BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19217_g1_i2 len=936 path=[2477:0-714 1735:715-736 2109:737-935]

Length=936
                                                                      Score     E

ref|XP_009612572.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   3e-22   
ref|XP_009785025.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    103   5e-22   
ref|XP_004248833.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  96.7    1e-19   
ref|XP_006339950.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  95.5    2e-19   
emb|CDP07668.1|  unnamed protein product                              87.8    1e-16   
ref|XP_011086925.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  85.9    5e-16   
ref|XP_010257498.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  81.6    3e-14   
gb|KDP27158.1|  hypothetical protein JCGZ_19857                       77.0    2e-13   
ref|XP_011009647.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...  76.3    3e-13   
ref|XP_006369477.1|  hypothetical protein POPTR_0001s23810g           76.3    3e-13   
ref|XP_006280544.1|  hypothetical protein CARUB_v10026486mg           79.0    4e-13   
ref|XP_008390049.1|  PREDICTED: E3 ubiquitin-protein ligase RNF181    75.5    1e-12   
ref|XP_009609375.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...  73.9    2e-12   
ref|XP_011093399.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1...  73.9    4e-12   
ref|XP_011098772.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  73.2    5e-12   
ref|XP_002271062.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  74.7    5e-12   Vitis vinifera
ref|XP_006408425.1|  hypothetical protein EUTSA_v10020821mg           75.5    6e-12   
ref|NP_200890.1|  RING/U-box domain-containing protein                75.5    7e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDY34722.1|  BnaA01g33030D                                        75.1    7e-12   
emb|CDX69973.1|  BnaA10g23220D                                        74.7    8e-12   
ref|XP_009122921.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8      75.1    8e-12   
ref|XP_009360490.1|  PREDICTED: E3 ubiquitin-protein ligase RNF181    72.8    8e-12   
ref|XP_004306138.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.9    9e-12   
ref|XP_006849546.1|  hypothetical protein AMTR_s00024p00170820        73.6    1e-11   
ref|XP_009598845.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  71.6    1e-11   
ref|XP_009767704.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  72.8    1e-11   
gb|KFK23879.1|  hypothetical protein AALP_AAs51353U000300             74.3    1e-11   
ref|XP_002871309.1|  zinc finger family protein                       74.3    2e-11   
ref|XP_007223926.1|  hypothetical protein PRUPE_ppa011037mg           72.0    2e-11   
emb|CDP02240.1|  unnamed protein product                              72.4    2e-11   
ref|XP_004951613.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  73.9    2e-11   
emb|CDY34721.1|  BnaA01g33040D                                        73.9    2e-11   
ref|XP_008221607.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  71.6    2e-11   
ref|XP_002871686.1|  hypothetical protein ARALYDRAFT_909558           73.6    2e-11   
dbj|BAA77204.1|  ring finger protein                                  70.1    2e-11   Cicer arietinum [garbanzo]
ref|XP_010453731.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  71.6    2e-11   
ref|XP_009117930.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8      73.6    2e-11   
ref|XP_002864705.1|  zinc finger family protein                       73.6    2e-11   
gb|KDP20379.1|  hypothetical protein JCGZ_05262                       71.6    3e-11   
ref|XP_008461232.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  72.8    3e-11   
ref|XP_006438705.1|  hypothetical protein CICLE_v10032639mg           71.2    3e-11   
emb|CDY21513.1|  BnaC09g47790D                                        72.8    3e-11   
ref|XP_006483144.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  71.2    3e-11   
ref|XP_003711952.1|  hypothetical protein MGG_06087                   73.6    4e-11   
gb|ELQ40024.1|  hypothetical protein OOU_Y34scaffold00464g107         73.6    4e-11   
ref|XP_010443889.1|  PREDICTED: uncharacterized protein LOC104726672  73.2    4e-11   
gb|KHN15189.1|  E3 ubiquitin-protein ligase RING1-like                70.1    4e-11   
emb|CAN63309.1|  hypothetical protein VITISV_017174                   72.4    4e-11   Vitis vinifera
ref|XP_009420273.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  71.6    4e-11   
ref|XP_010420259.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.1    5e-11   
ref|XP_006400108.1|  hypothetical protein EUTSA_v10013685mg           72.8    5e-11   
ref|XP_011085754.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.1    5e-11   
ref|XP_010492431.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...  72.4    5e-11   
emb|CAB93715.1|  putative protein                                     72.8    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010660538.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  72.4    6e-11   
ref|XP_003532982.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  72.0    6e-11   
ref|XP_004135900.1|  PREDICTED: uncharacterized protein LOC101219937  72.0    6e-11   
ref|XP_004158213.1|  PREDICTED: uncharacterized LOC101219937          72.0    7e-11   
ref|XP_010456764.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...  72.4    7e-11   
gb|EPS71177.1|  hypothetical protein M569_03584                       68.2    7e-11   
ref|XP_009126069.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  72.0    8e-11   
gb|KDO82940.1|  hypothetical protein CISIN_1g026833mg                 70.1    8e-11   
ref|NP_850790.1|  RING/U-box domain-containing protein                72.0    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297779.1|  hypothetical protein CARUB_v10013815mg           72.0    8e-11   
ref|XP_008907457.1|  hypothetical protein PPTG_13494                  70.9    8e-11   
gb|AAL25539.1|  AT5g08140/T22D6_80                                    72.0    8e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ETO72364.1|  hypothetical protein F444_11492                       70.9    8e-11   
ref|NP_001148976.1|  protein binding protein                          72.4    9e-11   Zea mays [maize]
ref|XP_010453730.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...  71.6    9e-11   
ref|XP_010483737.1|  PREDICTED: uncharacterized protein LOC104762191  72.0    1e-10   
ref|XP_009515775.1|  hypothetical protein PHYSODRAFT_294053           70.9    1e-10   
ref|XP_002448908.1|  hypothetical protein SORBIDRAFT_05g001320        72.4    1e-10   Sorghum bicolor [broomcorn]
gb|KFK27843.1|  hypothetical protein AALP_AA8G437200                  72.0    1e-10   
ref|XP_006399301.1|  hypothetical protein EUTSA_v10013909mg           71.2    1e-10   
ref|XP_008231400.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM      70.1    1e-10   
gb|AFG50296.1|  hypothetical protein 2_5309_02                        68.2    1e-10   
gb|AEW08280.1|  hypothetical protein 2_5309_02                        68.2    1e-10   
gb|KHN26687.1|  E3 ubiquitin-protein ligase RING1                     72.0    1e-10   
gb|KHN33467.1|  E3 ubiquitin-protein ligase RING1                     70.9    1e-10   
ref|XP_009136400.1|  PREDICTED: E3 ubiquitin-protein ligase TOM1-...  71.2    1e-10   
emb|CDO98567.1|  unnamed protein product                              71.2    1e-10   
ref|XP_006288146.1|  hypothetical protein CARUB_v10001383mg           70.9    2e-10   
ref|XP_010667286.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  71.2    2e-10   
ref|XP_003547055.2|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.9    2e-10   
ref|XP_009761708.1|  PREDICTED: uncharacterized RING finger prote...  68.6    2e-10   
gb|KHN30758.1|  E3 ubiquitin-protein ligase RING1-like                71.2    2e-10   
ref|XP_010667287.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.9    2e-10   
ref|XP_010501167.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.9    2e-10   
emb|CDY51628.1|  BnaCnng21200D                                        71.2    2e-10   
ref|XP_011010655.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.8    2e-10   
emb|CDX85531.1|  BnaA02g02820D                                        70.9    2e-10   
gb|AFG53307.1|  hypothetical protein 0_8445_01                        67.8    2e-10   
ref|XP_007151431.1|  hypothetical protein PHAVU_004G045600g           70.9    2e-10   
emb|CDP02365.1|  unnamed protein product                              70.9    2e-10   
ref|XP_010485476.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...  70.9    2e-10   
gb|KCW52328.1|  hypothetical protein EUGRSUZ_J01748                   70.9    2e-10   
ref|XP_010032834.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  70.9    2e-10   
ref|XP_007151827.1|  hypothetical protein PHAVU_004G078500g           70.5    2e-10   
gb|AFG53317.1|  hypothetical protein 0_8445_01                        67.8    2e-10   
gb|EEE65310.1|  hypothetical protein OsJ_20551                        71.6    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|KCW52329.1|  hypothetical protein EUGRSUZ_J01748                   70.9    2e-10   
gb|KHN02654.1|  E3 ubiquitin-protein ligase RING1-like                70.9    2e-10   
gb|EEC79816.1|  hypothetical protein OsI_21260                        68.6    2e-10   Oryza sativa Indica Group [Indian rice]
gb|ABK21010.1|  unknown                                               70.1    2e-10   Picea sitchensis
ref|XP_006579707.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  70.5    2e-10   
gb|KCW52327.1|  hypothetical protein EUGRSUZ_J01748                   70.5    3e-10   
ref|XP_002317728.2|  hypothetical protein POPTR_0012s03370g           69.3    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_004507269.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  70.5    3e-10   
gb|KDO43107.1|  hypothetical protein CISIN_1g043965mg                 70.1    3e-10   
gb|EYU22950.1|  hypothetical protein MIMGU_mgv1a022478mg              70.1    3e-10   
gb|KGN52465.1|  hypothetical protein Csa_5G636570                     68.9    3e-10   
ref|XP_002906712.1|  conserved hypothetical protein                   69.3    3e-10   
ref|XP_003579014.1|  PREDICTED: uncharacterized protein LOC100825978  70.5    3e-10   
ref|XP_009795472.1|  PREDICTED: E3 ubiquitin-protein ligase AIP2-...  69.7    3e-10   
ref|XP_008650496.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.1    3e-10   
ref|XP_009384344.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...  70.5    3e-10   
ref|XP_010037320.1|  PREDICTED: uncharacterized protein LOC104426083  70.5    3e-10   
ref|XP_010462406.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.1    3e-10   
ref|XP_010463639.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  70.5    3e-10   
emb|CDY02194.1|  BnaA03g39730D                                        70.1    4e-10   
ref|XP_006353939.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.1    4e-10   
ref|XP_010243363.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.1    4e-10   
ref|XP_004235401.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.1    4e-10   
ref|XP_009409315.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  69.3    4e-10   
ref|XP_009384343.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...  70.1    4e-10   
ref|NP_001141684.1|  uncharacterized protein LOC100273811             69.7    4e-10   Zea mays [maize]
gb|EMT01564.1|  E3 ubiquitin-protein ligase CIP8                      70.1    5e-10   
gb|EMT27310.1|  RING finger protein 126                               69.3    5e-10   
gb|KHN01234.1|  E3 ubiquitin-protein ligase RING1                     67.8    5e-10   
ref|XP_006655672.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  69.3    5e-10   
ref|XP_002437660.1|  hypothetical protein SORBIDRAFT_10g000250        69.3    5e-10   Sorghum bicolor [broomcorn]
ref|XP_009384341.1|  PREDICTED: uncharacterized protein LOC103971...  70.1    5e-10   
ref|NP_186883.1|  RING/U-box domain-containing protein                69.7    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006443366.1|  hypothetical protein CICLE_v10024260mg           69.3    5e-10   
ref|XP_003620140.1|  RING finger protein                              68.2    5e-10   
gb|EPS73974.1|  hypothetical protein M569_00782                       68.9    5e-10   
gb|EAZ00111.1|  hypothetical protein OsI_22117                        70.1    5e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010231240.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  69.3    6e-10   
ref|XP_006355109.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    6e-10   
ref|XP_008369925.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  69.3    6e-10   
gb|EMS58467.1|  E3 ubiquitin-protein ligase RING1                     69.7    6e-10   
dbj|BAD35703.1|  zinc finger-like                                     68.9    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004137524.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  69.3    6e-10   
ref|XP_008659414.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.2    6e-10   
ref|XP_002882223.1|  hypothetical protein ARALYDRAFT_477467           69.3    7e-10   
ref|XP_008467256.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  69.3    7e-10   
ref|XP_004155306.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.0    7e-10   
ref|XP_008659413.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.6    7e-10   
ref|XP_004488573.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    7e-10   
gb|AFG56541.1|  hypothetical protein 2_4925_01                        65.9    7e-10   
ref|XP_010477810.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    7e-10   
ref|XP_010552573.1|  PREDICTED: RING-H2 finger protein ATL33-like     67.4    8e-10   
ref|XP_011070991.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    8e-10   
ref|XP_008449904.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.9    8e-10   
ref|XP_008350262.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    8e-10   
emb|CDX90972.1|  BnaC02g06250D                                        68.9    8e-10   
ref|XP_006298551.1|  hypothetical protein CARUB_v10014632mg           67.0    8e-10   
ref|XP_004299466.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.9    9e-10   
gb|AFG67337.1|  hypothetical protein 2_7298_01                        65.5    9e-10   
ref|XP_007148495.1|  hypothetical protein PHAVU_006G213500g           68.9    9e-10   
emb|CCI42106.1|  unnamed protein product                              67.8    9e-10   
gb|KFK37700.1|  hypothetical protein AALP_AA3G017500                  68.9    9e-10   
gb|AFW66241.1|  putative RING zinc finger domain superfamily protein  68.9    9e-10   
ref|XP_006349435.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.2    9e-10   
ref|XP_006650082.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.2    9e-10   
gb|AFG56549.1|  hypothetical protein 2_4925_01                        65.5    1e-09   
ref|NP_001056529.1|  Os06g0101300                                     68.6    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AFW67216.1|  putative RING zinc finger domain superfamily protein  65.9    1e-09   
dbj|BAJ99443.1|  predicted protein                                    68.9    1e-09   
ref|XP_010480093.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.6    1e-09   
ref|XP_006298099.1|  hypothetical protein CARUB_v10014141mg           68.6    1e-09   
ref|XP_007148496.1|  hypothetical protein PHAVU_006G213500g           68.9    1e-09   
gb|AEW08366.1|  hypothetical protein 2_7298_01                        65.5    1e-09   
ref|XP_003613816.1|  RING finger protein                              67.0    1e-09   
ref|XP_004977402.1|  PREDICTED: cytochrome P450 714C3-like isofor...  68.9    1e-09   
ref|XP_010276428.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.6    1e-09   
gb|KDP30629.1|  hypothetical protein JCGZ_16194                       68.6    1e-09   
ref|XP_010465177.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  68.6    1e-09   
ref|XP_002531854.1|  zinc finger protein, putative                    65.9    1e-09   Ricinus communis
ref|XP_002512193.1|  zinc finger protein, putative                    66.2    1e-09   Ricinus communis
ref|XP_004977400.1|  PREDICTED: cytochrome P450 714C3-like isofor...  68.9    1e-09   
ref|XP_010249658.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.6    1e-09   
ref|XP_009788594.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.2    1e-09   
ref|XP_007005745.1|  hypothetical protein TREMEDRAFT_63337            68.9    1e-09   
ref|XP_010108676.1|  E3 ubiquitin-protein ligase RING1                67.0    1e-09   
gb|KDP25432.1|  hypothetical protein JCGZ_20588                       65.9    1e-09   
ref|XP_010045101.1|  PREDICTED: RING finger protein 126-B-like is...  68.2    1e-09   
ref|XP_010940373.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.6    1e-09   
ref|XP_010045099.1|  PREDICTED: RING finger protein 126-B-like is...  68.2    1e-09   
ref|NP_197086.1|  RING/U-box domain-containing protein                68.6    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009400147.1|  PREDICTED: uncharacterized protein LOC103984394  69.3    1e-09   
ref|XP_009588217.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.2    1e-09   
emb|CDY20579.1|  BnaC07g12460D                                        66.6    1e-09   
ref|XP_011086955.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.6    1e-09   
gb|ACF82510.1|  unknown                                               65.5    1e-09   Zea mays [maize]
ref|XP_010045102.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.2    1e-09   
ref|XP_004135452.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    1e-09   
gb|AFG68993.1|  hypothetical protein 0_10618_01                       65.5    1e-09   
ref|XP_009132309.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.6    1e-09   
ref|XP_010917264.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.2    1e-09   
gb|KHN00667.1|  E3 ubiquitin-protein ligase RING1                     68.2    1e-09   
ref|XP_006338779.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  65.5    1e-09   
gb|ABD96901.1|  hypothetical protein                                  68.2    1e-09   Tarenaya spinosa
gb|ABR17677.1|  unknown                                               68.6    1e-09   Picea sitchensis
ref|XP_003519952.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.2    1e-09   
gb|AFG67327.1|  hypothetical protein 2_7298_01                        65.1    1e-09   
ref|XP_003620252.1|  RING finger protein                              68.2    1e-09   
ref|XP_011019833.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.2    1e-09   
ref|XP_002309072.1|  hypothetical protein POPTR_0006s08810g           67.8    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010558535.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  68.6    1e-09   
ref|XP_010322969.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.2    1e-09   
ref|XP_010532788.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    1e-09   
gb|KDO65626.1|  hypothetical protein CISIN_1g036764mg                 68.6    1e-09   
ref|XP_008446365.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.2    1e-09   
ref|XP_010031683.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    1e-09   
ref|XP_004149638.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.2    1e-09   
gb|EPS68825.1|  hypothetical protein M569_05945                       64.3    1e-09   
ref|XP_004508643.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  68.2    1e-09   
ref|XP_011013345.1|  PREDICTED: E3 ubiquitin-protein ligase RNF181    66.2    2e-09   
ref|XP_010922808.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-1   68.6    2e-09   
gb|KCW56354.1|  hypothetical protein EUGRSUZ_I02088                   68.2    2e-09   
ref|XP_004978503.1|  PREDICTED: uncharacterized protein LOC101780...  68.6    2e-09   
ref|XP_011022020.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    2e-09   
ref|XP_004978505.1|  PREDICTED: uncharacterized protein LOC101780...  68.6    2e-09   
ref|XP_010653554.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  66.6    2e-09   
ref|XP_010423131.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  67.8    2e-09   
ref|XP_010942240.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  68.2    2e-09   
ref|XP_009630475.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  64.7    2e-09   
gb|EMS62753.1|  E3 ubiquitin-protein ligase RING1                     68.2    2e-09   
ref|XP_006365161.1|  PREDICTED: RING-H2 finger protein ATL54-like     67.4    2e-09   
ref|XP_011072066.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.2    2e-09   
ref|XP_006439010.1|  hypothetical protein CICLE_v10032875mg           65.5    2e-09   
ref|XP_010653528.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  66.6    2e-09   
gb|EMS63398.1|  E3 ubiquitin-protein ligase RING1                     66.2    2e-09   
ref|XP_006415962.1|  hypothetical protein EUTSA_v10009887mg           66.2    2e-09   
ref|XP_002438034.1|  hypothetical protein SORBIDRAFT_10g007000        67.8    2e-09   Sorghum bicolor [broomcorn]
ref|XP_002305361.2|  hypothetical protein POPTR_0004s12100g           65.1    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_007041516.1|  RING/U-box superfamily protein, putative         67.8    2e-09   
ref|XP_010029440.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-1   67.8    2e-09   
ref|XP_009787392.1|  PREDICTED: uncharacterized protein LOC104235354  68.2    2e-09   
ref|XP_010487098.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  67.4    2e-09   
emb|CDY69134.1|  BnaAnng29400D                                        67.4    2e-09   
ref|XP_008240345.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.8    2e-09   
ref|XP_006440833.1|  hypothetical protein CICLE_v10018495mg           68.6    2e-09   
ref|XP_007157614.1|  hypothetical protein PHAVU_002G084300g           66.2    2e-09   
ref|XP_004301091.1|  PREDICTED: uncharacterized protein LOC101292026  68.2    2e-09   
ref|XP_006599433.1|  PREDICTED: E3 ubiquitin-protein ligase RNF11...  67.4    2e-09   
ref|XP_006345087.1|  PREDICTED: uncharacterized protein LOC102578405  68.2    2e-09   
gb|EEC74065.1|  hypothetical protein OsI_09075                        67.4    2e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_002523963.1|  zinc finger protein, putative                    64.3    2e-09   Ricinus communis
ref|XP_007032559.1|  RING/U-box superfamily protein                   64.3    2e-09   
ref|XP_002307159.2|  hypothetical protein POPTR_0005s09270g           67.0    2e-09   Populus trichocarpa [western balsam poplar]
gb|AES76470.2|  zinc finger, C3HC4 type (RING finger) protein         67.8    2e-09   
ref|XP_010653561.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  66.2    2e-09   
ref|XP_010538978.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.8    2e-09   
ref|XP_007209050.1|  hypothetical protein PRUPE_ppa022542mg           64.3    2e-09   
ref|XP_007155197.1|  hypothetical protein PHAVU_003G181600g           67.4    2e-09   
ref|XP_010318890.1|  PREDICTED: E3 ubiquitin ligase BIG BROTHER-r...  67.8    2e-09   
gb|EPS63574.1|  hypothetical protein M569_11208                       66.2    2e-09   
ref|XP_010474409.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...  67.8    2e-09   
ref|XP_010100889.1|  E3 ubiquitin-protein ligase RING1                67.8    2e-09   
gb|KDP20275.1|  hypothetical protein JCGZ_06861                       67.8    2e-09   
ref|XP_010091370.1|  E3 ubiquitin-protein ligase RING1-like protein   67.4    2e-09   
ref|XP_010491437.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  67.8    2e-09   
gb|KDO48740.1|  hypothetical protein CISIN_1g0186891mg                67.8    2e-09   
ref|XP_009410041.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.0    2e-09   
ref|XP_010538977.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    2e-09   
ref|XP_006441411.1|  hypothetical protein CICLE_v10020902mg           67.8    2e-09   
ref|XP_006287823.1|  hypothetical protein CARUB_v10001041mg           67.8    2e-09   
gb|AFK42291.1|  unknown                                               65.5    2e-09   
ref|XP_010423130.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  67.8    2e-09   
ref|XP_010098653.1|  E3 ubiquitin-protein ligase RING1                67.0    2e-09   
ref|XP_010088395.1|  E3 ubiquitin-protein ligase RING1                67.8    2e-09   
ref|XP_002316133.1|  zinc finger family protein                       65.9    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_011070454.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     67.4    2e-09   
ref|XP_006493415.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    3e-09   
gb|KDP39315.1|  hypothetical protein JCGZ_01072                       64.3    3e-09   
gb|ACU13632.1|  unknown                                               65.1    3e-09   Glycine max [soybeans]
ref|XP_009103111.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.9    3e-09   
ref|XP_003517795.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.9    3e-09   
ref|XP_002444481.1|  hypothetical protein SORBIDRAFT_07g022610        65.1    3e-09   
ref|XP_009399929.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    3e-09   
ref|XP_009587466.1|  PREDICTED: putative RING-H2 finger protein A...  65.9    3e-09   
ref|XP_011088125.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...  65.5    3e-09   
ref|XP_010315798.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  66.2    3e-09   
ref|XP_009630602.1|  PREDICTED: uncharacterized protein LOC104120530  67.0    3e-09   
ref|XP_002890641.1|  zinc finger family protein                       65.5    3e-09   
gb|EYU35570.1|  hypothetical protein MIMGU_mgv1a013774mg              65.5    3e-09   
ref|XP_011017226.1|  PREDICTED: E3 ubiquitin-protein ligase RNF181    65.9    3e-09   
ref|XP_002520538.1|  zinc finger protein, putative                    67.0    3e-09   
ref|XP_008442524.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.0    3e-09   
ref|XP_008803049.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    3e-09   
ref|XP_011089756.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  67.4    3e-09   
ref|XP_006845926.1|  hypothetical protein AMTR_s00157p00061490        66.2    3e-09   
ref|XP_010257723.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    3e-09   
ref|XP_010044920.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  67.4    3e-09   
gb|ABK96350.1|  unknown                                               65.5    3e-09   
ref|XP_003557912.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    3e-09   
emb|CDO97539.1|  unnamed protein product                              66.6    3e-09   
ref|XP_003634328.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     67.4    3e-09   
ref|XP_010498994.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...  65.1    3e-09   
ref|XP_009338606.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.0    3e-09   
emb|CAN79596.1|  hypothetical protein VITISV_042386                   67.4    3e-09   
ref|XP_002311305.1|  zinc finger family protein                       65.5    3e-09   
gb|ACN31910.1|  unknown                                               67.0    3e-09   
ref|NP_001050120.1|  Os03g0351800                                     66.6    3e-09   
ref|XP_006305221.1|  hypothetical protein CARUB_v10009589mg           67.0    3e-09   
ref|XP_004536886.1|  PREDICTED: E3 ubiquitin-protein ligase RNF18...  64.3    3e-09   
ref|XP_006827275.1|  hypothetical protein AMTR_s00010p00263520        66.2    3e-09   
gb|ABK95155.1|  unknown                                               65.5    3e-09   
ref|XP_008677285.1|  PREDICTED: RHC1A isoform X1                      67.0    3e-09   
emb|CDM85845.1|  unnamed protein product                              66.6    4e-09   
ref|XP_011089755.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  67.4    4e-09   
ref|XP_004964254.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    4e-09   
ref|XP_004231341.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    4e-09   
gb|AFW79534.1|  putative RING zinc finger domain superfamily prot...  67.0    4e-09   
emb|CDX81263.1|  BnaC09g06740D                                        66.2    4e-09   
gb|AFW64339.1|  putative RING zinc finger domain superfamily protein  66.6    4e-09   
ref|XP_008797578.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  67.4    4e-09   
ref|XP_009355932.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.0    4e-09   
ref|XP_007209024.1|  hypothetical protein PRUPE_ppa023903mg           67.0    4e-09   
ref|XP_004141355.1|  PREDICTED: E3 ubiquitin-protein ligase AIP2-...  66.6    4e-09   
ref|XP_009146494.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     66.6    4e-09   
ref|XP_002325407.2|  hypothetical protein POPTR_0019s04790g           66.6    4e-09   
ref|XP_006663753.1|  PREDICTED: uncharacterized protein LOC102707444  67.4    4e-09   
gb|KFK44584.1|  hypothetical protein AALP_AA1G277700                  65.1    4e-09   
gb|KHN12201.1|  E3 ubiquitin-protein ligase RING1                     65.5    4e-09   
ref|XP_009787540.1|  PREDICTED: putative RING-H2 finger protein A...  65.5    4e-09   
ref|NP_001148003.1|  protein binding protein                          67.0    4e-09   
ref|XP_004238823.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.1    4e-09   
ref|XP_008452807.1|  PREDICTED: E3 ubiquitin-protein ligase AIP2      66.6    4e-09   
ref|XP_008803022.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-2   67.4    4e-09   
ref|XP_011075512.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    4e-09   
ref|XP_008646313.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    4e-09   
ref|NP_001147077.1|  RING finger protein 126                          66.6    4e-09   
ref|XP_006394096.1|  hypothetical protein EUTSA_v10005668mg           66.6    4e-09   
ref|XP_007149115.1|  hypothetical protein PHAVU_005G042300g           65.1    4e-09   
ref|XP_009604770.1|  PREDICTED: uncharacterized protein LOC104099468  67.0    4e-09   
ref|XP_006650016.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    4e-09   
gb|KDP31400.1|  hypothetical protein JCGZ_11776                       67.0    4e-09   
gb|ACN40798.1|  unknown                                               66.2    4e-09   
ref|XP_006359295.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    4e-09   
gb|EMT01795.1|  RING finger protein 126                               65.9    4e-09   
ref|XP_004306482.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  64.3    5e-09   
ref|XP_008240686.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    5e-09   
gb|AEW08272.1|  hypothetical protein 2_4925_01                        63.5    5e-09   
gb|EYU28768.1|  hypothetical protein MIMGU_mgv1a013604mg              65.1    5e-09   
ref|XP_009373743.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...  67.0    5e-09   
gb|EXX59304.1|  Etp1p                                                 66.2    5e-09   
ref|XP_007205441.1|  hypothetical protein PRUPE_ppa007829mg           66.6    5e-09   
ref|XP_007149114.1|  hypothetical protein PHAVU_005G042300g           64.7    5e-09   
ref|XP_006661882.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    5e-09   
ref|XP_009416223.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1...  65.9    5e-09   
ref|XP_002514591.1|  zinc finger protein, putative                    67.0    5e-09   
ref|XP_003623661.1|  E3 ubiquitin-protein ligase CG7694               67.0    5e-09   
ref|XP_003573045.2|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.2    5e-09   
ref|XP_006485723.1|  PREDICTED: uncharacterized protein LOC102607084  67.0    5e-09   
ref|XP_003613818.1|  RING finger protein                              65.1    5e-09   
ref|XP_008797580.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  66.6    5e-09   
ref|XP_004954037.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.2    5e-09   
ref|NP_001049982.1|  Os03g0324900                                     66.2    5e-09   
ref|XP_008797579.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  66.6    5e-09   
gb|AFW64340.1|  putative RING zinc finger domain superfamily protein  66.2    5e-09   
ref|XP_010228681.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    5e-09   
ref|XP_010069810.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8      66.6    5e-09   
ref|XP_010522349.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-2   66.6    5e-09   
gb|KEH34728.1|  E3 ubiquitin-protein ligase RING1-like protein        66.6    6e-09   
ref|XP_011003690.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.2    6e-09   
ref|XP_007037687.1|  Zinc finger protein, putative isoform 2          66.6    6e-09   
ref|XP_008459699.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.1    6e-09   
emb|CDY36794.1|  BnaA03g10920D                                        67.0    6e-09   
ref|XP_009394851.1|  PREDICTED: uncharacterized protein LOC103980247  66.6    6e-09   
ref|XP_002452884.1|  hypothetical protein SORBIDRAFT_04g034270        66.2    6e-09   
ref|XP_008791925.1|  PREDICTED: immediate early response gene 5-l...  65.9    6e-09   
gb|KEF58190.1|  hypothetical protein A1O9_06116                       66.2    6e-09   
ref|XP_002587088.1|  hypothetical protein BRAFLDRAFT_285971           63.9    6e-09   
ref|XP_010935556.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.2    6e-09   
ref|XP_007037686.1|  Zinc finger protein, putative isoform 1          66.6    6e-09   
ref|XP_002991361.1|  hypothetical protein SELMODRAFT_429694           66.6    6e-09   
ref|XP_004967690.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    6e-09   
ref|XP_004304178.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  64.3    6e-09   
ref|XP_003563882.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  66.6    6e-09   
gb|EYU26548.1|  hypothetical protein MIMGU_mgv1a025958mg              65.9    6e-09   
emb|CDY40265.1|  BnaA07g09350D                                        64.7    6e-09   
ref|XP_002988229.1|  hypothetical protein SELMODRAFT_451319           66.6    6e-09   
ref|XP_009630493.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.6    6e-09   
ref|XP_004489711.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.2    6e-09   
ref|XP_011108497.1|  hypothetical protein H072_2510                   66.6    7e-09   
emb|CBI19044.3|  unnamed protein product                              65.9    7e-09   
ref|XP_003291873.1|  hypothetical protein DICPUDRAFT_24826            62.0    7e-09   
gb|KDP24313.1|  hypothetical protein JCGZ_25609                       65.1    7e-09   
ref|NP_564263.1|  RING/U-box domain-containing protein                64.3    7e-09   
ref|XP_010939389.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.9    7e-09   
ref|XP_006305588.1|  hypothetical protein CARUB_v10010252mg           64.7    7e-09   
ref|XP_010687250.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.2    7e-09   
ref|XP_009103020.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  65.1    7e-09   
ref|XP_004304177.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  64.3    7e-09   
ref|XP_007040245.1|  Uncharacterized protein TCM_016258               64.7    7e-09   
ref|XP_003635910.1|  E3 ubiquitin-protein ligase RNF181               66.2    7e-09   
gb|ESA18349.1|  hypothetical protein GLOINDRAFT_344623                66.2    7e-09   
ref|NP_001064906.2|  Os10g0487400                                     65.9    7e-09   
ref|XP_008352981.1|  PREDICTED: uncharacterized protein LOC103416517  65.1    7e-09   
ref|XP_002531415.1|  zinc finger protein, putative                    65.9    7e-09   
ref|XP_010657767.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    7e-09   
ref|XP_002284442.2|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.9    7e-09   
dbj|BAK03398.1|  predicted protein                                    65.9    7e-09   
ref|XP_002455457.1|  hypothetical protein SORBIDRAFT_03g011120        66.2    7e-09   
ref|XP_010664227.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.9    8e-09   
ref|XP_002273461.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  64.7    8e-09   
ref|XP_008643657.1|  PREDICTED: LOC100282229 isoform X1               66.2    8e-09   
ref|XP_010032583.1|  PREDICTED: E3 ubiquitin-protein ligase RLIM-...  65.9    8e-09   
gb|KDP32779.1|  hypothetical protein JCGZ_12071                       65.9    8e-09   
gb|EEC68744.1|  hypothetical protein OsI_37259                        64.7    8e-09   
ref|XP_001777565.1|  predicted protein                                66.6    8e-09   
ref|XP_008238708.1|  PREDICTED: uncharacterized protein LOC103337325  65.9    8e-09   
ref|NP_001148613.1|  LOC100282229                                     66.2    8e-09   
ref|XP_004302753.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.2    8e-09   
gb|AAM63417.1|  unknown                                               63.9    8e-09   
ref|XP_002882822.1|  zinc finger family protein                       65.5    8e-09   
ref|XP_009421331.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  66.2    8e-09   
ref|XP_008379833.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  63.5    8e-09   
ref|XP_010536808.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.9    8e-09   
ref|XP_009357359.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     65.5    8e-09   
ref|XP_009143292.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.9    9e-09   
ref|NP_001169469.1|  LOC100383341                                     65.9    9e-09   
ref|XP_006827726.1|  hypothetical protein AMTR_s00009p00261080        64.3    9e-09   
ref|XP_004964907.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    9e-09   
ref|XP_003557291.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.9    9e-09   
ref|XP_007142752.1|  hypothetical protein PHAVU_007G014100g           65.9    9e-09   
ref|XP_010261518.1|  PREDICTED: uncharacterized protein LOC104600329  66.2    9e-09   
ref|XP_009131038.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  65.5    9e-09   
gb|KDP41209.1|  hypothetical protein JCGZ_15616                       64.3    9e-09   
ref|XP_007030174.1|  RING/U-box superfamily protein, putative         65.9    9e-09   
ref|XP_002894508.1|  zinc finger family protein                       65.9    9e-09   
ref|XP_007224367.1|  hypothetical protein PRUPE_ppa020945mg           65.9    9e-09   
ref|XP_010044497.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  63.5    9e-09   
ref|XP_010549960.1|  PREDICTED: E3 ubiquitin-protein ligase Praja-1   65.9    9e-09   
ref|NP_001149547.1|  RHC1A                                            65.5    9e-09   
ref|XP_008235557.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  62.4    9e-09   
emb|CDY23599.1|  BnaC05g39950D                                        66.2    1e-08   
gb|KEH32065.1|  zinc finger, C3HC4 type (RING finger) protein         65.9    1e-08   
gb|AES75238.2|  C3HC4-type RING zinc finger protein                   65.5    1e-08   
ref|XP_009804057.1|  PREDICTED: putative RING-H2 finger protein A...  64.3    1e-08   
ref|XP_006660191.1|  PREDICTED: E3 ubiquitin-protein ligase Praja...  63.2    1e-08   
ref|XP_010922891.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    1e-08   
ref|XP_009338574.1|  PREDICTED: E3 ubiquitin-protein ligase SGR9,...  65.5    1e-08   
ref|XP_009416225.1|  PREDICTED: E3 ubiquitin-protein ligase SDIR1...  65.1    1e-08   
gb|EYU22293.1|  hypothetical protein MIMGU_mgv1a006235mg              65.9    1e-08   
ref|XP_007142767.1|  hypothetical protein PHAVU_007G015200g           65.5    1e-08   
emb|CAN68008.1|  hypothetical protein VITISV_014950                   65.9    1e-08   
gb|EAY89830.1|  hypothetical protein OsI_11376                        65.9    1e-08   
ref|XP_010087330.1|  E3 ubiquitin-protein ligase RING1                65.9    1e-08   
gb|EAZ16486.1|  hypothetical protein OsJ_31957                        65.5    1e-08   
ref|XP_010262557.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.9    1e-08   
ref|XP_010500491.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    1e-08   
ref|XP_002525210.1|  zinc finger protein, putative                    65.1    1e-08   
ref|XP_006051183.1|  PREDICTED: E3 ubiquitin-protein ligase RNF11...  64.7    1e-08   
ref|XP_008366125.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.9    1e-08   
ref|XP_008358830.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  65.9    1e-08   
ref|XP_005204053.1|  PREDICTED: E3 ubiquitin-protein ligase RNF11...  64.7    1e-08   
gb|EEE58975.1|  hypothetical protein OsJ_10676                        65.5    1e-08   
ref|XP_007663744.1|  PREDICTED: E3 ubiquitin-protein ligase RNF181    63.2    1e-08   
gb|KCW58279.1|  hypothetical protein EUGRSUZ_H00970                   65.9    1e-08   
emb|CDP18533.1|  unnamed protein product                              65.5    1e-08   
ref|XP_003597390.1|  RING finger protein                              65.5    1e-08   
ref|XP_009365082.1|  PREDICTED: uncharacterized protein LOC103954954  65.5    1e-08   
ref|XP_011027570.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    1e-08   
emb|CCA20603.1|  conserved hypothetical protein                       65.1    1e-08   
ref|XP_001759471.1|  predicted protein                                60.8    1e-08   
ref|XP_010507641.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.1    1e-08   
emb|CDY20473.1|  BnaC04g05710D                                        65.5    1e-08   
ref|XP_006299900.1|  hypothetical protein CARUB_v10016109mg           64.7    1e-08   
ref|XP_002513785.1|  zinc finger protein, putative                    65.5    1e-08   
ref|XP_009416356.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    1e-08   
gb|EAY78992.1|  hypothetical protein OsI_34100                        65.5    1e-08   
ref|NP_001130065.1|  uncharacterized protein LOC100191157             65.5    1e-08   
emb|CDY26096.1|  BnaC06g11000D                                        65.1    1e-08   
ref|XP_010045619.1|  PREDICTED: uncharacterized protein LOC104434379  65.9    1e-08   
emb|CDX74839.1|  BnaA05g05850D                                        65.1    1e-08   
ref|XP_004515274.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    1e-08   
ref|XP_007182210.1|  PREDICTED: E3 ubiquitin-protein ligase RNF11...  64.3    1e-08   
ref|NP_001061993.1|  Os08g0464400                                     63.5    1e-08   
ref|XP_004291350.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  65.5    1e-08   
emb|CDX72127.1|  BnaC08g27470D                                        65.1    1e-08   
ref|XP_002525456.1|  zinc finger protein, putative                    65.5    1e-08   
ref|XP_011027569.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    1e-08   
ref|XP_008647279.1|  PREDICTED: uncharacterized protein LOC100191...  65.1    1e-08   
ref|XP_011027568.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    1e-08   
ref|XP_008351262.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  65.5    1e-08   
ref|XP_008220737.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8-...  65.5    1e-08   
dbj|BAJ87106.1|  predicted protein                                    62.4    1e-08   
ref|XP_010413605.1|  PREDICTED: uncharacterized RING finger prote...  65.1    1e-08   
ref|XP_002990229.1|  hypothetical protein SELMODRAFT_18755            61.6    1e-08   
emb|CDO98521.1|  unnamed protein product                              65.5    1e-08   
gb|EZF30512.1|  hypothetical protein H101_05855                       63.5    1e-08   
ref|XP_011006162.1|  PREDICTED: uncharacterized protein LOC105112236  65.5    1e-08   
ref|XP_002522447.1|  zinc finger protein, putative                    63.9    1e-08   
ref|XP_009792116.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    1e-08   
gb|EAZ07263.1|  hypothetical protein OsI_29509                        63.5    1e-08   
ref|XP_008811090.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.5    1e-08   



>ref|XP_009612572.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
 gb|ABJ16351.1| cytokinesis negative regulator RCP1 [Nicotiana tabacum]
Length=302

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 78/123 (63%), Gaps = 6/123 (5%)
 Frame = +1

Query  319  ANGFAPSGDNLRINLRL--ELHHHASNDDRNPLTADTNLRHSQASEFSAQSLQQGIKLDS  492
            A  F PS DN  ++      L HH +  +  P+    N +HS AS+ + ++L+ GIK+ S
Sbjct  81   ATNFTPSDDNFLLDSPYLHRLIHHLTTANDAPIP---NRQHSPASKAAMEALE-GIKISS  136

Query  493  SILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
             +LE D  I CP+CKD   LD+E K+LPCKH +H++CI  WL++ NSCP+CRF++P + +
Sbjct  137  LMLENDPVIPCPVCKDNFLLDMEVKMLPCKHMYHSDCILPWLEVNNSCPVCRFKLPTEEE  196

Query  673  AGE  681
              E
Sbjct  197  DDE  199



>ref|XP_009785025.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
 ref|XP_009785031.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
Length=302

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 78/123 (63%), Gaps = 6/123 (5%)
 Frame = +1

Query  319  ANGFAPSGDNLRINLRL--ELHHHASNDDRNPLTADTNLRHSQASEFSAQSLQQGIKLDS  492
            A  F PS DN  ++      L HH +  +  P+    N +HS AS+ + ++L+ GIK+ S
Sbjct  81   ATTFTPSDDNFLLDSPYLHRLIHHLTTANDAPIP---NRQHSPASKAAVEALE-GIKVSS  136

Query  493  SILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
             +LE D  I CP+CKD   LD+E K+LPCKH +H++CI  WL++ NSCP+CRF++P + +
Sbjct  137  LMLENDPVIPCPVCKDNFLLDVEVKMLPCKHMYHSDCILPWLEVNNSCPVCRFKLPTEEE  196

Query  673  AGE  681
              E
Sbjct  197  DDE  199



>ref|XP_004248833.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_010327515.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=291

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 74/119 (62%), Gaps = 10/119 (8%)
 Frame = +1

Query  328  FAPSGDNLRINL----RLELHHHASNDDRNPLTADTNLRHSQASEFSAQSLQQGIKLDSS  495
            F PS DN  +N     RL  H   +ND   P     NL ++ AS  +  +L+  +++ SS
Sbjct  74   FTPSDDNFLLNSPYLHRLIRHLTTTNDAPTP-----NLHNNSASRSAVAALEL-LQITSS  127

Query  496  ILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            +LE D  I C +CKD+  LD++ K+LPCKH +H++CI  WL++ NSCP+CRFQ+P + D
Sbjct  128  MLENDPVILCAVCKDQFLLDMQVKMLPCKHMYHSDCILPWLEMNNSCPVCRFQLPTEED  186



>ref|XP_006339950.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum tuberosum]
Length=291

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 73/119 (61%), Gaps = 10/119 (8%)
 Frame = +1

Query  328  FAPSGDNLRINL----RLELHHHASNDDRNPLTADTNLRHSQASEFSAQSLQQGIKLDSS  495
            F PS DN  +N     RL  H   +ND      A T   H+ ++  SA +  + +++ SS
Sbjct  74   FTPSDDNFLLNSPYLHRLIRHLTTTND------APTPNPHNNSASRSAVAALELLQITSS  127

Query  496  ILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            +LE D  I C +CKD+  LD++ K+LPCKH +H++CI  WL++ NSCP+CRFQ+P + D
Sbjct  128  MLENDPVIPCAVCKDQFLLDMQVKMLPCKHMYHSDCILPWLEMNNSCPVCRFQLPTEED  186



>emb|CDP07668.1| unnamed protein product [Coffea canephora]
Length=291

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 68/102 (67%), Gaps = 3/102 (3%)
 Frame = +1

Query  373  LHHHASNDDRNP-LTADTNLR-HSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDEL  546
            +HH  +N +  P  T+ T  + +S AS+ + +SL   I +DS+ L++D  + CP+CKD+ 
Sbjct  50   IHHLMTNTNNIPNQTSPTPPQFNSPASKHAIESLSHVI-VDSTFLDLDPSLVCPVCKDQF  108

Query  547  FLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
             +  E KVLPC H +HA+CI  WL++ NSCP+CR+++P + D
Sbjct  109  LVSSEAKVLPCNHTYHADCIVPWLEMNNSCPVCRYRLPSESD  150



>ref|XP_011086925.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=293

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 66/114 (58%), Gaps = 13/114 (11%)
 Frame = +1

Query  328  FAPSGDNLRIN---LRLELHHHASNDDRNPLTADTNLRHSQASEFSAQSLQQGIKLDSSI  498
            F PS DN  +N   L   +HH  +       TA  N R + A + S ++LQ+     +  
Sbjct  78   FTPSDDNFLLNSPYLHRLIHHLTTT------TAAANPRSNPAPKSSIEALQEV----TIT  127

Query  499  LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            LE D  + CP+CKD   ++   K++PCKH +H++CI  WL+I NSCP+CRF++P
Sbjct  128  LESDPTMLCPVCKDPFVVNSVVKMMPCKHSYHSDCIVPWLEINNSCPVCRFKLP  181



>ref|XP_010257498.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
 ref|XP_010257499.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
 ref|XP_010257500.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=345

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 68/114 (60%), Gaps = 9/114 (8%)
 Frame = +1

Query  331  APSGDNLRINL----RLELHHHASNDDRNPLTADTNLRHSQASEFSAQSLQQGIKLDSSI  498
            APS D+  ++     RL  H   S+DD +   +  +   + AS+ S +S+   IK+ SS 
Sbjct  121  APSSDHYLLDSQYLDRLIQHLAHSDDDTDSYRSPGS---TPASKSSVESIPT-IKITSSF  176

Query  499  LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            L  D  I C +CKDE  +D+E K LPCKH +H+NCI  WL   NSCP+CRF++P
Sbjct  177  LSSD-TILCAVCKDEFVVDVEAKQLPCKHIYHSNCILPWLSQHNSCPVCRFRLP  229



>gb|KDP27158.1| hypothetical protein JCGZ_19857 [Jatropha curcas]
Length=192

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +1

Query  496  ILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDA  675
            I+  DR   CPIC DE+ +  E + +PCKH FH+ CI +WL I  SCPICRF MP++ D 
Sbjct  84   IVTEDRVEDCPICLDEMSIGGEIREMPCKHGFHSGCIEKWLGIHGSCPICRFGMPVEDDG  143



>ref|XP_011009647.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2-like [Populus 
euphratica]
Length=191

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +1

Query  454  SAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNS  633
            +  S+   IK+ S +LEMD  + C +CKD+  +D+E K LPC H +H  CI  WL   NS
Sbjct  86   TIDSIIPTIKITSCMLEMDPMLVCAVCKDQFLIDVEAKQLPCSHLYHPGCILPWLSNHNS  145

Query  634  CPICRFQMPIKV  669
            CP+CRFQ+   V
Sbjct  146  CPLCRFQLQTPV  157



>ref|XP_006369477.1| hypothetical protein POPTR_0001s23810g [Populus trichocarpa]
 gb|ERP66046.1| hypothetical protein POPTR_0001s23810g [Populus trichocarpa]
Length=191

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +1

Query  454  SAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNS  633
            +  S+   IK+ S +LEMD  + C +CKD+  +D+E K LPC H +H  CI  WL   NS
Sbjct  86   TIDSIIPTIKITSCMLEMDPMLVCAVCKDQFLIDVEAKQLPCSHLYHPGCILPWLSNHNS  145

Query  634  CPICRFQMPIKV  669
            CP+CRFQ+   V
Sbjct  146  CPLCRFQLQTPV  157



>ref|XP_006280544.1| hypothetical protein CARUB_v10026486mg [Capsella rubella]
 gb|EOA13442.1| hypothetical protein CARUB_v10026486mg [Capsella rubella]
Length=416

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  496  ILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            ++E D G+CC +CK+E+ L  E   LPC+H++H+ CI  WL I+N+CP+CRF++P
Sbjct  360  VMENDDGMCCAVCKEEMNLGKEVAELPCRHRYHSECIVPWLGIRNTCPVCRFELP  414



>ref|XP_008390049.1| PREDICTED: E3 ubiquitin-protein ligase RNF181 [Malus domestica]
Length=238

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  493  SILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIK  666
            +I+E D G  C IC ++  +D   K +PCKH+FH +CI RWLK++ SCP+CRF MP +
Sbjct  112  TIVEADVGSECSICLEQFEVDGVAKEMPCKHRFHGDCIERWLKLRGSCPVCRFTMPFE  169



>ref|XP_009609375.1| PREDICTED: E3 ubiquitin-protein ligase RNF181-like [Nicotiana 
tomentosiformis]
Length=179

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +1

Query  505  MDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            ++ G+ C IC  E  +D E K +PCKHK+H +C+ +WLKI  SCPICR++MP+  D
Sbjct  80   VEEGVECAICLLEFEVDGEAKEMPCKHKYHVDCVDKWLKINGSCPICRYKMPVDED  135



>ref|XP_011093399.1| PREDICTED: E3 ubiquitin-protein ligase SDIR1-like [Sesamum indicum]
Length=247

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 56/96 (58%), Gaps = 8/96 (8%)
 Frame = +1

Query  421  TNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHAN  600
            T    + A+  SA    Q I + S   + D  + CP+CKD   L+   K++PCKH +H++
Sbjct  94   TTTSTANAAPRSAIDSLQEITITS---DSDPDMLCPVCKDPFLLNSTEKMMPCKHTYHSD  150

Query  601  CISRWLKIKNSCPICRFQMPI----KVDAG-EFDRL  693
            CI  WLKI NSCP+CRF++P     K ++G  F RL
Sbjct  151  CIIPWLKINNSCPVCRFKLPAGEEGKAESGVRFARL  186



>ref|XP_011098772.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=214

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +1

Query  514  GICCPICKDELFL--DLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            G+ CPIC  E  +  D+E K +PC+HKFHA+CI +WL I  SCP+CRF MP+
Sbjct  96   GLECPICLAEYEVNGDMEVKEMPCRHKFHADCIDKWLGIHGSCPVCRFNMPV  147



>ref|XP_002271062.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Vitis vinifera]
Length=312

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = +1

Query  442  ASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLK  621
            AS  S ++L    K+  S L++D  + C +CKD+  +D+E K LPC H +H++CI  WL 
Sbjct  123  ASRASLEALPT-FKITPSFLQLDPILFCAVCKDQFVVDVEAKRLPCNHIYHSDCILPWLS  181

Query  622  IKNSCPICRFQMPIKVDAGE  681
             +NSCP+CRF++P   D GE
Sbjct  182  QQNSCPLCRFRLP--TDEGE  199



>ref|XP_006408425.1| hypothetical protein EUTSA_v10020821mg [Eutrema salsugineum]
 gb|ESQ49878.1| hypothetical protein EUTSA_v10020821mg [Eutrema salsugineum]
Length=413

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 48/67 (72%), Gaps = 3/67 (4%)
 Frame = +1

Query  493  SILEMDRG-ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKV  669
            ++ E+++G I C +CKDE+ ++ +  +LPC+H +H  CI  WLKI+N+CP+CRF+ P   
Sbjct  336  TVEEVNKGNIFCAVCKDEMVIEEKVNMLPCRHSYHGECIVSWLKIRNTCPVCRFEFP--T  393

Query  670  DAGEFDR  690
            D  E++R
Sbjct  394  DDFEYER  400



>ref|NP_200890.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 dbj|BAB10102.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97383.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=419

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  508  DRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            D  +CC +CK+E+ +  E   LPC+HK+H+ CI  WL I+N+CP+CRF++P
Sbjct  367  DDAVCCAVCKEEMIVGKEVAELPCRHKYHSECIVPWLGIRNTCPVCRFELP  417



>emb|CDY34722.1| BnaA01g33030D [Brassica napus]
Length=390

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = +1

Query  517  ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            + C +CKDE+ L+ E K LPC+H +H  CI+ WL I+N+CP+CRF++P   D  E++R
Sbjct  320  VVCAVCKDEMVLEEEVKRLPCRHLYHGECITPWLGIRNTCPVCRFELP--TDDVEYER  375



>emb|CDX69973.1| BnaA10g23220D [Brassica napus]
Length=360

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 5/90 (6%)
 Frame = +1

Query  421  TNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHAN  600
            TNLR    +  S       ++LD   +E D G  C +CKDE+ +  E   LPC HK+H  
Sbjct  262  TNLRRFPPASRSFIKDLPMVQLD---VEKDEGAVCAVCKDEMDVGTEAVGLPCDHKYHTE  318

Query  601  CISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            CI  WLK +N+CP+CR+++P   D+ +++R
Sbjct  319  CIVPWLKTRNTCPVCRYELP--TDSTDYER  346



>ref|XP_009122921.1| PREDICTED: E3 ubiquitin-protein ligase CIP8 [Brassica rapa]
Length=379

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 5/71 (7%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            ++LD   +E D G  C +CKDE+ +  E   LPC HK+H  CI  WLK +N+CP+CR+++
Sbjct  300  VQLD---VEKDEGAVCAVCKDEMDVGTEAVGLPCDHKYHTECIVPWLKTRNTCPVCRYEL  356

Query  658  PIKVDAGEFDR  690
            P   D+ +++R
Sbjct  357  P--TDSTDYER  365



>ref|XP_009360490.1| PREDICTED: E3 ubiquitin-protein ligase RNF181 [Pyrus x bretschneideri]
Length=212

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  496  ILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIK  666
            I+E D G  C IC ++  +D   + +PCKH+FH +CI  WLK++ SCP+CRF MP++
Sbjct  107  IVEADVGSECSICLEQFEVDGVAREMPCKHRFHGDCIETWLKLRGSCPVCRFTMPVE  163



>ref|XP_004306138.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Fragaria vesca 
subsp. vesca]
Length=126

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +1

Query  424  NLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANC  603
            +LRH+     +  + +  I+  S+++  + G  C IC +   +  E K + C H+FH++C
Sbjct  35   DLRHADRPPVAVGASRASIETMSTVIVTEEGTDCSICLESFKVSGEAKEMACTHRFHSDC  94

Query  604  ISRWLKIKNSCPICRFQMPIKVD  672
            I  WL+++ SCP+CRF MP+  D
Sbjct  95   IENWLRMRASCPLCRFTMPVNSD  117



>ref|XP_006849546.1| hypothetical protein AMTR_s00024p00170820 [Amborella trichopoda]
 gb|ERN11127.1| hypothetical protein AMTR_s00024p00170820 [Amborella trichopoda]
Length=291

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  508  DRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEF  684
            D  I CP+CKDE  +D E K LPC H +H +CI  WL+  NSCP+CRF +P +   G  
Sbjct  74   DLAIYCPVCKDEFEIDDEVKQLPCNHLYHGDCILPWLQTHNSCPVCRFVLPTEEHLGNL  132



>ref|XP_009598845.1| PREDICTED: E3 ubiquitin-protein ligase RNF126-like [Nicotiana 
tomentosiformis]
Length=181

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  505  MDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIK  666
             ++GI C IC  E  +  E K +PC+HKFH+NC+++WL I  SCPICR++MPI+
Sbjct  85   FEQGIECAICLLEFEVGDEAKEMPCRHKFHSNCVAKWLGINGSCPICRYKMPIE  138



>ref|XP_009767704.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
Length=263

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  505  MDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            ++ G+ C IC  E  +  E K +PCKHK+H +C+ +WLKI  SCPICR++MP+
Sbjct  81   VEEGVECAICLLEFEVGGEAKEMPCKHKYHVDCVEKWLKINGSCPICRYKMPV  133



>gb|KFK23879.1| hypothetical protein AALP_AAs51353U000300 [Arabis alpina]
Length=363

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +1

Query  502  EMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
            E D G+ C +CKDE+ +  +   LPC HK+H  CI  WL+++N+CP+CR+++P   D  E
Sbjct  289  EKDEGVACTVCKDEMEIGNKAVQLPCNHKYHGECIVPWLRVRNTCPVCRYELP--TDDAE  346

Query  682  FDR  690
            +++
Sbjct  347  YEQ  349



>ref|XP_002871309.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47568.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +1

Query  508  DRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFD  687
            D G+ C +CKDE+ +  E   LPC HK+H+ CI  WLK++N+CP+CR+++P   D  E++
Sbjct  312  DDGVVCAVCKDEMNIGNEAVQLPCNHKYHSECIVPWLKVRNTCPVCRYELP--TDDAEYE  369

Query  688  R  690
            +
Sbjct  370  Q  370



>ref|XP_007223926.1| hypothetical protein PRUPE_ppa011037mg [Prunus persica]
 gb|EMJ25125.1| hypothetical protein PRUPE_ppa011037mg [Prunus persica]
Length=226

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 7/72 (10%)
 Frame = +1

Query  496  ILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI----  663
            I+E D G  C IC ++  +D   K +PCKH+FH  CI +WLKI  SCP+CR+ MP+    
Sbjct  107  IVEGDGGSECVICLEQFEIDGVAKEMPCKHRFHGGCIEKWLKIHGSCPVCRYNMPVDEEE  166

Query  664  ---KVDAGEFDR  690
               K+D  + +R
Sbjct  167  PGKKIDGADRER  178



>emb|CDP02240.1| unnamed protein product [Coffea canephora]
Length=251

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +1

Query  514  GICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            G+ C IC  EL +  E K +PCKH +HA CI +WL I+ SCP+CR++MP++ D
Sbjct  100  GLDCAICLAELEVGEEAKQMPCKHHYHAGCIDKWLGIQGSCPVCRYRMPVEQD  152



>ref|XP_004951613.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Setaria italica]
Length=358

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 59/116 (51%), Gaps = 21/116 (18%)
 Frame = +1

Query  385  ASNDDRNPLTADTNL--------------RHSQASEFSAQSLQQGIKLDSSILEMDRGIC  522
            A  +D +P  AD NL              R   AS  + + LQ+ +     + E +    
Sbjct  224  AGAEDTDPGDADMNLLEVLAAAAHVGEAVRQLPASRAAVEGLQEVV-----LSEEEASHG  278

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            C +CKD +   L    LPCKH FHA CI  WL I+N+CP+CRF++P   DA E+DR
Sbjct  279  CAVCKDVIAAGLSVLKLPCKHYFHAECIRPWLAIRNTCPVCRFELPTG-DA-EYDR  332



>emb|CDY34721.1| BnaA01g33040D [Brassica napus]
Length=390

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  517  ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            + C +CKDE+ L+ E K LPC+H +H  CI+ WL I+N+CP+CRF++P
Sbjct  320  VVCAVCKDEMVLEEEVKRLPCRHLYHGECITPWLGIRNTCPVCRFELP  367



>ref|XP_008221607.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Prunus mume]
Length=226

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +1

Query  496  ILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            I+E D G  C IC ++  +D   K +PCKH+FH  CI +WLKI  SCP+CR+ MP+
Sbjct  107  IVEGDGGSECVICLEQFEIDGVAKEMPCKHRFHGGCIEKWLKIHGSCPVCRYNMPV  162



>ref|XP_002871686.1| hypothetical protein ARALYDRAFT_909558 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47945.1| hypothetical protein ARALYDRAFT_909558 [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +1

Query  484  LDSSILEM-DRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            +D +I E+ +R I C ICKDE+ +  + K LPCKH +H  CI  WL I+N+CP+CR+++P
Sbjct  274  VDFTIEELSNRNIVCAICKDEVVVKEKVKRLPCKHYYHGECIIPWLGIRNTCPVCRYELP  333

Query  661  IKVDAGEFDR  690
               D  E++R
Sbjct  334  --TDDLEYER  341



>dbj|BAA77204.1| ring finger protein [Cicer arietinum]
Length=131

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 53/86 (62%), Gaps = 4/86 (5%)
 Frame = +1

Query  439  QASEFSAQSLQQGIKLDSSILEMDRG--ICCPICKDELFLDLEFKVLPCKHKFHANCISR  612
            + S  +A+S  + + L     E  +G  I C +CKDE+ L+ + + LPC H +H +CI  
Sbjct  46   KGSPPTAKSFVENLPLVELTEEELKGKDIVCAVCKDEVMLEEKVRKLPCSHCYHGDCILP  105

Query  613  WLKIKNSCPICRFQMPIKVDAGEFDR  690
            WL I+N+CP+CRF++P   D  +++R
Sbjct  106  WLSIRNTCPVCRFELP--TDDADYER  129



>ref|XP_010453731.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Camelina sativa]
Length=232

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +1

Query  475  GIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQ  654
             + + S  L     I C ICKD++ +D + K LPCKH +H +CI  WL I+N+CP+CR++
Sbjct  149  AVVITSEQLSNGNTIVCAICKDDIVVDEKAKRLPCKHYYHGDCIVPWLGIRNTCPVCRYE  208

Query  655  MPIKVDAGEFDR  690
            +P   D  +++R
Sbjct  209  LP--TDDPDYER  218



>ref|XP_009117930.1| PREDICTED: E3 ubiquitin-protein ligase CIP8 [Brassica rapa]
Length=390

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  517  ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            + C +CKDE+ L+ E K LPC+H +H  CI+ WL I+N+CP+CRF++P
Sbjct  320  VVCAVCKDEMVLEEEVKRLPCRHLYHGECITPWLGIRNTCPVCRFELP  367



>ref|XP_002864705.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40964.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=413

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +1

Query  508  DRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            D  +CC +CK+E+ +  E   LPC+HK+H+ CI  WL I+N+CP+CRF++P
Sbjct  361  DDAVCCAVCKEEMNVGKEVAELPCRHKYHSECIVPWLGIRNTCPVCRFELP  411



>gb|KDP20379.1| hypothetical protein JCGZ_05262 [Jatropha curcas]
Length=229

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 4/86 (5%)
 Frame = +1

Query  406  PLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKH  585
            P  AD+N       + +  S+   IK+ SS L+ D  + C +CKD+  +D++ K+LPC H
Sbjct  72   PFFADSN---PSGDDTTIDSVIPTIKITSSFLDDDPVLLCAVCKDQFVIDVDAKLLPCNH  128

Query  586  KFHANCISRWLKIK-NSCPICRFQMP  660
             FH +CI  WL    +SCP+CRFQ+P
Sbjct  129  LFHPDCILPWLNSNHDSCPLCRFQLP  154



>ref|XP_008461232.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
Length=332

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            IK+ S++L+ D+ + C ICKD+  L++E K LPC H +H +CI  WL   +SCP+CRF++
Sbjct  146  IKVTSALLDEDQVLICAICKDQFLLEVEAKQLPCSHLYHPDCILPWLSNHDSCPLCRFKL  205

Query  658  P  660
            P
Sbjct  206  P  206



>ref|XP_006438705.1| hypothetical protein CICLE_v10032639mg [Citrus clementina]
 gb|ESR51945.1| hypothetical protein CICLE_v10032639mg [Citrus clementina]
Length=232

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (60%), Gaps = 5/89 (6%)
 Frame = +1

Query  400  RNPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPC  579
            RN +  D     S+AS  +  S++ G   + ++     G  C +C +E  +    + +PC
Sbjct  88   RNFVGKDGQPPASKASVEAMPSIKVGESEEEAL-----GGECVVCLEEYEVGEVAREMPC  142

Query  580  KHKFHANCISRWLKIKNSCPICRFQMPIK  666
            KHKFHANCI +WL I+ SCP+CR++MP++
Sbjct  143  KHKFHANCIEKWLGIQGSCPVCRYKMPVE  171



>emb|CDY21513.1| BnaC09g47790D [Brassica napus]
Length=356

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            ++LD   +E D G  C +CKDE+ +  E   LPC HK+H  CI  WLK +N+CP+CR+++
Sbjct  277  VQLD---VEKDEGAFCAVCKDEMDIGTEAVGLPCDHKYHTECIVPWLKTRNTCPVCRYEL  333

Query  658  P  660
            P
Sbjct  334  P  334



>ref|XP_006483144.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Citrus sinensis]
Length=232

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (60%), Gaps = 5/89 (6%)
 Frame = +1

Query  400  RNPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPC  579
            RN +  D     S+AS  +  S++ G   + ++     G  C +C +E  +    + +PC
Sbjct  88   RNFVGKDGQPPASKASVEAMPSIKVGESEEEAL-----GGECVVCLEEYEVGEVAREMPC  142

Query  580  KHKFHANCISRWLKIKNSCPICRFQMPIK  666
            KHKFHANCI +WL I+ SCP+CR++MP++
Sbjct  143  KHKFHANCIEKWLGIQGSCPVCRYKMPVE  171



>ref|XP_003711952.1| hypothetical protein MGG_06087 [Magnaporthe oryzae 70-15]
 gb|EHA52145.1| hypothetical protein MGG_06087 [Magnaporthe oryzae 70-15]
Length=606

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +1

Query  442  ASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLK  621
            ASE + + L++  KLD  +L  D  + C IC D+L L  E  VLPCKH FH  C++ WLK
Sbjct  290  ASEAAIEKLER-KKLDEKMLGTDETVECTICMDDLSLGDEATVLPCKHFFHGECVTIWLK  348

Query  622  IKNSCPICRFQMPIKVDA  675
              N+CPICR  M  +  A
Sbjct  349  EHNTCPICRTPMEQRSSA  366



>gb|ELQ40024.1| hypothetical protein OOU_Y34scaffold00464g107 [Magnaporthe oryzae 
Y34]
 gb|ELQ59359.1| hypothetical protein OOW_P131scaffold01360g1 [Magnaporthe oryzae 
P131]
Length=633

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +1

Query  442  ASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLK  621
            ASE + + L++  KLD  +L  D  + C IC D+L L  E  VLPCKH FH  C++ WLK
Sbjct  317  ASEAAIEKLER-KKLDEKMLGTDETVECTICMDDLSLGDEATVLPCKHFFHGECVTIWLK  375

Query  622  IKNSCPICRFQMPIKVDA  675
              N+CPICR  M  +  A
Sbjct  376  EHNTCPICRTPMEQRSSA  393



>ref|XP_010443889.1| PREDICTED: uncharacterized protein LOC104726672 [Camelina sativa]
Length=415

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  496  ILEMDRGICC-PICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            ++E   G+CC  +CK+E+ L  E   LPC+HK+H+ CI  WL I+N+CP+CRF++P
Sbjct  358  VMENGDGMCCCAVCKEEMSLGEEVAELPCRHKYHSECIVPWLGIRNTCPVCRFELP  413



>gb|KHN15189.1| E3 ubiquitin-protein ligase RING1-like [Glycine soja]
Length=165

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = +1

Query  493  SILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            S++  +  + C +CKDE  +    KVLPC H++H +CI  WL I+N+CP+CR++ P   D
Sbjct  93   SVVVTEADVVCAVCKDEFGVGEGVKVLPCSHRYHEDCIVPWLGIRNTCPVCRYEFP--TD  150

Query  673  AGEFDR  690
              +++R
Sbjct  151  DADYER  156



>emb|CAN63309.1| hypothetical protein VITISV_017174 [Vitis vinifera]
Length=310

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +1

Query  439  QASEFSAQSLQQG---IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCIS  609
            + S  +A+S+ Q    ++L    LE +  + C +CKDE+ L+ + K LPC H +H +CI 
Sbjct  217  KGSPPAAKSVVQNLPVVELTQQYLEKNN-VVCAVCKDEILLEEKVKRLPCSHHYHGDCIV  275

Query  610  RWLKIKNSCPICRFQMPIKVDAGEFDRLGS  699
             WL I+N+CP+CR+++P   D  E++ + S
Sbjct  276  PWLSIRNTCPVCRYELP--TDDPEYEHMKS  303



>ref|XP_009420273.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
Length=282

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 56/104 (54%), Gaps = 12/104 (12%)
 Frame = +1

Query  400  RNPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPC  579
            + P   D N   +  ++ +A      +K++ S+        C +C ++L +  E + +PC
Sbjct  132  QRPEETDLNRHGTPPAQKAAVEAMPTVKIEESL-------SCLVCLEDLEISAEAREMPC  184

Query  580  KHKFHANCISRWLKIKNSCPICRFQMPIKVD-----AGEFDRLG  696
            KHKFHA CI  WL++ +SCPICRFQMP +        G  DR+G
Sbjct  185  KHKFHAGCILPWLELHSSCPICRFQMPTEESTSSSAGGNGDRVG  228



>ref|XP_010420259.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=195

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +1

Query  475  GIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQ  654
             + + S  L     I C ICKD++ +D + K LPC H +H  CI  WL I+N+CP+CR++
Sbjct  112  AVVITSEQLSNGNTIVCAICKDDIVVDEKAKRLPCNHYYHGECIVPWLGIRNTCPVCRYE  171

Query  655  MPIKVDAGEFDR  690
            +P   D  E++R
Sbjct  172  LP--TDDPEYER  181



>ref|XP_006400108.1| hypothetical protein EUTSA_v10013685mg [Eutrema salsugineum]
 gb|ESQ41561.1| hypothetical protein EUTSA_v10013685mg [Eutrema salsugineum]
Length=410

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 45/64 (70%), Gaps = 3/64 (5%)
 Frame = +1

Query  502  EMDRG-ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAG  678
            E+ +G I C ICKDE+ ++ + K LPCKH +H  CI  WL I+N+CP+CR+++P   D  
Sbjct  330  ELSKGDIVCAICKDEVVVEEKVKRLPCKHYYHGECIIPWLGIRNTCPVCRYELP--TDDV  387

Query  679  EFDR  690
            E++R
Sbjct  388  EYER  391



>ref|XP_011085754.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=199

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +1

Query  409  LTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHK  588
            L  ++ LR   + E    + +  I+    +   D G+ CPIC  E + ++E K +PC+H+
Sbjct  61   LEMESLLREVASKEGPLPASKASIESLPRVQVSDPGLECPICLAE-YGEVEVKEMPCRHR  119

Query  589  FHANCISRWLKIKNSCPICRFQMP  660
            FH  CI +WL I  SCP+CR+ MP
Sbjct  120  FHPGCIEKWLGIHGSCPVCRYSMP  143



>ref|XP_010492431.1| PREDICTED: E3 ubiquitin-protein ligase Praja-1-like [Camelina 
sativa]
Length=346

 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +1

Query  475  GIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQ  654
             + + S  L     I C ICKD++ +D + K LPCKH +H  CI  WL I+N+CP+CR++
Sbjct  263  AVVITSEQLSNGNTIVCAICKDDIVVDEKAKRLPCKHYYHGECIVPWLGIRNTCPVCRYE  322

Query  655  MPIKVDAGEFDR  690
            +P   D  E++R
Sbjct  323  LP--TDDPEYER  332



>emb|CAB93715.1| putative protein [Arabidopsis thaliana]
Length=530

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +1

Query  508  DRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFD  687
            D G+ C +CKDE+ +  +   LPC HK+H+ CI  WLK++N+CP+CR+++P   D  E++
Sbjct  304  DGGLVCAVCKDEMNIGNKAVQLPCNHKYHSECIVPWLKVRNTCPVCRYELP--TDDAEYE  361

Query  688  R  690
            +
Sbjct  362  Q  362



>ref|XP_010660538.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related [Vitis vinifera]
Length=397

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +1

Query  454  SAQSLQQG---IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKI  624
            +A+S+ Q    ++L    LE +  + C +CKDE+ L+ + K LPC H +H +CI  WL I
Sbjct  309  AAKSVVQNLPVVELTQQYLEKNN-VVCAVCKDEILLEEKVKRLPCSHHYHGDCIVPWLSI  367

Query  625  KNSCPICRFQMPIKVDAGEFDRLGS  699
            +N+CP+CR+++P   D  E++ + S
Sbjct  368  RNTCPVCRYELP--TDDPEYEHMKS  390



>ref|XP_003532982.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=311

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            +KL  + L  D    CPICKDE  LD+E + LPCKH +H++CI  WL++ N+CP+CR+++
Sbjct  189  VKLTQTHLASDPN--CPICKDEFLLDMEARELPCKHFYHSDCIIPWLRMHNTCPVCRYEL  246



>ref|XP_004135900.1| PREDICTED: uncharacterized protein LOC101219937 [Cucumis sativus]
Length=334

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            IK+ S++L+ D  + C ICKD+  L++E K LPC H +H +CI  WL   +SCP+CRF++
Sbjct  148  IKVTSALLDEDPVLICAICKDQFLLEVEAKQLPCSHLYHPDCILPWLSNHDSCPLCRFKL  207

Query  658  P  660
            P
Sbjct  208  P  208



>ref|XP_004158213.1| PREDICTED: uncharacterized LOC101219937 [Cucumis sativus]
 gb|KGN45176.1| hypothetical protein Csa_7G429620 [Cucumis sativus]
Length=333

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            IK+ S++L+ D  + C ICKD+  L++E K LPC H +H +CI  WL   +SCP+CRF++
Sbjct  147  IKVTSALLDEDPVLICAICKDQFLLEVEAKQLPCSHLYHPDCILPWLSNHDSCPLCRFKL  206

Query  658  P  660
            P
Sbjct  207  P  207



>ref|XP_010456764.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2-like [Camelina 
sativa]
Length=411

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  520  CCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            CC +CK+E+ L  E   LPC+HK+H+ CI  WL I+N+CP+CRF++P
Sbjct  363  CCAVCKEEMSLGEEVAELPCRHKYHSECIVPWLGIRNTCPVCRFEVP  409



>gb|EPS71177.1| hypothetical protein M569_03584, partial [Genlisea aurea]
Length=104

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +1

Query  442  ASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLK  621
            AS+ + ++L++ +     + E DR   C +CK+E     E   +PC+H +H  CI  WL 
Sbjct  31   ASKSAVENLRRTVLTKREVGE-DRAPACAVCKEEFAAGEEATAMPCRHMYHGECIVPWLG  89

Query  622  IKNSCPICRFQMPI  663
            I+N+CP+CR+++P 
Sbjct  90   IRNTCPVCRYELPT  103



>ref|XP_009126069.1| PREDICTED: E3 ubiquitin-protein ligase RNF12-like [Brassica rapa]
Length=397

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = +1

Query  487  DSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIK  666
            D  I   +  I C ICKDE+ ++ + K LPC+H +H  CI  WL I+N+CP+CR+++P  
Sbjct  317  DVGITSEELSIGCAICKDEIVVEEKVKRLPCRHYYHKECIVPWLGIRNTCPVCRYELP--  374

Query  667  VDAGEFDR  690
             D  E++R
Sbjct  375  TDDLEYER  382



>gb|KDO82940.1| hypothetical protein CISIN_1g026833mg [Citrus sinensis]
Length=232

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 2/77 (3%)
 Frame = +1

Query  442  ASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLK  621
            AS+ S +++   IK+  S  E   G C  +C +E  +    + +PCKHKFHANCI +WL 
Sbjct  99   ASKASVEAMPS-IKVGESEEEALGGECV-VCLEEYEVGEVAREMPCKHKFHANCIEKWLG  156

Query  622  IKNSCPICRFQMPIKVD  672
            I  SCP+CR++MP++ +
Sbjct  157  INGSCPVCRYKMPVEEE  173



>ref|NP_850790.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 dbj|BAC42311.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD95088.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD93876.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91256.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=376

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +1

Query  508  DRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFD  687
            D G+ C +CKDE+ +  +   LPC HK+H+ CI  WLK++N+CP+CR+++P   D  E++
Sbjct  304  DGGLVCAVCKDEMNIGNKAVQLPCNHKYHSECIVPWLKVRNTCPVCRYELP--TDDAEYE  361

Query  688  R  690
            +
Sbjct  362  Q  362



>ref|XP_006297779.1| hypothetical protein CARUB_v10013815mg [Capsella rubella]
 gb|EOA30677.1| hypothetical protein CARUB_v10013815mg [Capsella rubella]
Length=415

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 52/71 (73%), Gaps = 2/71 (3%)
 Frame = +1

Query  454  SAQSLQQGIKL-DSSILEMDRG-ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIK  627
            +A+S+ + + + + ++ E+++G + C ICKDE+ ++ + + LPCKH +H  CI  WL I+
Sbjct  315  AAKSVTEDLPVVELTVEELNKGNVVCAICKDEMVVEEKVRRLPCKHFYHGECIMPWLGIR  374

Query  628  NSCPICRFQMP  660
            N+CP+CR+++P
Sbjct  375  NTCPVCRYELP  385



>ref|XP_008907457.1| hypothetical protein PPTG_13494 [Phytophthora parasitica INRA-310]
 gb|ETI43684.1| hypothetical protein F443_11427 [Phytophthora parasitica P1569]
 gb|ETK83780.1| hypothetical protein L915_11118 [Phytophthora parasitica]
 gb|ETL37191.1| hypothetical protein L916_11015 [Phytophthora parasitica]
 gb|ETL90350.1| hypothetical protein L917_10924 [Phytophthora parasitica]
 gb|ETM43657.1| hypothetical protein L914_10948 [Phytophthora parasitica]
 gb|ETN07081.1| hypothetical protein PPTG_13494 [Phytophthora parasitica INRA-310]
 gb|ETP13502.1| hypothetical protein F441_11345 [Phytophthora parasitica CJ01A1]
 gb|ETP41604.1| hypothetical protein F442_11316 [Phytophthora parasitica P10297]
Length=284

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +1

Query  430  RHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCIS  609
            RH  A   + + +++  K+  + +E+D    CP+CKD   +D E   LPC+H FH +CI 
Sbjct  193  RHG-APPAAKEVVEKLPKVKITQVEVDGSAECPVCKDFFAVDDEVHRLPCEHSFHPDCIL  251

Query  610  RWLKIKNSCPICRFQMPIKVDAGEFDR  690
             WLK  NSCP+CRF++P   D  +++R
Sbjct  252  PWLKQHNSCPLCRFELP--TDDPDYER  276



>gb|AAL25539.1| AT5g08140/T22D6_80 [Arabidopsis thaliana]
 gb|AAN38702.1| At5g08140/T22D6_80 [Arabidopsis thaliana]
Length=376

 Score = 72.0 bits (175),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = +1

Query  508  DRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFD  687
            D G+ C +CKDE+ +  +   LPC HK+H+ CI  WLK++N+CP+CR+++P   D  E++
Sbjct  304  DGGLVCAVCKDEMNIGNKAVQLPCNHKYHSECIVPWLKVRNTCPVCRYELP--TDDAEYE  361

Query  688  R  690
            +
Sbjct  362  Q  362



>gb|ETO72364.1| hypothetical protein F444_11492 [Phytophthora parasitica P1976]
Length=284

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 3/87 (3%)
 Frame = +1

Query  430  RHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCIS  609
            RH  A   + + +++  K+  + +E+D    CP+CKD   +D E   LPC+H FH +CI 
Sbjct  193  RHG-APPAAKEVVEKLPKVKITQVEVDGSAECPVCKDFFAVDDEVHRLPCEHSFHPDCIL  251

Query  610  RWLKIKNSCPICRFQMPIKVDAGEFDR  690
             WLK  NSCP+CRF++P   D  +++R
Sbjct  252  PWLKQHNSCPLCRFELP--TDDPDYER  276



>ref|NP_001148976.1| protein binding protein [Zea mays]
 gb|ACG33701.1| protein binding protein [Zea mays]
 gb|AFW64644.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=502

 Score = 72.4 bits (176),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = +1

Query  490  SSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKV  669
            S   E++ G+ CP+CKD++ +    K LPC H +H++CI  WL  +N+CP+CR+++P   
Sbjct  320  SKGYEINGGVTCPVCKDDMPITTVAKQLPCMHLYHSSCILPWLNSRNTCPVCRYELP--T  377

Query  670  DAGEFDR  690
            D  E++R
Sbjct  378  DDSEYER  384



>ref|XP_010453730.1| PREDICTED: E3 ubiquitin-protein ligase Praja-1-like isoform X1 
[Camelina sativa]
Length=344

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +1

Query  475  GIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQ  654
             + + S  L     I C ICKD++ +D + K LPCKH +H +CI  WL I+N+CP+CR++
Sbjct  261  AVVITSEQLSNGNTIVCAICKDDIVVDEKAKRLPCKHYYHGDCIVPWLGIRNTCPVCRYE  320

Query  655  MPIKVDAGEFDR  690
            +P   D  +++R
Sbjct  321  LP--TDDPDYER  330



>ref|XP_010483737.1| PREDICTED: uncharacterized protein LOC104762191 [Camelina sativa]
Length=418

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  496  ILEMDRGICC-PICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            ++E   G+CC  +CK+E+ +  E   LPC+HK+H+ CI  WL I+N+CP+CRF++P
Sbjct  361  VMENGDGMCCCAVCKEEMSMGEEVAELPCRHKYHSECIVPWLGIRNTCPVCRFEVP  416



>ref|XP_009515775.1| hypothetical protein PHYSODRAFT_294053 [Phytophthora sojae]
 gb|EGZ28500.1| hypothetical protein PHYSODRAFT_294053 [Phytophthora sojae]
Length=297

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 67/118 (57%), Gaps = 5/118 (4%)
 Frame = +1

Query  340  GDNLRINLRLELHHHASND-DRNPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRG  516
            GD    N+   ++    ND +R  + AD +L+H  A   + + +++  K+  +  ++D  
Sbjct  176  GDYAFGNMANVINQLMQNDPNRREVVAD-DLKHG-APPAAKEVVEKLPKVKITQSDVDGS  233

Query  517  ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
              CP+CKD   +D E   LPC+H FH +CI  WLK  NSCP+CRF++P   D  +++R
Sbjct  234  AECPVCKDFFAVDDEVHRLPCEHSFHPDCILPWLKDHNSCPLCRFELP--TDDPDYER  289



>ref|XP_002448908.1| hypothetical protein SORBIDRAFT_05g001320 [Sorghum bicolor]
 gb|EES07896.1| hypothetical protein SORBIDRAFT_05g001320 [Sorghum bicolor]
Length=1013

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +1

Query  502  EMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
            E + G+ CP+CKD++ +    K LPC H +HA+CI  WL  +N+CP+CR+++P   D  E
Sbjct  339  ERNGGVTCPVCKDDMPITTVAKQLPCMHLYHASCILPWLSCRNTCPVCRYELP--TDDPE  396

Query  682  FDR  690
            ++R
Sbjct  397  YER  399



>gb|KFK27843.1| hypothetical protein AALP_AA8G437200 [Arabis alpina]
Length=513

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  496  ILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            I E D  +CC +CK+E+ +      LPC+HK+H+ CI  WL I+N+CP+CRF++P + D
Sbjct  455  ITENDDPMCCAVCKEEMNVGKVVAELPCRHKYHSECIVPWLGIRNTCPVCRFELPSEED  513



>ref|XP_006399301.1| hypothetical protein EUTSA_v10013909mg [Eutrema salsugineum]
 gb|ESQ40754.1| hypothetical protein EUTSA_v10013909mg [Eutrema salsugineum]
Length=362

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 44/67 (66%), Gaps = 2/67 (3%)
 Frame = +1

Query  499  LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAG  678
            +E D G  C +CKDE+ +  +   LPC HK+H+ CI  WL+ +N+CP+CR+++P   D  
Sbjct  288  VENDEGAVCAVCKDEMSVGSKAVRLPCNHKYHSECIVPWLRTRNTCPVCRYELP--TDDA  345

Query  679  EFDRLGS  699
            E+++  S
Sbjct  346  EYEQRKS  352



>ref|XP_008231400.1| PREDICTED: E3 ubiquitin-protein ligase RLIM [Prunus mume]
Length=250

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 56/98 (57%), Gaps = 2/98 (2%)
 Frame = +1

Query  379  HHASNDDRNP-LTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLD  555
            H  ++DDR P  TA        AS+ S  ++   +K+ SS+L++D  + C +CKD     
Sbjct  78   HPINHDDRLPSPTAAVPPSSLPASKASVDAIP-TLKITSSMLDLDPLLLCAVCKDPFLHS  136

Query  556  LEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKV  669
            ++ K LPC H +H +CI  WL   +SCP+CRFQ+P   
Sbjct  137  VDAKQLPCNHLYHPHCILPWLSSHSSCPLCRFQLPTDT  174



>gb|AFG50296.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
Length=140

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  481  KLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            K+    L  D    C +CK++  +  E + LPCKH +H  CI  WLK+ +SCP+CRFQMP
Sbjct  1    KISEEHLRHDYSSECTVCKEDFEVGEETRQLPCKHLYHHGCIMPWLKMHSSCPVCRFQMP  60

Query  661  IKVDAG  678
             + + G
Sbjct  61   TEEEGG  66



>gb|AEW08280.1| hypothetical protein 2_5309_02, partial [Pinus radiata]
 gb|AFG50284.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50285.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50286.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50287.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50288.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50289.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50290.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50291.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50292.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50293.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50294.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50295.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50297.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50298.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50299.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50300.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
 gb|AFG50301.1| hypothetical protein 2_5309_02, partial [Pinus taeda]
Length=140

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  481  KLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            K+    L  D    C +CK++  +  E + LPCKH +H  CI  WLK+ +SCP+CRFQMP
Sbjct  1    KISEEHLRHDYSSECTVCKEDFEVGEETRQLPCKHLYHHGCIMPWLKMHSSCPVCRFQMP  60

Query  661  IKVDAG  678
             + + G
Sbjct  61   TEEEGG  66



>gb|KHN26687.1| E3 ubiquitin-protein ligase RING1 [Glycine soja]
Length=713

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            +KL  + L  D    CPICKDE  LD+E + LPCKH +H++CI  WL++ N+CP+CR+++
Sbjct  189  VKLTQTHLASDPN--CPICKDEFLLDMEARELPCKHFYHSDCIIPWLRMHNTCPVCRYEL  246



>gb|KHN33467.1| E3 ubiquitin-protein ligase RING1 [Glycine soja]
Length=315

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            +KL  + L  D    CPICKDE  LD+E + LPCKH +H++CI  WL++ N+CP+CR+++
Sbjct  186  VKLTQTHLASDPN--CPICKDEFELDMEARELPCKHFYHSDCIIPWLRMHNTCPVCRYEL  243



>ref|XP_009136400.1| PREDICTED: E3 ubiquitin-protein ligase TOM1-like [Brassica rapa]
Length=417

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +1

Query  514  GICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
             +CC +C++E+ +  E   LPC+HK+H  CI  WL I+N+CP+CRF++P
Sbjct  360  AMCCAVCREEMSVGNEVAELPCRHKYHGECIVPWLGIRNTCPVCRFELP  408



>emb|CDO98567.1| unnamed protein product [Coffea canephora]
Length=391

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA      +K+   +L  D   C  +CKD   LD E K +PCKH +H+
Sbjct  192  DPNRYGTPPASKSAVEGLPTVKMTEELLATDSSQCA-VCKDSFLLDEEAKQMPCKHIYHS  250

Query  598  NCISRWLKIKNSCPICRFQMPI  663
            +CI  WL++ NSCP+CR+++P 
Sbjct  251  DCILPWLELHNSCPVCRYELPT  272



>ref|XP_006288146.1| hypothetical protein CARUB_v10001383mg [Capsella rubella]
 gb|EOA21044.1| hypothetical protein CARUB_v10001383mg [Capsella rubella]
Length=336

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 42/58 (72%), Gaps = 2/58 (3%)
 Frame = +1

Query  517  ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            I C ICKD++ ++ + K LPCKH +H +CI  WL I+N+CP+CR+++P   D  E++R
Sbjct  262  IVCAICKDDIVVEEKAKRLPCKHFYHGDCIVPWLGIRNTCPVCRYELP--TDDVEYER  317



>ref|XP_010667286.1| PREDICTED: E3 ubiquitin-protein ligase RING1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=357

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 57/106 (54%), Gaps = 14/106 (13%)
 Frame = +1

Query  370  ELHHHASNDDRN--PLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDE  543
            EL +  + +DR   P   DT +      + +A+ + QG            G  CP+CK+E
Sbjct  183  ELINELTENDRPGPPPAPDTAIEAVPLVKLTAEHVAQG------------GSECPVCKEE  230

Query  544  LFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
              +  E + LPCKH +H++CI  WL++ NSCP+CR ++P+  D  E
Sbjct  231  FEIGCEVRELPCKHVYHSDCIVPWLRLHNSCPVCRTELPVIHDQCE  276



>ref|XP_003547055.2| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Glycine max]
 ref|XP_006597325.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Glycine max]
Length=321

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            +KL  + L  D    CPICKDE  LD+E + LPCKH +H++CI  WL++ N+CP+CR+++
Sbjct  186  VKLTQTHLASDPN--CPICKDEFELDMEARELPCKHFYHSDCIIPWLRMHNTCPVCRYEL  243



>ref|XP_009761708.1| PREDICTED: uncharacterized RING finger protein P32A8.03c-like 
[Nicotiana sylvestris]
Length=181

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  505  MDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIK  666
             ++GI C IC  E  +  E K +PC H FH+NC+++WL I  SCPICR++MPI+
Sbjct  85   FEQGIECAICLLEFEVGDEAKEMPCTHNFHSNCVAKWLGINGSCPICRYKMPIE  138



>gb|KHN30758.1| E3 ubiquitin-protein ligase RING1-like [Glycine soja]
Length=380

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            ++L    L   + + C ICKDE+ L+ + + LPC H +H +CI  WL I+N+CP+CRF++
Sbjct  292  VELSKEELLQGKNVACAICKDEILLEEKVRRLPCSHCYHGDCIFPWLGIRNTCPVCRFEL  351

Query  658  P  660
            P
Sbjct  352  P  352



>ref|XP_010667287.1| PREDICTED: E3 ubiquitin-protein ligase RING1 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=345

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 57/106 (54%), Gaps = 14/106 (13%)
 Frame = +1

Query  370  ELHHHASNDDRN--PLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDE  543
            EL +  + +DR   P   DT +      + +A+ + QG            G  CP+CK+E
Sbjct  183  ELINELTENDRPGPPPAPDTAIEAVPLVKLTAEHVAQG------------GSECPVCKEE  230

Query  544  LFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
              +  E + LPCKH +H++CI  WL++ NSCP+CR ++P+  D  E
Sbjct  231  FEIGCEVRELPCKHVYHSDCIVPWLRLHNSCPVCRTELPVIHDQCE  276



>ref|XP_010501167.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=355

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  493  SILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            S ++M+  + C +C D+  +  E K++PCKHKFHA+C+  WL++ +SCP+CRFQ+P
Sbjct  221  STVKMEETLQCSVCLDDFEIGTEAKLMPCKHKFHADCLLPWLELHSSCPVCRFQLP  276



>emb|CDY51628.1| BnaCnng21200D [Brassica napus]
Length=406

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +1

Query  514  GICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
             +CC +C++E+ +  E   LPC+HK+H  CI  WL I+N+CP+CRF++P
Sbjct  349  AMCCAVCREEMSVGNEVAELPCRHKYHGECIVPWLGIRNTCPVCRFELP  397



>ref|XP_011010655.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=145

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDRLGS  699
            C IC +E+ +  E + +PCKH FH+ CI +WL+I  SCP+CRF M + V+  E    GS
Sbjct  86   CAICLNEIGIGSELREMPCKHGFHSGCIEQWLRIHGSCPVCRFTM-MPVEGAEVGASGS  143



>emb|CDX85531.1| BnaA02g02820D [Brassica napus]
Length=343

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = +1

Query  517  ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            I C ICKDE+ ++ + K LPC+H +H  CI  WL I+N+CP+CR+++P   D  E++R
Sbjct  273  IGCAICKDEIVVEEKVKRLPCRHYYHKECIVPWLGIRNTCPVCRYELP--TDDLEYER  328



>gb|AFG53307.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53308.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53309.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53310.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53311.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53312.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53313.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53314.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53315.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53316.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53319.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53320.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
Length=146

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            IK+   +L  D    C +CKDE  +  E + +PCKH +H+ CI  WL+  NSCP+CR++M
Sbjct  3    IKITQDLLVTDS-TQCAVCKDEFEVGTEVRQMPCKHMYHSVCILPWLEQHNSCPVCRYEM  61

Query  658  P  660
            P
Sbjct  62   P  62



>ref|XP_007151431.1| hypothetical protein PHAVU_004G045600g [Phaseolus vulgaris]
 gb|ESW23425.1| hypothetical protein PHAVU_004G045600g [Phaseolus vulgaris]
Length=379

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            ++L    L   + + C ICKDE+ L+ + + LPC H +H +CI  WL+I+N+CP+CRF++
Sbjct  291  VELSKEELLQGKNLACAICKDEILLEEKVRRLPCSHCYHGDCILPWLEIRNTCPVCRFEL  350

Query  658  P  660
            P
Sbjct  351  P  351



>emb|CDP02365.1| unnamed protein product [Coffea canephora]
Length=402

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  505  MDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            M   + C +CKDE+ L +E   LPC H +H +CI  WL I+N+CP+CRF++P
Sbjct  319  MANDVVCAVCKDEISLGVEVTRLPCSHHYHQDCIMPWLSIRNTCPLCRFELP  370



>ref|XP_010485476.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2-like [Camelina 
sativa]
 ref|XP_010485477.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2-like [Camelina 
sativa]
Length=417

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 53/96 (55%), Gaps = 14/96 (15%)
 Frame = +1

Query  403  NPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCK  582
            NP  A + +      EF+ + L +G             I C +CKDE+ ++ + + LPC 
Sbjct  316  NPPAAKSVIEDLPVVEFTVEKLNKG------------NIVCAVCKDEIVVEEKVRRLPCS  363

Query  583  HKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            H +H +CI  WL ++N+CP+CR+++P   D  E++R
Sbjct  364  HFYHGDCIMPWLGMRNTCPVCRYELP--TDDLEYER  397



>gb|KCW52328.1| hypothetical protein EUGRSUZ_J01748 [Eucalyptus grandis]
Length=401

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = +1

Query  499  LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI---KV  669
            ++M   + C +C D+  +  E K +PCKHKFH+ CI  WL++ +SCP+CRFQ+PI   K 
Sbjct  249  VKMTENVQCSVCLDDFHVGAEAKEMPCKHKFHSGCILPWLELHSSCPVCRFQLPIDESKT  308

Query  670  DA  675
            DA
Sbjct  309  DA  310



>ref|XP_010032834.1| PREDICTED: E3 ubiquitin-protein ligase RNF126-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010032835.1| PREDICTED: E3 ubiquitin-protein ligase RNF126-like isoform X2 
[Eucalyptus grandis]
 ref|XP_010032836.1| PREDICTED: E3 ubiquitin-protein ligase RNF126-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010032837.1| PREDICTED: E3 ubiquitin-protein ligase RNF126-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010032838.1| PREDICTED: E3 ubiquitin-protein ligase RNF126-like isoform X1 
[Eucalyptus grandis]
Length=370

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = +1

Query  499  LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI---KV  669
            ++M   + C +C D+  +  E K +PCKHKFH+ CI  WL++ +SCP+CRFQ+PI   K 
Sbjct  228  VKMTENVQCSVCLDDFHVGAEAKEMPCKHKFHSGCILPWLELHSSCPVCRFQLPIDESKT  287

Query  670  DA  675
            DA
Sbjct  288  DA  289



>ref|XP_007151827.1| hypothetical protein PHAVU_004G078500g [Phaseolus vulgaris]
 gb|ESW23821.1| hypothetical protein PHAVU_004G078500g [Phaseolus vulgaris]
Length=321

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIK  666
            C +C +++ + +E K +PCKHKFHA+CI  WLK+  SCP+CRFQMP +
Sbjct  226  CTVCLEDVEVGIEAKEMPCKHKFHADCIVSWLKLHGSCPVCRFQMPYE  273



>gb|AFG53317.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
 gb|AFG53318.1| hypothetical protein 0_8445_01, partial [Pinus taeda]
Length=146

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            IK+   +L  D    C +CKDE  +  E + +PCKH +H+ CI  WL+  NSCP+CR++M
Sbjct  3    IKITQDLLVTDS-TQCAVCKDEFEVGTEVRQMPCKHMYHSVCILPWLEQHNSCPVCRYEM  61

Query  658  P  660
            P
Sbjct  62   P  62



>gb|EEE65310.1| hypothetical protein OsJ_20551 [Oryza sativa Japonica Group]
Length=1054

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +1

Query  403  NPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCK  582
            + LT D       A E + +SL   + +    L  D G  CP+CK+E  L    + LPCK
Sbjct  149  DALTQDDRPGPPPAPESAIESLPT-VHISPDHLPADGGSECPVCKEEFELGEAARELPCK  207

Query  583  HKFHANCISRWLKIKNSCPICRFQMP  660
            H +H++CI  WL++ NSCP+CR ++P
Sbjct  208  HAYHSDCIVPWLRLHNSCPVCRQEVP  233



>gb|KCW52329.1| hypothetical protein EUGRSUZ_J01748 [Eucalyptus grandis]
Length=380

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = +1

Query  499  LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI---KV  669
            ++M   + C +C D+  +  E K +PCKHKFH+ CI  WL++ +SCP+CRFQ+PI   K 
Sbjct  228  VKMTENVQCSVCLDDFHVGAEAKEMPCKHKFHSGCILPWLELHSSCPVCRFQLPIDESKT  287

Query  670  DA  675
            DA
Sbjct  288  DA  289



>gb|KHN02654.1| E3 ubiquitin-protein ligase RING1-like [Glycine soja]
Length=374

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            ++L    L   + + C ICKDE+ L+ + + LPC H +H +CI  WL I+N+CP+CRF++
Sbjct  286  VELSKEELLQGKNVACAICKDEVLLEEKVRRLPCSHCYHGDCILPWLDIRNTCPVCRFEL  345

Query  658  P  660
            P
Sbjct  346  P  346



>gb|EEC79816.1| hypothetical protein OsI_21260 [Oryza sativa Indica Group]
Length=221

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 0/94 (0%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA +    + + + ++  D G  C +C D+  L    K LPCKH FH 
Sbjct  50   DPNRYGTPPAAKSAVAALPDVAVSADMMAADGGAQCAVCMDDFHLGAAAKQLPCKHVFHK  109

Query  598  NCISRWLKIKNSCPICRFQMPIKVDAGEFDRLGS  699
            +CI  WL + +SCP+CRF++P          LGS
Sbjct  110  DCILPWLDLHSSCPVCRFELPTDDPHHAHPTLGS  143



>gb|ABK21010.1| unknown [Picea sitchensis]
 gb|ABR17400.1| unknown [Picea sitchensis]
Length=325

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA      +++  S L  D   C  +C +E  L  E + +PCKH FH+
Sbjct  158  DANHYGTPPASRSAVEAMPAVEISESHLSSDVSQCA-VCLEEFELGSEARQMPCKHMFHS  216

Query  598  NCISRWLKIKNSCPICRFQMPI  663
            +CI  WLK+ +SCP+CRFQMP+
Sbjct  217  DCIQPWLKLHSSCPVCRFQMPV  238



>ref|XP_006579707.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Glycine max]
Length=342

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = +1

Query  493  SILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            S++  +  + C +CKDE  +    KVLPC H++H +CI  WL I+N+CP+CR++ P   D
Sbjct  270  SVVVTEADVVCAVCKDEFGVGEGVKVLPCSHRYHEDCIVPWLGIRNTCPVCRYEFP--TD  327

Query  673  AGEFDR  690
              +++R
Sbjct  328  DADYER  333



>gb|KCW52327.1| hypothetical protein EUGRSUZ_J01748 [Eucalyptus grandis]
Length=401

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = +1

Query  499  LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI---KV  669
            ++M   + C +C D+  +  E K +PCKHKFH+ CI  WL++ +SCP+CRFQ+PI   K 
Sbjct  249  VKMTENVQCSVCLDDFHVGAEAKEMPCKHKFHSGCILPWLELHSSCPVCRFQLPIDESKT  308

Query  670  DA  675
            DA
Sbjct  309  DA  310



>ref|XP_002317728.2| hypothetical protein POPTR_0012s03370g [Populus trichocarpa]
 gb|EEE95948.2| hypothetical protein POPTR_0012s03370g [Populus trichocarpa]
Length=269

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA      IK+   +LE D   C  +CKD   L  E K +PCKH +H 
Sbjct  167  DPNRYGTPPASKSAVENLPDIKVTKELLESDSSQCA-VCKDSFELGEEAKQIPCKHIYHK  225

Query  598  NCISRWLKIKNSCPICRFQMPI  663
            +CI+ WL++ NSCP+CR+++P 
Sbjct  226  DCITPWLELHNSCPVCRYELPT  247



>ref|XP_004507269.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Cicer arietinum]
Length=359

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 42/60 (70%), Gaps = 2/60 (3%)
 Frame = +1

Query  511  RGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            + I C +CKDE+ L+ + + LPC H +H +CI  WL I+N+CP+CRF++P   D  +++R
Sbjct  287  KDIVCAVCKDEVMLEEKVRKLPCSHCYHGDCILPWLSIRNTCPVCRFELP--TDDADYER  344



>gb|KDO43107.1| hypothetical protein CISIN_1g043965mg [Citrus sinensis]
Length=342

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  499  LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            + +D+ + C +C +E  +  E K +PCKHKFH  CI  WL++++SCP+CRFQ+P
Sbjct  208  VTIDKNLQCAVCLEEFEIGNEAKEMPCKHKFHGECIMPWLEVRSSCPVCRFQVP  261



>gb|EYU22950.1| hypothetical protein MIMGU_mgv1a022478mg [Erythranthe guttata]
Length=326

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +1

Query  409  LTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHK  588
            LT +       A +++  +L   IK+ S+ LE   G  CP+CK+EL + +E + LPC H 
Sbjct  190  LTQEDRPGPPPAPDWAIDALPT-IKIRSAHLET--GPECPVCKEELTVGMEARELPCGHV  246

Query  589  FHANCISRWLKIKNSCPICRFQMPI  663
            +H+NCI  WL++ NSCP+CR ++ +
Sbjct  247  YHSNCIVPWLRLHNSCPVCRQELAV  271



>gb|KGN52465.1| hypothetical protein Csa_5G636570 [Cucumis sativus]
Length=240

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  514  GICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            G+ C IC D   +D E + +PCKH +H++CI +WL ++ +CP+CRF MP+
Sbjct  92   GMDCAICLDGFEVDEEAREMPCKHMYHSDCIEKWLNVRGTCPVCRFAMPV  141



>ref|XP_002906712.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY66113.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=266

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +1

Query  502  EMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
            E+D    CP+CKD   +D E   LPC+H FH +CI  WLK  NSCP+CRF++P   D  +
Sbjct  198  EVDGSAECPVCKDFFAVDDEVHRLPCEHSFHPDCILPWLKQHNSCPLCRFELP--TDDPD  255

Query  682  FDR  690
            ++R
Sbjct  256  YER  258



>ref|XP_003579014.1| PREDICTED: uncharacterized protein LOC100825978 [Brachypodium 
distachyon]
Length=509

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +1

Query  502  EMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
            E D G+ CP+CKD + +    K LPC H +H++CI  WL  +N+CP+CR+++P   D  E
Sbjct  330  ETDGGVICPVCKDPMPIRTRAKQLPCMHLYHSSCILPWLSSRNTCPVCRYELP--TDDRE  387

Query  682  FDR  690
            + R
Sbjct  388  YKR  390



>ref|XP_009795472.1| PREDICTED: E3 ubiquitin-protein ligase AIP2-like [Nicotiana sylvestris]
Length=297

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            I L+++ LE D    CP+CKDE+ + +E K LPCKH +H+ CI  WL++ N+CP+CR+Q+
Sbjct  165  IVLNANHLENDS--VCPVCKDEVEVGIEVKELPCKHFYHSECIVPWLRMHNTCPVCRYQL  222



>ref|XP_008650496.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Zea mays]
 gb|AFW76696.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=340

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 49/93 (53%), Gaps = 3/93 (3%)
 Frame = +1

Query  409  LTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHK  588
            LT D       A E + +SL     +  S   +  G  CP+CK+E  +    + LPCKH 
Sbjct  172  LTQDDRPGPPPAPESAIESLP---TVQVSPAHLSDGSQCPVCKEEFEIGEAARELPCKHA  228

Query  589  FHANCISRWLKIKNSCPICRFQMPIKVDAGEFD  687
            +H +CI  WL++ NSCP+CR ++P   D G  D
Sbjct  229  YHTDCIVPWLRLHNSCPVCRQELPQPADGGSQD  261



>ref|XP_009384344.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=463

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            C +CKD L +D E K LPC+H +H +CI  WL ++NSCP+CR+++P 
Sbjct  290  CAVCKDPLLVDTEAKRLPCRHLYHPSCILPWLNVRNSCPVCRYELPT  336



>ref|XP_010037320.1| PREDICTED: uncharacterized protein LOC104426083 [Eucalyptus grandis]
Length=466

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 43/62 (69%), Gaps = 1/62 (2%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            I L    +E + G+C P+CKDE  +  +   LPC H++H+NCI  WL+++N+CP+CR+++
Sbjct  392  IVLGQGDVEKNEGLC-PVCKDEFDVGEKVIDLPCSHRYHSNCILTWLRMRNTCPVCRYEL  450

Query  658  PI  663
            P 
Sbjct  451  PT  452



>ref|XP_010462406.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=350

 Score = 70.1 bits (170),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  493  SILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            S ++++  + C +C D+  +  E K++PCKHKFHA+C+  WL++ +SCP+CRFQ+P
Sbjct  216  STVKIEETLQCSVCLDDFEIGTEAKLMPCKHKFHADCLLPWLELHSSCPVCRFQLP  271



>ref|XP_010463639.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Camelina 
sativa]
Length=424

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 14/96 (15%)
 Frame = +1

Query  403  NPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCK  582
            NP  A + +      E + + L +G             I C +CKDE+ ++ + + LPC 
Sbjct  324  NPPAAKSVIEDLPVVELTVEELSKG------------NIVCAVCKDEIVVEEKVRRLPCS  371

Query  583  HKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            H +H +CI  WL I+N+CP+CR+++P   D  E++R
Sbjct  372  HLYHGDCIMPWLGIRNTCPVCRYELP--TDDLEYER  405



>emb|CDY02194.1| BnaA03g39730D [Brassica napus]
Length=398

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +1

Query  514  GICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
             +CC +C++E+ +  E   LPC HK+H  CI  WL I+N+CP+CRF++P
Sbjct  341  AMCCAVCREEMSVGNEVAELPCSHKYHGECIVPWLGIRNTCPVCRFELP  389



>ref|XP_006353939.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum tuberosum]
Length=387

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA +    IK+   +L+ D   C  +CKD   L +E K +PCKH +H 
Sbjct  188  DPNRHGTPPAAKSAVAGLPDIKITEELLDSDSSQCA-VCKDTFELGMEAKQIPCKHIYHK  246

Query  598  NCISRWLKIKNSCPICRFQMPI  663
            +CI  WL++ NSCP+CR+++P 
Sbjct  247  DCIMPWLELHNSCPVCRYELPT  268



>ref|XP_010243363.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
 ref|XP_010243364.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=348

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +1

Query  436  SQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRW  615
            + AS+ S +S+   IK+  + L  D  I C ICKDE  +D E K LPCKH +H++CI  W
Sbjct  166  TPASKASVESIPT-IKISGNFLASDT-ILCAICKDEFEIDGEAKQLPCKHIYHSDCILPW  223

Query  616  LKIKNSCPICRFQMP  660
            L   NSCP+CRF +P
Sbjct  224  LSQHNSCPVCRFCLP  238



>ref|XP_004235401.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_004235402.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_010318345.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_010318346.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=383

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA +    IK+   +L+ D   C  +CKD   L +E K +PCKH +H 
Sbjct  188  DPNRHGTPPAAKSAVAGLPDIKITEELLDSDSSQCA-VCKDTFELGMEAKQIPCKHIYHK  246

Query  598  NCISRWLKIKNSCPICRFQMPI  663
            +CI  WL++ NSCP+CR+++P 
Sbjct  247  DCIMPWLELHNSCPVCRYELPT  268



>ref|XP_009409315.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409316.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
Length=308

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  514  GICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAG  678
            G  CP+CK+E  L  E + +PCKH +H+ CI  WL + NSCP+CRFQ+P   + G
Sbjct  185  GSQCPVCKEEFSLGEEAREMPCKHVYHSECIVPWLSMHNSCPVCRFQLPGAGNGG  239



>ref|XP_009384343.1| PREDICTED: E3 ubiquitin-protein ligase Praja-2-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=493

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            C +CKD L +D E K LPC+H +H +CI  WL ++NSCP+CR+++P 
Sbjct  320  CAVCKDPLLVDTEAKRLPCRHLYHPSCILPWLNVRNSCPVCRYELPT  366



>ref|NP_001141684.1| uncharacterized protein LOC100273811 [Zea mays]
 gb|ACF86854.1| unknown [Zea mays]
 gb|ACG42347.1| zinc finger, C3HC4 type family protein [Zea mays]
Length=386

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFD  687
            C +CKD +        LPC H FH  CI  WL I+N+CP+CRFQ+P   DA E+D
Sbjct  278  CAVCKDAVVAGQSVLRLPCNHYFHGECIRPWLAIRNTCPVCRFQLPTG-DAAEYD  331



>gb|EMT01564.1| E3 ubiquitin-protein ligase CIP8 [Aegilops tauschii]
Length=480

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  490  SSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            S+  E D G+ CP+CKD + +    K LPC H +H++CI  WL  +N+CP+CR+++P 
Sbjct  322  STSHEADGGVICPVCKDPMPIRTRAKQLPCMHLYHSSCILPWLSSRNTCPVCRYELPT  379



>gb|EMT27310.1| RING finger protein 126 [Aegilops tauschii]
Length=306

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  517  ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIK  666
            + C +C +E  +  E K +PC+HKFH+NCI  WL++ +SCPICRFQ+P +
Sbjct  180  LGCTVCLEEFEMGTEAKEMPCQHKFHSNCILPWLELHSSCPICRFQLPTE  229



>gb|KHN01234.1| E3 ubiquitin-protein ligase RING1 [Glycine soja]
Length=228

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIK-VDAGE  681
            C +C +E  +    K +PCKH+FH NCI +WL +  SCP+CR++MP+K +D G+
Sbjct  117  CVVCLEEFGVGGVAKEMPCKHRFHVNCIEKWLGMHGSCPVCRYEMPVKEIDWGK  170



>ref|XP_006655672.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Oryza brachyantha]
Length=332

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA +    + + + ++  D G  C +C D+  L  + K LPCKH FH 
Sbjct  161  DPNRYGTPPAAKSAVAALPDVAVSADMMAADGGAQCAVCMDDFHLGADAKQLPCKHVFHK  220

Query  598  NCISRWLKIKNSCPICRFQMPI  663
            +CI  WL + +SCP+CRF++P 
Sbjct  221  DCILPWLDLHSSCPVCRFELPT  242



>ref|XP_002437660.1| hypothetical protein SORBIDRAFT_10g000250 [Sorghum bicolor]
 gb|EER89027.1| hypothetical protein SORBIDRAFT_10g000250 [Sorghum bicolor]
Length=321

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA +    + + + +++ D G  C +C D+  L    K LPCKH FH 
Sbjct  149  DPNRYGTPPAAKSAVASLPDVAVSADMMQADGGAQCAVCMDDFHLGAAAKQLPCKHVFHK  208

Query  598  NCISRWLKIKNSCPICRFQMPI  663
            +CI  WL + +SCP+CRF++P 
Sbjct  209  DCILPWLDLHSSCPVCRFELPT  230



>ref|XP_009384341.1| PREDICTED: uncharacterized protein LOC103971910 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384342.1| PREDICTED: uncharacterized protein LOC103971910 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=523

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            C +CKD L +D E K LPC+H +H +CI  WL ++NSCP+CR+++P 
Sbjct  350  CAVCKDPLLVDTEAKRLPCRHLYHPSCILPWLNVRNSCPVCRYELPT  396



>ref|NP_186883.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAG12602.1|AC068900_8 RING zinc-finger protein, putative; 7563-8792 [Arabidopsis thaliana]
 gb|AAP12856.1| At3g02340 [Arabidopsis thaliana]
 dbj|BAE99789.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE73794.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=409

 Score = 69.7 bits (169),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 55/81 (68%), Gaps = 4/81 (5%)
 Frame = +1

Query  454  SAQSLQQGIKL-DSSILEMDRGI-CCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIK  627
            +A+S+ Q + + + ++ E+D+G   C +CKDE+ ++ + + LPC H +H  CI  WL I+
Sbjct  310  AAKSVIQDLPVVELAVEELDKGNNVCAVCKDEMLVEEKVRRLPCSHFYHGECIIPWLGIR  369

Query  628  NSCPICRFQMPIKVDAGEFDR  690
            N+CP+CR+++P   D  E++R
Sbjct  370  NTCPVCRYELP--TDDLEYER  388



>ref|XP_006443366.1| hypothetical protein CICLE_v10024260mg [Citrus clementina]
 ref|XP_006479322.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Citrus sinensis]
 gb|ESR56606.1| hypothetical protein CICLE_v10024260mg [Citrus clementina]
 gb|KDO39254.1| hypothetical protein CISIN_1g036250mg [Citrus sinensis]
Length=347

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  499  LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            + +D+ + C +C +E  +  E K +PCKHKFH  CI  WL++++SCPICR+Q+P
Sbjct  208  VAIDQDLQCAVCLEEFVMGNEAKEMPCKHKFHGECIMPWLELQSSCPICRYQLP  261



>ref|XP_003620140.1| RING finger protein [Medicago truncatula]
Length=238

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N R +  +  SA      I++   +LE D   C  +CKD   L  + K +PCKH +H 
Sbjct  65   DPNRRGTPPASKSAVEKLPVIEVTGELLESDSSQCA-VCKDTFALGEKAKQMPCKHIYHD  123

Query  598  NCISRWLKIKNSCPICRFQMPI  663
            +CI  WL++ NSCP+CRF++P 
Sbjct  124  DCILPWLELHNSCPVCRFELPT  145



>gb|EPS73974.1| hypothetical protein M569_00782, partial [Genlisea aurea]
Length=296

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA      +K+D  +L+ +   C  +CKD   LD   K +PCKH +H 
Sbjct  158  DPNRYGTPPASKSAVQALPNVKVDEELLKSELAQCA-VCKDAFELDTVVKQMPCKHVYHQ  216

Query  598  NCISRWLKIKNSCPICRFQMP  660
            +CI  WL++ NSCP+CR+++P
Sbjct  217  DCIFPWLELHNSCPVCRYELP  237



>gb|EAZ00111.1| hypothetical protein OsI_22117 [Oryza sativa Indica Group]
Length=819

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +1

Query  409  LTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHK  588
            LT D       A E + +SL   + +    L  D G  CP+CK+E  L    + LPCKH 
Sbjct  149  LTQDDRPGPPPAPESAIESLPT-VHISPDHLPADGGSECPVCKEEFELGEAARELPCKHA  207

Query  589  FHANCISRWLKIKNSCPICRFQMP  660
            +H++CI  WL++ NSCP+CR ++P
Sbjct  208  YHSDCIVPWLRLHNSCPVCRQEVP  231



>ref|XP_010231240.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brachypodium 
distachyon]
Length=327

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 61/103 (59%), Gaps = 2/103 (2%)
 Frame = +1

Query  499  LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI--KVD  672
            ++++  + C +C D+L L  + K +PC+HKFH++CI  WL++ +SCP+CRF++P   K D
Sbjct  195  VKIEEVVSCSVCLDDLELGSQAKKMPCEHKFHSSCILPWLELHSSCPVCRFELPSDEKKD  254

Query  673  AGEFDRLGSVeseefddeeeeeGTNSQERKKTSAFM*CGSGAY  801
              E   +  + S   +   ++ G +S+E  +  A +   SG +
Sbjct  255  LNETGNMDGIVSIREEVVADDPGNSSEESSRPWAIVPWFSGLF  297



>ref|XP_006355109.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum tuberosum]
Length=207

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            C IC D+  +    K +PCKH+FH +C+ +WLKI  SCPICR++MP
Sbjct  118  CSICLDDWVIGGVVKEMPCKHRFHGDCVEKWLKIHGSCPICRYKMP  163



>ref|XP_008369925.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=355

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = +1

Query  421  TNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHAN  600
              L H  AS+ + +S+   IK+  S +E +    C +CK+   LD E + +PCKH +H++
Sbjct  150  ARLDHPPASKAAIESMPV-IKIADSHVETES--HCAVCKEAFELDSEAREMPCKHIYHSD  206

Query  601  CISRWLKIKNSCPICRFQMPIKV  669
            CI  WL I+NSCP+CR Q+P  V
Sbjct  207  CIFPWLSIRNSCPVCRHQLPTDV  229



>gb|EMS58467.1| E3 ubiquitin-protein ligase RING1 [Triticum urartu]
Length=405

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  517  ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIK  666
            + C +C +E  +  E K +PC+HKFH+NCI  WL++ +SCPICRFQ+P +
Sbjct  279  LGCTVCLEEFEMGTEAKEMPCQHKFHSNCILPWLELHSSCPICRFQLPTE  328



>dbj|BAD35703.1| zinc finger-like [Oryza sativa Japonica Group]
Length=331

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +1

Query  409  LTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHK  588
            LT D       A E + +SL   + +    L  D G  CP+CK+E  L    + LPCKH 
Sbjct  151  LTQDDRPGPPPAPESAIESLPT-VHISPDHLPADGGSECPVCKEEFELGEAARELPCKHA  209

Query  589  FHANCISRWLKIKNSCPICRFQMP  660
            +H++CI  WL++ NSCP+CR ++P
Sbjct  210  YHSDCIVPWLRLHNSCPVCRQEVP  233



>ref|XP_004137524.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004137525.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004137526.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004161827.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004161828.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004161829.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 3 [Cucumis 
sativus]
 gb|KGN64207.1| hypothetical protein Csa_1G043100 [Cucumis sativus]
Length=378

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            IK+   +L  D   C  +CKD   LD   K++PCKH +HA+CI  WL++ NSCP+CR+++
Sbjct  210  IKITEELLATDSSQCA-VCKDTFELDEVAKLMPCKHIYHADCIIPWLELHNSCPVCRYEL  268

Query  658  PI  663
            P 
Sbjct  269  PT  270



>ref|XP_008659414.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Zea mays]
Length=264

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  +A +    + + + +++ D G  C +C D+  L    K LPCKH FH 
Sbjct  144  DPNRYGTPPAAKAAVASLPDVAVSADMMQADGGAQCAVCMDDFHLGAAAKQLPCKHVFHK  203

Query  598  NCISRWLKIKNSCPICRFQMP  660
            +CI  WL + +SCP+CRF++P
Sbjct  204  DCIVPWLDLHSSCPVCRFELP  224



>ref|XP_002882223.1| hypothetical protein ARALYDRAFT_477467 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58482.1| hypothetical protein ARALYDRAFT_477467 [Arabidopsis lyrata subsp. 
lyrata]
Length=406

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = +1

Query  454  SAQSLQQGIKL-DSSILEMDRG-ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIK  627
            +A+S+ Q + + + ++ E+++G I C +CKDE+ ++ + + LPC H +H  CI  WL I+
Sbjct  308  AAKSVIQDLPVVELTVEELNKGNIVCAVCKDEMVVEEKVRRLPCSHFYHGECIMPWLGIR  367

Query  628  NSCPICRFQMPIKVDAGEFDR  690
            N+CP+CR+++  + D  E++R
Sbjct  368  NTCPVCRYEL--RTDDLEYER  386



>ref|XP_008467256.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
 ref|XP_008467264.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
Length=377

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            IK+   +L  D   C  +CKD   LD   K++PCKH +HA+CI  WL++ NSCP+CR+++
Sbjct  209  IKITEELLATDSSQCA-VCKDTFELDEVAKLMPCKHIYHADCIIPWLELHNSCPVCRYEL  267

Query  658  PI  663
            P 
Sbjct  268  PT  269



>ref|XP_004155306.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 gb|KGN51927.1| hypothetical protein Csa_5G605210 [Cucumis sativus]
Length=196

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            C IC DE+ +    K +PC HKFH +CI +WL++  SCP+CR+QMPI  D
Sbjct  99   CVICLDEIEVGRLAKQMPCNHKFHGDCIQKWLELHGSCPVCRYQMPIDGD  148



>ref|XP_008659413.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Zea mays]
 gb|AFW86264.1| putative RING zinc finger domain superfamily protein isoform 
1 [Zea mays]
 gb|AFW86265.1| putative RING zinc finger domain superfamily protein isoform 
2 [Zea mays]
Length=310

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  +A +    + + + +++ D G  C +C D+  L    K LPCKH FH 
Sbjct  144  DPNRYGTPPAAKAAVASLPDVAVSADMMQADGGAQCAVCMDDFHLGAAAKQLPCKHVFHK  203

Query  598  NCISRWLKIKNSCPICRFQMPI  663
            +CI  WL + +SCP+CRF++P 
Sbjct  204  DCIVPWLDLHSSCPVCRFELPT  225



>ref|XP_004488573.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cicer arietinum]
Length=237

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +1

Query  493  SILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            S+L+ +  + C +C++++F+D E K LPC H +H++CI+ WL +++SCP+CRF M
Sbjct  102  SLLDPNGVVFCAVCREQIFVDSEAKQLPCDHLYHSDCITPWLHLRSSCPLCRFHM  156



>gb|AFG56541.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56542.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56543.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56544.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56545.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56546.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56547.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56548.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56550.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56551.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56552.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56553.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56554.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56555.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56556.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
 gb|AFG56557.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
Length=135

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA      +K+    L  D   C  +C +E  +  E + +PCKH FH+
Sbjct  32   DANHYGTPPASRSAVEAMAAVKISEGHLRSDLSQCA-VCLEEFEVGSEAREMPCKHMFHS  90

Query  598  NCISRWLKIKNSCPICRFQMP  660
            +CI  WLK+ +SCP+CR+QMP
Sbjct  91   DCIQPWLKLHSSCPVCRYQMP  111



>ref|XP_010477810.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=216

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +1

Query  496  ILEMDRGIC-CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            ++EMD     C IC +E   +   K +PCKH+FH  C+ +WL I  SCP+CR++MP+  D
Sbjct  105  VVEMDGSEGECVICLEEWKSEETVKEMPCKHRFHGGCVEKWLGIHGSCPVCRYEMPVDGD  164



>ref|XP_010552573.1| PREDICTED: RING-H2 finger protein ATL33-like [Tarenaya hassleriana]
Length=230

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  514  GICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            G  C IC D++ +    K +PCKH+FH  CI +WL +  SCP+CRF+MP+  D
Sbjct  122  GGECAICLDDMVVGETGKEMPCKHRFHGQCIEKWLLLHGSCPVCRFEMPVDED  174



>ref|XP_011070991.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=230

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            C +C +E       K +PCKHKFH  CI +WLKI+ SCP+CR++MP   D
Sbjct  124  CVVCLEEWETGDMAKEMPCKHKFHVECIEKWLKIRGSCPVCRYEMPADED  173



>ref|XP_008449904.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
 ref|XP_008449905.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
Length=366

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 5/72 (7%)
 Frame = +1

Query  499  LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP-----I  663
            LE D  + C +C DE  +D E K +PCKHKFH  CI  WL++ +SCP+CR Q+P      
Sbjct  235  LEEDSRLQCSVCLDEFEVDEEAKEMPCKHKFHTGCILPWLELHSSCPVCRHQLPGDESKR  294

Query  664  KVDAGEFDRLGS  699
             VD G   R  S
Sbjct  295  DVDGGSAARFMS  306



>ref|XP_008350262.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
 ref|XP_008344640.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=225

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            +K+ SS+L+ D  + C +CK++    ++ K LPC H +H +CI  WL   +SCP+CRFQ+
Sbjct  80   LKITSSMLDRDPLLLCAVCKEQFLHSVDAKQLPCNHLYHPHCILPWLSSHSSCPLCRFQL  139

Query  658  PIKVDAGEF  684
            P +    + 
Sbjct  140  PTETQHHQL  148



>emb|CDX90972.1| BnaC02g06250D [Brassica napus]
Length=335

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = +1

Query  487  DSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIK  666
            D  +   +  I C ICKDE+  + + K LPC+H +H  CI  WL I+N+CP+CR+++P  
Sbjct  258  DVDVTSEELSIGCAICKDEIVDEEKVKRLPCRHYYHKECIVPWLGIRNTCPVCRYELP--  315

Query  667  VDAGEFDR  690
             D  E++R
Sbjct  316  TDDLEYER  323



>ref|XP_006298551.1| hypothetical protein CARUB_v10014632mg [Capsella rubella]
 gb|EOA31449.1| hypothetical protein CARUB_v10014632mg [Capsella rubella]
Length=209

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 54/92 (59%), Gaps = 3/92 (3%)
 Frame = +1

Query  403  NPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCK  582
            N L+A        AS  +  SLQ+ IK+    L +D  +CCP+C+D   +  + + +PCK
Sbjct  94   NRLSAQDRRGPPPASPTAINSLQK-IKIRQKHLGLD--LCCPVCQDRFEIGSDARKMPCK  150

Query  583  HKFHANCISRWLKIKNSCPICRFQMPIKVDAG  678
            H +H+ CI+ WL  +NSCP+CR ++P   + G
Sbjct  151  HIYHSECIAPWLVQRNSCPVCRKELPQDRNNG  182



>ref|XP_004299466.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Fragaria vesca 
subsp. vesca]
Length=379

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            +K+   +L+ D   C  +CKD   LD E K +PCKH +H++CI  WL++ NSCP+CR ++
Sbjct  206  VKITQELLDSDSSQCA-VCKDSFELDEEAKQMPCKHIYHSDCILPWLELHNSCPVCRHEL  264

Query  658  PIKVDAGEFDR  690
            P   D  E+++
Sbjct  265  P--TDDSEYEQ  273



>gb|AFG67337.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
Length=132

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 2/57 (4%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDRL  693
            C +CKDE  L    K +PC H +HA+CI  WL   NSCP+CR++MP   D  E+DR+
Sbjct  78   CAVCKDEFELGKYAKRMPCNHMYHADCILPWLARHNSCPVCRYEMP--TDDLEYDRM  132



>ref|XP_007148495.1| hypothetical protein PHAVU_006G213500g [Phaseolus vulgaris]
 gb|ESW20489.1| hypothetical protein PHAVU_006G213500g [Phaseolus vulgaris]
Length=381

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = +1

Query  388  SNDDR-NPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEF  564
            S+DD  N +  ++N      +  SA S    +KL  + L  D    CP+CKDE  +++E 
Sbjct  193  SDDDFINGVIENSNRTRPPPAASSAISALPVVKLTQAHLASDPN--CPVCKDEFEVEMEA  250

Query  565  KVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            + LPCKH +H++CI  WL++ N+CP+CR+++
Sbjct  251  RELPCKHFYHSDCIIPWLRMHNTCPVCRYEL  281



>emb|CCI42106.1| unnamed protein product [Albugo candida]
Length=258

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            C +CKDE  L  E + +PC H FH +CI  WLK  NSCPICR+++P   D  +++R
Sbjct  192  CAVCKDEFNLAEEARRMPCTHTFHPDCILPWLKQHNSCPICRYELP--TDDADYER  245



>gb|KFK37700.1| hypothetical protein AALP_AA3G017500 [Arabis alpina]
Length=375

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 46/67 (69%), Gaps = 3/67 (4%)
 Frame = +1

Query  493  SILEMDRG-ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKV  669
            ++ E++ G + C +CKD++ ++ + K LPC H +H  CI  WL I+N+CP+CRF++P   
Sbjct  296  TVEELNNGNVVCAVCKDDMVVEEKVKRLPCMHLYHGECIMPWLGIRNTCPVCRFELP--T  353

Query  670  DAGEFDR  690
            D  E++R
Sbjct  354  DDLEYER  360



>gb|AFW66241.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=462

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFD  687
            C +CKD +        LPC H FH  CI  WL I+N+CP+CRFQ+P   DA E+D
Sbjct  354  CAVCKDAVVAGQSVLRLPCNHYFHGECIRPWLAIRNTCPVCRFQLPTG-DAAEYD  407



>ref|XP_006349435.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum tuberosum]
Length=298

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            I L  ++LE D    CP+CKDE  + +E   LPCKH +H+ CI  WL++ N+CP+CR+Q+
Sbjct  164  IYLTPNLLENDS--VCPVCKDEFEVGIEVIELPCKHFYHSECIVPWLRLHNTCPVCRYQL  221



>ref|XP_006650082.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Oryza brachyantha]
 ref|XP_006650083.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Oryza brachyantha]
Length=282

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAG  678
            CP+CKD+  L  E + +PCKH +H++CI  WL+  NSCP+CR+++P +  AG
Sbjct  187  CPVCKDKFELGSEAREMPCKHLYHSDCIVPWLEQHNSCPVCRYELPPQSTAG  238



>gb|AFG56549.1| hypothetical protein 2_4925_01, partial [Pinus taeda]
Length=135

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 1/81 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA      +K+    L  D   C  +C +E  +  E + +PCKH FH+
Sbjct  32   DANHYGTPPASRSAVEAMAAVKISQEHLSSDLSQCA-VCLEEFEVGSEAREMPCKHMFHS  90

Query  598  NCISRWLKIKNSCPICRFQMP  660
            +CI  WLK+ +SCP+CR+QMP
Sbjct  91   DCIQPWLKLHSSCPVCRYQMP  111



>ref|NP_001056529.1| Os06g0101300 [Oryza sativa Japonica Group]
 dbj|BAD69377.1| putative ring finger protein 126 isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAD67937.1| putative ring finger protein 126 isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF18443.1| Os06g0101300 [Oryza sativa Japonica Group]
 gb|EAZ35517.1| hypothetical protein OsJ_19796 [Oryza sativa Japonica Group]
 dbj|BAH00711.1| unnamed protein product [Oryza sativa Japonica Group]
Length=338

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA +    + + + ++  D G  C +C D+  L    K LPCKH FH 
Sbjct  167  DPNRYGTPPAAKSAVAALPDVAVSADMMAADGGAQCAVCMDDFHLGAAAKQLPCKHVFHK  226

Query  598  NCISRWLKIKNSCPICRFQMPI  663
            +CI  WL + +SCP+CRF++P 
Sbjct  227  DCILPWLDLHSSCPVCRFELPT  248



>gb|AFW67216.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=147

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  496  ILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIK  666
             + ++  + C +C ++  +  E K +PC+HKFH++CI  WL++ +SCPICRFQ+P +
Sbjct  20   TVNIEEALGCSVCLEDFEMGGEAKQMPCQHKFHSHCILPWLELHSSCPICRFQLPTE  76



>dbj|BAJ99443.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  502  EMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            E D G+ CP+CKD + +    K LPC H +H++CI  WL  +N+CP+CR+++P 
Sbjct  324  EADGGLICPVCKDPMPIRTRAKQLPCMHLYHSSCILPWLSSRNTCPVCRYELPT  377



>ref|XP_010480093.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=350

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +1

Query  493  SILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            S ++++  + C +C D+  +  E K++PCKHKFH +C+  WL++ +SCP+CRFQ+P
Sbjct  217  STVKIEETLQCSVCLDDFEIGTEAKLMPCKHKFHVDCLLPWLELHSSCPVCRFQLP  272



>ref|XP_006298099.1| hypothetical protein CARUB_v10014141mg [Capsella rubella]
 gb|EOA30997.1| hypothetical protein CARUB_v10014141mg [Capsella rubella]
Length=334

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  508  DRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
            DR + C +C D+  + +E K +PCKHKFH++C+  WL++ +SCP+CR+ +P   D G+
Sbjct  237  DRLLQCTVCLDDFEIGMEAKEMPCKHKFHSDCLLPWLELHSSCPVCRYLLPTADDVGK  294



>ref|XP_007148496.1| hypothetical protein PHAVU_006G213500g [Phaseolus vulgaris]
 gb|ESW20490.1| hypothetical protein PHAVU_006G213500g [Phaseolus vulgaris]
Length=399

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = +1

Query  454  SAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNS  633
            SA S    +KL  + L  D    CP+CKDE  +++E + LPCKH +H++CI  WL++ N+
Sbjct  234  SAISALPVVKLTQAHLASDPN--CPVCKDEFEVEMEARELPCKHFYHSDCIIPWLRMHNT  291

Query  634  CPICRFQM  657
            CP+CR+++
Sbjct  292  CPVCRYEL  299



>gb|AEW08366.1| hypothetical protein 2_7298_01, partial [Pinus radiata]
 gb|AFG67326.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67328.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67329.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67330.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67331.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67333.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67334.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67336.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67338.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67339.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67340.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67341.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67342.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67343.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
Length=132

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 2/57 (4%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDRL  693
            C +CKDE  L    K +PC H +HA+CI  WL   NSCP+CR++MP   D  E+DR+
Sbjct  78   CAVCKDEFELGKYAKRMPCNHMYHADCILPWLARHNSCPVCRYEMP--TDDLEYDRM  132



>ref|XP_003613816.1| RING finger protein [Medicago truncatula]
 gb|AES96774.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=222

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  LDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            +D   +E   G  C +C +E  +    K +PCKH+FH  CI +WL I  SCP+CR+QMP+
Sbjct  102  MDKIEIEEGDGGECVVCLEEFEVGGVVKEMPCKHRFHGKCIEKWLGIHGSCPVCRYQMPV  161



>ref|XP_004977402.1| PREDICTED: cytochrome P450 714C3-like isoform X5 [Setaria italica]
Length=473

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +1

Query  502  EMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
            E++  + CP+CKDE+ +    K LPC H +H++CI  WL  +N+CP+CR+++P   D  E
Sbjct  330  EINGNLMCPVCKDEMPIKTVAKQLPCMHLYHSSCILPWLSSRNTCPVCRYELP--TDDME  387

Query  682  FDR  690
            ++R
Sbjct  388  YER  390



>ref|XP_010276428.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
 ref|XP_010276429.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
 ref|XP_010276430.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
 ref|XP_010276431.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=353

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 56/112 (50%), Gaps = 17/112 (15%)
 Frame = +1

Query  331  APS--GDNLRINLRLELHHHASNDDRNPLTADTNLRHSQASEFSAQSLQQGIKLDSSILE  504
            APS  GD     L L L H A ND         N   +  ++  A      +K+  S   
Sbjct  166  APSSLGDYFGPGLDLLLQHLAEND--------PNRYGTPPAQKEAVEAMPTVKITESSQ-  216

Query  505  MDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
                  C +C D+L +  E K +PCKHKFH+ CI  WL++ +SCP+CRFQ+P
Sbjct  217  ------CSVCLDDLEIGAEAKEMPCKHKFHSGCILPWLELHSSCPVCRFQIP  262



>gb|KDP30629.1| hypothetical protein JCGZ_16194 [Jatropha curcas]
Length=377

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = +1

Query  517  ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            I C +C D+L +  E K +PCKHKFH+NC+  WL++ +SCP+CRFQ+P      + +R
Sbjct  222  IQCSVCLDDLEVGTEAKEMPCKHKFHSNCLLPWLELHSSCPVCRFQLPADESKSDSER  279



>ref|XP_010465177.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Camelina sativa]
Length=333

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = +1

Query  496  ILEMDRGIC-CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            I++++ G+  C +C D+  + +E K +PCKHKFH++C+  WL++ +SCP+CR+ +P   D
Sbjct  231  IVKIEDGLLQCTVCLDDFEIGMEVKEMPCKHKFHSDCLLPWLELHSSCPVCRYLLPTGDD  290

Query  673  AGE  681
             GE
Sbjct  291  DGE  293



>ref|XP_002531854.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF30532.1| zinc finger protein, putative [Ricinus communis]
Length=161

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            C IC D++ +  E + +PC H+FH+ CI  WL +  SCP+CR+ MP++ D
Sbjct  92   CAICLDDVGIGSEVREMPCNHRFHSACIENWLAVHGSCPVCRYVMPVQED  141



>ref|XP_002512193.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF50227.1| zinc finger protein, putative [Ricinus communis]
Length=190

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 57/106 (54%), Gaps = 17/106 (16%)
 Frame = +1

Query  343  DNLRINLRLELHHHASNDDRNPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGIC  522
            D+L      +++  +SNDD N                +  S+   +K+ +S+LE +  +C
Sbjct  63   DSLFFPFLTDMNSSSSNDDLN---------------HNIDSILPTVKITASLLEGEEVVC  107

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIK-NSCPICRFQM  657
              +CKDE  +D++ K+LPC H FH +CI  WL    NSCP+CRF +
Sbjct  108  A-VCKDEFVIDVDVKILPCNHFFHPDCILPWLNSDHNSCPLCRFHL  152



>ref|XP_004977400.1| PREDICTED: cytochrome P450 714C3-like isoform X3 [Setaria italica]
Length=511

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +1

Query  502  EMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
            E++  + CP+CKDE+ +    K LPC H +H++CI  WL  +N+CP+CR+++P   D  E
Sbjct  330  EINGNLMCPVCKDEMPIKTVAKQLPCMHLYHSSCILPWLSSRNTCPVCRYELP--TDDME  387

Query  682  FDR  690
            ++R
Sbjct  388  YER  390



>ref|XP_010249658.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=363

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            +K+   +L  D   C  +CKD   L  E K +PCKH +H++CI  WLK+ NSCP+CR+++
Sbjct  206  VKISEELLASDLAQCA-VCKDTFELGSEAKQMPCKHIYHSDCILPWLKLHNSCPVCRYEL  264

Query  658  PI  663
            P 
Sbjct  265  PT  266



>ref|XP_009788594.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009788595.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Nicotiana sylvestris]
 ref|XP_009788596.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Nicotiana sylvestris]
Length=311

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA      IK++  +L+ +   C  +CKD+  L L+ K LPCKH +H 
Sbjct  164  DPNRYGTPPASKSAVEGLPSIKVNEELLKSELAQCA-VCKDDFELGLDVKQLPCKHVYHE  222

Query  598  NCISRWLKIKNSCPICRFQMPI  663
             CI  WL++ NSCP+CR+++P 
Sbjct  223  GCILPWLELHNSCPVCRYKLPT  244



>ref|XP_007005745.1| hypothetical protein TREMEDRAFT_63337 [Tremella mesenterica DSM 
1558]
 gb|EIW68167.1| hypothetical protein TREMEDRAFT_63337 [Tremella mesenterica DSM 
1558]
Length=424

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +1

Query  481  KLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            KLD   LE  +   CP+CKD+  +  E   +PCKH FH +C+  WLK+  SCP+CRF +
Sbjct  271  KLDEKALETSQFKDCPVCKDDFAVGDEVMRIPCKHIFHPDCLQPWLKVNGSCPVCRFSL  329



>ref|XP_010108676.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
 gb|EXC19987.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
Length=225

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 51/94 (54%), Gaps = 0/94 (0%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D+ LR     +    + ++ IK  +S+   + G  C IC +E  +    K +PCKH+FH 
Sbjct  84   DSLLRELGNKDGQPPASKESIKAMASVEIGEDGEECVICLEEFEVGGFAKEMPCKHRFHG  143

Query  598  NCISRWLKIKNSCPICRFQMPIKVDAGEFDRLGS  699
             CI +WL I  SCP+CR +MP+  +  +  R G+
Sbjct  144  GCIEKWLGIHGSCPVCRHKMPVDEEGEDGKRRGA  177



>gb|KDP25432.1| hypothetical protein JCGZ_20588 [Jatropha curcas]
Length=153

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            C IC DEL +  E K LPC H +H NCI+ WLK  N+CP+CR+ +P
Sbjct  104  CSICLDELLVGSEAKCLPCSHVYHGNCIAEWLKNSNTCPLCRYSLP  149



>ref|XP_010045101.1| PREDICTED: RING finger protein 126-B-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW87254.1| hypothetical protein EUGRSUZ_B03765 [Eucalyptus grandis]
 gb|KCW87255.1| hypothetical protein EUGRSUZ_B03765 [Eucalyptus grandis]
Length=327

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            CP+CK+E  L  E K++PC H +H +CI  WL+  NSCP+CRF+MP
Sbjct  196  CPVCKEEFELQAEAKMMPCHHFYHPDCIVPWLEQHNSCPVCRFEMP  241



>ref|XP_010940373.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940374.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940375.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940376.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
Length=363

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA +    IK++  +L  D   C  +CKD   + +E K +PCKH +H 
Sbjct  179  DPNRYGTPPAAKSAITSLPDIKINEELLASDEAQCA-VCKDTFEIGVEAKQMPCKHIYHK  237

Query  598  NCISRWLKIKNSCPICRFQMP  660
            +CI  WL++ NSCP+CR+++P
Sbjct  238  DCILPWLELHNSCPVCRYELP  258



>ref|XP_010045099.1| PREDICTED: RING finger protein 126-B-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010045100.1| PREDICTED: RING finger protein 126-B-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW87256.1| hypothetical protein EUGRSUZ_B03765 [Eucalyptus grandis]
 gb|KCW87257.1| hypothetical protein EUGRSUZ_B03765 [Eucalyptus grandis]
 gb|KCW87258.1| hypothetical protein EUGRSUZ_B03765 [Eucalyptus grandis]
Length=328

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            CP+CK+E  L  E K++PC H +H +CI  WL+  NSCP+CRF+MP
Sbjct  197  CPVCKEEFELQAEAKMMPCHHFYHPDCIVPWLEQHNSCPVCRFEMP  242



>ref|NP_197086.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 emb|CAC01781.1| putative protein [Arabidopsis thaliana]
 gb|AAL15297.1| AT5g15820/F14F8_200 [Arabidopsis thaliana]
 gb|AAM47324.1| AT5g15820/F14F8_200 [Arabidopsis thaliana]
 gb|AED92211.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=348

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = +1

Query  517  ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            I C ICKDE+    + K LPCKH +H  CI  WL I+N+CP+CR ++P   D  E++R
Sbjct  289  IVCAICKDEVVFKEKVKRLPCKHYYHGECIIPWLGIRNTCPVCRHELP--TDDLEYER  344



>ref|XP_009400147.1| PREDICTED: uncharacterized protein LOC103984394 [Musa acuminata 
subsp. malaccensis]
Length=2557

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +1

Query  499   LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
             ++++    CP+C +++ +  E + +PCKHKFH  CI  WL++ +SCP+CRFQ+P
Sbjct  1978  VKVEENTSCPVCLEDMEVGAEAREMPCKHKFHGECILPWLELHSSCPLCRFQLP  2031



>ref|XP_009588217.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
Length=314

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA      IK++  +L+ +   C  +CKD+  L L+ K LPCKH +H 
Sbjct  166  DPNRYGTPPASKSAVEGLPSIKVNEELLKSELAQCA-VCKDDFELGLDVKQLPCKHVYHE  224

Query  598  NCISRWLKIKNSCPICRFQMP  660
             CI  WL++ NSCP+CR+++P
Sbjct  225  GCILPWLELHNSCPVCRYELP  245



>emb|CDY20579.1| BnaC07g12460D [Brassica napus]
Length=217

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            C IC +E       K +PCKH+FH  CI +WL ++ SCP+CRF+MP+  D
Sbjct  112  CVICLEEWQAGETVKEMPCKHRFHGGCIEKWLGLRRSCPVCRFEMPVDGD  161



>ref|XP_011086955.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
 ref|XP_011086956.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
 ref|XP_011086957.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=382

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 50/95 (53%), Gaps = 1/95 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA      IK+   +L  D   C  +CKD   L+ E K +PCKH +H 
Sbjct  189  DPNRYGTPPASKSAVEGLPNIKITEEMLPSDSSQCA-VCKDSFELNEEAKQMPCKHIYHK  247

Query  598  NCISRWLKIKNSCPICRFQMPIKVDAGEFDRLGSV  702
            +CI  WL++ NSCP+CR+++P      E  R G +
Sbjct  248  DCILPWLELHNSCPVCRYELPTDDPDYENRRTGQM  282



>gb|ACF82510.1| unknown [Zea mays]
 gb|AFW67217.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=147

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +1

Query  496  ILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIK  666
             + ++  + C +C ++  +  E K +PC+HKFH++CI  WL++ +SCPICRFQ+P +
Sbjct  20   TVNIEEALGCSVCLEDFEMGGEAKQMPCQHKFHSHCILPWLELHSSCPICRFQLPTE  76



>ref|XP_010045102.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X3 
[Eucalyptus grandis]
Length=312

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            CP+CK+E  L  E K++PC H +H +CI  WL+  NSCP+CRF+MP
Sbjct  181  CPVCKEEFELQAEAKMMPCHHFYHPDCIVPWLEQHNSCPVCRFEMP  226



>ref|XP_004135452.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
Length=207

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            C IC DE+ +    K +PC HKFH +CI +WL++  SCP+CR+QMPI  D
Sbjct  99   CVICLDEIEVGRLAKQMPCNHKFHGDCIQKWLELHGSCPVCRYQMPIDGD  148



>gb|AFG68993.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68994.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68995.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68996.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68997.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68998.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG68999.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69000.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69001.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69002.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69003.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69004.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69005.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69006.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69007.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69008.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69009.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
 gb|AFG69010.1| hypothetical protein 0_10618_01, partial [Pinus taeda]
Length=138

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +1

Query  502  EMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
            E D    C ICKD L L  + K LPC H +H NCI  WL  +NSCP+CR+++P      E
Sbjct  71   EEDGSSVCAICKDSLALGDQAKQLPCMHLYHPNCILPWLGARNSCPVCRYELPTDDPEYE  130

Query  682  FDRLGSV  702
             ++  +V
Sbjct  131  EEKCNAV  137



>ref|XP_009132309.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=378

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 54/108 (50%), Gaps = 14/108 (13%)
 Frame = +1

Query  358  NLRLELHHHASNDDRNPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICK  537
             L L L H A ND         N + +  +   A      +K+   +L+      C +C 
Sbjct  196  GLDLLLQHLAEND--------PNRQGTPPARKEAVEALPTVKVTEPLLQ------CSVCL  241

Query  538  DELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
            DE    +E K +PCKHKFH  CI  WL+I +SCP+CRF++P   D G+
Sbjct  242  DEFERGVEAKEMPCKHKFHVKCIVPWLEIHSSCPVCRFELPSGNDDGD  289



>ref|XP_010917264.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010917265.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
Length=336

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 7/100 (7%)
 Frame = +1

Query  361  LRLELHHHASNDDRNPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKD  540
            LR  +HH A+ DD +PL     +R    +  S+      +++       D  + C +CKD
Sbjct  124  LRRLIHHLAAGDD-HPLPFPIPVRGPSPAPKSSIDALPTVQIS------DPSLFCAVCKD  176

Query  541  ELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            E  L  + + LPC H +H++CI  WL + NSCP+CRF++P
Sbjct  177  EFPLQSDARQLPCFHLYHSDCIVPWLSLHNSCPVCRFRLP  216



>gb|KHN00667.1| E3 ubiquitin-protein ligase RING1 [Glycine soja]
Length=319

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            CP+C +++ +  E K +PC HKFH +CI  WLK+  SCP+CRFQMP
Sbjct  228  CPVCLEDVEVGSEAKEMPCMHKFHGDCIVSWLKLHGSCPVCRFQMP  273



>ref|XP_006338779.1| PREDICTED: E3 ubiquitin-protein ligase RNF126-like [Solanum tuberosum]
Length=149

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKV  669
            C IC  E  +  + K +PCKH++H+NCI++WL+I  SCP+CR++MP  V
Sbjct  48   CAICLSEFQVGEKAKEMPCKHRYHSNCINQWLEIHGSCPVCRYKMPAAV  96



>gb|ABD96901.1| hypothetical protein [Cleome spinosa]
Length=339

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (57%), Gaps = 12/86 (14%)
 Frame = +1

Query  403  NPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCK  582
            NP  A   ++     EF+ + L +G             + C +CKD++ ++ + + LPC+
Sbjct  192  NPPAAKRVVKDLPLVEFTVEKLGKG------------EVVCSVCKDKIAIEEKVRRLPCR  239

Query  583  HKFHANCISRWLKIKNSCPICRFQMP  660
            H +H +CI  WL I+N+CP+CR+++P
Sbjct  240  HYYHGDCILPWLGIRNTCPVCRYELP  265



>gb|ABR17677.1| unknown [Picea sitchensis]
Length=451

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            IK+   +L  D    C +CKDE  +  E + +PCKH +H+ CI  WL+  NSCP+CR++M
Sbjct  218  IKITQDLLVTDS-TQCAVCKDEFEVGTEVRQMPCKHMYHSVCILPWLEQHNSCPVCRYEM  276

Query  658  PI  663
            P 
Sbjct  277  PT  278



>ref|XP_003519952.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=319

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            CP+C +++ +  E K +PC HKFH +CI  WLK+  SCP+CRFQMP
Sbjct  228  CPVCLEDVEVGSEAKEMPCMHKFHGDCIVSWLKLHGSCPVCRFQMP  273



>gb|AFG67327.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67332.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
 gb|AFG67335.1| hypothetical protein 2_7298_01, partial [Pinus taeda]
Length=132

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 2/57 (4%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDRL  693
            C +CKDE  L    K +PC H +HA+CI  WL   NSCP+CR++MP   D  E+DR+
Sbjct  78   CAVCKDEFELGKYAKRMPCNHVYHADCILPWLARHNSCPVCRYEMP--TDDLEYDRM  132



>ref|XP_003620252.1| RING finger protein [Medicago truncatula]
Length=340

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N R +  +  SA      I++   +LE D   C  +CKD   L  + K +PCKH +H 
Sbjct  167  DPNRRGTPPASKSAVEKLPVIEVTGELLESDSSQCA-VCKDTFALGEKAKQMPCKHIYHD  225

Query  598  NCISRWLKIKNSCPICRFQMPI  663
            +CI  WL++ NSCP+CRF++P 
Sbjct  226  DCILPWLELHNSCPVCRFELPT  247



>ref|XP_011019833.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
 ref|XP_011019834.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
 ref|XP_011019835.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=311

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +1

Query  433  HSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISR  612
            H QAS+ + +S+   IK+ +S + M+    C +CK+   ++ E + +PC H +H++CI  
Sbjct  131  HPQASKAAIESMPV-IKILNSHVSMESQ--CAVCKEAFEINTEAREMPCNHIYHSDCILP  187

Query  613  WLKIKNSCPICRFQMPIKVDAG  678
            WL I+NSCP+CR ++P +  +G
Sbjct  188  WLSIRNSCPVCRHELPTETGSG  209



>ref|XP_002309072.1| hypothetical protein POPTR_0006s08810g [Populus trichocarpa]
 gb|EEE92595.1| hypothetical protein POPTR_0006s08810g [Populus trichocarpa]
Length=311

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +1

Query  433  HSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISR  612
            H QAS+ + +S+   IK+ +S + M+    C +CK+   ++ E + +PC H +H++CI  
Sbjct  131  HPQASKAAIESMPV-IKILNSHVSMESQ--CAVCKEAFEINTEAREMPCNHIYHSDCILP  187

Query  613  WLKIKNSCPICRFQMPIKVDAG  678
            WL I+NSCP+CR ++P +  +G
Sbjct  188  WLSIRNSCPVCRHELPTETGSG  209



>ref|XP_010558535.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase Praja-1 
[Tarenaya hassleriana]
Length=397

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (57%), Gaps = 12/86 (14%)
 Frame = +1

Query  403  NPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCK  582
            NP  A   ++     EF+ + L +G             + C +CKD++ ++ + + LPC+
Sbjct  300  NPPAAKRVVKDLPLVEFTVEKLGKG------------EVVCSVCKDKIAIEEKVRRLPCR  347

Query  583  HKFHANCISRWLKIKNSCPICRFQMP  660
            H +H +CI  WL I+N+CP+CR+++P
Sbjct  348  HYYHGDCILPWLGIRNTCPVCRYELP  373



>ref|XP_010322969.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=359

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            C +CKD   LD   K +PCKH +H +CI  WL+++NSCP+CRF++P    A E  R
Sbjct  177  CAVCKDGFKLDEMVKQMPCKHMYHNDCILPWLEMRNSCPVCRFELPTDDFAYEIRR  232



>ref|XP_010532788.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Tarenaya hassleriana]
Length=225

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +1

Query  499  LEMDRGIC-CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            +EM+ G   C IC DEL      K +PCKH+FH  CI +WL +  SCP+CR++MP+
Sbjct  111  VEMESGGGECVICLDELTAGETAKEMPCKHRFHGECIEKWLGLHGSCPVCRYEMPV  166



>gb|KDO65626.1| hypothetical protein CISIN_1g036764mg [Citrus sinensis]
Length=476

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            C +CKDE  +  + K LPC H++H  CI  WL+I+N+CP+CR++MP
Sbjct  412  CAVCKDEFGVGEKAKRLPCSHRYHGECIVPWLRIRNTCPVCRYEMP  457



>ref|XP_008446365.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
Length=196

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            C IC DE+ +    K +PC HKFH  CI +WL++  SCP+CR+QMPI  D
Sbjct  99   CVICLDEIEVGGLAKQMPCNHKFHGECIQKWLELHGSCPVCRYQMPIDGD  148



>ref|XP_010031683.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Eucalyptus 
grandis]
 gb|KCW51044.1| hypothetical protein EUGRSUZ_J00661 [Eucalyptus grandis]
Length=280

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIK  666
            CP+CK+E  L  E +++PC H +H++CI  WL+  NSCP+CR +MP +
Sbjct  201  CPVCKEEFVLGSEVRMMPCHHIYHSDCIVTWLERHNSCPVCRIEMPAQ  248



>ref|XP_004149638.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 ref|XP_004166543.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 gb|KGN54015.1| hypothetical protein Csa_4G267990 [Cucumis sativus]
Length=362

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  499  LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            LE D  + C +C DE  +D E K +PCKHKFH  CI  WL++ +SCP+CR Q+P
Sbjct  235  LEEDSCLQCSVCLDEFEVDEEAKEMPCKHKFHTGCILPWLELHSSCPVCRHQLP  288



>gb|EPS68825.1| hypothetical protein M569_05945, partial [Genlisea aurea]
Length=96

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEF  684
            C ICKD   +    K LPC H +H  CISRWL  KN+CP+CR+Q+P   +  E+
Sbjct  39   CAICKDSFSVGSLVKQLPCFHLYHPRCISRWLSTKNTCPLCRYQLPTDNEDDEY  92



>ref|XP_004508643.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Cicer arietinum]
Length=386

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = +1

Query  517  ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            + C +CKDE  +    K+LPC H++H +CI  WL I+N+CP+CR++ P   D  +++R
Sbjct  321  VLCAVCKDEFVVGEGAKLLPCSHRYHGDCIVPWLGIRNTCPVCRYEFP--TDDADYER  376



>ref|XP_011013345.1| PREDICTED: E3 ubiquitin-protein ligase RNF181 [Populus euphratica]
Length=218

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            C IC +E  L    K +PCKH+FH  C+ +WLKI  +CP+CR++MP+
Sbjct  116  CAICLEEWELGGVVKEMPCKHRFHGGCVEKWLKIHGNCPVCRYKMPV  162



>ref|XP_010922808.1| PREDICTED: E3 ubiquitin-protein ligase Praja-1 [Elaeis guineensis]
 ref|XP_010922809.1| PREDICTED: E3 ubiquitin-protein ligase Praja-1 [Elaeis guineensis]
 ref|XP_010922810.1| PREDICTED: E3 ubiquitin-protein ligase Praja-1 [Elaeis guineensis]
 ref|XP_010922812.1| PREDICTED: E3 ubiquitin-protein ligase Praja-1 [Elaeis guineensis]
Length=538

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 4/64 (6%)
 Frame = +1

Query  484  LDSSILEMDR----GICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRF  651
            L S I+ MD      + C +CKD L ++ E K LPCKH +H +CI  WL  +NSCP+CR+
Sbjct  340  LPSVIISMDHERNGSLICAVCKDPLPINTEAKQLPCKHLYHPSCILPWLAARNSCPVCRY  399

Query  652  QMPI  663
            ++P 
Sbjct  400  ELPT  403



>gb|KCW56354.1| hypothetical protein EUGRSUZ_I02088 [Eucalyptus grandis]
Length=346

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            I L  S +++  G+C  +CKDE+ +    + LPC H +H +CI  WL I+NSCPICR+++
Sbjct  259  IILSESDVQLSGGVCA-VCKDEVSVGDGVRKLPCSHYYHGDCILPWLAIRNSCPICRYEL  317

Query  658  PIKVDAGEFDR  690
            P   D  E++R
Sbjct  318  P--TDDLEYER  326



>ref|XP_004978503.1| PREDICTED: uncharacterized protein LOC101780364 isoform X1 [Setaria 
italica]
 ref|XP_004978504.1| PREDICTED: uncharacterized protein LOC101780364 isoform X2 [Setaria 
italica]
Length=511

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +1

Query  502  EMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
            E++  + CP+CKDE+ +    K LPC H +H++CI  WL  +N+CP+CR+++P   D  E
Sbjct  330  EINGDLMCPVCKDEMPIKTVAKQLPCMHLYHSSCILPWLSSRNTCPVCRYELP--TDDME  387

Query  682  FDR  690
            ++R
Sbjct  388  YER  390



>ref|XP_011022020.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
 ref|XP_011022021.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=291

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  +A      +K+   +++ +    C +CKDE     E K +PCKH FH 
Sbjct  167  DPNRYGTPPASKTAIEALPTMKVTEEMMKSEMNNQCAVCKDEFESGEEVKGMPCKHVFHE  226

Query  598  NCISRWLKIKNSCPICRFQMPI  663
            +CI  WLK+ NSCP+CR+++P 
Sbjct  227  DCIMPWLKMHNSCPVCRYELPT  248



>ref|XP_004978505.1| PREDICTED: uncharacterized protein LOC101780364 isoform X3 [Setaria 
italica]
Length=510

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +1

Query  502  EMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
            E++  + CP+CKDE+ +    K LPC H +H++CI  WL  +N+CP+CR+++P   D  E
Sbjct  329  EINGDLMCPVCKDEMPIKTVAKQLPCMHLYHSSCILPWLSSRNTCPVCRYELP--TDDME  386

Query  682  FDR  690
            ++R
Sbjct  387  YER  389



>ref|XP_010653554.1| PREDICTED: E3 ubiquitin-protein ligase RNF130-like [Vitis vinifera]
Length=239

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 8/73 (11%)
 Frame = +1

Query  442  ASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLK  621
            A+E S ++L+       +ILE   G  C IC +EL    E  V+PC H FH +CI RWLK
Sbjct  171  ATEISIKTLKT-----ETILE---GESCMICLEELGGGSEVTVMPCSHVFHGSCIIRWLK  222

Query  622  IKNSCPICRFQMP  660
              + CPICRF+MP
Sbjct  223  QSHVCPICRFEMP  235



>ref|XP_010423131.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like isoform X2 [Camelina 
sativa]
Length=330

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = +1

Query  508  DRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFD  687
            D  + C +CKDE+ +  E   LPC HK+H+ CI  WLK++N+CP+CR ++P   D  E++
Sbjct  258  DGVVVCAVCKDEMNIGNEAVQLPCNHKYHSECIVPWLKVRNTCPVCRHELP--TDDAEYE  315

Query  688  R  690
            +
Sbjct  316  Q  316



>ref|XP_010942240.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Elaeis guineensis]
Length=423

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +1

Query  517  ICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
             CC +CKDE+ L    K LPC H +H  CI  WL I+N+CP+CR+++P 
Sbjct  340  TCCAVCKDEISLGEMAKRLPCSHHYHGGCIVPWLGIRNTCPVCRYELPT  388



>ref|XP_009630475.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
Length=130

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 51/93 (55%), Gaps = 0/93 (0%)
 Frame = +1

Query  388  SNDDRNPLTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFK  567
            S   R  +T+ T       S  + ++  + + +   + E ++   C IC  E  +  + K
Sbjct  3    SRSSRESITSSTVQNLQGPSPPATKASIEALPIVEIVQEEEKRTECAICLLEFQVGGKAK  62

Query  568  VLPCKHKFHANCISRWLKIKNSCPICRFQMPIK  666
             +PCKH++H NCI  WL++  SCP+CR++MP++
Sbjct  63   EMPCKHRYHPNCIDPWLRVHGSCPVCRYEMPVE  95



>gb|EMS62753.1| E3 ubiquitin-protein ligase RING1 [Triticum urartu]
Length=482

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  502  EMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            E D  + CP+CKD + L    K LPC H +H++CI  WL  +N+CP+CR+++P 
Sbjct  328  EADGAVICPVCKDPMPLRTRAKQLPCMHLYHSSCILPWLSSRNTCPVCRYELPT  381



>ref|XP_006365161.1| PREDICTED: RING-H2 finger protein ATL54-like [Solanum tuberosum]
Length=305

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 8/88 (9%)
 Frame = +1

Query  403  NPLTADTNLRH-SQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPC  579
            NP+ A+  L   S AS  S +++   +K+      +  GI C IC        E K +PC
Sbjct  60   NPINAEPILEGLSPASTASIEAIPM-VKV------LGEGIDCSICLSNFETGKEAKEMPC  112

Query  580  KHKFHANCISRWLKIKNSCPICRFQMPI  663
            KH FH+ CI +WL I  SCPICR++MP+
Sbjct  113  KHHFHSICIDKWLGINGSCPICRYKMPV  140



>ref|XP_011072066.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=380

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            IK+   +L  D   C  +CKD   L+ E K +PCKH +H +CI  WL++ NSCP+CR+++
Sbjct  207  IKITEEMLASDSSQCA-VCKDSFELNEEAKQMPCKHIYHKDCILPWLELHNSCPVCRYEL  265

Query  658  PIKVDAGEFDRLGSV  702
            P      E  R G  
Sbjct  266  PTDDPDYENRRTGQT  280



>ref|XP_006439010.1| hypothetical protein CICLE_v10032875mg [Citrus clementina]
 gb|ESR52250.1| hypothetical protein CICLE_v10032875mg [Citrus clementina]
Length=181

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +1

Query  475  GIKLDS-SILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRF  651
            G++++S  I E      C ICKDE  L  E K LPC H +H+ CI  WL +++SCP+CRF
Sbjct  101  GMRMNSVEISESLSQESCAICKDEFSLHSEAKQLPCNHLYHSECILPWLSLQSSCPLCRF  160

Query  652  QMPI  663
            Q+P+
Sbjct  161  QLPM  164



>ref|XP_010653528.1| PREDICTED: E3 ubiquitin-protein ligase RNF130-like [Vitis vinifera]
Length=239

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 8/73 (11%)
 Frame = +1

Query  442  ASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLK  621
            A+E S ++L+       +ILE   G  C IC +EL    E  V+PC H FH +CI RWLK
Sbjct  171  ATEISIKTLK-----TETILE---GESCMICLEELGGGSEVTVMPCSHVFHGSCIIRWLK  222

Query  622  IKNSCPICRFQMP  660
              + CPICRF+MP
Sbjct  223  QSHVCPICRFEMP  235



>gb|EMS63398.1| E3 ubiquitin-protein ligase RING1 [Triticum urartu]
Length=228

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = +1

Query  418  DTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHA  597
            D N   +  +  SA +    + +  +++    G  C +CK++       K +PCKH +HA
Sbjct  51   DPNRYGTPPAAKSALTTLPDVVVTDAMVAAAEGAECAVCKEDFSPGDGAKQMPCKHIYHA  110

Query  598  NCISRWLKIKNSCPICRFQMPI  663
            +CI  WL++ NSCPICRF++P 
Sbjct  111  DCIVPWLELHNSCPICRFELPT  132



>ref|XP_006415962.1| hypothetical protein EUTSA_v10009887mg [Eutrema salsugineum]
 gb|ESQ34315.1| hypothetical protein EUTSA_v10009887mg [Eutrema salsugineum]
Length=217

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            C IC +E   +   K +PCKH+FH  CI +WL    SCP+CR++MP+  D
Sbjct  113  CVICLEEWKTEETVKEMPCKHRFHGGCIEKWLGFHGSCPVCRYEMPVDGD  162



>ref|XP_002438034.1| hypothetical protein SORBIDRAFT_10g007000 [Sorghum bicolor]
 gb|EER89401.1| hypothetical protein SORBIDRAFT_10g007000 [Sorghum bicolor]
Length=334

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = +1

Query  409  LTADTNLRHSQASEFSAQSLQQGIKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHK  588
            LT D     + A E + +SL     +  S   +  G  CP+CK+E  L    + LPCKH 
Sbjct  157  LTQDDRPGPAPAPESAIESLP---TVQVSPANLSDGSQCPVCKEEFELGEAARELPCKHA  213

Query  589  FHANCISRWLKIKNSCPICRFQMPIKVDAGEFDRLG  696
            +H +CI  WL++ NSCP+CR ++P +   G  D  G
Sbjct  214  YHTDCIVPWLRLHNSCPVCRQELPQQPADGAQDDGG  249



>ref|XP_002305361.2| hypothetical protein POPTR_0004s12100g [Populus trichocarpa]
 gb|EEE85872.2| hypothetical protein POPTR_0004s12100g [Populus trichocarpa]
Length=151

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 57/111 (51%), Gaps = 5/111 (5%)
 Frame = +1

Query  358  NLRLELHHHASNDDRNPLTADTNLRHSQASEFSAQSL---QQGIKLDSSILEMDRGICCP  528
            N+R ++  HA ND      A  +      S  +A+ L   +  I     I   + G  C 
Sbjct  26   NIR-QIFQHAINDVFAVRAAIRSTNQDGNSNTTARRLPASRDAIDAMPRITVQEGGNDCA  84

Query  529  ICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
            IC +E+ +  E + +PCKH FH+ CI +WL+I  SCP+CRF M + V+  E
Sbjct  85   ICLNEIGIGSELREMPCKHGFHSGCIEQWLRIHGSCPVCRFTM-MPVEGAE  134



>ref|XP_007041516.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOX97347.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=320

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDRLGSV  702
            CP+CKDE  +  E + LPCKH +H++CI  WL + N+CP+CRF++    +A + D +G +
Sbjct  195  CPVCKDEFEVGGEARELPCKHLYHSDCIVPWLSMHNTCPVCRFEINDDSNATDDDEIGEI  254



>ref|XP_010029440.1| PREDICTED: E3 ubiquitin-protein ligase Praja-1 [Eucalyptus grandis]
Length=350

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (65%), Gaps = 3/71 (4%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            I L  S +++  G+C  +CKDE+ +    + LPC H +H +CI  WL I+NSCPICR+++
Sbjct  259  IILSESDVQLSGGVCA-VCKDEVSVGDGVRKLPCSHYYHGDCILPWLAIRNSCPICRYEL  317

Query  658  PIKVDAGEFDR  690
            P   D  E++R
Sbjct  318  P--TDDLEYER  326



>ref|XP_009787392.1| PREDICTED: uncharacterized protein LOC104235354 [Nicotiana sylvestris]
Length=439

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 58/114 (51%), Gaps = 16/114 (14%)
 Frame = +1

Query  358  NLRLELHHHASNDDRNPLTADTNLRHSQ-------------ASEFSAQSLQQGIKLDSSI  498
            N+  +L HH   DD N  TA+  L   Q             AS+   ++L   + L    
Sbjct  308  NVEFDLAHHIDQDDYN-YTAEYELLFGQFAEGENGLVGKPPASKTVVRNLPT-VALSKDD  365

Query  499  LEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            +E +   C  ICKDE+ L    + LPC H++H +CI  WL I+N+CP+CR ++P
Sbjct  366  IEKNDATCA-ICKDEMNLGERARQLPCAHRYHGDCIVPWLGIRNTCPVCRHELP  418



>ref|XP_010487098.1| PREDICTED: E3 ubiquitin-protein ligase CIP8-like [Camelina sativa]
Length=302

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = +1

Query  496  ILEMDRGIC-CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVD  672
            +++++ G+  C +C D+  + +E K +PCKHKFH++C+  WL++ +SCP+CR+ +P   D
Sbjct  221  VVKIEDGLLQCTVCLDDFEIGMEAKEMPCKHKFHSDCLLPWLELHSSCPVCRYLLPTGDD  280

Query  673  AGE  681
             GE
Sbjct  281  DGE  283



>emb|CDY69134.1| BnaAnng29400D [Brassica napus]
Length=291

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 49/86 (57%), Gaps = 16/86 (19%)
 Frame = +1

Query  421  TNLRHSQASEFSAQSL----QQGIKLDSSILEMDRGICCPICKDELFLDLEFKVL--PCK  582
            TNLR   ASE   ++L    Q G++ D           C +CKDE+ +  +  VL  PC 
Sbjct  196  TNLRFPPASEAFVKNLPVVVQVGVENDD----------CAVCKDEMGIGSKGVVLLLPCN  245

Query  583  HKFHANCISRWLKIKNSCPICRFQMP  660
            HK+H  CI  WLK +N+CP+CR+++P
Sbjct  246  HKYHGECIVPWLKTRNTCPVCRYELP  271



>ref|XP_008240345.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Prunus mume]
Length=381

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = +1

Query  478  IKLDSSILEMDRGICCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQM  657
            +K+   +L+ D   C  +CKD   L  E K +PCKH +H++CI  WL++ NSCP+CR+++
Sbjct  203  VKISKELLDSDSSQCA-VCKDSFELGEEAKQMPCKHIYHSDCILPWLELHNSCPVCRYEL  261

Query  658  PI  663
            P 
Sbjct  262  PT  263



>ref|XP_006440833.1| hypothetical protein CICLE_v10018495mg [Citrus clementina]
 gb|ESR54073.1| hypothetical protein CICLE_v10018495mg [Citrus clementina]
Length=1434

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  520   CCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
              C +CKDE  +  + K LPC H++H  CI  WL+I+N+CP+CR++MP
Sbjct  1370  ICAVCKDEFGVGEKAKRLPCSHRYHGECIVPWLRIRNTCPVCRYEMP  1416



>ref|XP_007157614.1| hypothetical protein PHAVU_002G084300g [Phaseolus vulgaris]
 gb|ESW29608.1| hypothetical protein PHAVU_002G084300g [Phaseolus vulgaris]
Length=222

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGE  681
            C +C +E  +    K +PCKHKFH +CI +WL +  SCP+CR++MP++ + G+
Sbjct  115  CVVCLEEFGVGGVAKEMPCKHKFHGDCIEKWLGMHGSCPVCRYEMPVEKNWGK  167



>ref|XP_004301091.1| PREDICTED: uncharacterized protein LOC101292026 [Fragaria vesca 
subsp. vesca]
Length=460

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAGEFDR  690
            C +CKD++ L  + K LPC H++H +CI  WL+I+N+CP+CR+++P    A E  R
Sbjct  392  CAVCKDDITLGEQGKKLPCAHRYHGDCIVPWLRIRNTCPVCRYELPTDDAAYERRR  447



>ref|XP_006599433.1| PREDICTED: E3 ubiquitin-protein ligase RNF115-like [Glycine max]
 gb|KHN32751.1| E3 ubiquitin-protein ligase RING1 [Glycine soja]
Length=322

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
            C +C +++ +  E K +PCKHKFH +CI  WLK+  SCP+CRFQMP
Sbjct  226  CTVCLEDVEVGSEAKEMPCKHKFHGDCIVSWLKLHGSCPVCRFQMP  271



>ref|XP_006345087.1| PREDICTED: uncharacterized protein LOC102578405 [Solanum tuberosum]
Length=432

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +1

Query  520  CCPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMP  660
             C ICKDEL L  + + LPC H++H +CI  WL I+N+CP+CR+++P
Sbjct  364  TCAICKDELNLGEKARQLPCAHRYHGDCIQPWLGIRNTCPVCRYELP  410



>gb|EEC74065.1| hypothetical protein OsI_09075 [Oryza sativa Indica Group]
Length=327

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPIKVDAG  678
            CP+CK++  L    + +PCKH +H++CI  WL++ NSCP+CR+Q+P    AG
Sbjct  186  CPVCKEDFELGEAARQMPCKHVYHSDCIVPWLRLHNSCPVCRYQLPSSAAAG  237



>ref|XP_002523963.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF38331.1| zinc finger protein, putative [Ricinus communis]
Length=116

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +1

Query  523  CPICKDELFLDLEFKVLPCKHKFHANCISRWLKIKNSCPICRFQMPI  663
            C +CKDE     E K +PCKH +H +CI  WL++ NSCP+CR+++P 
Sbjct  4    CAVCKDEFEKGAEAKQMPCKHVYHNDCIVPWLELHNSCPVCRYELPT  50



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1997200541776