLICLDYDGNILDASTFALLAALKNVQLPEVNINEE----------  179

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLSCVLHKN--YILADPTAEEESVMETVLN  892
                              K+K HLN  + P + S  +  +   ++ DPT EEE +    L 
Sbjct  180   ---------TALAEVNLKKKTHLNIRNYPVATSFAIFDDSTLLIVDPTGEEEHLATGTLT  230

Query  893   VVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             VV D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  231   VVTDEGGRLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIQSM  280



>ref|XP_006085631.1| PREDICTED: exosome complex component RRP43 [Myotis lucifugus]
Length=276

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 165/288 (57%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GSV++ADGSALVK+G+T ++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSVSTADGSALVKLGNTAVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPPDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIPKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++KR L++ + P + S  V     ++ DPT EEE +    L VV+
Sbjct  174   -------TALAEVNLKKKRYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   QL  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  227   DEEGQLCCLHKPGGSGLTGAK-LQDCLSRAVTRHKEIKKLMDEVIKSM  273



>ref|XP_010633527.1| PREDICTED: exosome complex component RRP43 isoform X3 [Fukomys 
damarensis]
Length=278

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 107/285 (38%), Positives = 165/285 (58%), Gaps = 19/285 (7%)
 Frame = +2

Query  203   PLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVEVMTP  382
             PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK E   P
Sbjct  12    PLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIKAEFAVP  71

Query  383   SADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASG  562
              AD+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++LC++SG
Sbjct  72    PADAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISSG  131

Query  563   KAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevp  742
             K AW+ Y D+ CLD DG + DA   + +AA  ++++P  S+N++                
Sbjct  132   KLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVSINEE----------------  175

Query  743   epenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVLDSSYQL  919
                   V  ++K  L++ + P + S  V     ++ DPT EEE +    L VV+D   +L
Sbjct  176   -TALAEVNLKKKNYLNIRNHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVMDEEGRL  234

Query  920   VSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
               L+KPGG  L     +QDC++    R  ++K ++ E I  M  +
Sbjct  235   CCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSMKTE  278



>ref|XP_010740770.1| PREDICTED: exosome complex component RRP43 [Larimichthys crocea]
Length=277

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 169/285 (59%), Gaps = 19/285 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+   PL +H  +L E+ RPDGR L E R TT+ +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTAEPLEYHRSFLKENCRPDGRELTEFRTTTLNIGSISTADGSALVKVGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P+ ++P +G I     +PP+CSS  RPG P E A   S+ ++D I SS +I  ++
Sbjct  64    AELTNPTVEAPGKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIESSELIQTED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK  W+ Y D+ CLD DG + DA +++ +AA  + ++P  ++N +          
Sbjct  124   LCIDRGKLCWVLYCDLMCLDYDGNVLDACVIALLAALKNTQLPEVTINTE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                      +  V  E++R LH+N  P S S CV   + ++ DPTAEEES+  + L VV 
Sbjct  174   -------TCSPQVDLEKRRGLHINKHPVSASLCVFDDSILITDPTAEEESLTSSQLTVVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAI  1036
             D   +L +++KPGG ++ S   +Q+C++    R  +++ ++ + I
Sbjct  227   DEEGRLCAMHKPGGTSM-SAEKLQECISRATARQQEIQKLIDKVI  270



>ref|XP_002720651.1| PREDICTED: exosome complex component RRP43 [Oryctolagus cuniculus]
Length=276

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 165/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P AD+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPADAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSRIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_004631152.1| PREDICTED: exosome complex component RRP43 [Octodon degus]
Length=276

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 167/288 (58%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAVPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++SGK AW+ Y D+ CLD DG + DA   + +AA  ++++P  S+N++  +       
Sbjct  124   LCISSGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVSINEETSLA------  177

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++K  L++ + P + S  V     ++ DPT EEE +    L VV+
Sbjct  178   -----------EVNLKKKSFLNIRTHPVATSFAVFDDTLLIVDPTGEEERLATGTLTVVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  227   DEEGRLSCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKTLMDEVIKSM  273



>ref|XP_006915858.1| PREDICTED: exosome complex component RRP43 [Pteropus alecto]
Length=276

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 166/288 (58%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++K  L++ + P + S  V     ++ DPTAEEE +    L VV+
Sbjct  174   -------TALAEVNLKKKSCLNIRTHPVATSFAVFDDTLLIVDPTAEEEHLATGTLTVVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  227   DEESKLCCLHKPGGSGLTGGK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_004399964.1| PREDICTED: exosome complex component RRP43 [Odobenus rosmarus 
divergens]
Length=276

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 165/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I   +
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKAD  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+++GK +W+ Y DI CLD DG + DA   + +AA  ++++P  ++N++  +       
Sbjct  124   LCISTGKLSWVLYCDIICLDYDGNILDACTFALLAALKNVQLPEVTINEETGLA------  177

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  178   -------------EVNLKKKSYLNIRTNPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_002946572.1| hypothetical protein VOLCADRAFT_86657 [Volvox carteri f. nagariensis]
 gb|EFJ52499.1| hypothetical protein VOLCADRAFT_86657 [Volvox carteri f. nagariensis]
Length=311

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 171/296 (58%), Gaps = 2/296 (1%)
 Frame = +2

Query  161   LSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGS  340
             LS  ++ DAF+RL+P ++++R+L E +RPDGR LG AR  T+  G++ SADGSALVKIG 
Sbjct  9     LSDDVDADAFKRLYPDQYYDRFLAEGVRPDGRPLGRARAVTIGAGAITSADGSALVKIGR  68

Query  341   TTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIAS  520
             TT+L  +++E++ P   +P +G +A+   + P  S   RPGR  +    ++++L+  + +
Sbjct  69    TTVLGGVRLEIIRPDETAPSQGQLALNVELAPFSSQDYRPGRQPDHVSAVTEKLTSALLT  128

Query  521   SG-MIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDG  697
              G  + L  LC+A GKAAW A LD+Y LDADG + D ALL+A AA  +  IP      +G
Sbjct  129   GGDAVQLSSLCIAEGKAAWRASLDLYVLDADGCVLDTALLAATAALRNTRIPAVRSTREG  188

Query  698   RVVLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVM  877
               V      + +     +   V       + +   P  L+C L++NYIL DPTAEEE + 
Sbjct  189   HYVAVGAGSSGSGGAGGDGGLVAGSPT-AVGMGRCPLGLTCCLYRNYILVDPTAEEERLA  247

Query  878   ETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
                ++VVLD   +L  +YK GG  LA  + +  C    + R  +L  +L +++S +
Sbjct  248   ACSVSVVLDQHGRLQGVYKAGGKVLADAATLVKCTEAARLRYRELSGLLEQSLSQV  303



>ref|XP_004390018.1| PREDICTED: exosome complex component RRP43 [Trichechus manatus 
latirostris]
Length=276

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 165/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G I     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYIVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA+  + +AA  ++++P  ++N++          
Sbjct  124   LCISQGKLAWVLYCDLICLDYDGNILDASTFALLAALKNVQLPEVNINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K HL+  + P + S  +     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSHLSIRNHPVATSFAIFDDTLLIVDPTGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEGGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKTLMDEVIQSM  273



>ref|XP_003270334.1| PREDICTED: exosome complex component RRP43 [Nomascus leucogenys]
Length=276

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G I     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYIVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_007229825.1| PREDICTED: exosome complex component RRP43 [Astyanax mexicanus]
Length=277

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/285 (38%), Positives = 163/285 (57%), Gaps = 19/285 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+   PL +H  +L E+ RPDGR LGE R TT+ +GS+ +ADGSA+VKIG+TT++  IK
Sbjct  4     GFKTAEPLEYHRSFLKENCRPDGRELGEFRPTTLNIGSIGTADGSAMVKIGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P +D+PD+G I     +PP+CSS  RPG P E A   S+ ++D I  S +I  ++
Sbjct  64    AELAAPPSDAPDKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIDGSKIIKKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+   K  W+ Y DI CLD DG + DA +++ +AA  + +IP  ++N +  +       
Sbjct  124   LCIEKSKLCWVLYCDIMCLDYDGNVLDACIITLLAALKNTQIPKVTINKETDLA------  177

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  E KR L +N  P S S  V     I+ DPTAEEES+  +V+  V+
Sbjct  178   -----------EVDIEHKRHLQINKHPVSSSFAVFDDTVIIVDPTAEEESLATSVITAVV  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAI  1036
             D   QL + +KPGG +L S   +QDC+  +  R  ++  ++ + +
Sbjct  227   DEDDQLCAFHKPGGSSL-SAEKLQDCITRSVTRHREVGKLIDKVL  270



>ref|XP_007097738.1| PREDICTED: exosome complex component RRP43 [Panthera tigris altaica]
Length=298

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              FR + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  26    CFRTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  85

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  86    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  145

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK +W+ Y DI CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  146   LCISPGKLSWVLYCDIICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  195

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  196   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  246

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  247   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  295



>gb|EHH58538.1| Exosome complex exonuclease RRP43, partial [Macaca fascicularis]
Length=272

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 164/289 (57%), Gaps = 23/289 (8%)
 Frame = +2

Query  188   FRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKV  367
             FR + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K 
Sbjct  1     FRTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKA  60

Query  368   EVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKEL  547
             E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++L
Sbjct  61    EFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDL  120

Query  548   CLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkkn  727
             C++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++           
Sbjct  121   CISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE-----------  169

Query  728   knevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNVV  898
                             K+K +LN  + P + S  V     ++ DPT EEE +    L +V
Sbjct  170   --------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIV  221

Query  899   LDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             +D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  222   MDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  269



>ref|XP_008690479.1| PREDICTED: exosome complex component RRP43 [Ursus maritimus]
Length=276

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 165/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDTPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK +W+ Y DI CLD DG + DA   + +AA  ++++P  ++N++  +       
Sbjct  124   LCISPGKLSWVLYCDIICLDYDGNILDACTFALLAALKNVQLPEVTINEETGLA------  177

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  178   -------------EVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_002930910.1| PREDICTED: exosome complex exonuclease RRP43-like [Ailuropoda 
melanoleuca]
Length=276

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 165/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDTPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK +W+ Y DI CLD DG + DA   + +AA  ++++P  ++N++  +       
Sbjct  124   LCISPGKLSWVLYCDIICLDYDGNILDACTFALLAALKNVQLPEVTINEETGLA------  177

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  178   -------------EVHLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>gb|KFV87215.1| Exosome complex component RRP43, partial [Struthio camelus australis]
Length=272

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/287 (37%), Positives = 166/287 (58%), Gaps = 19/287 (7%)
 Frame = +2

Query  188   FRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKV  367
             FR + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  +K 
Sbjct  1     FRTVEPLEYYRRFLKENCRPDGRELGEFRATTVNIGSITTADGSALVKLGNTTVICGVKA  60

Query  368   EVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKEL  547
             E+ TP  DSP++G I     +P +CS+  RPG P E A   S+ ++D I +S +I+ ++L
Sbjct  61    ELATPPVDSPNKGYIVPNVELPSLCSTRFRPGPPGEEAQAASQFIADVIENSQIIEKEDL  120

Query  548   CLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkkn  727
             C+A+GK AW+ Y DI CLD DG + DA+  + +AA  ++++P  ++N++           
Sbjct  121   CIANGKLAWVLYCDIICLDYDGNVLDASTFALLAALKNVQLPAVTVNEE-----------  169

Query  728   knevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVLD  904
                        V  ++K  L +   P + S  V     ++ DPTAEEE +    + VV D
Sbjct  170   ------TGLSEVNLKQKNPLIIRKHPVATSFAVFDDTLLIVDPTAEEEDLATGTVTVVTD  223

Query  905   SSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
                +L S++KPGG  L     +QDC+     R  ++K ++ + I  M
Sbjct  224   EEGRLCSVHKPGGSPLTGAK-LQDCITRAVTRHKEVKKLIDKVIKSM  269



>ref|XP_005387722.1| PREDICTED: exosome complex component RRP43 isoform X2 [Chinchilla 
lanigera]
Length=276

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAVPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++SGK AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++          
Sbjct  124   LCISSGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVRINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGRLSCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_003477480.1| PREDICTED: exosome complex component RRP43 isoform X1 [Cavia 
porcellus]
Length=276

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P AD+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAVPPADAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++SGK AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++          
Sbjct  124   LCISSGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVRINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V++   +L  L+KPGG  L     +QDC+     R  ++K ++ E I  M
Sbjct  225   VMNEEGRLCCLHKPGGSGLTGPK-LQDCMGRAVTRHKEVKKLMDEVIRSM  273



>ref|XP_004770814.1| PREDICTED: exosome complex component RRP43 isoform X2 [Mustela 
putorius furo]
 ref|XP_004802243.1| PREDICTED: exosome complex component RRP43 isoform X2 [Mustela 
putorius furo]
Length=276

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 165/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK +W+ Y DI CLD DG + DA   + +AA  ++++P  ++N++  +       
Sbjct  124   LCISPGKLSWVLYCDIICLDYDGNILDACTFALLAALKNVQLPEVTINEETGLA------  177

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  178   -------------EVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_004453371.1| PREDICTED: exosome complex component RRP43 isoform 1 [Dasypus 
novemcinctus]
Length=302

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 104/290 (36%), Positives = 163/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  30    GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  89

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  90    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  149

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA   +++P  S+N++          
Sbjct  150   LCISQGKLAWVLYCDLICLDYDGNILDACTFALLAALKDVQLPEVSINEE----------  199

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K HLN  + P + S  +     ++ DPT EEE +    + +
Sbjct  200   ---------TALAEVNLKKKSHLNIKTHPVATSFAIFDDTLLIVDPTGEEEHLATGTITI  250

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  251   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIQSM  299



>ref|XP_006734088.1| PREDICTED: exosome complex component RRP43 [Leptonychotes weddellii]
Length=276

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 165/288 (57%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+++GK +W+ Y DI CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISTGKLSWVLYCDIICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++K  L + + P + S  V     ++ DPT EEE +    L VV+
Sbjct  174   -------TGLAEVNLKKKSYLDIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  227   DEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHREVKKLMDEVIKSM  273



>ref|XP_010043072.1| PREDICTED: exosome complex component RRP43-like isoform X2 [Eucalyptus 
grandis]
Length=161

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = +2

Query  134  MDTANGSGDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASAD  313
            M+T N  GD SS+ME++AFRRLFPLR++ER+L ESIRPD R L +AR T+V LG+VAS+D
Sbjct  1    METPNAVGDWSSEMEVNAFRRLFPLRYYERHLYESIRPDARPLKKARDTSVSLGAVASSD  60

Query  314  GSALVKIGSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVIS  493
            GSAL KIGSTTMLAAIK+EVMTP  +SP++GSI VEFHMPPIC  L+RPGRPAE APVIS
Sbjct  61   GSALAKIGSTTMLAAIKMEVMTPPVNSPEDGSI-VEFHMPPICLPLMRPGRPAEVAPVIS  119

Query  494  K  496
            K
Sbjct  120  K  120



>ref|XP_006757907.1| PREDICTED: exosome complex component RRP43 [Myotis davidii]
Length=312

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 165/288 (57%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL F+ R+L E+ RPDGR LGE R TTV +GSV++ADGSALVK+G+T ++  IK
Sbjct  40    GFKTVEPLEFYRRFLKENCRPDGRELGEFRTTTVNIGSVSTADGSALVKLGNTAVICGIK  99

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  100   AEFAAPPPDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIPKED  159

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK +W+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  160   LCISPGKLSWVLYCDLICLDYDGNILDACTCALLAALKNVQLPEVTINEE----------  209

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++KR L++ + P + S  V     ++ DPT EEE +    L VV+
Sbjct  210   -------TALAEVNLKKKRYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVM  262

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  263   DEEGKLCCLHKPGGSGLTGAK-LQDCLSRAVTRHKEIKKLMDEVIKSM  309



>ref|XP_008047100.1| PREDICTED: exosome complex component RRP43 [Tarsius syrichta]
Length=276

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 164/288 (57%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D  CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDFICLDYDGNILDACTFALLAALKNVQLPEVAINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++K  L++ + P + S  V     ++ DPT EEE +    L +V+
Sbjct  174   -------TALAEVNLKKKNYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  227   DEESKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_003803149.1| PREDICTED: exosome complex component RRP43 [Otolemur garnettii]
Length=280

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 163/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  8     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  67

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  68    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  127

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++          
Sbjct  128   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVIINEE----------  177

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  178   ---------TALAEVNLKKKSYLNIRTYPVATSFAVFDDTLLIVDPTGEEEHLATGTLTI  228

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  +LK ++ E I  M
Sbjct  229   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKELKKLMDEVIKSM  277



>ref|NP_001187695.1| exosome complex exonuclease rrp43 [Ictalurus punctatus]
 gb|ADO28997.1| exosome complex exonuclease rrp43 [Ictalurus punctatus]
Length=277

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 112/288 (39%), Positives = 169/288 (59%), Gaps = 22/288 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+   PL +H  +L E+ RPDGR LGE R TT+  GS+++ADGSALVKIG+ T++  IK
Sbjct  4     GFKTAEPLEYHRSFLKENCRPDGRELGEFRPTTLNTGSISTADGSALVKIGNATVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+ TP+AD+PD+G I     +PP+CSS  RPG P E A V S+ ++D I  S +I  ++
Sbjct  64    AELATPTADAPDKGYIVPNVDLPPLCSSRFRPGPPGEQAQVASQFIADIIDDSNIIKKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+   K  W+ Y DI CLD DG L DA +++ +AA  + ++P  ++N +  +       
Sbjct  124   LCIGKSKLCWVLYCDIMCLDYDGNLPDACIITLLAALKNAQLPKVTINKETDL-------  176

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  + KR L +N  P + S  V     I+ DPT EEES+   ++  V 
Sbjct  177   ----------PEVDVQHKRHLQINKHPVASSFAVFDDEVIIVDPTTEEESLATALITAVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCV--ALTKQR-VNQLKNILSEAI  1036
             D + QL + +KPGG +L S   +Q C+  A+T+ R +N+L + ++E+I
Sbjct  227   DENDQLCAFHKPGGSSL-SAEKLQGCISRAVTRNREINKLIDRVTESI  273



>ref|NP_852480.1| exosome complex component RRP43 [Homo sapiens]
 sp|Q96B26.1|EXOS8_HUMAN RecName: Full=Exosome complex component RRP43; AltName: Full=Exosome 
component 8; AltName: Full=Opa-interacting protein 2; 
Short=OIP-2; AltName: Full=Ribosomal RNA-processing protein 
43; AltName: Full=p9 [Homo sapiens]
 gb|AAH20773.1| Exosome component 8 [Homo sapiens]
 gb|ABM84060.1| exosome component 8 [synthetic construct]
 gb|ABM87413.1| exosome component 8 [synthetic construct]
 dbj|BAG73136.1| exosome component 8 [synthetic construct]
 gb|AIC55969.1| EXOSC8, partial [synthetic construct]
Length=276

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/290 (36%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   PS D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK  W+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_007433299.1| PREDICTED: exosome complex component RRP43 isoform X1 [Python 
bivittatus]
 ref|XP_007433300.1| PREDICTED: exosome complex component RRP43 isoform X2 [Python 
bivittatus]
 ref|XP_007433301.1| PREDICTED: exosome complex component RRP43 isoform X3 [Python 
bivittatus]
 ref|XP_007433302.1| PREDICTED: exosome complex component RRP43 isoform X4 [Python 
bivittatus]
Length=276

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/285 (38%), Positives = 164/285 (58%), Gaps = 18/285 (6%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
             AFR + PL ++ R+L E+ RPDGR LGE R TT+ +GS+ +ADGSALVK+G+TT++  IK
Sbjct  8     AFRTVEPLEYYRRFLKENCRPDGRDLGEFRTTTINIGSITTADGSALVKLGNTTVICGIK  67

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P+ DS ++G I     +PP+CSS  RPG P E A   S+ ++D I +S ++  ++
Sbjct  68    AEFAAPTVDSSNKGYIIPNVDLPPLCSSRFRPGPPGEEAQAASQFIADVIENSQVVMKED  127

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK  W+ Y DI CLD DG L DA + + +AA  ++ +PV ++N +  +       
Sbjct  128   LCIIDGKIVWVLYCDIICLDYDGNLLDACMCAFLAALKNVLLPVVTINAETGL-------  180

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLD  904
                         V  +EK  L +   P + S VL    ++ DPTAEEE +    L +V D
Sbjct  181   ----------AEVNLKEKNPLTIKKQPVATSFVLFDTLVVVDPTAEEEDLASGTLTIVTD  230

Query  905   SSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
                +L S++KPGG  +     +QDC++  K R  ++K ++ + I 
Sbjct  231   EEDKLCSVHKPGGSTVTEAK-LQDCISRAKTRHKEVKKLMDKIIK  274



>ref|XP_004854777.1| PREDICTED: exosome complex component RRP43 isoform X1 [Heterocephalus 
glaber]
Length=310

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  38    GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  97

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  98    AEFAVPPKDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  157

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++SGK AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++          
Sbjct  158   LCISSGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVCINEE----------  207

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  208   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLMVDPTGEEEHLATGALTV  258

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  259   VMDEEGRLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  307



>pdb|2NN6|C Chain C, Structure Of The Human Rna Exosome Composed Of Rrp41, 
Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, And Rrp40
Length=278

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 104/290 (36%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  6     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  65

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   PS D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  66    AEFAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  125

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK  W+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  126   LCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  175

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  176   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTI  226

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  227   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  275



>ref|NP_001247467.1| exosome component 8 [Macaca mulatta]
 ref|XP_005585732.1| PREDICTED: exosome complex component RRP43 [Macaca fascicularis]
 ref|XP_007958362.1| PREDICTED: exosome complex component RRP43 [Chlorocebus sabaeus]
 ref|XP_009190067.1| PREDICTED: exosome complex component RRP43 [Papio anubis]
Length=276

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 104/290 (36%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_003216847.1| PREDICTED: exosome complex component RRP43 [Anolis carolinensis]
Length=277

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 165/285 (58%), Gaps = 18/285 (6%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              FR + P+ ++ R+L E+ RPDGR LGE R TT+ +GS+ +ADGSALVK+G+TT++  IK
Sbjct  6     GFRTVEPVEYYRRFLKENCRPDGRDLGEFRTTTINIGSITTADGSALVKLGNTTVVCGIK  65

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P ADS ++G I     +PP+CSS  RPG P E A   S+ ++D I +S ++  ++
Sbjct  66    AEFAAPLADSSNKGYIVPNVDLPPLCSSRFRPGPPGEEAQAASQFVADVIENSQVVMKED  125

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK AW+ Y DI CLD DG L DA + + +AA  ++++P  ++N++          
Sbjct  126   LCIVDGKIAWVLYCDIICLDYDGNLLDACMCAFLAALRNVQLPAVTINEE----------  175

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLD  904
                         V  +EK  L +   P + S +L    ++ DPTAEEE +   +L +V D
Sbjct  176   -------TGLAEVNLKEKIPLTIRKEPVATSFILFDTVMIVDPTAEEEDLATGMLTIVTD  228

Query  905   SSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
                +L S++KPGG AL     +QDC++    R  ++K ++ + I 
Sbjct  229   EEGKLCSVHKPGGSALTGAK-LQDCISRATARYKEVKKLIDKVIK  272



>gb|EHH28956.1| Exosome complex exonuclease RRP43, partial [Macaca mulatta]
Length=272

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 164/289 (57%), Gaps = 23/289 (8%)
 Frame = +2

Query  188   FRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKV  367
             FR + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K 
Sbjct  1     FRTVEPLEYYRRFLLENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKA  60

Query  368   EVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKEL  547
             E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++L
Sbjct  61    EFAAPPTDAPDKGYVVPNVDLPPLCSSRFRAGPPGEEAQVASQFIADVIENSQIIQKEDL  120

Query  548   CLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkkn  727
             C++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++           
Sbjct  121   CISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE-----------  169

Query  728   knevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNVV  898
                             K+K +LN  + P + S  V     ++ DPT EEE +    L +V
Sbjct  170   --------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIV  221

Query  899   LDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             +D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  222   MDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  269



>ref|XP_002112521.1| hypothetical protein TRIADDRAFT_25085 [Trichoplax adhaerens]
 gb|EDV24631.1| hypothetical protein TRIADDRAFT_25085, partial [Trichoplax adhaerens]
Length=266

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 166/282 (59%), Gaps = 19/282 (7%)
 Frame = +2

Query  188   FRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKV  367
             FR L P  F++R++ E+IRPD R   + R TTV +GS+ +A+GSALVKIG+TTML  IK 
Sbjct  1     FRTLRPKEFYDRFIAENIRPDRRTFKQFRKTTVNVGSITTANGSALVKIGNTTMLCGIKT  60

Query  368   EVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKEL  547
             E   P  DSPD G I     +PP+CS   RPG P E A V S+ L+D I S  +I+LK+L
Sbjct  61    EFAVPKLDSPDHGYIVPNVDLPPLCSYRFRPGPPGEQAQVCSQYLADIIKSCNLINLKDL  120

Query  548   CLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkkn  727
             C+   K AW+ Y+D+ CLD DG + DA++++ +AA    + P   ++++           
Sbjct  121   CIVKEKLAWVIYIDLLCLDCDGNVLDASVIAMLAALRSAKFPKVEIDEE-----------  169

Query  728   knevpepenepvtkeekRKLHLNSVPFSLSCVLH-KNYILADPTAEEESVMETVLNVVLD  904
                    +   V+K+E   L++N  P S + VL  KN ILADPT+EEE++    L + ++
Sbjct  170   ------VDKPIVSKDESFSLNVNDCPISSTFVLFDKNLILADPTSEEENLSSGYLTITVN  223

Query  905   SSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSE  1030
             +   L ++ KPGG  +     + +C+ L  +R   ++++LS+
Sbjct  224   NDDGLSNVLKPGGRGVNDAE-LNECITLAIKRARDMRDLLSK  264



>ref|XP_534492.2| PREDICTED: exosome complex component RRP43 isoformX1 [Canis lupus 
familiaris]
Length=276

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK +W+ Y DI CLD DG + DA   + +AA  + ++P  ++N++  +       
Sbjct  124   LCISPGKLSWVLYCDIICLDYDGNILDACTFALLAALKNAQLPEVTINEETGLA------  177

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  178   -------------EVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_003512044.2| PREDICTED: exosome complex component RRP43 isoform X1 [Cricetulus 
griseus]
 ref|XP_007630919.1| PREDICTED: exosome complex component RRP43 isoform X3 [Cricetulus 
griseus]
 gb|ERE89686.1| exosome complex component RRP43-like protein [Cricetulus griseus]
Length=276

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 163/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD G +     +PP+CSS  R G P E A V S+ ++D + +S +I  ++
Sbjct  64    AEFAAPPLDAPDRGYVVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVLENSQIIKKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSYLNVRTNPVATSFAVFDDTLLIVDPTGEEEHLSTGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L SL+KPGG  L     +QDC++    R  ++  +L E I  M
Sbjct  225   VMDEEGKLCSLHKPGGSGLTGAK-LQDCMSRAVSRHKEVNKLLDEVIQSM  273



>ref|XP_004886213.1| PREDICTED: exosome complex component RRP43 isoform X1 [Heterocephalus 
glaber]
Length=310

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  38    GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  97

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  98    AEFAVPPKDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  157

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++SGK AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++          
Sbjct  158   LCISSGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVCINEE----------  207

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  208   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLMVDPTGEEEHLATGSLTV  258

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  259   VMDEEGRLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  307



>ref|XP_006154251.1| PREDICTED: exosome complex component RRP43 [Tupaia chinensis]
Length=276

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+P++G I     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDTPNKGYIVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKELMDEVIKSM  273



>ref|XP_005646128.1| 3'-5'-exoribonuclease/RNA binding-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21584.1| 3'-5'-exoribonuclease/RNA binding-like protein [Coccomyxa subellipsoidea 
C-169]
Length=293

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 184/297 (62%), Gaps = 14/297 (5%)
 Frame = +2

Query  164   SSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGST  343
             S++++ +AF+RL+P  ++ +++ +S+RPDGR LG AR TT+ +  + S   SALVKIG+T
Sbjct  9     SNELQAEAFKRLYPNEYYAKFISKSLRPDGRPLGGARATTIGIHPLESTSSSALVKIGNT  68

Query  344   TMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASS  523
             T +A IK++    S+D P EG++AV   M    SS  RPGRP++AA  + +Q+   + ++
Sbjct  69    TAMAGIKLQHFAISSDQPVEGTLAVNMEMAAFASSETRPGRPSDAAQCVQEQIRTALRTA  128

Query  524   GMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRV  703
             G + L+EL +     AW  +LDIY LDADG L D  LL+AVAA   L++P   +ND G+V
Sbjct  129   GAVKLEELAIDKSH-AWAVFLDIYVLDADGCLLDVCLLAAVAALLGLQLPRVEVNDQGQV  187

Query  704   VLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMET  883
             V              +    +  + R+  L +VP +L+C L+   ++ADPT+EEE+++ +
Sbjct  188   V-------------TKPISGSASDSRRFGLKAVPMALTCGLYSGSLIADPTSEEEALVAS  234

Query  884   VLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
             +++ ++D+S  LV LYK GG A A   ++  C+  TK R  +L  +L +A+++  ++
Sbjct  235   LVSTIVDASGSLVGLYKAGGHATADEGLLLQCMEATKLRYKELMILLKQALAEKGIE  291



>ref|XP_006977629.1| PREDICTED: exosome complex component RRP43 [Peromyscus maniculatus 
bairdii]
Length=276

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 163/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G I     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPLDAPDKGYIVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVIENSQIIKKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSYLNVRTNPVATSFAVFDDTLLIVDPTGEEEHLSTGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++  +L E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVNKLLDEVIQSM  273



>ref|XP_004577581.1| PREDICTED: exosome complex component RRP43 [Ochotona princeps]
Length=276

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 165/288 (57%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL +H R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYHRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVVCGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  DSPD+G +     +PP+CSS  R G P E A V S+ ++D + +S +I  ++
Sbjct  64    AEFAAPPTDSPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVVENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  +++  L++ + P + S  V     ++ DPT EEE +    L VV+
Sbjct  174   -------TGLAEVNLQKRSFLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGSLTVVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  +
Sbjct  227   DEDGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIQSI  273



>ref|XP_004711301.1| PREDICTED: exosome complex component RRP43 [Echinops telfairi]
Length=276

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 163/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSITTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CS   R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSPRFRSGPPGEDAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  +++++          
Sbjct  124   LCISQGKLAWVLYCDLLCLDYDGNILDACTFALLAALKNVQLPEVTISEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K++ HLN    P + S  +     ++ DPT EEE +    L +
Sbjct  174   ---------TALAKVNLKKRSHLNIRHYPVATSFAIFDDTLLIVDPTGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L SL+KPGG  L  T  +QDC++    R  ++K ++ E I  +
Sbjct  225   VMDEEGKLCSLHKPGGSGLTGTK-LQDCLSRAVTRHKEVKKLMDEVIQSI  273



>ref|XP_005344037.1| PREDICTED: exosome complex component RRP43 isoform X2 [Microtus 
ochrogaster]
Length=276

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/290 (36%), Positives = 162/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTIVCGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPLDAPDRGYVVPNVDLPPLCSSRFRTGPPGEEAQVASQFIADVIENSQIIKKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSYLNVRTTPVATSFAVFDDTLLIVDPTGEEEHLSTGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++  +L E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVNKLLDEVIQSM  273



>ref|XP_008845351.1| PREDICTED: exosome complex component RRP43 [Nannospalax galili]
Length=282

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/285 (37%), Positives = 163/285 (57%), Gaps = 23/285 (8%)
 Frame = +2

Query  203   PLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVEVMTP  382
             PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K E  TP
Sbjct  16    PLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFATP  75

Query  383   SADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASG  562
             S D+P +G I     +PP+CSS  R G P E A V S+ ++D I +S +I  ++LC++ G
Sbjct  76    STDAPAKGYIVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVIENSQIIKKEDLCISPG  135

Query  563   KAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevp  742
             K AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++                
Sbjct  136   KLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------------  179

Query  743   epenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVLDSSY  913
                        K+K +LN  + P + S  V     ++ DPT EEE +    L VV++   
Sbjct  180   ---TALAEVNLKKKSYLNIRTNPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVMNEHG  236

Query  914   QLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMD  1048
             +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M+
Sbjct  237   KLCCLHKPGGSGLTGAK-LQDCMSRAVTRQKEVKKLMDEVIKSMN  280



>ref|XP_008158328.1| PREDICTED: exosome complex component RRP43 [Eptesicus fuscus]
Length=276

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 163/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GSV++ADGSALVK+G+T ++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSVSTADGSALVKLGNTAVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPPDTPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIPKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCLSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_006232394.1| PREDICTED: exosome complex component RRP43 isoform X1 [Rattus 
norvegicus]
 gb|EDM14921.1| exosome component 8 (predicted), isoform CRA_a [Rattus norvegicus]
Length=276

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 162/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPVDAPDRGYVVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVIENSQIIKKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  174   ---------TALAEVNLKKKSYLNVRANPVATSFAVFDDTLLIVDPTGEEEHLSTGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++  +L E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVSKLLDEVIQSM  273



>ref|XP_522661.2| PREDICTED: exosome complex component RRP43 isoform X2 [Pan troglodytes]
 ref|XP_003826944.1| PREDICTED: exosome complex component RRP43 isoform X2 [Pan paniscus]
Length=276

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 163/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK  W+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_003934463.1| PREDICTED: exosome complex component RRP43 [Saimiri boliviensis 
boliviensis]
Length=276

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAVPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  +
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSI  273



>ref|XP_004854779.1| PREDICTED: exosome complex component RRP43 isoform X3 [Heterocephalus 
glaber]
Length=278

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/284 (37%), Positives = 161/284 (57%), Gaps = 23/284 (8%)
 Frame = +2

Query  203   PLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVEVMTP  382
             PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K E   P
Sbjct  12    PLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAVP  71

Query  383   SADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASG  562
               D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++LC++SG
Sbjct  72    PKDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISSG  131

Query  563   KAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevp  742
             K AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++                
Sbjct  132   KLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVCINEE----------------  175

Query  743   epenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVLDSSY  913
                        K+K +LN  + P + S  V     ++ DPT EEE +    L VV+D   
Sbjct  176   ---TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLMVDPTGEEEHLATGALTVVMDEEG  232

Query  914   QLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  233   RLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  275



>ref|XP_008583528.1| PREDICTED: exosome complex component RRP43 isoform X2 [Galeopterus 
variegatus]
Length=276

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/290 (36%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRPTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P AD+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPADAPDKGFVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DP  EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSYLNVRTHPVATSFAVFDDTLLIVDPAGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDDEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_004435395.1| PREDICTED: exosome complex component RRP43 [Ceratotherium simum 
simum]
Length=276

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 165/288 (57%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S ++  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQVLQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++K  L++ + P + S  V     ++ DPT EEE +    L VV+
Sbjct  174   -------TALAEVNLKKKSFLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E +  M
Sbjct  227   DEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVMKSM  273



>ref|XP_004657185.1| PREDICTED: exosome complex component RRP43-like [Jaculus jaculus]
Length=276

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 165/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +G +++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGYISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E  TP  D+PD+G I     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFATPPTDAPDKGYIVPNVDLPPLCSSRFRAGPPGEEAQVTSQFIADVIENSQVIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA   +++   ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKDVQLLEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     +L DPTAEEE +    L V
Sbjct  174   ---------TALAEVNLKKKSYLNIGTHPVATSFAVFDDTLLLVDPTAEEEHLAAGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L + + +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEKGRLCCLHKPGGSGL-NGAKLQDCMSRAVTRHKEVKKLMEEVIKSM  273



>ref|XP_005808491.1| PREDICTED: exosome complex component RRP43-like [Xiphophorus 
maculatus]
Length=277

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/285 (38%), Positives = 167/285 (59%), Gaps = 19/285 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+   PL +H  +L E+ RPDGR L E R TT+ +GS+++ADGSALVKIG+TT++  IK
Sbjct  4     GFKIAEPLEYHRSFLKENCRPDGRELSEFRTTTLNIGSISTADGSALVKIGNTTIICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P+AD+P +G I     +PP+CSS  RPG P E A   S+ ++D I SS +I  ++
Sbjct  64    AELANPTADAPGKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIESSEVIKAED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK  W+ Y DI CLD DG + DA +++ +AA  + ++P  ++N +          
Sbjct  124   LCVDRGKLCWVLYCDIMCLDYDGNILDACIIALLAALKNTQLPEVTVNKE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                      +  V  E++++L ++  P S S CV   + ++ DPTAEEES+    L VV 
Sbjct  174   -------TCSPEVNLEKRQRLRIHKHPASASFCVFDDSILIVDPTAEEESLSTAHLTVVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAI  1036
             D   +L S++KPGG +L S   +QDC+     R  ++  ++ + +
Sbjct  227   DEEGRLCSVHKPGGSSL-SREKLQDCITRATARQREIHKLIDKVL  270



>ref|XP_005635498.1| PREDICTED: exosome complex component RRP43 isoform X3 [Canis 
lupus familiaris]
Length=279

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 163/288 (57%), Gaps = 23/288 (8%)
 Frame = +2

Query  191   RRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVE  370
             R + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK E
Sbjct  9     RTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIKAE  68

Query  371   VMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELC  550
                P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++LC
Sbjct  69    FAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLC  128

Query  551   LASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknk  730
             ++ GK +W+ Y DI CLD DG + DA   + +AA  + ++P  ++N++  +         
Sbjct  129   ISPGKLSWVLYCDIICLDYDGNILDACTFALLAALKNAQLPEVTINEETGLA--------  180

Query  731   nevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                            K+K +LN  + P + S  V     ++ DPT EEE +    L VV+
Sbjct  181   -----------EVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVM  229

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  230   DEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  276



>gb|EDL35278.1| exosome component 8, isoform CRA_f [Mus musculus]
Length=283

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 164/297 (55%), Gaps = 27/297 (9%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              FR + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  11    CFRTVEPLEYYRRFLKENCRPDGRELGEFRATTVNIGSISTADGSALVKLGNTTVICGVK  70

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD G +     +PP+CSS  R G P E A V S+ ++D + +S +I  ++
Sbjct  71    AEFAAPPVDAPDRGYVVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVVDNSQVIKKED  130

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  131   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  180

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  181   ---------TALAEVNLKKKSYLNVRTNPVATSFAVFDDTLLIVDPTGEEEHLSTGTLTV  231

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD*RHR  1066
             V D   +L  L+KPGG  L     +QDC++    R  ++  +L E I  M    RH+
Sbjct  232   VTDEDGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVSKLLDEVIQSM----RHK  283



>ref|XP_002824217.1| PREDICTED: exosome complex component RRP43 [Pongo abelii]
Length=276

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 163/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNVGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDTGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK  W+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSYLNVRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I+ M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVINSM  273



>ref|XP_004886215.1| PREDICTED: exosome complex component RRP43 isoform X3 [Heterocephalus 
glaber]
Length=278

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 105/284 (37%), Positives = 161/284 (57%), Gaps = 23/284 (8%)
 Frame = +2

Query  203   PLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVEVMTP  382
             PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K E   P
Sbjct  12    PLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAVP  71

Query  383   SADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASG  562
               D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++LC++SG
Sbjct  72    PKDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISSG  131

Query  563   KAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevp  742
             K AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++                
Sbjct  132   KLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVCINEE----------------  175

Query  743   epenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVLDSSY  913
                        K+K +LN  + P + S  V     ++ DPT EEE +    L VV+D   
Sbjct  176   ---TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLMVDPTGEEEHLATGSLTVVMDEEG  232

Query  914   QLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  233   RLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  275



>ref|XP_005877028.1| PREDICTED: exosome complex component RRP43 [Myotis brandtii]
Length=276

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 163/288 (57%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ R DGR LGE R TTV +GSV++ADGSALVK+G+T ++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRADGRELGEFRTTTVNIGSVSTADGSALVKLGNTAVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPPDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIPKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                            ++KR L++ + P + S  V     ++ DPT EEE +    L VV+
Sbjct  174   -------TALAEANLKKKRYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  227   DEEGKLCCLHKPGGSGLTGAK-LQDCLSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_010381377.1| PREDICTED: exosome complex component RRP43 [Rhinopithecus roxellana]
Length=276

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 163/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CS   R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSWRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|XP_002749024.2| PREDICTED: exosome complex component RRP43 [Callithrix jacchus]
 ref|XP_008996408.1| PREDICTED: exosome complex component RRP43 [Callithrix jacchus]
Length=300

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 162/288 (56%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  28    GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  87

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  88    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  147

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N  G   L     
Sbjct  148   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTIN--GETALAEVNL  205

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
              K                  L++ + P + S  V     ++ DPT EEE +    L +V+
Sbjct  206   KKKSY---------------LNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIVM  250

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  +
Sbjct  251   DEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSI  297



>ref|XP_001495596.1| PREDICTED: exosome complex component RRP43 [Equus caballus]
 ref|XP_008528928.1| PREDICTED: exosome complex component RRP43 [Equus przewalskii]
Length=276

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 165/288 (57%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  +++++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTISEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++K  L++ + P + S  V     ++ DPT EEE +    L VV+
Sbjct  174   -------TALAEVNLKKKSFLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E +  M
Sbjct  227   DEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVVKSM  273



>ref|NP_081424.3| exosome complex component RRP43 isoform 2 [Mus musculus]
 sp|Q9D753.1|EXOS8_MOUSE RecName: Full=Exosome complex component RRP43; AltName: Full=Exosome 
component 8; AltName: Full=Ribosomal RNA-processing 
protein 43 [Mus musculus]
 emb|CAD43467.1| CBP-interacting protein 3 [Mus musculus]
 gb|EDL35276.1| exosome component 8, isoform CRA_d [Mus musculus]
Length=276

 Score =   180 bits (456),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 106/297 (36%), Positives = 164/297 (55%), Gaps = 27/297 (9%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRATTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD G +     +PP+CSS  R G P E A V S+ ++D + +S +I  ++
Sbjct  64    AEFAAPPVDAPDRGYVVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVVDNSQVIKKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  174   ---------TALAEVNLKKKSYLNVRTNPVATSFAVFDDTLLIVDPTGEEEHLSTGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD*RHR  1066
             V D   +L  L+KPGG  L     +QDC++    R  ++  +L E I  M    RH+
Sbjct  225   VTDEDGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVSKLLDEVIQSM----RHK  276



>ref|XP_007555234.1| PREDICTED: exosome complex component RRP43 isoform X2 [Poecilia 
formosa]
Length=277

 Score =   179 bits (455),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 168/285 (59%), Gaps = 19/285 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+   PL +H  +L E+ RPDGR L E R TT+ +GS+++ADGSALVKIG+TT++  IK
Sbjct  4     GFKIAEPLEYHRSFLKENCRPDGRGLSEFRTTTLNVGSISTADGSALVKIGNTTIICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P+A++P +G I     +PP+CSS  RPG P E A   S+ ++D I SS +I  ++
Sbjct  64    AELANPTAEAPGKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIESSEVIKAED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK  W+ Y DI CLD DG + DA +++ +AA  + ++P  ++N +          
Sbjct  124   LCVDRGKLCWVLYCDIMCLDYDGNILDACIIALLAALKNTQLPEVTVNKE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                      +  V  E++++LH++  P S S CV   + ++ DPTAEEES+    L VV 
Sbjct  174   -------TCSPEVNLEKRQRLHIHKHPASASFCVFDDSILIVDPTAEEESLSTAHLTVVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAI  1036
             D   +L S++KPGG +L S   +Q+C+     R  ++  ++ + +
Sbjct  227   DEGGRLCSVHKPGGTSL-SGQKLQECINRATARQREIHKLIDKVL  270



>ref|XP_005906823.1| PREDICTED: exosome complex component RRP43 [Bos mutus]
 ref|XP_010833933.1| PREDICTED: exosome complex component RRP43 [Bison bison bison]
Length=276

 Score =   179 bits (455),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 104/290 (36%), Positives = 162/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNVGSIGTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     + P+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFGAPPTDAPDKGYVVPNVDLSPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++SGK AW+ Y D+ CL+ DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISSGKLAWVLYCDLICLNHDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTEEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E    M
Sbjct  225   VMDEEGRLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVFKSM  273



>ref|XP_005635497.1| PREDICTED: exosome complex component RRP43 isoform X2 [Canis 
lupus familiaris]
Length=308

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 163/288 (57%), Gaps = 23/288 (8%)
 Frame = +2

Query  191   RRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVE  370
             R + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK E
Sbjct  38    RTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIKAE  97

Query  371   VMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELC  550
                P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++LC
Sbjct  98    FAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLC  157

Query  551   LASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknk  730
             ++ GK +W+ Y DI CLD DG + DA   + +AA  + ++P  ++N++  +         
Sbjct  158   ISPGKLSWVLYCDIICLDYDGNILDACTFALLAALKNAQLPEVTINEETGLA--------  209

Query  731   nevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                            K+K +LN  + P + S  V     ++ DPT EEE +    L VV+
Sbjct  210   -----------EVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVM  258

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  259   DEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  305



>ref|XP_002733208.1| PREDICTED: exosome complex component RRP43-like [Saccoglossus 
kowalevskii]
Length=275

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 172/288 (60%), Gaps = 19/288 (7%)
 Frame = +2

Query  188   FRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKV  367
             F+   P+ ++ ++L + +RPDGR LGE R T V +GS+++A+GSALVK+G+TT++  IK 
Sbjct  5     FKTAQPVEYYRQFLKKDVRPDGRELGEIRSTIVNIGSISTAEGSALVKLGNTTVICGIKA  64

Query  368   EVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKEL  547
             E+ TP+ D P +G +     +PP+CS   RPG P+E A V+S+ ++D +  S M++ ++L
Sbjct  65    ELCTPTNDEPKKGFVVPNVDLPPLCSPRFRPGPPSEQAQVVSQFIADVLKDSKMVNHEDL  124

Query  548   CLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkkn  727
             C+A GK  W+ Y D+ CLD DG + DA ++S +AA  ++ +P   ++++           
Sbjct  125   CIAEGKIVWVLYCDMMCLDYDGNVIDACIISLLAALRNVALPSIEVDEE-----------  173

Query  728   knevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYIL-ADPTAEEESVMETVLNVVLD  904
                        +T      + + S+P S S  +  N IL ADPT EEE++   V+ VV +
Sbjct  174   ------TAKPKLTSSTSSTMTVQSLPVSTSFAIFDNSILIADPTNEEENLATGVVTVVTN  227

Query  905   SSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMD  1048
                +L +L+KPGG +L S S IQ+CV  +  R ++++ +L E  + +D
Sbjct  228   ECGELCALHKPGGSSL-SESQIQECVKRSFSRGDEIRKLLDETFNSLD  274



>ref|XP_004054442.1| PREDICTED: exosome complex component RRP43 [Gorilla gorilla gorilla]
Length=276

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 162/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK  W+ Y D+ CLD DG + DA   + +AA  ++++P   +N++          
Sbjct  124   LCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVIINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>gb|AAH59089.1| Exosome component 8 [Mus musculus]
Length=276

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/297 (36%), Positives = 164/297 (55%), Gaps = 27/297 (9%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRATTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD G +     +PP+CSS  R G P E A V S+ ++D + +S +I  ++
Sbjct  64    AEFAAPPVDAPDRGYVVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVVDNSQVIKKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  174   ---------TALAEVNLKKKSYLNVRTNPVAASFAVFDDTLLIVDPTGEEEHLSTGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD*RHR  1066
             V D   +L  L+KPGG  L     +QDC++    R  ++  +L E I  M    RH+
Sbjct  225   VTDEDGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVSKLLDEVIQSM----RHK  276



>ref|XP_007555095.1| PREDICTED: exosome complex component RRP43-like [Poecilia formosa]
Length=277

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 168/285 (59%), Gaps = 19/285 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+   PL +H  +L E+ RPDGR L E R TT+ +GS+++ADGSALVKIG+TT++  IK
Sbjct  4     GFKIAEPLEYHRSFLKENCRPDGRGLSEFRTTTLNVGSISTADGSALVKIGNTTIICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P+A++P +G I     +PP+CSS  RPG P E A   S+ ++D I SS +I  ++
Sbjct  64    AELANPTAEAPGKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIESSEVIKAED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK  W+ Y DI CLD DG + DA +++ +AA  + ++P  ++N +          
Sbjct  124   LCVDRGKLCWVLYCDIMCLDYDGNILDACIIALLAALKNTQLPEVTVNKE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                      +  V  E++++LH++  P S S CV   + ++ DPTAEEES+    L VV 
Sbjct  174   -------TCSPEVNLEKRQRLHIHKHPASASFCVFDDSILIVDPTAEEESLSTAHLTVVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAI  1036
             D   +L S++KPGG +L S   +Q+C+     R  ++  ++ + +
Sbjct  227   DEGGRLCSVHKPGGTSL-SGEKLQECINRATARQREIHKLIDKVL  270



>ref|XP_004770813.1| PREDICTED: exosome complex component RRP43 isoform X1 [Mustela 
putorius furo]
 ref|XP_004802242.1| PREDICTED: exosome complex component RRP43 isoform X1 [Mustela 
putorius furo]
Length=299

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/284 (37%), Positives = 162/284 (57%), Gaps = 23/284 (8%)
 Frame = +2

Query  203   PLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVEVMTP  382
             PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK E   P
Sbjct  33    PLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIKAEFAAP  92

Query  383   SADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASG  562
               D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++LC++ G
Sbjct  93    PTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISPG  152

Query  563   KAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevp  742
             K +W+ Y DI CLD DG + DA   + +AA  ++++P  ++N++  +             
Sbjct  153   KLSWVLYCDIICLDYDGNILDACTFALLAALKNVQLPEVTINEETGLA------------  200

Query  743   epenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVLDSSY  913
                        K+K +LN  + P + S  V     ++ DPT EEE +    L VV+D   
Sbjct  201   -------EVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVMDEEG  253

Query  914   QLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  254   KLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  296



>ref|XP_007526590.1| PREDICTED: exosome complex component RRP43 [Erinaceus europaeus]
Length=276

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+P +G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAVPPTDTPTKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D + +L  L+KPGG  L     +QDC++    R  ++K ++ E I  +
Sbjct  225   VMDEAGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSI  273



>ref|XP_007555228.1| PREDICTED: exosome complex component RRP43 isoform X1 [Poecilia 
formosa]
Length=277

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 168/285 (59%), Gaps = 19/285 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+   PL +H  +L E+ RPDGR L E R TT+ +GS+++ADGSALVKIG+TT++  IK
Sbjct  4     GFKIAEPLEYHRSFLKENCRPDGRELSEFRTTTLNVGSISTADGSALVKIGNTTIICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P+A++P +G I     +PP+CSS  RPG P E A   S+ ++D I SS +I  ++
Sbjct  64    AELANPTAEAPGKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIESSEVIKAED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK  W+ Y DI CLD DG + DA +++ +AA  + ++P  ++N +          
Sbjct  124   LCVDRGKLCWVLYCDIMCLDYDGNILDACIIALLAALKNTQLPEVTVNKE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                      +  V  E++++LH++  P S S CV   + ++ DPTAEEES+    L VV 
Sbjct  174   -------TCSPEVNLEKRQRLHIHKHPASASFCVFDDSILIVDPTAEEESLSTAHLTVVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAI  1036
             D   +L S++KPGG +L S   +Q+C+     R  ++  ++ + +
Sbjct  227   DEGGRLCSVHKPGGTSL-SGQKLQECINRATARQREIHKLIDKVL  270



>ref|XP_006182701.1| PREDICTED: exosome complex component RRP43 [Camelus ferus]
 ref|XP_006210174.1| PREDICTED: exosome complex component RRP43 [Vicugna pacos]
 ref|XP_010949787.1| PREDICTED: exosome complex component RRP43 [Camelus bactrianus]
 ref|XP_010992184.1| PREDICTED: exosome complex component RRP43 [Camelus dromedarius]
Length=276

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 161/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGS+LV++G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSIGTADGSSLVRLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P AD+PD+G +     + P+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFGAPPADAPDKGYVVPNVDLSPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CL+ DG + DA   + +AA  ++ +P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLNHDGNILDACTFALLAALKNVRLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K HLN  + P + S  V     ++ DPT EEE +    L V
Sbjct  174   ---------TALAEVNFKKKSHLNIRTHPVATSFAVFDDTLLIVDPTEEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E    M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVFKSM  273



>ref|XP_001368047.1| PREDICTED: exosome complex component RRP43 [Monodelphis domestica]
Length=276

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 161/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSITTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  DS ++G I     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    GEFAAPPVDSLNKGYIVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++          
Sbjct  124   LCISHGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPAVIINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K HLN  + P + S  +     ++ DPT EEE +    L V
Sbjct  174   ---------TGLAEVNLKKKSHLNIRTHPIATSFAIFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  273



>ref|NP_001073074.1| exosome complex component RRP43 [Bos taurus]
 sp|Q2KHU3.1|EXOS8_BOVIN RecName: Full=Exosome complex component RRP43; AltName: Full=Exosome 
component 8; AltName: Full=Ribosomal RNA-processing 
protein 43 [Bos taurus]
 gb|AAI12882.1| Exosome component 8 [Bos taurus]
 tpg|DAA23940.1| TPA: exosome complex exonuclease RRP43 [Bos taurus]
Length=276

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 163/288 (57%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNVGSIGTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     + P+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFGAPPTDAPDKGYVVPNVDLSPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++SGK AW+ Y D+ CL+ DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISSGKLAWVLYCDLICLNHDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++K  L++ + P + S  V     ++ DPT EEE +    L VV+
Sbjct  174   -------TALAEVNLKKKSCLNIRTHPVATSFAVFDDTLLIVDPTEEEEHLATGTLTVVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E    M
Sbjct  227   DEEGRLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVFKSM  273



>ref|XP_008425514.1| PREDICTED: exosome complex component RRP43 [Poecilia reticulata]
Length=277

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 167/285 (59%), Gaps = 19/285 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+   PL +H  +L E+ RPDGR L E R TT+ +GS+++ADGSALVKIG+TT++  IK
Sbjct  4     GFKIAEPLEYHRSFLKENCRPDGRELSEFRTTTLNVGSISTADGSALVKIGNTTIICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P+A++P +G I     +PP+CSS  RPG P E A   S+ ++D I SS +I  ++
Sbjct  64    AELANPTAEAPGKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIESSEVIKAED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK  W+ Y DI CLD DG + DA +++ +AA  + ++P  ++N +          
Sbjct  124   LCVDRGKLCWVIYCDIMCLDYDGNILDACIIALLAALKNTQLPEVTVNKE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                      +  V  E++++LH++  P S S CV   + ++ DPTAEEES+    L VV 
Sbjct  174   -------TCSPEVNLEKRQRLHIHKHPASASFCVFDDSILIVDPTAEEESLSTAHLTVVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAI  1036
             D   +L S++KPGG +L S   +Q C+     R  ++  ++ + +
Sbjct  227   DEGGRLCSVHKPGGTSL-SGEKLQQCINRATARQREIHKLIDKVL  270



>ref|XP_005007102.1| PREDICTED: exosome complex component RRP43 isoform X2 [Cavia 
porcellus]
Length=280

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 107/294 (36%), Positives = 164/294 (56%), Gaps = 27/294 (9%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAV----EFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMI  532
              E   P AD+PD+G +         +PP+CSS  R G P E A V S+ ++D I +S +I
Sbjct  64    AEFAVPPADAPDKGYVVFLSVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQII  123

Query  533   DLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLG  712
               ++LC++SGK AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++      
Sbjct  124   QKEDLCISSGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVRINEE------  177

Query  713   tkkknknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMET  883
                                  K+K +LN  + P + S  V     ++ DPT EEE +   
Sbjct  178   -------------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATG  224

Query  884   VLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
              L VV++   +L  L+KPGG  L     +QDC+     R  ++K ++ E I  M
Sbjct  225   TLTVVMNEEGRLCCLHKPGGSGLTGPK-LQDCMGRAVTRHKEVKKLMDEVIRSM  277



>ref|XP_008302217.1| PREDICTED: exosome complex component RRP43 [Stegastes partitus]
Length=277

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 166/285 (58%), Gaps = 19/285 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+   PL +H  +L E+ RPDGR L E+R TT+ +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTAEPLEYHRSFLKENCRPDGRELSESRTTTLNIGSISTADGSALVKMGNTTIICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P+ ++P +G I     +PP+CSS  RPG P E A   S+ ++D I SS +I  ++
Sbjct  64    AELANPTVEAPGKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIESSEVIKTED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK  W+ Y D+ CLD DG + DA +++ +AA  + ++P  ++N +          
Sbjct  124   LCIDRGKLCWVLYCDMMCLDYDGNILDACIIALLAALKNTQLPEVTINKE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  E++  LH++  P   S CV   + ++ DPTAEEES+    L VV 
Sbjct  174   -------TCAPEVNPEKRCGLHIHKHPVGASFCVFDDSILIVDPTAEEESLSTAQLTVVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAI  1036
             D   +L SL+KPGG +L S   +Q+C++    R  +++ ++ + I
Sbjct  227   DEEGRLCSLHKPGGTSL-SGEKLQECISRATARQREIQKLIDKVI  270



>ref|XP_005387721.1| PREDICTED: exosome complex component RRP43 isoform X1 [Chinchilla 
lanigera]
Length=280

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 164/294 (56%), Gaps = 27/294 (9%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAV----EFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMI  532
              E   P  D+PD+G +         +PP+CSS  R G P E A V S+ ++D I +S +I
Sbjct  64    AEFAVPPTDAPDKGYVVFLSVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQII  123

Query  533   DLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLG  712
               ++LC++SGK AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++      
Sbjct  124   QKEDLCISSGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVRINEE------  177

Query  713   tkkknknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMET  883
                                  K+K +LN  + P + S  V     ++ DPT EEE +   
Sbjct  178   -------------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATG  224

Query  884   VLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
              L VV+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   TLTVVMDEEGRLSCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  277



>ref|XP_007128934.1| PREDICTED: exosome complex component RRP43 [Physeter catodon]
Length=276

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 163/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGS+LVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSIGTADGSSLVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     + P+CS   R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFGAPPTDAPDKGYVVPNVDLSPLCSWRFRSGPPGEEAQVASQFIADVIENSQVIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CL+ DG + DA   + +AAF ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLNHDGNILDACTFALLAAFKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE++    L V
Sbjct  174   ---------TALAEVNLKKKSYLNVRTHPVATSFAVFDDTLLIVDPTEEEENLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L +   +QDC++    R  ++K ++ E    M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTAAK-LQDCMSRAVTRHKEVKKLMDEVFKSM  273



>ref|XP_004854778.1| PREDICTED: exosome complex component RRP43 isoform X2 [Heterocephalus 
glaber]
Length=314

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 164/294 (56%), Gaps = 27/294 (9%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  38    GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  97

Query  365   VEVMTPSADSPDEGSIAV----EFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMI  532
              E   P  D+PD+G +         +PP+CSS  R G P E A V S+ ++D I +S +I
Sbjct  98    AEFAVPPKDAPDKGYVVFLSVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQII  157

Query  533   DLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLG  712
               ++LC++SGK AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++      
Sbjct  158   QKEDLCISSGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVCINEE------  211

Query  713   tkkknknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMET  883
                                  K+K +LN  + P + S  V     ++ DPT EEE +   
Sbjct  212   -------------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLMVDPTGEEEHLATG  258

Query  884   VLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
              L VV+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  259   ALTVVMDEEGRLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  311



>gb|KFW78516.1| Exosome complex component RRP43, partial [Phalacrocorax carbo]
Length=272

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/287 (36%), Positives = 165/287 (57%), Gaps = 19/287 (7%)
 Frame = +2

Query  188   FRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKV  367
             FR + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  +K 
Sbjct  1     FRTVEPLEYYRRFLKENCRPDGRELGEFRATTVNIGSITTADGSALVKLGNTTVICGVKA  60

Query  368   EVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKEL  547
             E+  P+ADS ++G I     +P +CS+  R G P E A  +S+ ++D I +S MI  ++L
Sbjct  61    ELAAPAADSANKGYIVPNVELPSLCSTRFRSGPPGEEAQAVSQFIADVIENSQMIAKEDL  120

Query  548   CLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkkn  727
             C+A+GK AW+ Y DI CLD DG + DA+  + +AA  ++++P  +LN++           
Sbjct  121   CIANGKLAWVLYCDIICLDYDGNILDASTFALLAALKNVQLPSVTLNEE-----------  169

Query  728   knevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVLD  904
                        V  ++K  L +   P + S  +     ++ DPTAEEE +    + +V D
Sbjct  170   ------TGLSEVNLKQKNPLTIRKHPVATSFAIFDDTLLIVDPTAEEEDLATGTVTIVTD  223

Query  905   SSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
                +L S++KPGG  L     +QDC+     R  ++K ++ + I  +
Sbjct  224   DEGRLCSVHKPGGSPLTGAK-LQDCITRAITRHKEVKKLIDKVIKSI  269



>ref|XP_003764575.1| PREDICTED: exosome complex component RRP43 [Sarcophilus harrisii]
Length=276

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 102/287 (36%), Positives = 161/287 (56%), Gaps = 23/287 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TT+ +GS+ +ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTINIGSITTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  DS ++G I     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPVDSLNKGYIVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++  +       
Sbjct  124   LCISHGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPAVTINEETGLA------  177

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K HLN  + P + S  +     ++ DPT EEE +    L V
Sbjct  178   -------------EVNFKKKSHLNIRTHPIATSFAIFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAI  1036
             V+D   +L  L+KPGG  L     +QDC++    R  ++  ++ E I
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEINKLMDEVI  270



>ref|XP_009684893.1| PREDICTED: exosome complex component RRP43 [Struthio camelus 
australis]
Length=368

 Score =   180 bits (457),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 106/291 (36%), Positives = 167/291 (57%), Gaps = 19/291 (7%)
 Frame = +2

Query  176   ELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLA  355
             E    R + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++ 
Sbjct  93    ETGCSRTVEPLEYYRRFLKENCRPDGRELGEFRATTVNIGSITTADGSALVKLGNTTVIC  152

Query  356   AIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMID  535
              +K E+ TP  DSP++G I     +P +CS+  RPG P E A   S+ ++D I +S +I+
Sbjct  153   GVKAELATPPVDSPNKGYIVPNVELPSLCSTRFRPGPPGEEAQAASQFIADVIENSQIIE  212

Query  536   LKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGt  715
              ++LC+A+GK AW+ Y DI CLD DG + DA+  + +AA  ++++P  ++N++  +    
Sbjct  213   KEDLCIANGKLAWVLYCDIICLDYDGNVLDASTFALLAALKNVQLPAVTVNEETGL----  268

Query  716   kkknknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLN  892
                            V  ++K  L +   P + S  V     ++ DPTAEEE +    + 
Sbjct  269   -------------SEVNLKQKNPLIIRKHPVATSFAVFDDTLLIVDPTAEEEDLATGTVT  315

Query  893   VVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             VV D   +L S++KPGG  L     +QDC+     R  ++K ++ + I  M
Sbjct  316   VVTDEEGRLCSVHKPGGSPLTGAK-LQDCITRAVTRHKEVKKLIDKVIKSM  365



>dbj|BAD90152.1| mKIAA4013 protein [Mus musculus]
Length=308

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 106/297 (36%), Positives = 164/297 (55%), Gaps = 27/297 (9%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  36    GFKTVEPLEYYRRFLKENCRPDGRELGEFRATTVNIGSISTADGSALVKLGNTTVICGVK  95

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD G +     +PP+CSS  R G P E A V S+ ++D + +S +I  ++
Sbjct  96    AEFAAPPVDAPDRGYVVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVVDNSQVIKKED  155

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  156   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  205

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  206   ---------TALAEVNLKKKSYLNVRTNPVATSFAVFDDTLLIVDPTGEEEHLSTGTLTV  256

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD*RHR  1066
             V D   +L  L+KPGG  L     +QDC++    R  ++  +L E I  M    RH+
Sbjct  257   VTDEDGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVSKLLDEVIQSM----RHK  308



>ref|XP_008583527.1| PREDICTED: exosome complex component RRP43 isoform X1 [Galeopterus 
variegatus]
Length=280

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 161/284 (57%), Gaps = 23/284 (8%)
 Frame = +2

Query  203   PLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVEVMTP  382
             PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K E   P
Sbjct  14    PLEYYRRFLKENCRPDGRELGEFRPTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAP  73

Query  383   SADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASG  562
              AD+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++LC++ G
Sbjct  74    PADAPDKGFVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISPG  133

Query  563   KAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevp  742
             K AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++                
Sbjct  134   KLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------------  177

Query  743   epenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVLDSSY  913
                        K+K +LN  + P + S  V     ++ DP  EEE +    L +V+D   
Sbjct  178   ---TALAEVNLKKKSYLNVRTHPVATSFAVFDDTLLIVDPAGEEEHLATGTLTIVMDDEG  234

Query  914   QLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  235   KLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  277



>ref|XP_007433303.1| PREDICTED: exosome complex component RRP43 isoform X5 [Python 
bivittatus]
 ref|XP_007433304.1| PREDICTED: exosome complex component RRP43 isoform X6 [Python 
bivittatus]
Length=269

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 160/279 (57%), Gaps = 18/279 (6%)
 Frame = +2

Query  203   PLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVEVMTP  382
             PL ++ R+L E+ RPDGR LGE R TT+ +GS+ +ADGSALVK+G+TT++  IK E   P
Sbjct  7     PLEYYRRFLKENCRPDGRDLGEFRTTTINIGSITTADGSALVKLGNTTVICGIKAEFAAP  66

Query  383   SADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASG  562
             + DS ++G I     +PP+CSS  RPG P E A   S+ ++D I +S ++  ++LC+  G
Sbjct  67    TVDSSNKGYIIPNVDLPPLCSSRFRPGPPGEEAQAASQFIADVIENSQVVMKEDLCIIDG  126

Query  563   KAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevp  742
             K  W+ Y DI CLD DG L DA + + +AA  ++ +PV ++N +  +             
Sbjct  127   KIVWVLYCDIICLDYDGNLLDACMCAFLAALKNVLLPVVTINAETGL-------------  173

Query  743   epenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLDSSYQLV  922
                   V  +EK  L +   P + S VL    ++ DPTAEEE +    L +V D   +L 
Sbjct  174   ----AEVNLKEKNPLTIKKQPVATSFVLFDTLVVVDPTAEEEDLASGTLTIVTDEEDKLC  229

Query  923   SLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
             S++KPGG  +     +QDC++  K R  ++K ++ + I 
Sbjct  230   SVHKPGGSTVTEAK-LQDCISRAKTRHKEVKKLMDKIIK  267



>ref|XP_004886214.1| PREDICTED: exosome complex component RRP43 isoform X2 [Heterocephalus 
glaber]
Length=314

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 164/294 (56%), Gaps = 27/294 (9%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  38    GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  97

Query  365   VEVMTPSADSPDEGSIAV----EFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMI  532
              E   P  D+PD+G +         +PP+CSS  R G P E A V S+ ++D I +S +I
Sbjct  98    AEFAVPPKDAPDKGYVVFLSVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQII  157

Query  533   DLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLG  712
               ++LC++SGK AW+ Y D+ CLD DG + DA   + +AA  ++++P   +N++      
Sbjct  158   QKEDLCISSGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVCINEE------  211

Query  713   tkkknknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMET  883
                                  K+K +LN  + P + S  V     ++ DPT EEE +   
Sbjct  212   -------------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLMVDPTGEEEHLATG  258

Query  884   VLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
              L VV+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  259   SLTVVMDEEGRLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  311



>gb|KFO28691.1| Exosome complex component RRP43 [Fukomys damarensis]
Length=352

 Score =   179 bits (455),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 106/289 (37%), Positives = 168/289 (58%), Gaps = 20/289 (7%)
 Frame = +2

Query  191   RRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVE  370
             R + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK E
Sbjct  83    RTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIKAE  142

Query  371   VMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELC  550
                P AD+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++LC
Sbjct  143   FAVPPADAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLC  202

Query  551   LASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknk  730
             ++SGK AW+ Y D+ CLD DG + DA   + +AA  ++++P  S+N++            
Sbjct  203   ISSGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVSINEE------------  250

Query  731   nevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVLDS  907
                       V  ++K  L++ + P + S  V     ++ DPT EEE +    L VV+D 
Sbjct  251   -----TALAEVNLKKKNYLNIRNHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVMDE  305

Query  908   SYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD  1054
               +L  L+KPG  +  + + +QDC++    R  ++K ++ E I  M  +
Sbjct  306   EGRLCCLHKPG--SGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKTE  352



>ref|XP_006267502.1| PREDICTED: exosome complex component RRP43 [Alligator mississippiensis]
Length=276

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 100/286 (35%), Positives = 164/286 (57%), Gaps = 19/286 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRATTVNIGSITTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+ ++G I  +  +PP+CS+  RPG P E A  +S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPVDATNKGYIVPDVDLPPLCSARFRPGPPGEEAQAVSQFIADVIENSQIIMKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+ +GK AW+ Y DI CLD DG + DA   + +AA +++++P  ++N++          
Sbjct  124   LCIVNGKLAWVLYCDIICLDYDGNILDACTFALLAALNNVQLPAVAINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++K  L++   P + S  +     ++ DPTAEEE +    + +V 
Sbjct  174   -------TGLAEVNLKQKTPLNIRKYPVATSFAIFDDTLLIVDPTAEEEDLATGTVTIVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
             D   +L S++KPGG  L     +QDC+     R  ++K ++ + I 
Sbjct  227   DEEGRLCSVHKPGGSPLTGAK-LQDCITRAITRHKEVKQLMDKVIK  271



>ref|NP_001079391.1| exosome component 8 [Xenopus laevis]
 gb|AAH41271.1| MGC52847 protein [Xenopus laevis]
 gb|AAI06634.1| MGC52847 protein [Xenopus laevis]
Length=276

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 108/286 (38%), Positives = 164/286 (57%), Gaps = 19/286 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR L E R TT+ +GS+ +ADGSALVK+G+ T+L  +K
Sbjct  4     GFKTVEPLEYYRRFLKEACRPDGRELTEFRTTTINVGSITTADGSALVKLGNCTVLCGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P ADSPD+G +     + P+CSS  RPG P E A V S+ ++D I +S M+  ++
Sbjct  64    AELAAPPADSPDKGYVVPNVDLTPLCSSQFRPGPPGEEAQVASQFMADVIDNSQMLLKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+A GK AW+ Y D+ CLD DG L D  + + VAA  ++ +P   +N++  +       
Sbjct  124   LCIAHGKLAWVLYCDLICLDYDGNLLDTCMCALVAALQNVRLPSVKINEETGLA------  177

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNY-ILADPTAEEESVMETVLNVVL  901
                         V  + K  L +   P + S  L  +  +L DPT EEES+   +L VV 
Sbjct  178   -----------EVNLKTKCALKILKHPVATSFALFDDTSLLVDPTGEEESLASGLLTVVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
             D   +L +  KPGG AL S   +Q+C++    R  ++ N+L EA++
Sbjct  227   DEDERLCATRKPGGSAL-SAEKLQECISRAITRHKEVTNLLQEALA  271



>gb|AAH67250.1| Exosc8 protein, partial [Mus musculus]
Length=270

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 161/291 (55%), Gaps = 27/291 (9%)
 Frame = +2

Query  203   PLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVEVMTP  382
             PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K E   P
Sbjct  4     PLEYYRRFLKENCRPDGRELGEFRATTVNIGSISTADGSALVKLGNTTVICGVKAEFAAP  63

Query  383   SADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASG  562
               D+PD G +     +PP+CSS  R G P E A V S+ ++D + +S +I  ++LC++ G
Sbjct  64    PVDAPDRGYVVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVVDNSQVIKKEDLCISPG  123

Query  563   KAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevp  742
             K AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++                
Sbjct  124   KLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------------  167

Query  743   epenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVLDSSY  913
                        K+K +LN  + P + S  V     ++ DPT EEE +    L VV D   
Sbjct  168   ---TALAEVNLKKKSYLNVRTNPVATSFAVFDDTLLIVDPTGEEEHLSTGTLTVVTDEDG  224

Query  914   QLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD*RHR  1066
             +L  L+KPGG  L     +QDC++    R  ++  +L E I  M    RH+
Sbjct  225   KLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVSKLLDEVIQSM----RHK  270



>ref|XP_007630918.1| PREDICTED: exosome complex component RRP43 isoform X2 [Cricetulus 
griseus]
Length=280

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/294 (36%), Positives = 163/294 (55%), Gaps = 27/294 (9%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAV----EFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMI  532
              E   P  D+PD G +         +PP+CSS  R G P E A V S+ ++D + +S +I
Sbjct  64    AEFAAPPLDAPDRGYVVFLSVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVLENSQII  123

Query  533   DLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLG  712
               ++LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++      
Sbjct  124   KKEDLCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE------  177

Query  713   tkkknknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMET  883
                                  K+K +LN  + P + S  V     ++ DPT EEE +   
Sbjct  178   -------------TALAEVNLKKKSYLNVRTNPVATSFAVFDDTLLIVDPTGEEEHLSTG  224

Query  884   VLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
              L +V+D   +L SL+KPGG  L     +QDC++    R  ++  +L E I  M
Sbjct  225   TLTIVMDEEGKLCSLHKPGGSGLTGAK-LQDCMSRAVSRHKEVNKLLDEVIQSM  277



>gb|ELR48345.1| Exosome complex exonuclease RRP43, partial [Bos mutus]
Length=291

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 163/290 (56%), Gaps = 22/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  IK
Sbjct  18    GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNVGSIGTADGSALVKLGNTTVICGIK  77

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     + P+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  78    AEFGAPPTDAPDKGYVVPNVDLSPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  137

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++SGK AW+ Y D+ CL+ DG + DA   + +AA  ++++P  ++N++          
Sbjct  138   LCISSGKLAWVLYCDLICLNHDGNILDACTFALLAALKNVQLPEVTINEE----------  187

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  188   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTEEEEHLATGTLTV  238

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPG  +  + + +QDC++    R  ++K ++ E    M
Sbjct  239   VMDEEGRLCCLHKPGSGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVFKSM  288



>ref|XP_005286629.1| PREDICTED: exosome complex component RRP43 [Chrysemys picta bellii]
Length=276

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 164/288 (57%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSITTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P A+S ++G I     + P+CSS  RPG P E A   S+ ++D I +S +I  ++
Sbjct  64    AEFAEPPAESTNKGYIVPNVDLSPLCSSRFRPGPPGEEAQAASQFIADVIENSEIIMKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+A+GK AW+ Y D  CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCIANGKLAWVLYCDFICLDYDGNILDACTFALLAALKNVQLPKVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYIL-ADPTAEEESVMETVLNVVL  901
                         V  ++   L++   P + S V+    IL  DPTAEEE +    + +V+
Sbjct  174   -------TGLAEVDLKQTNPLNIRKHPVATSFVIFDETILIVDPTAEEEDLATGTVTIVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L S++KPGG  L +   +QDC+     R  ++K ++ + I  +
Sbjct  227   DEEGRLCSVHKPGGSGLTAAK-LQDCITRAVTRHKEVKKLIDKVIKSI  273



>ref|XP_004012165.1| PREDICTED: exosome complex component RRP43 [Ovis aries]
 ref|XP_005687555.1| PREDICTED: exosome complex component RRP43 [Capra hircus]
 ref|XP_005977756.1| PREDICTED: exosome complex component RRP43 [Pantholops hodgsonii]
Length=276

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 161/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGS+LVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNVGSIGTADGSSLVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     + P+CS   R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFGAPPTDAPDKGYVVPNVDLSPLCSWRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++SGK AW+ Y D+ CL+ DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISSGKLAWVLYCDLICLNHDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTEEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E    M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVFKSM  273



>gb|ELK34704.1| Exosome complex component RRP43 [Myotis davidii]
Length=307

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 165/288 (57%), Gaps = 20/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL F+ R+L E+ RPDGR LGE R TTV +GSV++ADGSALVK+G+T ++  IK
Sbjct  36    GFKTVEPLEFYRRFLKENCRPDGRELGEFRTTTVNIGSVSTADGSALVKLGNTAVICGIK  95

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  96    AEFAAPPPDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIPKED  155

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK +W+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  156   LCISPGKLSWVLYCDLICLDYDGNILDACTCALLAALKNVQLPEVTINEE----------  205

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++KR L++ + P + S  V     ++ DPT EEE +    L VV+
Sbjct  206   -------TALAEVNLKKKRYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVM  258

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPG     + + +QDC++    R  ++K ++ E I  M
Sbjct  259   DEEGKLCCLHKPG--IGLTGAKLQDCLSRAVTRHKEIKKLMDEVIKSM  304



>gb|KDQ64066.1| hypothetical protein JAAARDRAFT_166025 [Jaapia argillacea MUCL 
33604]
Length=284

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/272 (38%), Positives = 164/272 (60%), Gaps = 20/272 (7%)
 Frame = +2

Query  188  FRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKV  367
            F+RL P  + ER++ E++RPDGR   E R  TV +GS+++ADGSALV++G TT++  +K 
Sbjct  20   FQRLHPRVYLERFIAENVRPDGREFDEWRDITVNVGSISTADGSALVRMGDTTIVCGVKA  79

Query  368  EVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKEL  547
            E+  P  D P EG +     +P +CS   +PG PAE A V+S +L++ + ++G++DL  L
Sbjct  80   EIAEPELDIPGEGFLVPNLDLPALCSPKFKPGPPAEEAQVLSDRLNEALIAAGVLDLTSL  139

Query  548  CLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDD-GRVVLGtkkk  724
            C+ SGK+ W+ Y+D  C++ DG  FDA L++ VAA  +  +P A+ +++ GR +   K+ 
Sbjct  140  CIQSGKSVWVLYVDAVCINYDGNAFDATLIAMVAALKNTRLPKATFDEETGRTICSRKEM  199

Query  725  nknevpepenepvtkeekRKLHLNSVPFSLSC-VLHKNYILADPTAEEESVMETVLNVVL  901
                                L LN++P S+S  V    +ILADPT+ EE +++T L++VL
Sbjct  200  T------------------PLRLNTLPISMSFGVFDSQHILADPTSFEEPLLDTTLSIVL  241

Query  902  DSSYQLVSLYKPGGPALASTSVIQDCVALTKQ  997
            + +  LVS+ + G  A  S  V+  C+A  K+
Sbjct  242  NEAEALVSVTQLGIGATGSQDVLLQCIAAAKR  273



>gb|AAC39558.1| Opa-interacting protein OIP2 [Homo sapiens]
Length=265

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 159/280 (57%), Gaps = 23/280 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  2     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  61

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   PS D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  62    AEFAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  121

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK  W+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  122   LCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  171

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  172   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTI  222

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLK  1015
             V+D   +L  L+KPGG  L     +QDC++    R  ++K
Sbjct  223   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVK  261



>gb|EAX08581.1| exosome component 8, isoform CRA_c [Homo sapiens]
Length=275

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 164/290 (57%), Gaps = 24/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   PS D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK  W+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L +
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTI  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPG     + + +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPG--IGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSM  272



>ref|XP_009901127.1| PREDICTED: exosome complex component RRP43 [Picoides pubescens]
Length=276

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 164/285 (58%), Gaps = 19/285 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
             AF+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  +K
Sbjct  4     AFKTVEPLEYYRRFLKENCRPDGRELGEFRATTVNIGSITTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+ TP+ADS D+G I      P +CS   R G P E A   S+ ++D I +S MI  ++
Sbjct  64    AELATPTADSADKGYIVPNVEFPSLCSMRFRSGPPGEEAQAASQFIADVIENSQMIAKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+A+GK AW+ Y DI CLD DG + DA+  + +AA  ++++P  ++N++          
Sbjct  124   LCIANGKLAWVLYCDIICLDYDGNILDASTFALLAALKNVQLPSVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                      +  V  ++K  L +   P + S  +     ++ DPTAEEE +    + VV 
Sbjct  174   -------TGSSEVNLKQKNPLIIRKHPVATSFAIFDDTLLIVDPTAEEEDLATGTVTVVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAI  1036
             D   +L S++KPGG  +     +QDC+     R  ++K ++ + I
Sbjct  227   DDEGRLCSVHKPGGSPITGAK-LQDCITRAITRHKEVKKLIDKVI  270



>ref|XP_006028450.1| PREDICTED: exosome complex component RRP43 [Alligator sinensis]
Length=299

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/286 (35%), Positives = 164/286 (57%), Gaps = 19/286 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  IK
Sbjct  27    GFKTVEPLEYYRRFLKENCRPDGRELGEFRATTVNIGSITTADGSALVKLGNTTVICGIK  86

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+ ++G I  +  +PP+CS+  RPG P E A  +S+ ++D I +S +I  ++
Sbjct  87    AEFAAPPVDATNKGYIVPDVDLPPLCSARFRPGPPGEEAQAVSQFIADVIENSQIIMKED  146

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+ +GK AW+ Y DI CLD DG + DA   + +AA +++++P  ++N++          
Sbjct  147   LCIVNGKLAWVLYCDIICLDYDGNILDACTFALLAALNNVQLPAVAINEE----------  196

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++K  L++   P + S  +     ++ DPTAEEE +    + +V 
Sbjct  197   -------TGLAEVNLKQKTPLNIRKYPVATSFAIFDDTLLIVDPTAEEEDLATGTVTIVT  249

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
             D   +L S++KPGG  L     +QDC+     R  ++K ++ + I 
Sbjct  250   DEEGRLCSVHKPGGSPLTGAK-LQDCITRAITRHKEVKQLMDKVIK  294



>ref|XP_007070973.1| PREDICTED: exosome complex component RRP43 [Chelonia mydas]
Length=289

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/282 (36%), Positives = 163/282 (58%), Gaps = 19/282 (7%)
 Frame = +2

Query  203   PLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVEVMTP  382
             PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  IK E   P
Sbjct  23    PLEYYRRFLKENCRPDGRELGEFRTTTVNIGSITTADGSALVKLGNTTVICGIKAEFAEP  82

Query  383   SADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASG  562
              A S ++G I     +PP+CSS  RPG P E A   S+ ++D I +S +I  ++LC+A+G
Sbjct  83    PAQSTNKGYIVPNVDLPPLCSSRFRPGPPGEEAQAASQFIADVIENSEIIMKEDLCIANG  142

Query  563   KAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevp  742
             K AW+ Y D  CLD DG + DA   + +AA  ++++P  ++N++  +             
Sbjct  143   KLAWVLYCDFICLDYDGNILDACTFALLAALKNVQLPTVTINEETGLA------------  190

Query  743   epenepvtkeekRKLHLNSVPFSLSCVLHKNYIL-ADPTAEEESVMETVLNVVLDSSYQL  919
                   V  ++   L++   P + S  +  + IL  DPTAEEE +    + +V+D   +L
Sbjct  191   -----EVDLKQTNPLNIRKHPVATSFAVFDDTILIVDPTAEEEDLATGTVTIVMDEEGRL  245

Query  920   VSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
              S++KPGG  L +   +QDC+     R  ++K ++++ I  +
Sbjct  246   CSVHKPGGSGLTAAK-LQDCITRAVTRHKEVKKLINKVIKSI  286



>ref|XP_005344036.1| PREDICTED: exosome complex component RRP43 isoform X1 [Microtus 
ochrogaster]
Length=280

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 162/294 (55%), Gaps = 27/294 (9%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTIVCGVK  63

Query  365   VEVMTPSADSPDEGSIAV----EFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMI  532
              E   P  D+PD G +         +PP+CSS  R G P E A V S+ ++D I +S +I
Sbjct  64    AEFAAPPLDAPDRGYVVFLSVPNVDLPPLCSSRFRTGPPGEEAQVASQFIADVIENSQII  123

Query  533   DLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLG  712
               ++LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++      
Sbjct  124   KKEDLCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE------  177

Query  713   tkkknknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMET  883
                                  K+K +LN  + P + S  V     ++ DPT EEE +   
Sbjct  178   -------------TALAEVNLKKKSYLNVRTTPVATSFAVFDDTLLIVDPTGEEEHLSTG  224

Query  884   VLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
              L +V+D   +L  L+KPGG  L     +QDC++    R  ++  +L E I  M
Sbjct  225   TLTIVMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVNKLLDEVIQSM  277



>ref|XP_007193718.1| PREDICTED: exosome complex component RRP43 [Balaenoptera acutorostrata 
scammoni]
Length=276

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 161/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGS+LVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSIGTADGSSLVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G I     + P+CS   R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFGAPPTDAPDKGYIVPNVDLSPLCSWRFRSGPPGEEAQVASQFIADVIENSQVIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CL+ DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLNHDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE++    L V
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTEEEENLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E    M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVFKSM  273



>ref|XP_010901892.1| PREDICTED: exosome complex component RRP43 [Esox lucius]
Length=277

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 164/286 (57%), Gaps = 19/286 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+   PL +H  +L E+ RPDGR LGE R TT+ +GS+++ADGSALVKIG+TT++  IK
Sbjct  4     GFKTAEPLEYHRSFLKENCRPDGRELGEFRTTTLNIGSISTADGSALVKIGNTTVMCGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P+ + P  G +     +PP+CSS  RPG P E A   S+ ++D I SS +I  ++
Sbjct  64    AELANPAVEVPSRGYMVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIESSEVIQTED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK  W+ Y DI CLD DG + DA L++ +AA  ++ +P  + ++D  V       
Sbjct  124   LCIVKGKLCWVLYCDIMCLDYDGNVLDACLIALLAALKNVRLPEVTFSEDSEV-------  176

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  E +R L ++  P   S  V   + ++ DPTAEEE++   ++ VV+
Sbjct  177   ----------PKVNLENRRGLTIHKHPVGASFAVFDDSIMIVDPTAEEETLSTAIITVVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
             D    L +L+KPGG +L S   +QDC+  T  R  ++  ++++ I 
Sbjct  227   DEEKHLCALHKPGGTSL-SGEKLQDCINRTTIRHKEVHKLINKVIQ  271



>ref|NP_001007919.1| exosome component 8 [Xenopus (Silurana) tropicalis]
 gb|AAH80360.1| exosc8 protein [Xenopus (Silurana) tropicalis]
 emb|CAJ82996.1| exosome component 8 [Xenopus (Silurana) tropicalis]
Length=276

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 163/286 (57%), Gaps = 19/286 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ ++L E+ RPDGR L E R TT+ +GS+ +ADGSALVK+G+ T+L  +K
Sbjct  4     GFKTVEPLEYYRKFLKEACRPDGRELTEFRTTTINVGSITTADGSALVKLGNCTVLCGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P AD+P++G +     + P+CSS  RPG P E A V S+ ++D I +S M+  ++
Sbjct  64    AEFTAPPADAPNKGYVVPNVDLTPLCSSQFRPGPPGEEAQVASQFIADVIDNSQMLLKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+A GK AW+ Y D+ CLD DG L D  + + VAA  ++ +P   +N++  +       
Sbjct  124   LCIAHGKLAWVLYCDLICLDYDGNLLDTCMCALVAALQNVRLPSVKINEETGLA------  177

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  + K  L +   P + S  V    ++L DPT EEE +   +L VV 
Sbjct  178   -----------EVNLKTKHALKILKHPVATSFAVFDDTFLLVDPTGEEEGLASGLLTVVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
             D   +L +  KPGG ALA+   +Q+C++    R  ++ N+L EA++
Sbjct  227   DEDERLCATRKPGGSALAAEK-LQECISRAITRHKEVTNLLQEALA  271



>ref|XP_007392456.1| hypothetical protein PHACADRAFT_181840 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM59904.1| hypothetical protein PHACADRAFT_181840 [Phanerochaete carnosa 
HHB-10118-sp]
Length=287

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/277 (37%), Positives = 164/277 (59%), Gaps = 23/277 (8%)
 Frame = +2

Query  188   FRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKV  367
             F+RL P  + ER+L E++RPDGR   E R  +V +GS+++ADGSALV++G TT++  +K 
Sbjct  24    FQRLHPKAYLERFLAENVRPDGREPTEWRDVSVNVGSISTADGSALVRLGDTTVVCGVKA  83

Query  368   EVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKEL  547
             E+  P  DSP++G +     +P ICS   RPG P++ A V+S +L++T+ S+G+I  + L
Sbjct  84    EIAEPELDSPEDGFLVPNLDLPAICSPKFRPGPPSDEAQVLSDRLNETLVSTGVISTRSL  143

Query  548   CLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDD-GRVVLGtkkk  724
             C+ S KA W+ Y+D  C++ DG   DA L++ +AA  +  +P A+ ++D GRV+   K+ 
Sbjct  144   CIESRKAVWVLYVDATCINYDGNALDATLVAMIAALQNTRLPKATFDEDTGRVLCTRKEM  203

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLSC-VLHKNYILADPTAEEESVMETVLNVVL  901
                                 L ++  P S+S  V    +IL DPT+ EE +++T   V +
Sbjct  204   I------------------PLQISRFPLSMSFGVFDGTHILTDPTSFEEPLLDTTFTVTV  245

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQL  1012
             D +  ++S+ + G   LAS  V++ C+A TK R  QL
Sbjct  246   DENGGVISVVQLG---LASQDVLRKCIATTKSRYRQL  279



>ref|XP_007464290.1| PREDICTED: exosome complex component RRP43 [Lipotes vexillifer]
Length=276

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/290 (35%), Positives = 161/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGS+LVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSIGTADGSSLVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     + P+CS   R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFGAPPTDAPDKGYVVPNVDLSPLCSWRFRSGPPGEEAQVASQFIADVIENSQVIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CL+ DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLNHDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE++    L V
Sbjct  174   ---------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTEEEENLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E    M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVFKSM  273



>ref|XP_004405325.1| PREDICTED: exosome complex component RRP43-like [Odobenus rosmarus 
divergens]
Length=276

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 164/290 (57%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+  PDGR LGE R TTV +GS+++ADGSAL+K+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCHPDGRELGEFRTTTVNIGSISTADGSALLKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             L +++GK +W+ Y DI CLD DG + DA   + +AA  ++++P  ++N++  +       
Sbjct  124   LRISTGKLSWVLYCDIICLDYDGNILDACTFALLAALKNVQLPEVTINEETGLA------  177

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE +    L V
Sbjct  178   -------------KVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRGVTRHKEVKKLMDEEIKSM  273



>ref|XP_006120599.1| PREDICTED: exosome complex component RRP43 [Pelodiscus sinensis]
Length=274

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/286 (36%), Positives = 163/286 (57%), Gaps = 19/286 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSITTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P A+S ++G I     + P+CSS  RPG P E A   S+ ++D I +S +I  ++
Sbjct  64    AEFAEPPAESSNKGYIVPNVDLSPLCSSRFRPGPPGEEAQAASQFIADVIENSEIIMKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+A+GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCIANGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPTVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYIL-ADPTAEEESVMETVLNVVL  901
                         V  ++   L++   P + S  +  + IL  DPTAEEE +    + +V+
Sbjct  174   -------TGLAEVNLKQTNPLNIRKHPVATSFAVFDDTILIVDPTAEEEDLATGTVTIVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
             D   +L S+ KPGG  L +   +QDC+     R  ++K ++ + I 
Sbjct  227   DEEGRLCSVNKPGGSGLTAAK-LQDCITRAVTRHKEVKQLIDKVIK  271



>ref|XP_004282280.1| PREDICTED: exosome complex component RRP43 [Orcinus orca]
Length=276

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/290 (35%), Positives = 161/290 (56%), Gaps = 23/290 (8%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGS+LVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSIGTADGSSLVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     + P+CS   R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFGAPPTDAPDKGYVVPNVDLSPLCSWRFRSGPPGEEAQVASQFIADVIENSQVIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CL+ DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLNHDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNV  895
                              K+K +LN  + P + S  V     ++ DPT EEE++    L V
Sbjct  174   ---------TASAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTEEEENLATGTLTV  224

Query  896   VLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             V+D   +L  L+KPGG  L     +QDC++    R  ++K ++ E    M
Sbjct  225   VMDEEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVFKSM  273



>gb|ACO52081.1| Exosome complex exonuclease RRP43 [Rana catesbeiana]
Length=272

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 158/281 (56%), Gaps = 19/281 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ ++L E  RPDGR L E R TT+ +GS+ +ADGSALVKIG+ T++  IK
Sbjct  4     GFKSVEPLEYYRKFLKEKCRPDGRDLSEFRTTTINVGSITTADGSALVKIGNCTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E  TP  D+P++G I     + P+CS   RPG P E A V S+ ++D I +S MI  ++
Sbjct  64    AEFATPPIDAPNKGYIVPNVELTPLCSPRFRPGPPGEEAQVASQFIADVIENSQMILKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+ +GK AW+ Y D+ CLD  G L D  + + VA+  +  +P   +N++  +       
Sbjct  124   LCIENGKLAWVLYCDLICLDYGGNLLDTCMCALVASLRNARLPSVKINEETGLA------  177

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLSCVLHKN-YILADPTAEEESVMETVLNVVL  901
                         V    +  L ++  P S S  +  N +IL DPT EEES+   ++ +V 
Sbjct  178   -----------QVNLSTRNALKIHKHPLSTSFAIFDNKHILVDPTNEEESLATGLMTIVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNIL  1024
             D   +L ++ KPGG AL S   +QDC++    R  +++N+L
Sbjct  227   DEDGRLCTIRKPGGSAL-SAEKLQDCISRAITRHKEVQNLL  266



>ref|XP_005876038.1| PREDICTED: exosome complex component RRP43-like [Myotis brandtii]
 gb|EPQ13799.1| Exosome complex component RRP43 [Myotis brandtii]
Length=276

 Score =   175 bits (443),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 162/288 (56%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L ++ R DGR LGE   TTV +GSV++ADGSALVK+G+T ++  IK
Sbjct  4     GFKTVEPLEYYRRFLKKNCRADGRELGEFTTTTVNIGSVSTADGSALVKLGNTAVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPPDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIILKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++          
Sbjct  124   LCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                            ++KR L++ + P + S  V     ++ DPT EEE +    L VV+
Sbjct  174   -------TALAEANLKKKRYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTVVM  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  227   DEEGKLCCLHKPGGSGLTGAK-LQDCLSRAVTRHKEVKKLMDEVIKSM  273



>gb|AAX96113.1| expressed protein [Oryza sativa Japonica Group]
Length=165

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  155  GDLSSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKI  334
            G L+ +ME++A+RRLFPL F ER+L ES+RPD R   EAR TTV L +V+SA GSALV++
Sbjct  11   GGLAGEMEVEAYRRLFPLAFLERHLRESVRPDARRPAEARPTTVALAAVSSAHGSALVRL  70

Query  335  GSTTMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTI  514
            G T MLA+IK+EVM+PS ++PDEGSIAVEFHMPPICS LVRPGRPAE APVISK L D +
Sbjct  71   GDTAMLASIKLEVMSPSGEAPDEGSIAVEFHMPPICSPLVRPGRPAEVAPVISKNLEDIL  130



>ref|NP_001157042.1| exosome complex component RRP43 isoform 1 [Mus musculus]
Length=280

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 106/301 (35%), Positives = 164/301 (54%), Gaps = 31/301 (10%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRATTVNIGSISTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAV----EFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMI  532
              E   P  D+PD G +         +PP+CSS  R G P E A V S+ ++D + +S +I
Sbjct  64    AEFAAPPVDAPDRGYVVFLSVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVVDNSQVI  123

Query  533   DLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLG  712
               ++LC++ GK AW+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++      
Sbjct  124   KKEDLCISPGKLAWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE------  177

Query  713   tkkknknevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMET  883
                                  K+K +LN  + P + S  V     ++ DPT EEE +   
Sbjct  178   -------------TALAEVNLKKKSYLNVRTNPVATSFAVFDDTLLIVDPTGEEEHLSTG  224

Query  884   VLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDMDVD*RH  1063
              L VV D   +L  L+KPGG  L     +QDC++    R  ++  +L E I  M    RH
Sbjct  225   TLTVVTDEDGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVSKLLDEVIQSM----RH  279

Query  1064  R  1066
             +
Sbjct  280   K  280



>ref|XP_009510212.1| PREDICTED: exosome complex component RRP43, partial [Phalacrocorax 
carbo]
Length=270

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/282 (36%), Positives = 162/282 (57%), Gaps = 19/282 (7%)
 Frame = +2

Query  203   PLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVEVMTP  382
             PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  +K E+  P
Sbjct  4     PLEYYRRFLKENCRPDGRELGEFRATTVNIGSITTADGSALVKLGNTTVICGVKAELAAP  63

Query  383   SADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELCLASG  562
             +ADS ++G I     +P +CS+  R G P E A  +S+ ++D I +S MI  ++LC+A+G
Sbjct  64    AADSANKGYIVPNVELPSLCSTRFRSGPPGEEAQAVSQFIADVIENSQMIAKEDLCIANG  123

Query  563   KAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknknevp  742
             K AW+ Y DI CLD DG + DA+  + +AA  ++++P  +LN++                
Sbjct  124   KLAWVLYCDIICLDYDGNILDASTFALLAALKNVQLPSVTLNEE----------------  167

Query  743   epenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVLDSSYQL  919
                   V  ++K  L +   P + S  +     ++ DPTAEEE +    + +V D   +L
Sbjct  168   -TGLSEVNLKQKNPLTIRKHPVATSFAIFDDTLLIVDPTAEEEDLATGTVTIVTDDEGRL  226

Query  920   VSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
              S++KPGG  L     +QDC+     R  ++K ++ + I  +
Sbjct  227   CSVHKPGGSPLTGAK-LQDCITRAITRHKEVKKLIDKVIKSI  267



>ref|XP_004550171.1| PREDICTED: exosome complex component RRP43-like isoform X2 [Maylandia 
zebra]
 ref|XP_005750798.1| PREDICTED: exosome complex component RRP43-like [Pundamilia nyererei]
 ref|XP_005928150.1| PREDICTED: exosome complex component RRP43-like [Haplochromis 
burtoni]
Length=277

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/283 (36%), Positives = 165/283 (58%), Gaps = 19/283 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+   PL +H  +L E+ RPDGR L E R TT+ +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTAEPLEYHRSFLKENCRPDGRELTEFRTTTLNIGSISTADGSALVKLGNTTIICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P+ ++P +G I     +PP+CSS  RPG P E A   S+ ++D I SS +I  ++
Sbjct  64    AELTNPTVEAPGKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIESSEVIKTED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK  W+ Y D+ CLD DG + DA +++ +AA  +  +P  ++N +          
Sbjct  124   LCIDRGKLCWVLYCDLMCLDYDGNILDACVIALLAALKNTRLPEVTINKE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  E++R+L ++    S S C+   + ++ADPTAEEE++    L VV 
Sbjct  174   -------TSAPEVNLEKRRELQIHKHLVSASFCIFDDSILIADPTAEEETLSTANLTVVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSE  1030
             D   +L S++KPGG +L S   +Q+C++    R  +++ ++ +
Sbjct  227   DEDDRLCSVHKPGGTSL-SGERLQECISRATTRQREIQKLIDK  268



>ref|XP_005482498.1| PREDICTED: exosome complex component RRP43 [Zonotrichia albicollis]
Length=276

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 165/288 (57%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
             AF+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  IK
Sbjct  4     AFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSITTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P+ DS ++G I     +P +C+   R G P E A   S+ ++D I +S MI  ++
Sbjct  64    AELAAPAVDSANKGYIVPNVELPSLCAERFRSGPPGEEAQAASQYIADVIENSQMIVKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+A+GK AW+ Y DI CLD DG L DA++ + +AA  ++++P+ ++N++          
Sbjct  124   LCIANGKLAWVLYCDIICLDYDGNLLDASVFALLAALKNVQLPLVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++K  L +   P + S  V     ++ DPTAEEE +    + +V 
Sbjct  174   -------TGLSEVNLKQKNPLIIRKHPVATSFAVFDDTLLIVDPTAEEEDLATGTVTIVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L S++KPGG  L     +QDC+     R  ++K ++ + I  +
Sbjct  227   DEEGRLCSVHKPGGSPLTGAK-LQDCITRAITRHKEVKKLIDKVIKSI  273



>gb|EAX08579.1| exosome component 8, isoform CRA_a, partial [Homo sapiens]
Length=316

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 163/288 (57%), Gaps = 24/288 (8%)
 Frame = +2

Query  191   RRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKVE  370
             R + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  +K E
Sbjct  47    RTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAE  106

Query  371   VMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKELC  550
                PS D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++LC
Sbjct  107   FAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLC  166

Query  551   LASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkknk  730
             ++ GK  W+ Y D+ CLD DG + DA   + +AA  ++++P  ++N++            
Sbjct  167   ISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEE------------  214

Query  731   nevpepenepvtkeekRKLHLN--SVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                            K+K +LN  + P + S  V     ++ DPT EEE +    L +V+
Sbjct  215   -------TALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIVM  267

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L  L+KPG     + + +QDC++    R  ++K ++ E I  M
Sbjct  268   DEEGKLCCLHKPG--IGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSM  313



>ref|XP_010791674.1| PREDICTED: exosome complex component RRP43 [Notothenia coriiceps]
Length=277

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/286 (35%), Positives = 163/286 (57%), Gaps = 19/286 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+   PL +H  +L E+ RPDGR L E R TT+ +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKIAEPLEYHRSFLKENCRPDGRELSEFRTTTLNIGSISTADGSALVKVGNTTVMCGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
             VE+  P  ++P +G I     +PP+CSS  RPG P E A   S+ ++D I SS +I  ++
Sbjct  64    VELTNPLVEAPGKGFIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIESSELIQTED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK  W+ Y D+ C+D DG + DA +++ +AA  + ++P  ++N D          
Sbjct  124   LCIERGKLCWVLYCDMMCVDYDGNVLDACIIALLAALKNTKLPGVTINKD----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  E+++ L+++  P   S CV   + ++ DP+AEEE +  + L VV 
Sbjct  174   -------TGAPEVNLEKRKGLNIHKHPVGASFCVFDDSILIVDPSAEEEGLSTSHLTVVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
             D   +L  ++KPGG  L S   +Q+C+     R  +++ ++ + I 
Sbjct  227   DEKERLCVVHKPGGTPL-SAEKLQECIGRATARQREIQKLVDKVIQ  271



>gb|EMD40344.1| hypothetical protein CERSUDRAFT_148276 [Ceriporiopsis subvermispora 
B]
Length=291

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 166/281 (59%), Gaps = 20/281 (7%)
 Frame = +2

Query  188   FRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIKV  367
             F+RL P  + ER+L E++RPDGR L E R  +V +GS+++ADGSALV++G TT++  +K 
Sbjct  25    FQRLHPKAYLERFLQENVRPDGRELDEWRDVSVHVGSISTADGSALVRLGDTTIVCGVKA  84

Query  368   EVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKEL  547
             E+  P  DSP+ G I     +P ICS   +PG P E A VIS +L++ + ++G++    L
Sbjct  85    EIAEPELDSPEAGFIVPNLDLPAICSPKFKPGPPTEEAQVISDRLNEVLVTAGIVSPSSL  144

Query  548   CLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDD-GRVVLGtkkk  724
             C+  GKAAW+ Y+D  C++ DG  FDA LL+ VAA  +  +P A  +++ GR V      
Sbjct  145   CIQPGKAAWVLYIDATCINYDGNAFDATLLAMVAALKNTRLPKARFDEEAGRTVC-----  199

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLSC-VLHKNYILADPTAEEESVMETVLNVVL  901
                          +++ K  LH+  +P +++  +    ++L+DPT+ EE +++TVL+V +
Sbjct  200   -------------SRKVKEPLHIGRLPTAMTFGIFDGTHVLSDPTSFEEPLLDTVLSVTV  246

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNIL  1024
             D S  LVS+ + G   +    ++  C++  KQR + L   L
Sbjct  247   DESGGLVSVTQVGLGVIGKQDILPQCISAAKQRCSILAKQL  287



>ref|NP_001279869.1| exosome component 8 [Callorhinchus milii]
 gb|AFK11551.1| exosome complex component RRP43 [Callorhinchus milii]
Length=291

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/286 (35%), Positives = 167/286 (58%), Gaps = 19/286 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ ++L E+ RPDGR LGE R TT+ +GS+ +ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRKFLKENCRPDGRELGEFRTTTLNIGSITTADGSALVKLGNTTVVCGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
             +E   P+ D+P++G +     +PP+CSS  RPG P E A   S+ ++D I +S  +  ++
Sbjct  64    MEFAVPTVDAPNKGYVVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIENSQFLQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK  W+ Y D+ CLD DG L DA +++ +AA  ++++P  S++            
Sbjct  124   LCIEKGKLVWVVYCDMMCLDYDGNLLDACIIALLAALKNVQLPPVSIS------------  171

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYI-LADPTAEEESVMETVLNVVL  901
                   E     V   +K +L++   P + S  +  + I + DPTAEEE++   +  +V+
Sbjct  172   -----VETGLAEVDMNQKNQLNIRKHPVATSFAIFDDTIFIVDPTAEEETLASGMATIVV  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
             D   +L +++KPGG   AS   +QDC+   + R  ++  +LSE + 
Sbjct  227   DEEDRLCAVHKPGGSG-ASGEKLQDCIVRAQTRHREVYKLLSEVMK  271



>ref|XP_005852012.1| hypothetical protein CHLNCDRAFT_132943 [Chlorella variabilis]
 gb|EFN59910.1| hypothetical protein CHLNCDRAFT_132943 [Chlorella variabilis]
Length=301

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 110/298 (37%), Positives = 177/298 (59%), Gaps = 30/298 (10%)
 Frame = +2

Query  164   SSQMELDAFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGST  343
             S++++ D+F+RL+P    ++YL             A+ T++ LG V++AD SALVK+GST
Sbjct  7     SAELQADSFKRLYP----DQYL-------------AKPTSIGLGVVSTADASALVKVGST  49

Query  344   TMLAAIKVEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASS  523
               LA IK EVM  SAD+P+EG +A++  + P+CS+  RPGRP+EAA V+++QLS  +  +
Sbjct  50    AALAGIKCEVMPASADTPEEGRLALQVELAPLCSADTRPGRPSEAAAVLTEQLSSLLEGA  109

Query  524   GMIDLKELCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRV  703
             G++D ++LC+  GKAAW  Y+D+Y LDADG+L DA LL+ +AA S L +   +++D GR+
Sbjct  110   GVVDRRQLCIDPGKAAWAVYVDVYVLDADGSLHDACLLAVLAALSSLRLHAVAVDDTGRI  169

Query  704   -------------VLGtkkknknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYIL  844
                              ++   +       +     ++R L L   P SL+C L+++ +L
Sbjct  170   QKAPADAAAAGAAGAQRQQGAADGAATALQQQPQGHQRRPLLLACHPVSLTCGLYRDRLL  229

Query  845   ADPTAEEESVMETVLNVVLDSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKN  1018
              DPTAEEE ++E  +   +D S  ++  YK GG A  S   + +C+   KQR  +++ 
Sbjct  230   VDPTAEEEPLLEAAMTTTVDESGDILGFYKAGGSATLSRERMLECIEAAKQRSREVRG  287



>ref|XP_002196618.1| PREDICTED: exosome complex component RRP43 [Taeniopygia guttata]
Length=276

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 165/288 (57%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
             AF+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  +K
Sbjct  4     AFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSITTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P+ADS ++G I     +P +C+   R G P E A   S+ ++D I +S MI  ++
Sbjct  64    AELAAPAADSANKGYIVPNVELPSLCAERFRSGPPGEEAQAASQFIADVIENSQMIVKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+A+GK AW+ Y DI CLD DG L DA++ + +AA  ++++P  ++N++          
Sbjct  124   LCIANGKLAWVLYCDIICLDYDGNLLDASVFALLAALKNVQLPSVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++K  L +   P + S  +     ++ DPTAEEE +    + +V 
Sbjct  174   -------TGLSEVNLKQKNPLIIRKHPVATSFAIFDDTLLIVDPTAEEEDLATGTVTIVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L S++KPGG  L     +QDC+     R  ++K ++ + I  +
Sbjct  227   DEEGRLCSVHKPGGSPLTGAK-LQDCITRAITRHKEVKKLIDKVIKSI  273



>ref|XP_005516377.1| PREDICTED: exosome complex component RRP43 [Pseudopodoces humilis]
Length=276

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 165/288 (57%), Gaps = 19/288 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
             AF+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+ +ADGSALVK+G+TT++  +K
Sbjct  4     AFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSITTADGSALVKLGNTTVICGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P+ DS ++G I     +P +C+   R G P E A   S+ ++D I +S MI  ++
Sbjct  64    AELAAPAVDSANKGYIVPNVELPSLCAERFRSGPPGEEAQAASQFIADVIENSQMIVKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+A+GK AW+ Y DI CLD DG L DA++ + +AA  ++++P+ ++N++          
Sbjct  124   LCIANGKLAWVLYCDIICLDYDGNLLDASVFALLAALKNVQLPLVTINEE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  ++K  L +   P + S  V     ++ DPTAEEE +    + +V 
Sbjct  174   -------TGLSEVNLKQKNPLIIRKHPVATSFAVFDDTLLIVDPTAEEEDLATGTVTIVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
             D   +L S++KPGG  L     +QDC+     R  ++K ++ + I  +
Sbjct  227   DEEGRLCSVHKPGGSPLTGAK-LQDCITRAITRHKEVKKLIDKVIKSI  273



>ref|XP_006800170.1| PREDICTED: exosome complex component RRP43-like [Neolamprologus 
brichardi]
Length=277

 Score =   172 bits (435),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 165/283 (58%), Gaps = 19/283 (7%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+   PL +H  +L E+ RPDGR L E R TT+ +GS+++A+GSALVK+G+TT++  IK
Sbjct  4     GFKTAEPLEYHRSFLKENCRPDGRELTEFRTTTLNIGSISTANGSALVKLGNTTIICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E+  P+ ++P +G I     +PP+CSS  RPG P E A   S+ ++D I SS +I  ++
Sbjct  64    AELTNPTVEAPGKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIESSEVIKTED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK  W+ Y D+ CLD DG + DA +++ +AA  +  +P  ++N +          
Sbjct  124   LCIDRGKLCWVLYCDLMCLDYDGNILDACVIALLAALKNTRLPEVTINKE----------  173

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLS-CVLHKNYILADPTAEEESVMETVLNVVL  901
                         V  E++R+L ++    S S C+   + ++ADPTAEEE++    L VV 
Sbjct  174   -------TSAPEVNLEKRRELQIHKHLVSASFCIFDDSILIADPTAEEETLSTANLTVVT  226

Query  902   DSSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSE  1030
             D   +L S++KPGG +L S   +Q+C++    R  +++ ++ +
Sbjct  227   DEDDRLCSVHKPGGTSL-SGERLQECISRATTRQREIQKLIDK  268



>ref|NP_001088781.1| uncharacterized protein LOC496046 [Xenopus laevis]
 gb|AAH87445.1| LOC496046 protein [Xenopus laevis]
Length=276

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 160/285 (56%), Gaps = 17/285 (6%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E  RPDGR L E R TT+ +GS+ +ADGSALVK+G+ T+L  +K
Sbjct  4     GFKTVEPLEYYRRFLKEICRPDGRELTEFRTTTINVGSITTADGSALVKLGNCTVLCGVK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P AD+P++G +     + P+CSS  RPG P E A V S+ ++D I +S M+  ++
Sbjct  64    AEFAAPPADAPNKGYVVPNVDLSPLCSSQFRPGPPGEEAQVASQFMADVIDNSQMLLKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC+  GK AW+ Y D+ CLD DG L D    + VAA  ++ +P   +N++  +       
Sbjct  124   LCIRHGKLAWVLYCDLICLDYDGNLLDTCTCALVAALQNVRLPSVKINEETGLA------  177

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLD  904
                         +  +   K+  + +  S + V    ++LADPT EEES+   +L VV D
Sbjct  178   ---------EVNLKTKCALKILKHPIATSFA-VFDDKFLLADPTGEEESLARGLLTVVTD  227

Query  905   SSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAIS  1039
                +L +  KPGG +L S   +Q+C++    R  ++  +L EA++
Sbjct  228   EDERLCATQKPGGSSL-SAEKLQECISRAITRHKEVTTLLQEALA  271



>ref|XP_006927312.1| PREDICTED: exosome complex component RRP43 [Felis catus]
Length=252

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/287 (35%), Positives = 154/287 (54%), Gaps = 41/287 (14%)
 Frame = +2

Query  185   AFRRLFPLRFHERYLGESIRPDGRALGEARYTTVVLGSVASADGSALVKIGSTTMLAAIK  364
              F+ + PL ++ R+L E+ RPDGR LGE R TTV +GS+++ADGSALVK+G+TT++  IK
Sbjct  4     GFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGIK  63

Query  365   VEVMTPSADSPDEGSIAVEFHMPPICSSLVRPGRPAEAAPVISKQLSDTIASSGMIDLKE  544
              E   P  D+PD+G +     +PP+CSS  R G P E A V S+ ++D I +S +I  ++
Sbjct  64    AEFAAPPTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKED  123

Query  545   LCLASGKAAWMAYLDIYCldadgalfdaallSAVAAFSHLEIPVASLNDDGRVVLGtkkk  724
             LC++ GK +W+ Y DI CLD DG + DA   + +AA  +  +P                 
Sbjct  124   LCISPGKLSWVLYCDIICLDYDGNILDACTFALLAALKNEFVP-----------------  166

Query  725   nknevpepenepvtkeekRKLHLNSVPFSLSCVLHKNYILADPTAEEESVMETVLNVVLD  904
                                   ++++ F +   L+   ++ DPT EEE +    L VV+D
Sbjct  167   ---------------------WIDNLYFFI--FLNSTLLIVDPTGEEEHLATGTLTVVMD  203

Query  905   SSYQLVSLYKPGGPALASTSVIQDCVALTKQRVNQLKNILSEAISDM  1045
                +L  L+KPGG  L     +QDC++    R  ++K ++ E I  M
Sbjct  204   EEGKLCCLHKPGGSGLTGAK-LQDCMSRAVTRHKEVKKLMDEVIKSM  249



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3863858971050