BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19202_g1_i1 len=1572 path=[345:0-726 1071:727-775 1120:776-806
1151:807-1571]

Length=1572
                                                                      Score     E

ref|XP_009780813.1|  PREDICTED: agmatine coumaroyltransferase-2-like    745   0.0      
ref|XP_009613303.1|  PREDICTED: agmatine coumaroyltransferase-2 {...    733   0.0      
ref|XP_006347216.1|  PREDICTED: agmatine coumaroyltransferase-2-like    728   0.0      
ref|XP_004241296.1|  PREDICTED: agmatine coumaroyltransferase-2-like    712   0.0      
ref|XP_009616122.1|  PREDICTED: agmatine coumaroyltransferase-2 {...    709   0.0      
ref|XP_004250998.1|  PREDICTED: agmatine coumaroyltransferase-2-like    702   0.0      
ref|XP_006349059.1|  PREDICTED: agmatine coumaroyltransferase-2-like    700   0.0      
ref|XP_009611199.1|  PREDICTED: agmatine coumaroyltransferase-2 {...    670   0.0      
ref|XP_010247719.1|  PREDICTED: agmatine coumaroyltransferase-2-like    665   0.0      
ref|XP_009769251.1|  PREDICTED: agmatine coumaroyltransferase-2-like    659   0.0      
ref|XP_009779173.1|  PREDICTED: agmatine coumaroyltransferase-2-like    655   0.0      
gb|AET80688.1|  putrescine hydroxycinnamoyl transferase                 655   0.0      
ref|XP_009626006.1|  PREDICTED: agmatine coumaroyltransferase-2 {...    650   0.0      
ref|XP_011089981.1|  PREDICTED: agmatine coumaroyltransferase-2-like    649   0.0      
ref|XP_004251197.1|  PREDICTED: agmatine coumaroyltransferase-2-like    639   0.0      
gb|KDP43926.1|  hypothetical protein JCGZ_05393                         639   0.0      
ref|XP_004251198.1|  PREDICTED: agmatine coumaroyltransferase-2-like    639   0.0      
ref|XP_006340285.1|  PREDICTED: agmatine coumaroyltransferase-2-l...    637   0.0      
ref|XP_006340273.1|  PREDICTED: agmatine coumaroyltransferase-2-like    636   0.0      
ref|XP_006340284.1|  PREDICTED: agmatine coumaroyltransferase-2-l...    635   0.0      
gb|KDP43927.1|  hypothetical protein JCGZ_05394                         627   0.0      
ref|XP_010933349.1|  PREDICTED: agmatine coumaroyltransferase-2-like    620   0.0      
gb|EYU36999.1|  hypothetical protein MIMGU_mgv1a024237mg                612   0.0      
ref|XP_008794075.1|  PREDICTED: agmatine coumaroyltransferase-2-like    611   0.0      
ref|XP_010242999.1|  PREDICTED: agmatine coumaroyltransferase-2-like    600   0.0      
emb|CDP07005.1|  unnamed protein product                                598   0.0      
gb|EPS65947.1|  hypothetical protein M569_08830                         597   0.0      
ref|XP_009613513.1|  PREDICTED: agmatine coumaroyltransferase-2 {...    594   0.0      
ref|XP_011090111.1|  PREDICTED: agmatine coumaroyltransferase-2-like    583   0.0      
gb|KDP34344.1|  hypothetical protein JCGZ_11227                         572   0.0      
ref|XP_010248407.1|  PREDICTED: agmatine coumaroyltransferase-2-like    567   0.0      
ref|XP_010045273.1|  PREDICTED: agmatine coumaroyltransferase-2-like    565   0.0      
ref|XP_010905669.1|  PREDICTED: agmatine coumaroyltransferase-2-like    563   0.0      
ref|XP_008813714.1|  PREDICTED: LOW QUALITY PROTEIN: agmatine cou...    563   0.0      
ref|XP_010922272.1|  PREDICTED: agmatine coumaroyltransferase-2-like    556   0.0      
ref|XP_010911515.1|  PREDICTED: agmatine coumaroyltransferase-2-like    554   0.0      
gb|EYU36114.1|  hypothetical protein MIMGU_mgv1a007666mg                541   0.0      
ref|XP_009413296.1|  PREDICTED: agmatine coumaroyltransferase-2 {...    539   0.0      
ref|XP_009412963.1|  PREDICTED: agmatine coumaroyltransferase-2 {...    522   2e-178   
ref|XP_009412962.1|  PREDICTED: agmatine coumaroyltransferase-2 {...    521   4e-178   
ref|XP_004982166.1|  PREDICTED: agmatine coumaroyltransferase-2-like    514   5e-175   
ref|XP_002533025.1|  Anthranilate N-benzoyltransferase protein, p...    510   7e-174   Ricinus communis
ref|XP_002533026.1|  Anthranilate N-benzoyltransferase protein, p...    509   1e-173   Ricinus communis
ref|XP_009412964.1|  PREDICTED: agmatine coumaroyltransferase-2 {...    503   4e-171   
emb|CAH65973.1|  H1005F08.2                                             493   3e-167   Oryza sativa [red rice]
gb|AEV40930.1|  putative transferase family protein                     491   2e-166   
ref|XP_006652971.1|  PREDICTED: agmatine coumaroyltransferase-1-like    490   5e-166   
ref|XP_009412968.1|  PREDICTED: agmatine coumaroyltransferase-2 {...    489   7e-166   
ref|XP_002466666.1|  hypothetical protein SORBIDRAFT_01g011860          490   9e-166   Sorghum bicolor [broomcorn]
ref|XP_004960195.1|  PREDICTED: agmatine coumaroyltransferase-2-like    485   3e-164   
dbj|BAK00935.1|  predicted protein                                      484   1e-163   
gb|EAZ32318.1|  hypothetical protein OsJ_16526                          484   2e-163   Oryza sativa Japonica Group [Japonica rice]
sp|A9ZPJ7.1|AGCT2_HORVU  RecName: Full=Agmatine coumaroyltransfer...    483   2e-163   Hordeum vulgare [barley]
ref|XP_004969955.1|  PREDICTED: agmatine coumaroyltransferase-2-like    483   3e-163   
gb|EMT32981.1|  Anthranilate N-benzoyltransferase protein 1             482   9e-163   
emb|CAH65974.1|  H1005F08.3                                             481   2e-162   Oryza sativa [red rice]
ref|XP_004957522.1|  PREDICTED: agmatine coumaroyltransferase-2-like    481   2e-162   
ref|NP_001054171.2|  Os04g0664600                                       480   5e-162   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009412965.1|  PREDICTED: agmatine coumaroyltransferase-2 {...    480   7e-162   
dbj|BAJ89224.1|  predicted protein                                      478   3e-161   
dbj|BAJ86518.1|  predicted protein                                      477   5e-161   
ref|XP_004957521.1|  PREDICTED: agmatine coumaroyltransferase-2-like    477   5e-161   
sp|A9ZPJ6.1|AGCT1_HORVU  RecName: Full=Agmatine coumaroyltransfer...    476   1e-160   Hordeum vulgare [barley]
gb|AAO73071.1|  agmatine coumaroyltransferase                           474   8e-160   Hordeum vulgare [barley]
gb|AEV40931.1|  putative transferase family protein                     469   4e-158   
ref|XP_002460595.1|  hypothetical protein SORBIDRAFT_02g031580          469   7e-158   Sorghum bicolor [broomcorn]
ref|XP_004975399.1|  PREDICTED: agmatine coumaroyltransferase-2-like    468   3e-157   
ref|XP_008670362.1|  PREDICTED: agmatine coumaroyltransferase-2-like    468   4e-157   
tpg|DAA62504.1|  TPA: agmatine coumaroyltransferase                     466   2e-156   
ref|XP_003578560.1|  PREDICTED: agmatine coumaroyltransferase-2-like    465   4e-156   
gb|KDP34699.1|  hypothetical protein JCGZ_10904                         462   5e-156   
gb|EMT23728.1|  hypothetical protein F775_42423                         464   1e-155   
gb|EAZ09943.1|  hypothetical protein OsI_32242                          463   2e-155   Oryza sativa Indica Group [Indian rice]
ref|NP_001063828.1|  Os09g0543900                                       463   2e-155   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006838765.1|  hypothetical protein AMTR_s00002p00256790          462   2e-155   
ref|XP_003578558.1|  PREDICTED: agmatine coumaroyltransferase-2-like    462   3e-155   
ref|XP_003578556.1|  PREDICTED: agmatine coumaroyltransferase-2-like    462   3e-155   
ref|XP_006838766.1|  hypothetical protein AMTR_s00002p00256910          458   2e-153   
ref|XP_006838769.1|  hypothetical protein AMTR_s00002p00257440          458   2e-153   
ref|NP_001147611.1|  agmatine coumaroyltransferase                      458   2e-153   Zea mays [maize]
ref|XP_006838764.1|  hypothetical protein AMTR_s00002p00256740          457   4e-153   
ref|XP_008653003.1|  PREDICTED: agmatine coumaroyltransferase-2-like    457   5e-153   
ref|NP_001063829.1|  Os09g0544000                                       454   7e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660921.1|  PREDICTED: agmatine coumaroyltransferase-2-like    453   1e-151   
gb|EAY91421.1|  hypothetical protein OsI_13046                          454   2e-151   Oryza sativa Indica Group [Indian rice]
gb|AAP68378.1|  putative hydroxycinnamoyl transferase                   454   2e-151   Oryza sativa Japonica Group [Japonica rice]
gb|EMT15624.1|  Anthranilate N-benzoyltransferase protein 1             451   5e-151   
ref|XP_004958859.1|  PREDICTED: agmatine coumaroyltransferase-2-like    441   3e-146   
gb|EMT13704.1|  Anthranilate N-benzoyltransferase protein 1             436   6e-145   
dbj|BAK03392.1|  predicted protein                                      435   1e-144   
ref|XP_003580760.1|  PREDICTED: agmatine coumaroyltransferase-1-like    436   1e-144   
ref|XP_002446382.1|  hypothetical protein SORBIDRAFT_06g015030          434   1e-143   Sorghum bicolor [broomcorn]
gb|EMS52764.1|  Agmatine coumaroyltransferase-2                         432   3e-143   
dbj|BAJ96183.1|  predicted protein                                      434   2e-142   
dbj|BAJ97586.1|  predicted protein                                      430   2e-142   
ref|XP_003573713.2|  PREDICTED: agmatine coumaroyltransferase-2-like    427   6e-141   
dbj|BAK03149.1|  predicted protein                                      424   2e-140   
dbj|BAJ92466.1|  predicted protein                                      421   4e-140   
ref|XP_006853055.1|  hypothetical protein AMTR_s00038p00060070          424   4e-140   
gb|EMT28099.1|  Anthranilate N-benzoyltransferase protein 1             424   6e-140   
ref|XP_004978049.1|  PREDICTED: agmatine coumaroyltransferase-2-like    422   4e-139   
ref|XP_004980736.1|  PREDICTED: agmatine coumaroyltransferase-2-like    421   8e-139   
dbj|BAF97632.1|  agmatine coumaroyltransferase                          413   6e-137   Triticum aestivum [Canadian hard winter wheat]
gb|KDP34339.1|  hypothetical protein JCGZ_11222                         411   2e-136   
ref|XP_004958863.1|  PREDICTED: agmatine coumaroyltransferase-2-like    414   5e-136   
ref|XP_004979694.1|  PREDICTED: agmatine coumaroyltransferase-2-like    411   3e-135   
ref|XP_006838768.1|  hypothetical protein AMTR_s00002p00257270          410   5e-135   
dbj|BAF97635.1|  agmatine coumaroyltransferase                          404   2e-133   Triticum aestivum [Canadian hard winter wheat]
dbj|BAF97633.1|  agmatine coumaroyltransferase                          400   9e-132   Triticum aestivum [Canadian hard winter wheat]
dbj|BAF97638.1|  agmatine coumaroyltransferase                          399   1e-131   Triticum aestivum [Canadian hard winter wheat]
dbj|BAF97639.1|  agmatine coumaroyltransferase                          398   5e-131   Triticum aestivum [Canadian hard winter wheat]
dbj|BAF97637.1|  agmatine coumaroyltransferase                          398   5e-131   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010276127.1|  PREDICTED: agmatine coumaroyltransferase-2-like    399   1e-130   
ref|XP_008677985.1|  PREDICTED: agmatine coumaroyltransferase-2-like    394   2e-128   
ref|XP_004973036.1|  PREDICTED: agmatine coumaroyltransferase-2-like    394   3e-128   
dbj|BAF97630.1|  agmatine coumaroyltransferase                          390   6e-128   Triticum aestivum [Canadian hard winter wheat]
dbj|BAF97640.1|  agmatine coumaroyltransferase                          390   7e-128   Triticum aestivum [Canadian hard winter wheat]
gb|AFW60402.1|  hypothetical protein ZEAMMB73_955248                    392   2e-127   
ref|XP_010251819.1|  PREDICTED: agmatine coumaroyltransferase-2-like    389   8e-127   
ref|XP_002527426.1|  Anthranilate N-benzoyltransferase protein, p...    384   9e-127   Ricinus communis
ref|XP_009795806.1|  PREDICTED: agmatine coumaroyltransferase-2-like    384   1e-126   
gb|AAO73072.1|  putative agmatine coumaroyltransferase                  386   1e-126   Triticum aestivum [Canadian hard winter wheat]
dbj|BAF97628.1|  agmatine coumaroyltransferase                          385   6e-126   Triticum aestivum [Canadian hard winter wheat]
emb|CAE03578.1|  OSJNBa0087O24.1                                        386   1e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002449839.1|  hypothetical protein SORBIDRAFT_05g024230          387   2e-125   Sorghum bicolor [broomcorn]
ref|XP_010251817.1|  PREDICTED: agmatine coumaroyltransferase-2-like    384   1e-124   
ref|XP_006838773.1|  hypothetical protein AMTR_s00002p00257740          378   2e-122   
gb|AFW60401.1|  hypothetical protein ZEAMMB73_175715                    376   3e-121   
ref|XP_010251818.1|  PREDICTED: agmatine coumaroyltransferase-2-like    372   3e-120   
ref|XP_008671764.1|  PREDICTED: agmatine coumaroyltransferase-2-like    367   2e-118   
emb|CDM81057.1|  unnamed protein product                                363   2e-116   
ref|XP_004979693.1|  PREDICTED: agmatine coumaroyltransferase-2-like    364   2e-116   
dbj|BAF97631.1|  agmatine coumaroyltransferase                          353   9e-114   Triticum aestivum [Canadian hard winter wheat]
tpg|DAA64271.1|  TPA: hypothetical protein ZEAMMB73_959583              355   1e-113   
gb|KDP43925.1|  hypothetical protein JCGZ_05392                         351   1e-112   
dbj|BAF97636.1|  agmatine coumaroyltransferase                          350   2e-112   Triticum aestivum [Canadian hard winter wheat]
dbj|BAF97641.1|  agmatine coumaroyltransferase                          347   3e-111   Triticum aestivum [Canadian hard winter wheat]
dbj|BAF97629.1|  agmatine coumaroyltransferase                          347   3e-111   Triticum aestivum [Canadian hard winter wheat]
gb|AAV44204.1|  hypothetical protein                                    348   6e-111   Oryza sativa Japonica Group [Japonica rice]
dbj|BAF97634.1|  agmatine coumaroyltransferase                          346   1e-110   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008670871.1|  PREDICTED: agmatine coumaroyltransferase-2-like    347   8e-110   
ref|XP_008680089.1|  PREDICTED: agmatine coumaroyltransferase-2-like    355   1e-108   
gb|EMS45531.1|  Agmatine coumaroyltransferase-1                         335   2e-107   
ref|XP_006844995.1|  hypothetical protein AMTR_s00058p00196910          336   3e-106   
gb|EMT23769.1|  Anthranilate N-benzoyltransferase protein 1             340   5e-105   
gb|EMT30236.1|  Anthranilate N-benzoyltransferase protein 1             335   1e-104   
dbj|BAJ99837.1|  predicted protein                                      327   1e-104   
gb|EEE61855.1|  hypothetical protein OsJ_16525                          328   5e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009796118.1|  PREDICTED: agmatine coumaroyltransferase-2-like    323   1e-103   
ref|XP_006844996.1|  hypothetical protein AMTR_s00058p00197140          329   2e-103   
ref|XP_006653854.1|  PREDICTED: agmatine coumaroyltransferase-2-like    324   2e-102   
ref|XP_002991344.1|  BAHD family acyltransferase, clade IV              321   2e-100   
ref|XP_006844997.1|  hypothetical protein AMTR_s00058p00197270          322   2e-100   
ref|NP_001049199.2|  Os03g0185700                                       314   3e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008651745.1|  PREDICTED: agmatine coumaroyltransferase-1-like    311   3e-96    
gb|EEC78408.1|  hypothetical protein OsI_18206                          307   4e-96    Oryza sativa Indica Group [Indian rice]
gb|KDP34340.1|  hypothetical protein JCGZ_11223                         307   1e-95    
gb|EAY88823.1|  hypothetical protein OsI_10296                          309   2e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_003561974.1|  PREDICTED: agmatine coumaroyltransferase-1-like    306   1e-94    
ref|XP_009395154.1|  PREDICTED: agmatine coumaroyltransferase-2 {...    306   2e-94    
ref|XP_003573858.1|  PREDICTED: agmatine coumaroyltransferase-2-like    304   1e-93    
ref|XP_003558643.1|  PREDICTED: agmatine coumaroyltransferase-1-like    303   3e-93    
dbj|BAK02716.1|  predicted protein                                      300   3e-92    
dbj|BAJ87520.1|  predicted protein                                      300   4e-92    
gb|EMT24472.1|  Anthranilate N-benzoyltransferase protein 1             299   5e-92    
ref|NP_001169239.1|  hypothetical protein                               300   5e-92    Zea mays [maize]
ref|XP_004983083.1|  PREDICTED: agmatine coumaroyltransferase-2-like    297   6e-91    
ref|XP_001779848.1|  predicted protein                                  296   8e-91    
dbj|BAJ87102.1|  predicted protein                                      296   2e-90    
gb|EMT21091.1|  Anthranilate N-benzoyltransferase protein 2             295   3e-90    
ref|XP_008788605.1|  PREDICTED: agmatine coumaroyltransferase-2-like    294   7e-90    
ref|XP_010922027.1|  PREDICTED: agmatine coumaroyltransferase-2-like    294   8e-90    
ref|XP_001763897.1|  predicted protein                                  291   3e-89    
gb|EAY78283.1|  hypothetical protein OsI_33328                          292   4e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_001780270.1|  predicted protein                                  291   9e-89    
gb|EAZ15901.1|  hypothetical protein OsJ_31319                          290   2e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008788604.1|  PREDICTED: agmatine coumaroyltransferase-2-like    290   3e-88    
gb|EMT22438.1|  Anthranilate N-benzoyltransferase protein 1             289   7e-88    
ref|NP_001176675.1|  Os11g0642400                                       289   8e-88    
ref|XP_008660165.1|  PREDICTED: agmatine coumaroyltransferase-1-like    288   1e-87    
ref|XP_003561973.1|  PREDICTED: agmatine coumaroyltransferase-1-like    288   2e-87    
gb|AAM74310.1|AC114474_2  Putative anthranilate N-benzoyltransferase    287   3e-87    Oryza sativa Japonica Group [Japonica rice]
gb|EMT24916.1|  Anthranilate N-benzoyltransferase protein 1             286   2e-86    
gb|EMS62369.1|  Agmatine coumaroyltransferase-2                         284   6e-86    
ref|NP_001068358.1|  Os11g0643100                                       283   2e-85    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ86667.1|  predicted protein                                      279   4e-84    
gb|EMS45123.1|  Agmatine coumaroyltransferase-1                         279   6e-84    
gb|EMS56126.1|  Agmatine coumaroyltransferase-2                         278   1e-83    
ref|NP_001054170.1|  Os04g0664500                                       277   2e-83    Oryza sativa Japonica Group [Japonica rice]
gb|EMT17289.1|  Anthranilate N-benzoyltransferase protein 2             278   3e-83    
gb|EMT29560.1|  Anthranilate N-benzoyltransferase protein 2             274   4e-82    
ref|NP_001064484.1|  Os10g0379100                                       269   2e-80    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ96372.1|  predicted protein                                      269   2e-80    
gb|EMS67449.1|  Agmatine coumaroyltransferase-1                         268   7e-80    
ref|XP_004983082.1|  PREDICTED: agmatine coumaroyltransferase-1-like    266   3e-79    
gb|EMS47778.1|  Agmatine coumaroyltransferase-2                         261   2e-78    
gb|EMS65979.1|  Agmatine coumaroyltransferase-1                         264   2e-78    
gb|EMT08552.1|  hypothetical protein F775_42891                         263   3e-78    
gb|EEC80004.1|  hypothetical protein OsI_21657                          261   4e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_006853060.1|  hypothetical protein AMTR_s00038p00068550          255   7e-77    
gb|EEE58457.1|  hypothetical protein OsJ_09694                          258   3e-76    Oryza sativa Japonica Group [Japonica rice]
gb|EEE52439.1|  hypothetical protein OsJ_34584                          258   5e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003561971.1|  PREDICTED: agmatine coumaroyltransferase-1-like    257   1e-75    
ref|NP_001064485.1|  Os10g0380100                                       252   2e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002960602.1|  BAHD family acyltransferase, clade IV              257   2e-75    
ref|XP_002969244.1|  BAHD family acyltransferase, clade IV              255   2e-74    
gb|EEE59703.1|  hypothetical protein OsJ_12127                          247   1e-73    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ88765.1|  predicted protein                                      248   2e-73    
gb|EMT10925.1|  hypothetical protein F775_52506                         248   1e-72    
ref|XP_006662273.1|  PREDICTED: agmatine coumaroyltransferase-2-like    247   3e-72    
gb|EMS61449.1|  Agmatine coumaroyltransferase-1                         242   9e-71    
gb|ABO77956.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    241   2e-69    Coffea canephora [robusta coffee]
ref|XP_006662310.1|  PREDICTED: agmatine coumaroyltransferase-1-like    239   2e-69    
emb|CDP02827.1|  unnamed protein product                                241   5e-69    
emb|CAT00081.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    238   9e-69    Coffea arabica [arabica coffee]
ref|XP_006654926.1|  PREDICTED: agmatine coumaroyltransferase-1-like    233   6e-68    
gb|AFP49814.1|  caffeoyl-CoA quinic acid caffeoyl transferase 4         236   8e-68    
gb|ABO77957.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    236   9e-68    Coffea canephora [robusta coffee]
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase         236   9e-68    
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    236   1e-67    
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    235   2e-67    
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    235   2e-67    
emb|CBI83579.1|  hydroxycinnamoyl transferase                           234   3e-67    
emb|CDO98242.1|  unnamed protein product                                234   3e-67    
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    234   4e-67    Coffea canephora [robusta coffee]
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...    234   5e-67    
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora      234   5e-67    
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    234   6e-67    
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    234   7e-67    
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    233   8e-67    
emb|CAJ40778.1|  hydroxycinnamoyl transferase                           233   8e-67    Coffea arabica [arabica coffee]
gb|AEJ88365.1|  hydroxycinnamoyltransferase                             233   9e-67    
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...    233   1e-66    
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    233   1e-66    
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    233   1e-66    
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    234   1e-66    
emb|CDY31956.1|  BnaA07g00390D                                          233   1e-66    
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    233   2e-66    
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                     234   2e-66    
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    233   2e-66    Coffea canephora [robusta coffee]
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    232   2e-66    
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    232   3e-66    Coffea arabica [arabica coffee]
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    232   3e-66    
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    232   4e-66    
emb|CDY05770.1|  BnaC07g00330D                                          231   5e-66    
gb|KDP41953.1|  hypothetical protein JCGZ_26971                         231   5e-66    
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase           231   7e-66    
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    231   7e-66    
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    232   1e-65    
emb|CDY22880.1|  BnaA01g18180D                                          230   1e-65    
gb|EAZ45540.1|  hypothetical protein OsJ_30200                          226   2e-65    Oryza sativa Japonica Group [Japonica rice]
gb|ABR17170.1|  unknown                                                 229   2e-65    Picea sitchensis
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg            229   3e-65    
ref|XP_009146509.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    229   3e-65    
ref|XP_011018051.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    229   3e-65    
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    229   3e-65    
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...    229   4e-65    Pinus radiata
gb|ACN36537.1|  unknown                                                 224   4e-65    Zea mays [maize]
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    229   5e-65    
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg             228   6e-65    
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...    229   6e-65    
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase                228   8e-65    Trifolium pratense [peavine clover]
ref|XP_004303231.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    228   9e-65    
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase                 228   1e-64    Trifolium pratense [peavine clover]
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    228   1e-64    
gb|ADG46003.1|  hydroxycinnamoyl transferase                            228   1e-64    
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g             228   2e-64    
gb|AHA44839.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltr...    227   2e-64    
emb|CDY44162.1|  BnaC01g22120D                                          227   2e-64    
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...    227   2e-64    
gb|AEK80405.1|  HQT                                                     227   2e-64    
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                    226   3e-64    
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    227   3e-64    Cynara cardunculus [cardoon]
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    226   4e-64    
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase                 226   5e-64    
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    226   6e-64    
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    226   6e-64    
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    226   6e-64    
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    226   6e-64    
gb|AFS68800.1|  hydroxycinnamoyl transferase                            226   7e-64    
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g             226   7e-64    
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg             226   8e-64    
dbj|BAF49306.1|  putative acyltransferase                               226   8e-64    
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    225   9e-64    
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    225   9e-64    
ref|XP_004977484.1|  PREDICTED: agmatine coumaroyltransferase-2-like    226   9e-64    
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    225   9e-64    
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2              225   1e-63    
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    225   1e-63    
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    225   1e-63    
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    225   1e-63    
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    225   1e-63    
ref|XP_002894568.1|  transferase family protein                         225   1e-63    
ref|XP_002324530.2|  hypothetical protein POPTR_0018s11370g             225   2e-63    
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    225   2e-63    
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2             225   2e-63    
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    224   2e-63    
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg             224   3e-63    
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    226   3e-63    
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    224   3e-63    
gb|EAZ12078.1|  hypothetical protein OsJ_01961                          223   3e-63    
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg             224   3e-63    
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    225   3e-63    
gb|AID69225.1|  hydroxycinnamoyl coenzyme A shikimate hydroxycinn...    222   3e-63    
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1              224   3e-63    
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    224   5e-63    
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    223   5e-63    
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    223   5e-63    
ref|XP_011011266.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    223   6e-63    
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    223   6e-63    
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    223   8e-63    
ref|XP_002436797.1|  hypothetical protein SORBIDRAFT_10g008990          220   8e-63    
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...    223   1e-62    
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    223   1e-62    
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like       222   1e-62    
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                      223   1e-62    
ref|XP_011034568.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    222   1e-62    
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    222   2e-62    
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...    222   2e-62    
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    223   2e-62    
gb|AAM61215.1|  anthranilate N-benzoyltransferase                       222   2e-62    
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    222   2e-62    
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    222   2e-62    
ref|XP_006368492.1|  transferase family protein                         222   2e-62    
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg             221   2e-62    
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    221   3e-62    
emb|CBX25442.1|  hypothetical_protein                                   221   3e-62    
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    221   4e-62    
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                   221   6e-62    
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg             221   6e-62    
gb|EMT23265.1|  Anthranilate N-benzoyltransferase protein 1             218   7e-62    
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    220   9e-62    
ref|XP_010527105.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    219   1e-61    
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                      219   1e-61    
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    219   2e-61    
gb|AFL93687.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-tra...    219   2e-61    
emb|CAN82918.1|  hypothetical protein VITISV_023290                     219   2e-61    
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    219   2e-61    
ref|XP_006838767.1|  hypothetical protein AMTR_s00002p00257100          214   2e-61    
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    219   3e-61    
dbj|BAF49305.1|  putative acyltransferase                               219   3e-61    
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    218   3e-61    
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    219   3e-61    
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase           218   4e-61    
ref|XP_009789449.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    218   4e-61    
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    219   4e-61    
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase              219   4e-61    
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    218   5e-61    
emb|CBX25348.1|  hypothetical_protein                                   218   5e-61    
ref|NP_001234850.1|  hydroxycinnamoyl CoA quinate transferase           218   5e-61    
ref|XP_006662724.1|  PREDICTED: agmatine coumaroyltransferase-2-like    218   6e-61    
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase           218   6e-61    
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    218   8e-61    
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    218   9e-61    
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    217   1e-60    
emb|CBX25249.1|  hypothetical_protein                                   217   1e-60    
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    217   1e-60    
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    217   1e-60    
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    217   1e-60    
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    217   2e-60    
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase               217   2e-60    
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg             216   3e-60    
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg             216   5e-60    
gb|ACC63882.1|  quinate O-hydroxycinnamoyltransferase/shikimate O...    214   1e-59    
gb|AEO00530.1|  hydroxycinnamoyl transferase                            212   1e-59    
gb|EAY82189.1|  hypothetical protein OsI_37390                          214   2e-59    
emb|CAE46932.1|  hydroxycinnamoyl CoA quinate transferase               214   2e-59    
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg             214   3e-59    
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    213   3e-59    
emb|CBX24402.1|  hypothetical_protein                                   214   3e-59    
dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                  213   4e-59    
ref|XP_011020577.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    213   4e-59    
ref|XP_009624297.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    213   4e-59    
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    213   5e-59    
ref|NP_001145871.1|  uncharacterized protein LOC100279386               213   5e-59    
ref|XP_006343633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    213   6e-59    
ref|NP_001176778.1|  Os12g0134600                                       213   7e-59    
gb|ACG47161.1|  anthranilate N-benzoyltransferase protein 2             212   1e-58    
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg                212   1e-58    
ref|XP_004507047.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    211   2e-58    
ref|NP_001275483.1|  HQT                                                211   2e-58    
ref|XP_010094062.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    211   2e-58    
emb|CBI25231.3|  unnamed protein product                                210   3e-58    
ref|XP_006826688.1|  hypothetical protein AMTR_s00137p00072760          211   4e-58    
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like       211   4e-58    
ref|XP_002324532.1|  hypothetical protein POPTR_0018s11380g             210   4e-58    
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    210   4e-58    
gb|EAY79861.1|  hypothetical protein OsI_35022                          211   4e-58    
ref|XP_002446745.1|  hypothetical protein SORBIDRAFT_06g021640          210   5e-58    
ref|XP_010273688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    210   9e-58    
ref|XP_003629304.1|  Hydroxycinnamoyl-CoA quinate hydroxycinnamoy...    209   1e-57    
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g             208   2e-57    
ref|XP_006651694.1|  PREDICTED: agmatine coumaroyltransferase-2-like    202   3e-57    
ref|XP_002529412.1|  Anthranilate N-benzoyltransferase protein, p...    206   6e-57    
ref|XP_009365251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    207   7e-57    
gb|ABA46756.1|  hydroxycinnamoyl-CoA quinate-like protein               207   8e-57    
ref|XP_009366045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    207   9e-57    
ref|XP_007216058.1|  hypothetical protein PRUPE_ppa017691mg             207   1e-56    
ref|NP_001053225.1|  Os04g0500700                                       206   2e-56    
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    206   3e-56    
ref|XP_008381165.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    206   3e-56    
ref|XP_002529413.1|  Anthranilate N-benzoyltransferase protein, p...    204   5e-56    
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    204   8e-56    
dbj|BAO20883.1|  hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl...    204   1e-55    
gb|AFF19203.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    204   1e-55    
ref|XP_006652479.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    203   2e-55    
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    203   2e-55    
ref|XP_004293648.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    203   2e-55    
ref|XP_004976123.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    202   3e-55    
ref|XP_006486096.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    202   3e-55    
gb|ADB44897.1|  hydroxycinnamoyl transferase                            202   6e-55    
dbj|BAJ95750.1|  predicted protein                                      202   6e-55    
ref|XP_010273689.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    202   6e-55    
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    202   6e-55    
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    202   6e-55    
ref|XP_002450226.1|  hypothetical protein SORBIDRAFT_05g002200          202   7e-55    
ref|XP_004293649.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    202   7e-55    
dbj|BAJ93247.1|  predicted protein                                      202   7e-55    
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    201   1e-54    
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    200   2e-54    
ref|XP_009399564.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    201   2e-54    
dbj|BAC78635.1|  hydroxyanthranilate hydroxycinnamoyltransferase 3      200   3e-54    
ref|XP_007033668.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    199   4e-54    
gb|KDP38692.1|  hypothetical protein JCGZ_04045                         200   4e-54    
ref|XP_008790160.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    199   4e-54    
gb|EAY78258.1|  hypothetical protein OsI_33303                          197   5e-54    
ref|XP_007217854.1|  hypothetical protein PRUPE_ppa024073mg             199   5e-54    
ref|XP_009380783.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    199   7e-54    
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    198   1e-53    
gb|ACG29714.1|  anthranilate N-benzoyltransferase protein 1             198   1e-53    
ref|NP_001132890.1|  LOC100194386                                       198   1e-53    
emb|CDY11845.1|  BnaC03g12710D                                          205   1e-53    
ref|XP_004295153.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    198   2e-53    
dbj|BAC78634.1|  hydroxyanthranilate hydroxycinnamoyltransferase 2      198   2e-53    
ref|XP_006474019.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    198   2e-53    
ref|NP_001169127.1|  hypothetical protein                               198   2e-53    
ref|XP_006474020.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    198   2e-53    
ref|XP_008228885.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    196   2e-53    
ref|XP_009366046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    197   2e-53    
ref|NP_001047408.1|  Os02g0611800                                       197   3e-53    
ref|XP_003575337.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    197   3e-53    
gb|AGW27209.1|  rosmarinic acid synthase 4                              197   4e-53    
gb|EPS67739.1|  hypothetical protein M569_07035                         196   4e-53    
emb|CDG56250.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...    197   5e-53    
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    197   5e-53    
ref|XP_004291518.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    197   6e-53    
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    196   8e-53    
ref|XP_008223800.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    197   8e-53    
ref|XP_007027321.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    196   8e-53    
gb|AFK10218.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    196   9e-53    
emb|CAE01635.3|  OSJNBa0029H02.19                                       196   1e-52    
gb|KDP38698.1|  hypothetical protein JCGZ_04051                         195   2e-52    
ref|XP_006453163.1|  hypothetical protein CICLE_v10010833mg             195   3e-52    
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    194   3e-52    
ref|XP_002452435.1|  hypothetical protein SORBIDRAFT_04g025760          195   3e-52    
emb|CDX88644.1|  BnaA03g10050D                                          194   3e-52    
dbj|BAC78633.1|  hydroxyanthranilate hydroxycinnamoyltransferase 1      194   3e-52    
ref|XP_008237042.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    194   4e-52    
ref|XP_008231492.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    194   4e-52    
dbj|BAJ87836.1|  predicted protein                                      194   5e-52    
dbj|BAK06288.1|  predicted protein                                      194   5e-52    
ref|XP_004503772.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    194   5e-52    
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    193   6e-52    
ref|XP_006382509.1|  hypothetical protein POPTR_0005s02820g             193   1e-51    
emb|CDG56253.1|  hydroxycinnamoyltransferase 2                          193   1e-51    
dbj|BAJ89730.1|  predicted protein                                      192   1e-51    
gb|EYU21745.1|  hypothetical protein MIMGU_mgv1a006579mg                192   2e-51    
gb|ADA60182.1|  rosmarinic acid synthase                                192   2e-51    
dbj|BAJ91746.1|  predicted protein                                      193   2e-51    
ref|XP_004953073.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    194   2e-51    
sp|O24645.1|HCBT1_DIACA  RecName: Full=Anthranilate N-benzoyltran...    192   2e-51    
ref|XP_008223799.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    193   2e-51    
ref|XP_003550654.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    193   2e-51    
ref|XP_007156887.1|  hypothetical protein PHAVU_002G025600g             192   2e-51    
ref|XP_008679391.1|  PREDICTED: agmatine coumaroyltransferase-1-like    192   3e-51    
ref|XP_003580078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    192   3e-51    
gb|EMT08585.1|  Anthranilate N-benzoyltransferase protein 1             192   3e-51    
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    192   3e-51    
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    191   3e-51    
ref|XP_007211620.1|  hypothetical protein PRUPE_ppa005563mg             192   4e-51    
ref|XP_006382508.1|  hypothetical protein POPTR_0005s02810g             192   4e-51    
ref|XP_008231463.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    192   4e-51    
sp|A0PDV5.1|RAS_PLESU  RecName: Full=Rosmarinate synthase; Short=...    191   4e-51    
gb|AFF19202.1|  BAHD acyltransferase                                    191   5e-51    
gb|KHN17617.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    191   6e-51    
ref|XP_010093469.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    191   7e-51    
gb|AGM90558.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    191   9e-51    
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    190   9e-51    
emb|CAD88491.1|  hydroxycinnamoyl-CoA hydroxycinnamoyltransferase       187   1e-50    
gb|EAZ23787.1|  hypothetical protein OsJ_07497                          191   1e-50    
ref|XP_011036823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    190   1e-50    
ref|XP_009132100.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    190   1e-50    
ref|XP_009132104.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    190   1e-50    
gb|AJA31666.1|  rosmarinic acid synthase                                189   2e-50    
gb|EEE62111.1|  hypothetical protein OsJ_16895                          188   2e-50    
emb|CDG56252.1|  hydroxycinnamoyltransferase 1                          189   2e-50    
ref|XP_006471643.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    190   2e-50    
ref|XP_011036967.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    190   2e-50    
ref|XP_009394928.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    189   2e-50    
gb|KDP41799.1|  hypothetical protein JCGZ_26817                         189   3e-50    



>ref|XP_009780813.1| PREDICTED: agmatine coumaroyltransferase-2-like [Nicotiana sylvestris]
Length=442

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/440 (80%), Positives = 392/440 (89%), Gaps = 2/440 (0%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MKVKVES+R IKP YE  PP T +++PLSVFDKV+Y+AQIAVIYAYRPPTPPN+ I+LGL
Sbjct  1     MKVKVESSRIIKPFYEDIPPSTKSYIPLSVFDKVTYEAQIAVIYAYRPPTPPNAAIKLGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             +KA+ VYREWAGRLG DE GNPV+LLNDEGVKFVEAS D+TLDKV+PFKPS SLL LHPS
Sbjct  61    QKAIAVYREWAGRLGKDEHGNPVILLNDEGVKFVEASSDSTLDKVIPFKPSASLLKLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             L  VVELVQVQVTRFTCGSLVVGFTAHH VADGHSTSNFLVAWG+ACR + I PLPL DR
Sbjct  121   LNNVVELVQVQVTRFTCGSLVVGFTAHHTVADGHSTSNFLVAWGQACRGLDINPLPLHDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
             TIF PRNPP IEY+H GAE+M K +KK +    ++  T  +DIVVHKVHFT+EFLAK+KA
Sbjct  181   TIFNPRNPPLIEYEHKGAEFMSKFVKKENSLNETHHVT--EDIVVHKVHFTVEFLAKIKA  238

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
             KAS+MNG  +PYSTFESLVAHLWRAITKAR L GFETTHIRISV+GR RLNP++PN+YFG
Sbjct  239   KASSMNGNNKPYSTFESLVAHLWRAITKARGLSGFETTHIRISVNGRMRLNPRIPNEYFG  298

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             NLVLWAFPTAKVKDLLREPL YA KLIHDAV KVNNNY RSFIDFAN KV+ E++ LVPT
Sbjct  299   NLVLWAFPTAKVKDLLREPLPYATKLIHDAVMKVNNNYFRSFIDFANHKVLKEDEDLVPT  358

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             ADM+KHILCPNLEVDSWLRFPFYDLDFGTGCPY+FMP++FPTEGMMFLLPSFIGDGSID 
Sbjct  359   ADMNKHILCPNLEVDSWLRFPFYDLDFGTGCPYMFMPSYFPTEGMMFLLPSFIGDGSIDV  418

Query  1318  FIPLFQDNLPTFKQICYSLD  1377
             FIPLFQDNLPTFK+ICYS D
Sbjct  419   FIPLFQDNLPTFKKICYSFD  438



>ref|XP_009613303.1| PREDICTED: agmatine coumaroyltransferase-2 {ECO:0000303|PubMed:18270436, 
ECO:0000312|EMBL:BAF97627.1}-like [Nicotiana tomentosiformis]
Length=441

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/440 (80%), Positives = 389/440 (88%), Gaps = 3/440 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MKVKVES+R IKP YE   P T  ++PLSVFDKV+Y+AQIAVIYAY PPTPPN+ I+LGL
Sbjct  1     MKVKVESSRIIKPFYEDITPSTKGYIPLSVFDKVTYEAQIAVIYAYHPPTPPNAAIKLGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             +KAL VYREWAGRLG DE GNPV+LLNDEGVKFVEAS D+TLDKVMPFKPS SLL LHPS
Sbjct  61    QKALAVYREWAGRLGKDEHGNPVILLNDEGVKFVEASSDSTLDKVMPFKPSASLLKLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             L  VVELVQVQVTRFTCGSLVVGFTAHH VADGHSTSNFLVAWG+ACR + + PLPL DR
Sbjct  121   LNNVVELVQVQVTRFTCGSLVVGFTAHHTVADGHSTSNFLVAWGQACRGLDVNPLPLHDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
             TIF PRNPP IE++H GAE+M K +KK +    ++  T  +DIVVHKVHFT+EFLAKLKA
Sbjct  181   TIFNPRNPPLIEHEHKGAEFMSKFVKKENSLNEAHHVT--EDIVVHKVHFTVEFLAKLKA  238

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
             KAS++NG  +PYSTFESLVAHLWRAITKAR L GFETTHIRISV+GR RLNP+VPN+YFG
Sbjct  239   KASSINGNNKPYSTFESLVAHLWRAITKARGLSGFETTHIRISVNGRIRLNPRVPNEYFG  298

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             NLVLWAFPTAKVKDLLREPL YA KLIHDAV KVNNNY RSFIDFAN KV  ++D L+PT
Sbjct  299   NLVLWAFPTAKVKDLLREPLPYATKLIHDAVIKVNNNYFRSFIDFANHKVKEDKD-LIPT  357

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             ADM+KHILCPNLEVDSWLRFPFYDLDFGTGCPY+FMP++FPTEGMMFLLPSFIGDGSID 
Sbjct  358   ADMNKHILCPNLEVDSWLRFPFYDLDFGTGCPYMFMPSYFPTEGMMFLLPSFIGDGSIDV  417

Query  1318  FIPLFQDNLPTFKQICYSLD  1377
             FIPLFQDNLPTFK+ICYSLD
Sbjct  418   FIPLFQDNLPTFKKICYSLD  437



>ref|XP_006347216.1| PREDICTED: agmatine coumaroyltransferase-2-like [Solanum tuberosum]
Length=445

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/446 (79%), Positives = 389/446 (87%), Gaps = 11/446 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MKVK ES++ IKP YE N  PP T T++PLSVFDKV+Y+AQIA+IYAYRPPTPPN+ I+L
Sbjct  1     MKVKTESSKIIKPFYEDNIIPPSTRTYIPLSVFDKVTYEAQIAIIYAYRPPTPPNAAIQL  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL+KAL +YREWAGRLG DE  NPV+LLNDEGV+FVEAS D+TLDKVMPFKPS SLLNLH
Sbjct  61    GLQKALAIYREWAGRLGKDEHDNPVILLNDEGVRFVEASADSTLDKVMPFKPSASLLNLH  120

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             PSL  VVELVQVQVTRFTCGSLVVGFTAHH VADGHSTSNFLVAWG+ACR + I PLPL 
Sbjct  121   PSLNNVVELVQVQVTRFTCGSLVVGFTAHHTVADGHSTSNFLVAWGQACRGLGINPLPLH  180

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             DRTIF PRNPP IEY+H G E+M K +KK +  LN +     +DIVVHKVHFT+EFLAKL
Sbjct  181   DRTIFNPRNPPLIEYEHKGTEFMSKSVKKENS-LNESTHHVTEDIVVHKVHFTVEFLAKL  239

Query  772   KAKASAM----NGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKV  939
             KAKAS+M    +   +PYSTFESLVAHLWRAITKAR L GFETTHIRISV+GR RLNP+V
Sbjct  240   KAKASSMNNNNHNNNKPYSTFESLVAHLWRAITKARGLSGFETTHIRISVNGRMRLNPRV  299

Query  940   PNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEE  1119
             PN+YFGNLVLWAFPT+KVKDLLREPL YA KLIHDAV+KVNNNY +SFIDFAN K    E
Sbjct  300   PNEYFGNLVLWAFPTSKVKDLLREPLPYATKLIHDAVAKVNNNYFKSFIDFANHK----E  355

Query  1120  DGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIG  1299
             + L+PTADM KHILCPNLEVDSWLRFPFYDLDFGTGCPY+FMP++FPTEGMMFLLPSFIG
Sbjct  356   EDLIPTADMSKHILCPNLEVDSWLRFPFYDLDFGTGCPYMFMPSYFPTEGMMFLLPSFIG  415

Query  1300  DGSIDAFIPLFQDNLPTFKQICYSLD  1377
             DGSIDAFIPLFQDNLPTFK+ICYSLD
Sbjct  416   DGSIDAFIPLFQDNLPTFKKICYSLD  441



>ref|XP_004241296.1| PREDICTED: agmatine coumaroyltransferase-2-like [Solanum lycopersicum]
Length=444

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/447 (77%), Positives = 384/447 (86%), Gaps = 12/447 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MKVK+ES++ IKP YE N  PP T T++PLSVFDKV+Y+AQIA+IYAYRPPTPPN+ I+L
Sbjct  1     MKVKIESSKIIKPFYEDNIIPPSTKTYIPLSVFDKVTYEAQIAIIYAYRPPTPPNAAIQL  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL+KAL +YREWAGRLG DE G PV+ LNDEGV+FVEAS D+TLDKVMPFKPS SLLNLH
Sbjct  61    GLQKALAIYREWAGRLGKDENGIPVISLNDEGVRFVEASADSTLDKVMPFKPSASLLNLH  120

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P L  VVELVQVQVTRFTCGSLVVGFTAHH VADGHSTSNFLVAWG+ACR + I PLPL 
Sbjct  121   PRLNNVVELVQVQVTRFTCGSLVVGFTAHHTVADGHSTSNFLVAWGQACRGLDINPLPLH  180

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             DRTIF PRNPP IEY+H G E+M K +KK +  L+ +     +DIVVHKVHFT+EFLAKL
Sbjct  181   DRTIFNPRNPPLIEYEHKGTEFMSKSVKKENS-LDESTHHVTEDIVVHKVHFTVEFLAKL  239

Query  772   KAKA-----SAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPK  936
             K KA     +  +   RPYSTFESLVAHLWRAITKAR L GFETTHIRISV+GR RLNP+
Sbjct  240   KVKASSMNNNNNSNSNRPYSTFESLVAHLWRAITKARGLSGFETTHIRISVNGRMRLNPR  299

Query  937   VPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAE  1116
             VPN+YFGNLVLWAFPT+KVKDLLREPL YA KLIHDAV KVNNNY RSFIDFAN K    
Sbjct  300   VPNEYFGNLVLWAFPTSKVKDLLREPLPYATKLIHDAVVKVNNNYFRSFIDFANHK----  355

Query  1117  EDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFI  1296
             ++ L+PTADM+KHILCPNLEVDSWLRFPFYDLDFG GCPY+FMP++FPTEGMMFLLPSFI
Sbjct  356   DEDLIPTADMNKHILCPNLEVDSWLRFPFYDLDFGMGCPYMFMPSYFPTEGMMFLLPSFI  415

Query  1297  GDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             GDGSIDAFIPLFQDNLPTFK+ICYSLD
Sbjct  416   GDGSIDAFIPLFQDNLPTFKKICYSLD  442



>ref|XP_009616122.1| PREDICTED: agmatine coumaroyltransferase-2 {ECO:0000303|PubMed:18270436, 
ECO:0000312|EMBL:BAF97627.1}-like [Nicotiana tomentosiformis]
Length=439

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/440 (76%), Positives = 383/440 (87%), Gaps = 5/440 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MK+++ES+R IKP YE  PP TT+H+ LSVFDKV+YDA IA+IYAYRPPTPPN+ IELG 
Sbjct  1     MKIRIESSRIIKPFYENTPPPTTSHISLSVFDKVTYDAHIAIIYAYRPPTPPNAAIELGF  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             +KAL +YREWAGRLG DE  NPV+ LNDEGV+FVEAS D+TLD+VMP+KPS SLLNLHPS
Sbjct  61    QKALAIYREWAGRLGKDEHENPVIQLNDEGVRFVEASVDSTLDQVMPYKPSPSLLNLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             L  V ELVQVQ+TRFTCGSLVVGFTAHH +ADGHSTSNFLVAWG+ACR + + PLPL DR
Sbjct  121   LNDVKELVQVQLTRFTCGSLVVGFTAHHTLADGHSTSNFLVAWGQACRGLRVNPLPLHDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
             TIF PRNPP IEY+H G E+M K  KK   F   +  +  +DIVVHKVHFT+EFLAKLKA
Sbjct  181   TIFNPRNPPMIEYNHKGVEFMSK-FKKERSFNEVHHIS--EDIVVHKVHFTVEFLAKLKA  237

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
             KAS+MN   +PYSTFESLVAHLWR+ITKAR L GFETT IRISV+GR RLNP++PN+YFG
Sbjct  238   KASSMNSNNKPYSTFESLVAHLWRSITKARGLSGFETTQIRISVNGRTRLNPRIPNEYFG  297

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             NLVLWAFPTAKVKDLL EPLSYA KLIHDAV+KVNNNY +SFIDFAN+KV  +E+ L+ T
Sbjct  298   NLVLWAFPTAKVKDLLLEPLSYATKLIHDAVTKVNNNYFKSFIDFANTKV--KEEDLIST  355

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             ADM+KHILCPN+EVDSWLRFPFYDLDFGTGCPYIFMP++FPTEGMMFL+PSFIGDGSID 
Sbjct  356   ADMNKHILCPNIEVDSWLRFPFYDLDFGTGCPYIFMPSYFPTEGMMFLVPSFIGDGSIDV  415

Query  1318  FIPLFQDNLPTFKQICYSLD  1377
             FIPLF+D LPTFK+ICYSLD
Sbjct  416   FIPLFEDKLPTFKKICYSLD  435



>ref|XP_004250998.1| PREDICTED: agmatine coumaroyltransferase-2-like [Solanum lycopersicum]
Length=439

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/440 (75%), Positives = 378/440 (86%), Gaps = 5/440 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MK+K+ES+R IKP YE  PP TT+H+PLSVFDKV+Y+AQIA+IYAY PPTPPN  IELGL
Sbjct  1     MKIKIESSRIIKPFYEHTPPSTTSHIPLSVFDKVTYEAQIAIIYAYHPPTPPNIAIELGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             RKAL VYREW GRLG DE GN V+LLNDEGV+FVEAS  +TLD+ MPFKPS SLL+LHPS
Sbjct  61    RKALVVYREWGGRLGEDEHGNRVILLNDEGVRFVEASASSTLDQAMPFKPSPSLLSLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             LK V ELVQVQ+TRFTCGSLVVGFTAHH VADGHSTSNFLVAWG+ACR + + PLPL DR
Sbjct  121   LKDVKELVQVQLTRFTCGSLVVGFTAHHTVADGHSTSNFLVAWGQACRGLKVNPLPLHDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
             +IF PRN P  EY H G EYM K   K +H LN       +D+VVHKVHFT++FLA LKA
Sbjct  181   SIFTPRNSPLFEYQHKGVEYMSKS--KKEHSLNEVHH-ISEDVVVHKVHFTVQFLANLKA  237

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
             KAS+MNG  +PYSTFESL+AHLWR ITKAR L GFE+T IRISV+GR RLNPKVPN+YFG
Sbjct  238   KASSMNGNNKPYSTFESLLAHLWRVITKARGLSGFESTQIRISVNGRTRLNPKVPNEYFG  297

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             NLVLWAFPT KVK+LLREPL +A KLIHDA++KVNNNY RSFIDFAN+K  A+E+ LVPT
Sbjct  298   NLVLWAFPTTKVKELLREPLPHATKLIHDAIAKVNNNYFRSFIDFANTK--AKEEDLVPT  355

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             ADM+K+ILCPN+EVDSWLRFPFYDLDFGTGCPY+FMP++FPTEGMMFL+PSF+GDGSID 
Sbjct  356   ADMNKYILCPNIEVDSWLRFPFYDLDFGTGCPYMFMPSYFPTEGMMFLIPSFVGDGSIDV  415

Query  1318  FIPLFQDNLPTFKQICYSLD  1377
             F+PLF+D LP FK+ICYSLD
Sbjct  416   FVPLFEDKLPLFKKICYSLD  435



>ref|XP_006349059.1| PREDICTED: agmatine coumaroyltransferase-2-like [Solanum tuberosum]
Length=441

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/441 (75%), Positives = 380/441 (86%), Gaps = 5/441 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPP-LTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELG  234
             MK+++ES+R IKP YE  PP  TT+H+PLSVFDKV+Y AQIA+IYAY PPTPPN+ IELG
Sbjct  1     MKIRIESSRIIKPFYEHTPPPSTTSHIPLSVFDKVTYAAQIAIIYAYHPPTPPNTAIELG  60

Query  235   LRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
             LRKAL VY+EW GRLG DE+GN V+LLNDEGV+FVEAS  +TLD+VMPFKPS SLL+LHP
Sbjct  61    LRKALAVYQEWGGRLGEDEQGNRVILLNDEGVRFVEASSSSTLDQVMPFKPSPSLLSLHP  120

Query  415   SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRD  594
             SLK V ELVQVQ+TRFTCGSLVVGFTAHH VADGHSTSNFLVAWG+ACR + + PLPL D
Sbjct  121   SLKDVKELVQVQLTRFTCGSLVVGFTAHHTVADGHSTSNFLVAWGQACRGLRVNPLPLHD  180

Query  595   RTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLK  774
             RT+F PRNPP I+Y H G E+M K   K +H LN       +D+VVHKVHFT+EFLA LK
Sbjct  181   RTVFTPRNPPLIKYQHKGVEFMSKS--KKEHSLNEVHH-ISEDVVVHKVHFTVEFLANLK  237

Query  775   AKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYF  954
             AKAS+MNG  +PYSTFESL+AHLWR ITKAR L GFE+T IRISV+GR RLNPKVPN+YF
Sbjct  238   AKASSMNGNNKPYSTFESLLAHLWRVITKARGLSGFESTQIRISVNGRTRLNPKVPNEYF  297

Query  955   GNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVP  1134
             GNLVLWAFPT KVK+LL+EPL +A KLIHDA++KVNN+Y RSF+DFAN+K   EED LVP
Sbjct  298   GNLVLWAFPTTKVKELLQEPLPHATKLIHDAIAKVNNDYFRSFVDFANTK-AKEEDQLVP  356

Query  1135  TADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSID  1314
             TADM+KHILCPN+EVDSWLRFPFYDLDFGTGCPY+FMP++FPTEGMMFL+PSFIGDGSID
Sbjct  357   TADMNKHILCPNIEVDSWLRFPFYDLDFGTGCPYMFMPSYFPTEGMMFLIPSFIGDGSID  416

Query  1315  AFIPLFQDNLPTFKQICYSLD  1377
              F+PLF+D LP FK+ CYSLD
Sbjct  417   VFVPLFEDKLPLFKKTCYSLD  437



>ref|XP_009611199.1| PREDICTED: agmatine coumaroyltransferase-2 {ECO:0000303|PubMed:18270436, 
ECO:0000312|EMBL:BAF97627.1}-like [Nicotiana tomentosiformis]
Length=436

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/441 (73%), Positives = 374/441 (85%), Gaps = 6/441 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MK+++ES+R +KP YE   P T +H+PLSVFDKV+YDA IA+IYAYR PTPPN  IELGL
Sbjct  1     MKMRIESSRIVKPIYEDISP-TKSHIPLSVFDKVTYDAHIAIIYAYRSPTPPNPAIELGL  59

Query  238   RKALGVYREWAGRLGNDEEGNPV-VLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
             +KAL +Y E+AGRL  DE GNPV +LLNDEGV+FVEAS ++TLD+VMP+KPS SLL LHP
Sbjct  60    QKALAIYPEFAGRLDKDEHGNPVTILLNDEGVRFVEASANSTLDQVMPYKPSPSLLKLHP  119

Query  415   SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRD  594
             SL  V ELVQVQ+TRFTCGSLVVGFT++H++ADG STSNFLVAWG+ACR + + PLPL D
Sbjct  120   SLNDVKELVQVQLTRFTCGSLVVGFTSNHMIADGQSTSNFLVAWGQACRGLRVNPLPLHD  179

Query  595   RTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLK  774
             RTIF PRNP  IEY+H G E+  K +KK +  LN       +DIVVHKVHFT+EFLAKLK
Sbjct  180   RTIFTPRNPSLIEYEHKGVEFTSKLVKK-ERLLNQAHH-ISEDIVVHKVHFTIEFLAKLK  237

Query  775   AKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYF  954
             AKAS+MNG  +PYSTFESL+AHLWRAITKAR    FETT IRI+V+GRARLNP++PN++F
Sbjct  238   AKASSMNGNNKPYSTFESLIAHLWRAITKARGRSAFETTQIRIAVNGRARLNPRIPNEFF  297

Query  955   GNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVP  1134
             GNLVLWAFPTAKVKDLLREPL +A KLIHDAV+KVNNNY RSFIDFAN+KV  +E  L+P
Sbjct  298   GNLVLWAFPTAKVKDLLREPLPHATKLIHDAVTKVNNNYFRSFIDFANTKV--KEQDLIP  355

Query  1135  TADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSID  1314
             TADM+ HIL PNLEVDSWLRFPFYDLDFGTGCP IFMP++FP EG MF LPSF+GDGSID
Sbjct  356   TADMNDHILGPNLEVDSWLRFPFYDLDFGTGCPNIFMPSYFPVEGGMFFLPSFVGDGSID  415

Query  1315  AFIPLFQDNLPTFKQICYSLD  1377
              FIPLFQDNLPTFK+ICYSLD
Sbjct  416   VFIPLFQDNLPTFKKICYSLD  436



>ref|XP_010247719.1| PREDICTED: agmatine coumaroyltransferase-2-like [Nelumbo nucifera]
Length=438

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/442 (72%), Positives = 376/442 (85%), Gaps = 7/442 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN-PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELG  234
             MK++ ES+R +KP+YEG+ PP  T  +PLSVFDKV+Y+  IAVIYAYRPP PPN+TIE G
Sbjct  1     MKLRRESSRIVKPNYEGDIPPSNTARIPLSVFDKVTYNTHIAVIYAYRPPIPPNATIEQG  60

Query  235   LRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
             L KAL  YREWAGRL  D++G+P++LLND GV FVEAS D TLD+ MPFKPS +LL+LHP
Sbjct  61    LGKALAEYREWAGRLEADDKGDPLILLNDHGVNFVEASADCTLDQTMPFKPSPALLSLHP  120

Query  415   SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRD  594
             SLK    L+QVQ+TRFTCGSLVVGFTAHHLVADGHSTSNFLVAWG+ACR + + P PL +
Sbjct  121   SLKEAKALLQVQLTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGQACRGIEMSPRPLHN  180

Query  595   RTIFIPRNPPRIEYDHVGAEYMPKQIKK-NDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             R IF PR+PP IE++H G EYM + + K    F  S D    DDIVVHK HFTLEFL KL
Sbjct  181   RAIFAPRDPPLIEFEHRGVEYMSRNLNKVYPLFQTSADD---DDIVVHKAHFTLEFLVKL  237

Query  772   KAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDY  951
             KAKAS+ +G  RPYSTFESLVAHLWRAIT+AR L GFETT +RISV+GR+RL+P+VPN+Y
Sbjct  238   KAKASSGSGRNRPYSTFESLVAHLWRAITRARGLNGFETTKVRISVNGRSRLSPRVPNEY  297

Query  952   FGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLV  1131
             FGNLVLWAFP+AKVKDLLREPLS+AAK+IH+AV++VN++Y +SFID+A+S+V  +E+GL+
Sbjct  298   FGNLVLWAFPSAKVKDLLREPLSFAAKIIHEAVAEVNDSYFKSFIDYASSRV--KEEGLI  355

Query  1132  PTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
             P+ADMDK +LCPNLEVDSWLRFPFYDLDFG G PYIFMP++FPTEGMMFLLPSFIGDGSI
Sbjct  356   PSADMDKSVLCPNLEVDSWLRFPFYDLDFGGGSPYIFMPSYFPTEGMMFLLPSFIGDGSI  415

Query  1312  DAFIPLFQDNLPTFKQICYSLD  1377
             DAFIPLFQDN+ +FKQ CYSLD
Sbjct  416   DAFIPLFQDNVASFKQFCYSLD  437



>ref|XP_009769251.1| PREDICTED: agmatine coumaroyltransferase-2-like [Nicotiana sylvestris]
Length=437

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/442 (72%), Positives = 373/442 (84%), Gaps = 7/442 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MK+++ES+R +KP Y+   P T +H+ LSVFDKV+YDA IA+IYAY PPTPPN+ IELGL
Sbjct  1     MKMRIESSRIVKPIYDEISP-TKSHISLSVFDKVTYDAHIAIIYAYCPPTPPNTAIELGL  59

Query  238   RKALGVYREWAGRLGNDEEGNPV-VLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
             +KAL +Y E+AGRL  DE GNPV +LLNDEGV+FVEAS ++TLD+VMP+KPS SLLNLHP
Sbjct  60    QKALAIYPEFAGRLSKDEHGNPVNILLNDEGVRFVEASANSTLDQVMPYKPSPSLLNLHP  119

Query  415   SLKG-VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             SL   V ELVQVQ+T FTCGSL VGFT++H++ADG STSNFLVAWG+ACR + + P+PL 
Sbjct  120   SLNDDVKELVQVQLTWFTCGSLAVGFTSNHMIADGQSTSNFLVAWGQACRGLRVNPIPLH  179

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             DRTIF PRNPP +E +H G E+  K +KK +H LN      L+DIVVHKVHFT+EFLAKL
Sbjct  180   DRTIFNPRNPPLVENEHKGVEFTSKLVKK-EHLLNQAHH-ILEDIVVHKVHFTIEFLAKL  237

Query  772   KAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDY  951
             KAKAS+MNG  +PYSTFESL+AHLWR ITKAR    FETT IRI+V+GRARLNP++PN+Y
Sbjct  238   KAKASSMNGNNKPYSTFESLIAHLWRGITKARGRNAFETTQIRIAVNGRARLNPRIPNEY  297

Query  952   FGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLV  1131
             FGNLVLWAFPT KVKDLLREPL +A KLIHDAV+KVNNNY RSFIDFAN+KV  +E  L+
Sbjct  298   FGNLVLWAFPTTKVKDLLREPLPHATKLIHDAVTKVNNNYFRSFIDFANTKV--KEQDLI  355

Query  1132  PTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
             PTADM+ HIL PNLEVDSWL FPFYDLDFGTGCPYIFMP++FP EG MF LPSF+GDGSI
Sbjct  356   PTADMNDHILGPNLEVDSWLGFPFYDLDFGTGCPYIFMPSYFPVEGGMFFLPSFVGDGSI  415

Query  1312  DAFIPLFQDNLPTFKQICYSLD  1377
             D FIPLFQDNLPTFK+ICYSLD
Sbjct  416   DVFIPLFQDNLPTFKKICYSLD  437



>ref|XP_009779173.1| PREDICTED: agmatine coumaroyltransferase-2-like [Nicotiana sylvestris]
Length=438

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/444 (69%), Positives = 367/444 (83%), Gaps = 6/444 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M VK+ES+R IKP YEG PP T TH+  +VFD V+YDA +A+IYAYRPPTPP STIE+GL
Sbjct  1     MNVKIESSRIIKPFYEGPPPSTNTHISFNVFDNVTYDALMALIYAYRPPTPPTSTIEMGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             RK L VYREWAGR+G DE G+  V LNDEGV+F+EAS D TLD+V+P KPS SLL LHPS
Sbjct  61    RKTLAVYREWAGRIGRDENGSRAVFLNDEGVRFIEASVDATLDEVLPLKPSPSLLKLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             +K VVEL+QVQVTRFTCGS+VVGFT HH++ADGH+ SNF VAWG+ACR V I PLPL DR
Sbjct  121   MKDVVELIQVQVTRFTCGSVVVGFTGHHMIADGHAASNFFVAWGQACRGVEIIPLPLHDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
              IF PRNPP IE++HVGAE+M K + K + F+   +A    +I+VHKVHFTLEFL KLKA
Sbjct  181   AIFHPRNPPLIEFNHVGAEFMSKSLNKKE-FIKLENAE--KNIIVHKVHFTLEFLGKLKA  237

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
              AS +NG  + YSTFESLVAHLWR ITK+R L G + T IRISVDGR R+ P+VP+++FG
Sbjct  238   NASFLNGKTKTYSTFESLVAHLWRVITKSRELDGSQNTQIRISVDGRRRVVPRVPDEFFG  297

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             N+VLWAFPT+KV+DL+ EPL YA K+IHDA++KV++ Y +SFIDFAN KV  +   L+PT
Sbjct  298   NIVLWAFPTSKVRDLVNEPLHYATKIIHDAITKVDDKYFKSFIDFANHKVTED---LIPT  354

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             ADM K  LCPNLEVDSWLRFPFYDLDFGTGCP++FMP+++PTEGMMFL+PSFIGDGSIDA
Sbjct  355   ADMKKDTLCPNLEVDSWLRFPFYDLDFGTGCPFVFMPSYYPTEGMMFLVPSFIGDGSIDA  414

Query  1318  FIPLFQDNLPTFKQICYSLD*TGK  1389
             FIPL+Q+NLPTFK+ICYSLD   K
Sbjct  415   FIPLYQENLPTFKKICYSLDLKAK  438



>gb|AET80688.1| putrescine hydroxycinnamoyl transferase [Nicotiana attenuata]
Length=438

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/444 (69%), Positives = 362/444 (82%), Gaps = 6/444 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M VK+ES+R IKP YEG PP T TH+  +VFD V+YDA +A+IYAYRPPTPP STIE+GL
Sbjct  1     MNVKIESSRIIKPFYEGTPPSTNTHISFNVFDNVTYDALMALIYAYRPPTPPTSTIEMGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             RK L VYREWAGR+G DE GN VV LNDEGV+F+EAS + TLD+V+P KPS SLL LHP 
Sbjct  61    RKTLAVYREWAGRIGRDENGNRVVFLNDEGVRFIEASVNATLDEVLPLKPSPSLLKLHPG  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             +K VVEL+QVQVTRFTCGS++VGFT HH++ADGH+ SNF VAWG+ACR V I PLPL DR
Sbjct  121   MKDVVELIQVQVTRFTCGSVMVGFTGHHMIADGHAASNFFVAWGQACRGVEITPLPLHDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
              IF PRNPP IE++HVGAE+M K + K +     N      +I+VHKVHFTLEFL KLKA
Sbjct  181   AIFHPRNPPLIEFNHVGAEFMSKSLNKKEFIKLENTE---KNIIVHKVHFTLEFLGKLKA  237

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
              AS MNG  + YSTFESLVAHLWR ITKAR L G + T IRISVDGR R+ P+V +++FG
Sbjct  238   NASFMNGKTKTYSTFESLVAHLWRVITKARELDGSQNTQIRISVDGRRRVVPRVADEFFG  297

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             N+VLWAFPT+KV+DL+ EPL YA K+IHDA++KV++ Y +SFIDFAN KV  +   L+PT
Sbjct  298   NIVLWAFPTSKVRDLVNEPLHYATKIIHDAITKVDDKYFKSFIDFANHKVTED---LIPT  354

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             ADM K  LCPNLEVDSWLRFPFYDLDFGTGCP++FMP+++PTEGMMFL+PSFIGDGSIDA
Sbjct  355   ADMKKDTLCPNLEVDSWLRFPFYDLDFGTGCPFVFMPSYYPTEGMMFLVPSFIGDGSIDA  414

Query  1318  FIPLFQDNLPTFKQICYSLD*TGK  1389
             FIPL+QDN PTFK+ICYSLD   K
Sbjct  415   FIPLYQDNSPTFKKICYSLDLKAK  438



>ref|XP_009626006.1| PREDICTED: agmatine coumaroyltransferase-2 {ECO:0000303|PubMed:18270436, 
ECO:0000312|EMBL:BAF97627.1}-like [Nicotiana tomentosiformis]
Length=438

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/444 (68%), Positives = 360/444 (81%), Gaps = 6/444 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M VK+ES+R IKP YEG PP T TH+  ++FD ++YDA +A+IYAYRPPTPP STIE+GL
Sbjct  1     MNVKIESSRIIKPFYEGTPPSTNTHISFNIFDNITYDALMALIYAYRPPTPPTSTIEMGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             RK L VYREWAGR+G DE GN  V LNDEGV+F+EAS D TLD+V+P KPS SLL LHP 
Sbjct  61    RKTLAVYREWAGRIGQDENGNRAVFLNDEGVRFIEASVDATLDEVLPLKPSPSLLKLHPG  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             +K VVEL+QVQVTRFTCGS+VVGFT HH++ADGH+ SNF VAWG+ACR V I PLPL DR
Sbjct  121   MKDVVELIQVQVTRFTCGSVVVGFTGHHMIADGHAASNFFVAWGQACRGVEITPLPLHDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
              IF  RNPP IE++HVGAE+M K + K +     N      +I+VHKVHFTLEFL KLKA
Sbjct  181   AIFHTRNPPLIEFNHVGAEFMSKSVNKKEFIKLENTE---KNIIVHKVHFTLEFLGKLKA  237

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
              AS MNG  + YSTFESLVAHLWR ITK+R L G + T IRISVDGR R+ P+V +++FG
Sbjct  238   NASFMNGKTKTYSTFESLVAHLWRVITKSRELDGSQNTQIRISVDGRRRVVPRVADEFFG  297

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             NLVLWAFPT+KV+DL+ EPL +A K+IHDA++KV++ Y +SFIDFAN +V    + L+PT
Sbjct  298   NLVLWAFPTSKVRDLVNEPLHFATKIIHDAITKVDDKYFKSFIDFANHEV---NEDLIPT  354

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             ADM K  LCPNLEVDSWLRFPFYDLDFGTGCP++FMP+++PTEGMMFL+PSFIGDGSIDA
Sbjct  355   ADMKKDTLCPNLEVDSWLRFPFYDLDFGTGCPFVFMPSYYPTEGMMFLVPSFIGDGSIDA  414

Query  1318  FIPLFQDNLPTFKQICYSLD*TGK  1389
             FIPL+ DNLPTFK+ICYSLD   K
Sbjct  415   FIPLYHDNLPTFKKICYSLDLKAK  438



>ref|XP_011089981.1| PREDICTED: agmatine coumaroyltransferase-2-like [Sesamum indicum]
Length=436

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/442 (71%), Positives = 367/442 (83%), Gaps = 8/442 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MKVK+ S++ +KP YEG+PP TT + PLSVFDK +YD  +AVIYAY PPTPPN+TIELGL
Sbjct  1     MKVKIGSSKLVKPFYEGHPPSTTDYTPLSVFDKTTYDQHVAVIYAYNPPTPPNATIELGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             RKAL  YREWAG+LG D  G P++LLNDEGV+FVEAS D  L++ + F+PSVSLLNLHPS
Sbjct  61    RKALTAYREWAGKLGRDGNGEPIILLNDEGVRFVEASVDRPLNETVHFRPSVSLLNLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             L+GVVELVQVQVTRF+CGS+VVGFTAHHLVADGH TS+FLVAWG+ACR + + PLP RDR
Sbjct  121   LEGVVELVQVQVTRFSCGSMVVGFTAHHLVADGHGTSSFLVAWGQACRGLDVNPLPFRDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
             TIF PRNPP+ E++H G EY+ K +KK    ++++    ++DIV HKVH++ EFL+KLK+
Sbjct  181   TIFSPRNPPKFEFEHRGVEYITKNLKKIYPLIDNS----VEDIVAHKVHYSKEFLSKLKS  236

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
             KASAMN   +P+STFESLVAHLWRAITKAR L G ETT +RISVDGR RLNP+VPN+YFG
Sbjct  237   KASAMNRTNKPFSTFESLVAHLWRAITKARGLNGLETTQVRISVDGRYRLNPRVPNEYFG  296

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             NLVLWAF  AKV DLL EPL YAAKL+H+AV KVN+NY +SFIDFAN KV  E+  LVP 
Sbjct  297   NLVLWAFARAKVNDLLSEPLPYAAKLLHEAVMKVNDNYFKSFIDFANHKVKKED--LVPN  354

Query  1138  A--DMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
             A  D  + IL PNLEVDSWLRFPFYDLDFG G PYIFMP+F PTEGM+FLLPSF GDGSI
Sbjct  355   AVADTKESILWPNLEVDSWLRFPFYDLDFGCGGPYIFMPSFSPTEGMIFLLPSFTGDGSI  414

Query  1312  DAFIPLFQDNLPTFKQICYSLD  1377
             D F+PLFQ+NL TFKQICYSLD
Sbjct  415   DVFVPLFQENLTTFKQICYSLD  436



>ref|XP_004251197.1| PREDICTED: agmatine coumaroyltransferase-2-like [Solanum lycopersicum]
Length=443

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/444 (66%), Positives = 360/444 (81%), Gaps = 1/444 (0%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M VK+ES++ IKP YEG PP TT H+P +VFD V++D  +A+IYAYRPPTPP STIE GL
Sbjct  1     MNVKIESSKIIKPLYEGIPPSTTIHIPFNVFDNVTFDTLMALIYAYRPPTPPTSTIETGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             RK L +YREWAGR+G DE GN  V LNDEGV+F+EAS D +LD+V+P KPS S+L+LHPS
Sbjct  61    RKTLSIYREWAGRIGEDEHGNRGVFLNDEGVRFIEASVDASLDEVLPLKPSPSMLSLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             LK VVEL+QVQVTRFTCGS+VVGFT HH++ADGH+ SNF VAWG+ACR + I P+P+ DR
Sbjct  121   LKDVVELIQVQVTRFTCGSVVVGFTGHHMIADGHAASNFFVAWGQACRGMEITPIPMNDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
              IF PRNPP +EY+HVGAE++ K + K    +N ND     +I+VHKVHFTLEFL KLKA
Sbjct  181   AIFRPRNPPLVEYNHVGAEFVSKLVNKELVKIN-NDQDKEKNIIVHKVHFTLEFLGKLKA  239

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
              AS MNG A+ YSTFESL+AHLWR IT +RNL   + T IRISVDGR R+ P+VP+++FG
Sbjct  240   HASFMNGKAKTYSTFESLIAHLWRVITNSRNLNASQNTQIRISVDGRRRITPRVPDEFFG  299

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             N+VLWAFPT+KVKDLL EPL YA K+IH+A++KV++ Y +SFIDFAN + V     L+P+
Sbjct  300   NMVLWAFPTSKVKDLLDEPLHYATKIIHEAITKVDDKYFKSFIDFANDEKVMTRQDLIPS  359

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             A+M    LCPNLEVDSWLRFPFYDLDFGTGCP++FMP+++P EGMMFL+PSFIGDGSIDA
Sbjct  360   ANMKNDSLCPNLEVDSWLRFPFYDLDFGTGCPFLFMPSYYPIEGMMFLVPSFIGDGSIDA  419

Query  1318  FIPLFQDNLPTFKQICYSLD*TGK  1389
             FIPL++ NL  FK+ICYSLD   K
Sbjct  420   FIPLYEHNLTNFKKICYSLDLKAK  443



>gb|KDP43926.1| hypothetical protein JCGZ_05393 [Jatropha curcas]
Length=443

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/443 (68%), Positives = 364/443 (82%), Gaps = 3/443 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYE--GNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MKV++E  R +KP YE  G+ P  +  +PLSVFDKV+Y+  IAVIYAYRPPTPPN+TIEL
Sbjct  1     MKVRIEKVRNVKPIYEDNGDSPSNSQSIPLSVFDKVTYNTHIAVIYAYRPPTPPNATIEL  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL++AL  YREWAGRLG +E+G+PV+ LND+GVK VEAS D+ LD++MP KPS  LL+LH
Sbjct  61    GLQRALSEYREWAGRLGENEKGDPVIFLNDKGVKLVEASVDSKLDRLMPLKPSSILLSLH  120

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             PSLK V ELVQVQ+TRFTCGSLV+GFT+HHLVADG STSNFL+AWGKA R + I PLP  
Sbjct  121   PSLKDVEELVQVQLTRFTCGSLVIGFTSHHLVADGQSTSNFLIAWGKAARGLDISPLPFH  180

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             DRTIF PR PP  E++H G E+  K +K   ++ N  +  F DDIV+HKVHFTL FL+KL
Sbjct  181   DRTIFKPRKPPIFEFEHRGVEFKSKVVKDFHNYNNCLENNFADDIVIHKVHFTLAFLSKL  240

Query  772   KAKASA-MNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPND  948
             K +AS   +   +PYSTFE LVAHLWR+ITKAR LG FETT +RISV+GR R++P VPND
Sbjct  241   KFRASPPSSTNNKPYSTFECLVAHLWRSITKARGLGRFETTSVRISVNGRNRMSPPVPND  300

Query  949   YFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGL  1128
             YFGNLVLWAFP+++VK+L+ EPLS+AAKLIHDA+ KVNNNY +SFIDFA  K   EE+ L
Sbjct  301   YFGNLVLWAFPSSRVKELVNEPLSHAAKLIHDAILKVNNNYFKSFIDFATHKAENEEEEL  360

Query  1129  VPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGS  1308
             VPTA+M+K  LCPNLEVDSWLRFPFYDLDFG GCPY+FMP++FPTEGM+FLLPSFIGDGS
Sbjct  361   VPTAEMNKSALCPNLEVDSWLRFPFYDLDFGGGCPYLFMPSYFPTEGMLFLLPSFIGDGS  420

Query  1309  IDAFIPLFQDNLPTFKQICYSLD  1377
             IDA++PLFQDN  TFK++ YSL+
Sbjct  421   IDAYVPLFQDNAATFKEVVYSLE  443



>ref|XP_004251198.1| PREDICTED: agmatine coumaroyltransferase-2-like [Solanum lycopersicum]
Length=443

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/444 (66%), Positives = 365/444 (82%), Gaps = 1/444 (0%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M VK++S++ IKP YEG PP TTTH+P ++FD V++DA +A+IYAYRPPTPP STIE+GL
Sbjct  1     MNVKIDSSKIIKPLYEGTPPSTTTHIPFNIFDNVTFDALMALIYAYRPPTPPTSTIEIGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             RK L +YREWAGR+G DE GN  V LNDEGV+F+EAS DT+LD+V+P KPS S+L+LHPS
Sbjct  61    RKTLSIYREWAGRIGEDEHGNRGVFLNDEGVRFIEASVDTSLDEVLPLKPSPSVLSLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             LK VVEL+QVQVTRFTCGS+VVGFT HH++ADGH+ SNF VAWG+ACR + I PLP+ DR
Sbjct  121   LKDVVELIQVQVTRFTCGSVVVGFTGHHIIADGHAASNFFVAWGQACRGMEITPLPVNDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
             TIF PR+PP +EY+HVGAE++ K   K    +N ND     +I+VHKVHFTLE+L KLKA
Sbjct  181   TIFRPRDPPLVEYNHVGAEFVSKLGYKELVKVN-NDEHKEKNIIVHKVHFTLEYLGKLKA  239

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
              AS MN  A+ YSTFESL+AHLWR ITK+R+L  F+ T IRISVDGR R+ P+VP+++FG
Sbjct  240   HASFMNENAKTYSTFESLIAHLWRVITKSRDLNAFQNTRIRISVDGRRRIIPRVPDEFFG  299

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             N+VLWAFPT+KVKDLL EPL YA K+IH+A+SKV++ Y +SFIDFAN + V     L+P+
Sbjct  300   NIVLWAFPTSKVKDLLDEPLHYATKIIHEAISKVDDKYFKSFIDFANDEKVMTRQDLIPS  359

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             A+M+   LCPNLEVDSWLRFPFYDLDFGTGCP++FMP+++P EGMMFL+PSFIGDGSIDA
Sbjct  360   ANMNNESLCPNLEVDSWLRFPFYDLDFGTGCPFVFMPSYYPIEGMMFLVPSFIGDGSIDA  419

Query  1318  FIPLFQDNLPTFKQICYSLD*TGK  1389
             FIPL++ NL  F +ICYSLD   K
Sbjct  420   FIPLYEHNLTNFNKICYSLDLKAK  443



>ref|XP_006340285.1| PREDICTED: agmatine coumaroyltransferase-2-like isoform X2 [Solanum 
tuberosum]
Length=443

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/444 (67%), Positives = 362/444 (82%), Gaps = 1/444 (0%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M VK+ES++ IKP YEG PP TTTH+P +VFD V++D  +A+IYAYRPPTPP STIE GL
Sbjct  1     MNVKIESSKIIKPLYEGIPPSTTTHIPFNVFDNVTFDTLMALIYAYRPPTPPTSTIETGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             RK L +YREWAGR+G DE GN  V LNDEGV+F+EAS D +LD+V+P KPS S+L+LHPS
Sbjct  61    RKTLSIYREWAGRIGEDEHGNRGVFLNDEGVRFIEASIDASLDEVLPLKPSPSMLSLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             LK VVEL+QVQVTRFTCGS+VVGFT HH++ADGH+ SNF VAWG+ACR + I PLP+ DR
Sbjct  121   LKDVVELIQVQVTRFTCGSVVVGFTGHHMIADGHAASNFFVAWGQACRGMEIAPLPMNDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
              IF PR+PP IEY+HVGAE++ K + K    +N ND     +I+VHKVHFTLEFL KLKA
Sbjct  181   AIFHPRDPPLIEYNHVGAEFVSKLVNKELVKVN-NDENKEKNIIVHKVHFTLEFLGKLKA  239

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
              AS MNG A+ YSTFESL+AHLWRAITK+R+L   + T IRISVDGR R+ P+V +++FG
Sbjct  240   HASFMNGKAKTYSTFESLIAHLWRAITKSRDLNASQNTQIRISVDGRRRVIPRVSDEFFG  299

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             N+VLWAFPT+KVKDLL EPL YA K+IHDA++KV++ Y +SFIDFAN + V     L+P+
Sbjct  300   NIVLWAFPTSKVKDLLDEPLHYATKIIHDAITKVDDKYFKSFIDFANDEKVMTRQDLIPS  359

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             A+M +  L PNLEVDSWLRFPFYDLDFGTGCP++FMP+++P EGMMFL+PSFIGDGSIDA
Sbjct  360   ANMKEDSLSPNLEVDSWLRFPFYDLDFGTGCPFVFMPSYYPIEGMMFLVPSFIGDGSIDA  419

Query  1318  FIPLFQDNLPTFKQICYSLD*TGK  1389
             FIPL++ NL  FK+ICYSLD   K
Sbjct  420   FIPLYEHNLTNFKKICYSLDLKAK  443



>ref|XP_006340273.1| PREDICTED: agmatine coumaroyltransferase-2-like [Solanum tuberosum]
Length=444

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/444 (66%), Positives = 362/444 (82%), Gaps = 0/444 (0%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M VK+ES++ IKP YEG PP TT H+P +VFD V++D  +A+IYAYRPPTPP STIE GL
Sbjct  1     MNVKIESSKIIKPLYEGIPPSTTAHIPFNVFDNVTFDTLMALIYAYRPPTPPTSTIETGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             RK L +YREWAGR+G DE GN  V LNDEGV+F+EAS D +LD+V+P KPS S+L+LHPS
Sbjct  61    RKTLSIYREWAGRIGEDEHGNRGVFLNDEGVRFIEASVDASLDEVLPLKPSPSMLSLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             LK VVEL+QVQVTRFTCGS+VVGFT HH++ADGH+ SNF V WG+AC+ + I PLP+ DR
Sbjct  121   LKDVVELIQVQVTRFTCGSVVVGFTGHHMIADGHAASNFFVEWGQACQGMEIAPLPMNDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
              IF+PR+PP IEY+HVGAE++ K + K    +N+++     +I+VHKVHFTLEFL KLKA
Sbjct  181   AIFLPRDPPLIEYNHVGAEFVSKLVNKELVKVNNDEINEKKNIIVHKVHFTLEFLGKLKA  240

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
              AS MNG A+ YSTFESL+AHLWRAITK+R+L   + T IRISVDGR R+ P+VP+++FG
Sbjct  241   HASFMNGKAKTYSTFESLIAHLWRAITKSRDLNASQNTQIRISVDGRRRVIPRVPDEFFG  300

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             N+VLWAFPT+KVKDLL EPL YA K+IHDA++KV++ Y +SFIDFAN + V     L+P+
Sbjct  301   NIVLWAFPTSKVKDLLDEPLHYATKIIHDAITKVDDKYFKSFIDFANDEKVMTRQDLIPS  360

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             A+M +  L PNLEVDSWLRFPFYDLDFGTGCP++FMP+++P EGMMFL+PSFIGDGSIDA
Sbjct  361   ANMKEDSLSPNLEVDSWLRFPFYDLDFGTGCPFVFMPSYYPIEGMMFLVPSFIGDGSIDA  420

Query  1318  FIPLFQDNLPTFKQICYSLD*TGK  1389
             FIPL++ NL  FK ICYSL+   K
Sbjct  421   FIPLYEHNLTNFKNICYSLNLKAK  444



>ref|XP_006340284.1| PREDICTED: agmatine coumaroyltransferase-2-like isoform X1 [Solanum 
tuberosum]
Length=443

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/444 (66%), Positives = 361/444 (81%), Gaps = 1/444 (0%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M VK+ES++ IKP YEG PP TTTH+P +VFD V++D  +A+IYAYRPPTPP STIE GL
Sbjct  1     MNVKIESSKIIKPLYEGIPPSTTTHIPFNVFDNVTFDTLMALIYAYRPPTPPTSTIETGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             RK L +YREWAGR+G DE GN  V LNDEGV+F+EAS D +LD+V+P KPS S+L+LHPS
Sbjct  61    RKTLSIYREWAGRIGEDEHGNRGVFLNDEGVRFIEASIDASLDEVLPLKPSPSMLSLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             LK VVEL+QVQVTRFTCGS+VVGFT HH++ADGH+ SNF VAWG+ACR + I PLP+ DR
Sbjct  121   LKDVVELIQVQVTRFTCGSVVVGFTGHHMIADGHAASNFFVAWGQACRGMEIAPLPMNDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
              IF PR+PP IEY+HVGAE++ K + K    +N ND     +I+VHKVHFTLEFL KLKA
Sbjct  181   AIFHPRDPPLIEYNHVGAEFVSKLVNKELVKVN-NDENKEKNIIVHKVHFTLEFLGKLKA  239

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
              AS MNG A+ YSTFESL+AHLWR ITK+R+L   + T IRISVDGR R+ P+V +++FG
Sbjct  240   HASFMNGKAKTYSTFESLIAHLWRVITKSRDLNMLQNTQIRISVDGRRRVIPRVSDEFFG  299

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             N+VLWAFPT+KVKDLL EPL YA K+IHDA++KV++ Y +SFIDFAN + V     L+P+
Sbjct  300   NIVLWAFPTSKVKDLLDEPLHYATKIIHDAITKVDDKYFKSFIDFANDEKVMTRQDLIPS  359

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             A+M +  L PNLEVDSWLRFPFYDLDFGTGCP++FMP+++P EGMMFL+PSFIGDGSIDA
Sbjct  360   ANMKEDSLSPNLEVDSWLRFPFYDLDFGTGCPFVFMPSYYPIEGMMFLVPSFIGDGSIDA  419

Query  1318  FIPLFQDNLPTFKQICYSLD*TGK  1389
             FIPL++ NL  FK+ICYSLD   K
Sbjct  420   FIPLYEHNLTNFKKICYSLDLKAK  443



>gb|KDP43927.1| hypothetical protein JCGZ_05394 [Jatropha curcas]
Length=443

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/443 (68%), Positives = 360/443 (81%), Gaps = 3/443 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYE--GNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MKV++E  R +KP YE  G+ P  +  +PLSVFDKV+Y+  IAVIYAYRPPTPPN+TIEL
Sbjct  1     MKVRIEKVRNVKPIYEDNGDSPSNSQSIPLSVFDKVTYNTHIAVIYAYRPPTPPNATIEL  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL++AL  YREWAGRLG +E+G+PV+ LND+GVK VEAS D+ LD +MP KPS  LL+LH
Sbjct  61    GLQRALSEYREWAGRLGENEKGDPVIFLNDKGVKLVEASVDSKLDGLMPLKPSSILLSLH  120

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             PSLK V ELVQVQ+TRFTCGSLV+GFT+HHLVADG STSNFL+AWGKA R + I PLP  
Sbjct  121   PSLKDVEELVQVQLTRFTCGSLVIGFTSHHLVADGQSTSNFLIAWGKAARGLDISPLPFH  180

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             DRTIF PR PP  E++H G E+  K +K   ++ N  D  F DDI++HKVHFTL FL+KL
Sbjct  181   DRTIFKPRKPPIFEFEHRGVEFKSKVVKDFHNYNNCLDNNFADDIIIHKVHFTLAFLSKL  240

Query  772   KAKAS-AMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPND  948
             K +AS   +   +PYSTFE LVAHLWR+ITKAR LG FETT +RISV+GR R++P VPN+
Sbjct  241   KFRASPPSSTNNKPYSTFECLVAHLWRSITKARGLGRFETTSVRISVNGRNRMSPPVPNE  300

Query  949   YFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGL  1128
             YFGNLVLWAFP+++VK+L+ EPLS+AAKLIHDA+ KVNNNY +SFIDFA  K   EE+ L
Sbjct  301   YFGNLVLWAFPSSRVKELVNEPLSHAAKLIHDAILKVNNNYFKSFIDFATHKAENEEEEL  360

Query  1129  VPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGS  1308
             V TA+M+K  LCPNLEVDSWLRFPFYDLDFG G PY+FMP++FPTEGM+FLLPSFIGDGS
Sbjct  361   VLTAEMNKSALCPNLEVDSWLRFPFYDLDFGGGNPYLFMPSYFPTEGMLFLLPSFIGDGS  420

Query  1309  IDAFIPLFQDNLPTFKQICYSLD  1377
             IDA+IPLF DN  TFK+I YSL+
Sbjct  421   IDAYIPLFLDNAATFKEIVYSLE  443



>ref|XP_010933349.1| PREDICTED: agmatine coumaroyltransferase-2-like [Elaeis guineensis]
Length=443

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/445 (67%), Positives = 356/445 (80%), Gaps = 8/445 (2%)
 Frame = +1

Query  46    EKKTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTI  225
             + K M V+VES+R +KPS +G+PP TT  VPLS+FDKV+YD  IAVIYA+RPP P NS +
Sbjct  4     DPKAMMVRVESSRLVKPSDQGHPPPTTLRVPLSIFDKVTYDTHIAVIYAFRPPIPSNSMV  63

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             E GL + L  YREWAGRLG D EGNP +LLNDEGV+F+EAS DTTLDK MPFKPS +LL+
Sbjct  64    EKGLSRVLSEYREWAGRLGKDPEGNPFILLNDEGVRFIEASADTTLDKAMPFKPSAALLS  123

Query  406   LHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
              HPSL GV ELVQVQ+TRFTCGSL+VGFTAHHLVADGH+TSNFLVAWG A R + I PLP
Sbjct  124   FHPSLHGVAELVQVQLTRFTCGSLMVGFTAHHLVADGHATSNFLVAWGLASRGLAIDPLP  183

Query  586   LRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
             L DR + F+PR+PPR+E+ H G E+M +     + F    D    DDIVVH+VHFT EFL
Sbjct  184   LHDRASFFVPRSPPRLEFKHRGVEFMTR-----NKFDKGKDNPLKDDIVVHRVHFTKEFL  238

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
              KLKA+AS  +   RPY+TFESLVAHLWR +T+AR L G ETTH+RISV+GR RL+P+VP
Sbjct  239   HKLKAQASLGSKSNRPYTTFESLVAHLWRLVTRARGLDGCETTHVRISVNGRTRLSPRVP  298

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
             N+YFGNLVLWAFP AKV +L+ +PL +AA+LIHD V+KVN+ Y RSFIDFA+S VV E +
Sbjct  299   NEYFGNLVLWAFPRAKVAELIGKPLQFAAELIHDEVAKVNDGYFRSFIDFASSGVV-ESE  357

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGC-PYIFMPTFFPTEGMMFLLPSFIG  1299
              LVPTADM K +LCPNLEVDSWLRFPFYDLDFG G  PY FMP++FP EGM+F+LPS +G
Sbjct  358   NLVPTADMGKSVLCPNLEVDSWLRFPFYDLDFGGGAPPYYFMPSYFPVEGMLFILPSSMG  417

Query  1300  DGSIDAFIPLFQDNLPTFKQICYSL  1374
             DGSIDAF+PLF  ++  FKQ CYSL
Sbjct  418   DGSIDAFVPLFCHSVDAFKQDCYSL  442



>gb|EYU36999.1| hypothetical protein MIMGU_mgv1a024237mg [Erythranthe guttata]
Length=437

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/443 (67%), Positives = 357/443 (81%), Gaps = 9/443 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MKV +  +R IKP Y+ N P  +  +PLSVFD+V+Y+  +AVIYAYRPPTPPN T+ELGL
Sbjct  1     MKVNIGRSRLIKPIYQDNHPPKSHCIPLSVFDRVTYNQHLAVIYAYRPPTPPNITLELGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             R ALGVY EWAGRLG D  GNP++LLN EG++FVE+S D  LDK + FKPS SLL LHPS
Sbjct  61    RTALGVYPEWAGRLGKDSNGNPIILLNGEGIRFVESSVDCALDKAIIFKPSSSLLRLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             L+ VVELVQVQ+TRFTCGS+VVGFTAHHLVADG+STS+FLVAWG+A R + I PLP RDR
Sbjct  121   LEDVVELVQVQITRFTCGSMVVGFTAHHLVADGNSTSSFLVAWGQASRGLEISPLPFRDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
             TIF PRNPP+ E++H G EY+ K +K+    +N N    +D+I+VHKVH++++FL+ LKA
Sbjct  181   TIFNPRNPPKFEFEHKGVEYVTKNLKQVYPLINCN----VDNIMVHKVHYSVDFLSNLKA  236

Query  778   KASAMNG-GARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYF  954
             K S   G   + +STFES+VAHLWRAI +AR L G+ETT +R+SVDGRARLNPKVPN+YF
Sbjct  237   KTSPTYGNNNKTFSTFESIVAHLWRAINRARGLNGYETTRVRMSVDGRARLNPKVPNEYF  296

Query  955   GNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVP  1134
             GNLVLWAF +AKV DLL  PL YAA L+H+AV K+N+NY +SFIDFAN KV   E+ LVP
Sbjct  297   GNLVLWAFASAKVNDLLTNPLPYAASLLHEAVVKINDNYFKSFIDFANHKV--NEEDLVP  354

Query  1135  --TADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGS  1308
               TAD  + IL PNLEVDSWLRFPFYDLDFG G P+IFMP+FFPTEGM+FL+PSFIGDGS
Sbjct  355   NTTADTQESILWPNLEVDSWLRFPFYDLDFGKGGPHIFMPSFFPTEGMIFLVPSFIGDGS  414

Query  1309  IDAFIPLFQDNLPTFKQICYSLD  1377
             ID F+PLFQ +L  FKQICYSLD
Sbjct  415   IDVFVPLFQQSLTIFKQICYSLD  437



>ref|XP_008794075.1| PREDICTED: agmatine coumaroyltransferase-2-like [Phoenix dactylifera]
Length=438

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/441 (67%), Positives = 352/441 (80%), Gaps = 8/441 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MKV+VES+R +KPSYEG+PP TT  VPLSVFDKV+Y+  IAVIYA+RPPTP NST+E GL
Sbjct  1     MKVRVESSRLVKPSYEGHPPPTTLRVPLSVFDKVTYNTHIAVIYAFRPPTPCNSTVEKGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
                L  YREWAGRLG D +GNPV+LLNDEGV+F+EAS +TTLDK MPFKPS +LL+ HPS
Sbjct  61    SMVLSEYREWAGRLGKDPKGNPVILLNDEGVRFIEASAETTLDKAMPFKPSAALLSFHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             L GV ELVQVQ+TRFTCGSL+VGFTAHHLVADGH+TSNFLVAWG++ R + I PLPL DR
Sbjct  121   LHGVAELVQVQLTRFTCGSLMVGFTAHHLVADGHATSNFLVAWGRSSRGLAIDPLPLHDR  180

Query  598   -TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLK  774
              T F+PR+PP++E+ H G E+  K     + F    +    DDIVV KVHFT EFL KLK
Sbjct  181   TTFFVPRSPPKLEFKHRGVEFTSK-----NKFDKGKEDPLKDDIVVSKVHFTKEFLNKLK  235

Query  775   AKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYF  954
             A+AS  +   RP++TFESLVAHLWR +TKAR L G ETT +RISV+GR RL+P+VPN+YF
Sbjct  236   AQASLGSKSNRPHTTFESLVAHLWRVVTKARGLDGCETTQVRISVNGRTRLSPRVPNEYF  295

Query  955   GNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVP  1134
             GNLVLWAFP AKV +L+ +PL +AA+LIHD V+KVN+ Y RSFIDFA+S VV  E  L P
Sbjct  296   GNLVLWAFPRAKVAELISQPLQFAAELIHDEVAKVNDGYFRSFIDFASSGVVQSEK-LSP  354

Query  1135  TADMDKHILCPNLEVDSWLRFPFYDLDFGTGC-PYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
             TADM K +LCP+LEVDSWLRFPFYDLDFG G  PY FMP++FP EGM+F+LPS +GD SI
Sbjct  355   TADMGKSVLCPDLEVDSWLRFPFYDLDFGGGSPPYYFMPSYFPVEGMLFILPSSMGDSSI  414

Query  1312  DAFIPLFQDNLPTFKQICYSL  1374
             DAF+PLF  N+  FK  CYSL
Sbjct  415   DAFVPLFCHNVDAFKHNCYSL  435



>ref|XP_010242999.1| PREDICTED: agmatine coumaroyltransferase-2-like [Nelumbo nucifera]
Length=445

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/449 (65%), Positives = 356/449 (79%), Gaps = 14/449 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTH---VPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MKV   S++ +KP +EG+PP +      +PLSVFDK +++  +A IYAYRPP PPN+TIE
Sbjct  1     MKVXKVSSKFVKPLFEGDPPSSLNSGYCIPLSVFDKAAFNNHMAGIYAYRPPIPPNATIE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
             LGLRKAL  YREWAGRLG DE G+PV+LLND GV FVEAS D TL + MP  PS +LL+L
Sbjct  61    LGLRKALSEYREWAGRLGEDESGDPVILLNDAGVYFVEASADCTLHQAMPLSPSPALLSL  120

Query  409   HPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPL  588
             HPSLKG   LVQVQ+TRFTCGSL +GFTAHHLVADGHS SNFLVAWG+ACR + I P P+
Sbjct  121   HPSLKGAEALVQVQLTRFTCGSLALGFTAHHLVADGHSASNFLVAWGQACRGLEISPRPM  180

Query  589   RDRTIFIPRNPPRIEYDHVGAEYM---PKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEF  759
              +R IF+PR+PP I+++H G EYM   P Q+  +  F  +  A   DDI+VHK HFT EF
Sbjct  181   HNRAIFVPRDPPLIQFEHRGVEYMHKNPNQVNPHPPFEITPAA---DDILVHKAHFTSEF  237

Query  760   LAKLKAKASAMNGGAR-PYSTFESLVAHLWRAITKARNLGGFET-THIRISVDGRARLNP  933
             L KLKA AS+ N   R PYSTFESL+AHLWRAIT+AR L G ET T IRISVDGR+RL P
Sbjct  238   LVKLKATASSENADNRPPYSTFESLIAHLWRAITRARGLKGLETVTKIRISVDGRSRLRP  297

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVA  1113
             ++PN+YFGNLVLWAFP+AKVKDLL EPL++AA++IH A+++VN++Y +SFIDFAN +V  
Sbjct  298   RIPNEYFGNLVLWAFPSAKVKDLLDEPLAFAARIIHQAIAEVNDSYFKSFIDFANYRV--  355

Query  1114  EEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGC-PYIFMPTFFPTEGMMFLLPS  1290
             +E+GLV TA+M+K   CPNLEVDSWLR PF+ LDFG  C PYIFMP++FP EG++FLLPS
Sbjct  356   KEEGLVQTAEMEKSFHCPNLEVDSWLRIPFHKLDFGGSCIPYIFMPSYFPIEGLIFLLPS  415

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             FIGDGSIDAFI LFQDNL  FK++CYSLD
Sbjct  416   FIGDGSIDAFISLFQDNLDAFKRLCYSLD  444



>emb|CDP07005.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/442 (64%), Positives = 354/442 (80%), Gaps = 9/442 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M+V++ES+R IKP +EG PP TT H+PLSVFDKV++DA +A+IYAY PP PPN+T+E GL
Sbjct  1     MRVRIESSRVIKPLHEGIPP-TTNHIPLSVFDKVTFDAHMAIIYAYHPPNPPNATLETGL  59

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             RKAL VYREWAGRL  D +G P++LLND GV+FVEAS D  LD+VMP KPS   L+LHPS
Sbjct  60    RKALSVYREWAGRLSKDNDGEPIILLNDAGVRFVEASMDIELDQVMPLKPSAFCLSLHPS  119

Query  418   LKG-VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRD  594
             ++G + ELVQVQ+TRFTCGS+VVGFTA H VADG +TSNFLVAWG+ACR + I PLPL D
Sbjct  120   IQGNIQELVQVQITRFTCGSIVVGFTADHTVADGQATSNFLVAWGQACRGLEIHPLPLHD  179

Query  595   RTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLK  774
             R IF PR+PP IE++H G E+   ++++    L+ +    +D + V + HF+L FLAKLK
Sbjct  180   RGIFKPRDPPCIEFEHRGVEFKNPKLEQFHPLLDED----VDGVAVDQFHFSLGFLAKLK  235

Query  775   AKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYF  954
             AKAS+ NG  + YSTFESLVAHLW+A+TKAR L  ++TT +RISV+GR R++P++PN+YF
Sbjct  236   AKASSRNGNDKSYSTFESLVAHLWKAVTKARGLSAYQTTSVRISVNGRMRMDPRIPNEYF  295

Query  955   GNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVP  1134
             GNLVLWA PTAKVKDLLREP+ Y AKLIHD V+KVN+NY RSFIDFA+ KV  +E+ LVP
Sbjct  296   GNLVLWALPTAKVKDLLREPVPYGAKLIHDTVAKVNDNYFRSFIDFASHKV--KEENLVP  353

Query  1135  TADMDKHIL-CPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
               DM + ++ CPNL+V SWLRFPFYDLD G G PY+FMP+++P EG + LLPSFIGDGSI
Sbjct  354   VVDMGQSVIECPNLDVSSWLRFPFYDLDLGGGSPYVFMPSYYPLEGTILLLPSFIGDGSI  413

Query  1312  DAFIPLFQDNLPTFKQICYSLD  1377
             DA I LF+D+L  FKQICY L+
Sbjct  414   DAVIALFEDHLAAFKQICYELE  435



>gb|EPS65947.1| hypothetical protein M569_08830 [Genlisea aurea]
Length=436

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/440 (63%), Positives = 348/440 (79%), Gaps = 4/440 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MKVK+E ++ +KP Y G PP  T ++PLSVFDKV+YD  +A+IYAYRPPTP N+ +ELGL
Sbjct  1     MKVKIEWSKLVKPLYGGVPPPATEYIPLSVFDKVTYDQHVAIIYAYRPPTPSNAAVELGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             RKAL VYREWAGRLG+  +G P ++LNDEG KFVEA  D  LD+   F+PS +LL+LHP 
Sbjct  61    RKALAVYREWAGRLGHGRDGEPAIILNDEGAKFVEAYVDRNLDQDFTFRPSAALLSLHPP  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             L GV ELVQVQ+TRF+CGS+VVGFTAHH VADG++TS+FLVAWGKACR+V I P+P  DR
Sbjct  121   LIGVAELVQVQITRFSCGSMVVGFTAHHRVADGNATSSFLVAWGKACREVEITPMPFHDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
              IF PR  PRI+++H G E+M K  KK    +++     ++DIV HKV F+ EFL+KLK 
Sbjct  181   AIFPPRETPRIDFEHRGVEFMSKNFKKQYPLIDNQ----IEDIVAHKVKFSKEFLSKLKL  236

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
              AS+ N   +P+STFE+LVAHLWRAIT+AR L   ETT IRISVDGR+RL+P+VP +YFG
Sbjct  237   SASSWNPKEKPFSTFETLVAHLWRAITEARRLNSPETTQIRISVDGRSRLSPRVPQEYFG  296

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             NLVLWAF  A+V DLLREPL YAAKL+HDAV  V++ Y +SFIDFA+ +  AE+     T
Sbjct  297   NLVLWAFARARVGDLLREPLGYAAKLLHDAVVSVDDGYFKSFIDFAHRRAPAEDLVPTAT  356

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             AD ++ IL PNLEVDSWLRFPFYDLD G+GCPY+FMP+F PTEGM+F+LP+F GDGSID 
Sbjct  357   ADTEESILWPNLEVDSWLRFPFYDLDLGSGCPYVFMPSFSPTEGMIFILPTFSGDGSIDV  416

Query  1318  FIPLFQDNLPTFKQICYSLD  1377
             F+PLF++NL  FK++CYSL+
Sbjct  417   FVPLFRENLEVFKRVCYSLE  436



>ref|XP_009613513.1| PREDICTED: agmatine coumaroyltransferase-2 {ECO:0000303|PubMed:18270436, 
ECO:0000312|EMBL:BAF97627.1}-like [Nicotiana tomentosiformis]
Length=448

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/438 (65%), Positives = 345/438 (79%), Gaps = 3/438 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MKVKVES R IKP YE  PP  T+ +PLSVFD V+YDA IAVIYAY PPTP NS IELGL
Sbjct  1     MKVKVESPRIIKPLYEITPPSKTSQIPLSVFDTVTYDAHIAVIYAYHPPTPSNSAIELGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             +K L +YRE AGRLG DE GN V+LLND+GVKF+EAS ++ LD  +  KPS  LLNLHPS
Sbjct  61    QKTLAIYREMAGRLGKDERGNLVILLNDKGVKFIEASAESALDHSILLKPSPILLNLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             LK V +L+Q+Q+TRFTCGS++VGFT HH VADG S S+FLVAW +A R + + PLP  D 
Sbjct  121   LKNVDDLIQIQITRFTCGSMIVGFTIHHRVADGRSASHFLVAWSQATRGLGVNPLPFCDS  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
             TI  PRNP  IE++H GAE++ K+ +K ++ LN       +D+VV K HFT EF+ KLKA
Sbjct  181   TIVTPRNPSLIEFEHEGAEFISKREQK-EYSLNGLTPYMENDVVVEKFHFTPEFITKLKA  239

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
              AS+ NG  RP+STF+SLVAHLWR +T+ARNL   ETT IRI+VDGR RL P+V N+YFG
Sbjct  240   IASSKNGQNRPFSTFQSLVAHLWRVMTRARNLHCSETTQIRIAVDGRMRLIPRVSNEYFG  299

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             NLVLWAFPTAKVKDLLREPL YAA LIHDA++KVNN+Y +SFIDFA+ + +  E  L+PT
Sbjct  300   NLVLWAFPTAKVKDLLREPLPYAANLIHDAIAKVNNDYFKSFIDFASYEAI--EKDLIPT  357

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             ADM+KHILCPNLEVDSWL FP +DLDFGTG P   MP+F+PTEGM+ L+PS IG+G IDA
Sbjct  358   ADMNKHILCPNLEVDSWLSFPSHDLDFGTGSPCSSMPSFYPTEGMLLLVPSSIGEGGIDA  417

Query  1318  FIPLFQDNLPTFKQICYS  1371
             FIP+F+DNL  FK++CYS
Sbjct  418   FIPIFKDNLSVFKKLCYS  435



>ref|XP_011090111.1| PREDICTED: agmatine coumaroyltransferase-2-like [Sesamum indicum]
Length=438

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/439 (65%), Positives = 352/439 (80%), Gaps = 9/439 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MKVK+ S++ +KP YEGNPP  T + PLSVFDKV+Y+   A I AY+ PTPP++ IELGL
Sbjct  1     MKVKIGSSKLVKPFYEGNPPPITDYTPLSVFDKVTYNQHEANICAYKHPTPPSAIIELGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             RK +  YRE AGRLG D  G P++LLNDEGV+FVEAS D  L++ + F+ S +LL+LHPS
Sbjct  61    RKTMAAYRECAGRLGIDGNGEPIILLNDEGVRFVEASVDHPLNETVHFQSSPTLLSLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             L+GVVEL QVQVTRF+CGS+VVGFT HHLVADG++  NFL+AWG+ACR + I PLP RDR
Sbjct  121   LEGVVELFQVQVTRFSCGSMVVGFTVHHLVADGYAMRNFLIAWGEACRGLDINPLPFRDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
             TIF PRNPP+ E++H G EY+ K ++K    +++N    ++DIVVHKVH++ EFL+KLKA
Sbjct  181   TIFSPRNPPKFEFEHRGVEYITKNLEKVFPIIDNN----VEDIVVHKVHYSKEFLSKLKA  236

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
             +AS+MNG  +P+STFESLVAHLWRAITKAR L GFETT +RI VDGR RLNP+VPN+YFG
Sbjct  237   RASSMNGTNKPFSTFESLVAHLWRAITKARGLNGFETTQVRIPVDGRYRLNPRVPNEYFG  296

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPT  1137
             NLVLWAF  AKV +LLREPLSYAAKL+H+AV KV+++Y +SFIDFAN KV  +E+ LVP+
Sbjct  297   NLVLWAFAGAKVDNLLREPLSYAAKLLHEAVMKVDDSYFKSFIDFANYKV--KEEDLVPS  354

Query  1138  A--DMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
             A  D  + IL PNLEV SWLRFP YDLDFG G PYIF P+  P EGM+FLLPSF  DGSI
Sbjct  355   AMPDTKESILWPNLEVASWLRFPCYDLDFGGGGPYIFTPS-SPIEGMIFLLPSFTRDGSI  413

Query  1312  DAFIPLFQDNLPTFKQICY  1368
             D  +PLF++NL TFKQICY
Sbjct  414   DVLVPLFRENLTTFKQICY  432



>gb|KDP34344.1| hypothetical protein JCGZ_11227 [Jatropha curcas]
Length=439

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/442 (60%), Positives = 346/442 (78%), Gaps = 5/442 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M VK+ ST+ +KP +EGN  PP T+ ++PLSVFDK +Y+  +AVI+AYRPPTP N+T E 
Sbjct  1     MDVKIMSTKPVKPIFEGNDIPPSTSQYIPLSVFDKFTYNTHMAVIFAYRPPTPSNATFEH  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL+  L  YR  AGR G DE G+PV+ LND+GVK VEAS D  LD+ MP   S  LL LH
Sbjct  61    GLQIVLSKYRVLAGRFGEDENGDPVIFLNDKGVKLVEASVDGNLDQFMPLHSSPELLGLH  120

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P+ KGV EL+Q+Q+TRF CGSL++G+T+HH + D  S  NFLVAWGKA R + I PLP+ 
Sbjct  121   PTTKGVEELLQIQLTRFNCGSLIIGYTSHHKITDAQSGCNFLVAWGKATRGLDIDPLPIL  180

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             D T F+PRNPP IE++H G E+  K++ K  H   +++   +DDIV+HKVHFT++FL+KL
Sbjct  181   DGTFFVPRNPPIIEFEHRGFEFESKKLVKAFH---NDNNDLVDDIVIHKVHFTMDFLSKL  237

Query  772   KAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDY  951
             KAK S  N   +PY+TFESLVAHLWR ITK+R + GF+TT ++IS++GR R+NP+VP++Y
Sbjct  238   KAKVSENNNNLKPYTTFESLVAHLWRVITKSRGVNGFKTTRVKISINGRRRMNPRVPDEY  297

Query  952   FGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLV  1131
             +GNLVLWAFP+++VKDLL EPL+YAAKLIHDA++ +N+NY +SFIDFA+ K + +E+ LV
Sbjct  298   YGNLVLWAFPSSRVKDLLDEPLAYAAKLIHDAIANINDNYFKSFIDFASCKEMIKEEELV  357

Query  1132  PTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
              TAD+DK  L P+LEVDSW+RFPFY+LDFG G PY+FMP+++P EGM FL PSFIG GSI
Sbjct  358   STADIDKSTLYPDLEVDSWVRFPFYELDFGGGSPYLFMPSYYPLEGMFFLQPSFIGGGSI  417

Query  1312  DAFIPLFQDNLPTFKQICYSLD  1377
             D F+PLF+DNL TFK+I YS+D
Sbjct  418   DTFVPLFRDNLETFKKIVYSID  439



>ref|XP_010248407.1| PREDICTED: agmatine coumaroyltransferase-2-like [Nelumbo nucifera]
Length=440

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/442 (61%), Positives = 341/442 (77%), Gaps = 6/442 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN-PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELG  234
             MKV+  S+  +KP YE N PP    ++PLSVFD+ +Y+  IAVIY YRPPTPPN+TI+ G
Sbjct  1     MKVQTRSSELLKPIYESNIPPSNAHYIPLSVFDRATYNMNIAVIYVYRPPTPPNATIQQG  60

Query  235   LRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
             L+KAL  YRE+AGRLG  + G+PV+LLNDEG+ F+E   + TLD+ +P  PS +LL+LHP
Sbjct  61    LQKALTEYREFAGRLGTGDNGDPVILLNDEGINFIEVWVECTLDEKIPLNPS-ALLSLHP  119

Query  415   SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRD  594
             S++GV  L+QVQ+T+F CGSLVVG T+HH VADG  TSNFLVAWG+ACR V + P PL +
Sbjct  120   SVEGVDALLQVQLTKFACGSLVVGLTSHHQVADGQGTSNFLVAWGQACRGVEMSPRPLHN  179

Query  595   RTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLK  774
             RTIF+PR PP  +++H G E+    +  N  +   + A  + D+++HK H TLEFL KLK
Sbjct  180   RTIFVPREPPLFQFEHRGVEFTDTTLINNKAYPPLSKA-LVGDLIMHKAHLTLEFLDKLK  238

Query  775   AKASA--MNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPND  948
             A+AS+   NGG +PYS FES VAHLWR +TK R + GFE T I+ISV+GRARL P VPN+
Sbjct  239   AEASSSLANGGGKPYSMFESSVAHLWRTVTKVRGISGFERTQIKISVNGRARLRPPVPNE  298

Query  949   YFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGL  1128
             YFGNLVLWA P A+VKDLLREPLS+AAKLIHDAV KVN++Y +SFIDFA+S   AEE+GL
Sbjct  299   YFGNLVLWALPNARVKDLLREPLSFAAKLIHDAVGKVNDSYFKSFIDFASSH-RAEEEGL  357

Query  1129  VPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGS  1308
             VP AD D+ ++CPNLEV SWLRFPFYDLDFG G P +F+P++FP EG +FL+PSF GDGS
Sbjct  358   VPNADADELVMCPNLEVHSWLRFPFYDLDFGEGGPCLFLPSYFPVEGEIFLVPSFTGDGS  417

Query  1309  IDAFIPLFQDNLPTFKQICYSL  1374
             ID F+ LF+DNL  FKQ+CY L
Sbjct  418   IDVFLSLFRDNLAYFKQLCYCL  439



>ref|XP_010045273.1| PREDICTED: agmatine coumaroyltransferase-2-like [Eucalyptus grandis]
 gb|KCW87436.1| hypothetical protein EUGRSUZ_B03906 [Eucalyptus grandis]
Length=461

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/468 (60%), Positives = 351/468 (75%), Gaps = 36/468 (8%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MKVK+ES+R IKP Y+G PP TT  +PL+ FD  +YD Q+AVIYAY PPTPPN TI+ GL
Sbjct  1     MKVKIESSRIIKPCYDGPPPSTTLCIPLTPFDNANYDGQMAVIYAYHPPTPPNITIKRGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             +K L VYREWAGRLG +++G+PV+ LND+GV+FVEAS +  L++ MP  PS  LL LHPS
Sbjct  61    QKVLSVYREWAGRLGKNDKGDPVIFLNDKGVRFVEASVNDPLEESMPSTPSPVLLTLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             LK V ELVQVQ+TRF+CGSLVVGFTAHHLVADGH+TSNFLVAWGKACR + + PLP+ DR
Sbjct  121   LKDVEELVQVQLTRFSCGSLVVGFTAHHLVADGHATSNFLVAWGKACRGLEMAPLPMHDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQ-IKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLK  774
             TIF+PR+ P+ E+ H G EY  K+ I+ +D F   + +   +++V+HKVHFT +FLAKLK
Sbjct  181   TIFVPRDLPKFEFQHKGVEYTSKKPIEIDDDF---DGSILAEEVVIHKVHFTTDFLAKLK  237

Query  775   AKAS-------------------------AMNGGARP---YSTFESLVAHLWRAITKARN  870
             ++AS                           NG  +P   YSTFE LVAHLWR IT+AR 
Sbjct  238   SRASLSLNEDIRSPLDFKSDQIIVSSPTGTSNGQTQPNKMYSTFECLVAHLWRCITRARV  297

Query  871   LGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAV  1050
             L  FETT +RISV+GR RLNP++PN+YFGNLVLWAFP +KVKDLL EP+SYA K+IH+AV
Sbjct  298   LSEFETTQVRISVNGRMRLNPRIPNNYFGNLVLWAFPKSKVKDLLNEPISYATKVIHEAV  357

Query  1051  SKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGC  1230
             SKV++ Y +SFIDFA+ K+  +E+ L PT +++      NLEVDSWLRFPFYDLDFG G 
Sbjct  358   SKVDDRYFKSFIDFASYKL--KEEYLYPTENINPSPA--NLEVDSWLRFPFYDLDFGCGS  413

Query  1231  PYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             P++FMP++FP EG+M L PSF GDGSIDAFIPL +D+L  FK  CY+L
Sbjct  414   PFMFMPSYFPIEGIMLLSPSFKGDGSIDAFIPLHKDHLERFKGNCYTL  461



>ref|XP_010905669.1| PREDICTED: agmatine coumaroyltransferase-2-like [Elaeis guineensis]
Length=438

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/443 (63%), Positives = 340/443 (77%), Gaps = 11/443 (2%)
 Frame = +1

Query  52    KTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             K +KV VEST+ +KP Y GN P TT HV LSVFDKV+YD  +A+IYA+R PTPPNS ++ 
Sbjct  6     KILKVSVESTKIVKPKYAGNLPPTTPHVLLSVFDKVTYDVHVAIIYAFRAPTPPNSVMQN  65

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL +AL  YRE+AGRLG D EGNPV+LLNDEG +FVEA  D+TLD+ +PFKPS +LL+LH
Sbjct  66    GLARALSEYREFAGRLGEDAEGNPVILLNDEGARFVEALVDSTLDQALPFKPSSALLSLH  125

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P L GV EL+Q+Q TRF CGSLVVGFT HH VAD H+TSNFL+AW  A R +    L + 
Sbjct  126   PELHGVAELLQIQFTRFACGSLVVGFTWHHRVADAHATSNFLIAWSLATRGLDFS-LAVH  184

Query  592   DR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAK  768
             DR T F PR PP +E++H G E+ PK     + F         D+IVVHK HFT EFL K
Sbjct  185   DRCTFFTPRVPPLLEFEHRGVEFAPK-----NQFGAPKADPLNDNIVVHKAHFTKEFLTK  239

Query  769   LKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPND  948
             LKA+ASA  G ++PYSTFESL+AHLWR +TKAR L   ETTH+RISVDGR R+NP++P+D
Sbjct  240   LKARASA--GASKPYSTFESLMAHLWRVVTKARRLHETETTHVRISVDGRRRINPRLPDD  297

Query  949   YFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGL  1128
             YFGN+VLWAFP AKV++L+  PL YAA+LIH AV +VN+ Y RSFID A+S VV +E+ L
Sbjct  298   YFGNVVLWAFPRAKVRELVDSPLQYAAELIHGAVGRVNDAYFRSFIDLASSGVVKKEE-L  356

Query  1129  VPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGS  1308
             VPTAD DK +LCPN++VDSWLR PFYDLDFG G P+ FMP+F P EG++FL+PSFI DGS
Sbjct  357   VPTADADKWVLCPNVDVDSWLRLPFYDLDFGGGSPFYFMPSFLPVEGLIFLVPSFI-DGS  415

Query  1309  IDAFIPLFQDNLPTFKQICYSLD  1377
             I+A++ LF  N  +FKQ+CYSLD
Sbjct  416   IEAYVALFDYNQASFKQMCYSLD  438



>ref|XP_008813714.1| PREDICTED: LOW QUALITY PROTEIN: agmatine coumaroyltransferase-2-like 
[Phoenix dactylifera]
Length=438

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/443 (61%), Positives = 339/443 (77%), Gaps = 11/443 (2%)
 Frame = +1

Query  52    KTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             K +KV VESTR +KP+YE N P TT HVPLSVFDK +YD  IA IYA+R P PPNS ++ 
Sbjct  6     KILKVSVESTRIVKPNYECNLPPTTPHVPLSVFDKATYDMHIASIYAFRAPAPPNSVMQN  65

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL + L  YRE+AGRLG D EGNPV+LL+DEGV+FVEAS D+TLD+V+PFKPS +LL+LH
Sbjct  66    GLARVLSEYREFAGRLGEDAEGNPVILLSDEGVRFVEASVDSTLDQVLPFKPSPALLSLH  125

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P + GV EL+QVQ+TRF CGSLVVGFT+HH VAD H+  NFL+AW  A R + +  L + 
Sbjct  126   PEVHGVAELLQVQLTRFACGSLVVGFTSHHRVADAHAAGNFLIAWSLATRGLDVISLAVH  185

Query  592   DR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAK  768
             DR   F PR PP +E++H G E+ PK +     F  +      D+IVVHK HFT EFL K
Sbjct  186   DRGAFFTPRVPPLLEFEHRGVEFAPKNM-----FGAAKSDPLKDNIVVHKAHFTKEFLTK  240

Query  769   LKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPND  948
             LK++ASA  G ++PYSTFESL+AHLWR +TKAR L   ETTH+RISVDGR R+NP++P +
Sbjct  241   LKSRASA--GASKPYSTFESLMAHLWRVVTKARRLHESETTHVRISVDGRRRMNPRLPGE  298

Query  949   YFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGL  1128
             YFGN+VLWA+P A+V+DL+  PL YAA+LIHDAV++VN+ Y RSFIDFA+ +   E++ L
Sbjct  299   YFGNMVLWAYPRARVRDLVDSPLQYAAELIHDAVARVNDAYFRSFIDFASGR---EKEDL  355

Query  1129  VPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGS  1308
              PTAD DK +LCPN++VDSWLR P YDLDFG G P+ FMP+F P EG++FL+PSFIGDGS
Sbjct  356   APTADADKWVLCPNVDVDSWLRLPLYDLDFGGGSPFYFMPSFLPIEGVIFLVPSFIGDGS  415

Query  1309  IDAFIPLFQDNLPTFKQICYSLD  1377
             I+  + LF  N  +FK+ICYSL+
Sbjct  416   IEVHVALFDYNQASFKKICYSLE  438



>ref|XP_010922272.1| PREDICTED: agmatine coumaroyltransferase-2-like [Elaeis guineensis]
Length=492

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/444 (61%), Positives = 341/444 (77%), Gaps = 11/444 (2%)
 Frame = +1

Query  46    EKKTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTI  225
             + K +KV VEST  +KP Y GN P TT HVPLSVFDKV+YD  IA IYA+R PTPPNS +
Sbjct  56    QPKILKVSVESTSIVKPKYAGNLPPTTPHVPLSVFDKVTYDMHIASIYAFRAPTPPNSVM  115

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             + GL + L  YRE+AGRLG D EGNPV+LLNDEGV+FVEAS D+TLD+ +PFKPS +LL+
Sbjct  116   QNGLTRVLSEYREFAGRLGEDAEGNPVILLNDEGVRFVEASVDSTLDQALPFKPSSALLS  175

Query  406   LHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
             LHP + GV EL+QVQ+TRF CGSLV+GFT+HH VAD H+ SNFL+AW  A R + +  L 
Sbjct  176   LHPEVHGVAELLQVQLTRFACGSLVMGFTSHHRVADAHAASNFLIAWSLATRGLDVS-LA  234

Query  586   LRDR-TIFIPRNPPRI-EYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEF  759
             + DR T F PR PP + E++H G E+ PK     + F         D+IVV+K HFT EF
Sbjct  235   VHDRCTFFTPRLPPLLEEFEHRGVEFAPK-----NQFGAEKADPLKDNIVVYKAHFTKEF  289

Query  760   LAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKV  939
             L KLKA+ASA  G ++PYSTFESL+AHLWR +TKAR L   ETTH+RISV+GR R+NP++
Sbjct  290   LTKLKARASA--GASKPYSTFESLMAHLWRVVTKARRLHESETTHVRISVNGRRRMNPRL  347

Query  940   PNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEE  1119
             P++YFGN+VLWA+P AKV++L+  PL YAA+LI DAV++VN+ Y +SFID A+S VV +E
Sbjct  348   PDEYFGNVVLWAYPRAKVRELVDSPLRYAAELIRDAVARVNDAYFKSFIDLASSGVVEKE  407

Query  1120  DGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIG  1299
             + LVPTAD DK +LCPN++VDSWLR P YDLDFG G P+ FMP+F P EG++FL+PSFIG
Sbjct  408   E-LVPTADADKWVLCPNVDVDSWLRLPLYDLDFGGGGPFYFMPSFLPIEGVIFLVPSFIG  466

Query  1300  DGSIDAFIPLFQDNLPTFKQICYS  1371
             DGSI+A + LF  N  +FKQICYS
Sbjct  467   DGSIEAHVALFDYNQASFKQICYS  490



>ref|XP_010911515.1| PREDICTED: agmatine coumaroyltransferase-2-like [Elaeis guineensis]
Length=440

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/444 (61%), Positives = 340/444 (77%), Gaps = 11/444 (2%)
 Frame = +1

Query  52    KTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             K +KV VEST  +KP Y GN P TT HVPLSVFDKV+YD  IA IYA+R P PP+S ++ 
Sbjct  6     KILKVSVESTSIVKPKYAGNLPPTTPHVPLSVFDKVTYDIHIASIYAFRAPAPPSSVMQN  65

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL + L  YRE+AGRLG D EGNPV+LLNDEG +FVEAS D+TLD+ +P KPS++LL+LH
Sbjct  66    GLARVLSEYREFAGRLGEDPEGNPVILLNDEGARFVEASVDSTLDQALPIKPSLALLSLH  125

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P + GV EL+QVQ+TRF CGS VVGFT+HH VAD H+  NFL+AW  A R + +  L + 
Sbjct  126   PEVHGVAELLQVQLTRFACGSFVVGFTSHHRVADAHAAGNFLIAWSLATRGLDVS-LAVH  184

Query  592   DR-TIFIPRNPPRI-EYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLA  765
             DR T F PR PP + E++H G E+ PK     + F  +      D++VVHK HFT EFL 
Sbjct  185   DRSTFFTPRVPPLLEEFEHRGVEFAPK-----NQFGAAKADPLKDNMVVHKAHFTKEFLT  239

Query  766   KLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPN  945
             KLKA+ASA  G ++ YSTFESL+AHLWR +TKAR L   ETTH+RISV+GR R+NP++P+
Sbjct  240   KLKARASA--GASKCYSTFESLMAHLWRVVTKARRLHESETTHVRISVNGRRRMNPRLPD  297

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG  1125
             +YFGN+VLWA+P AKV++++  PL YAA+LIHDAV++VN+ Y RSFID A+S VV E++G
Sbjct  298   EYFGNVVLWAYPRAKVREIVDSPLRYAAELIHDAVARVNDAYFRSFIDLASSGVV-EKEG  356

Query  1126  LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDG  1305
             LVPTAD DK +LCPN++VDSWLR P YDLDFG G P+ FMP+F P EG++FL+PSFIGDG
Sbjct  357   LVPTADADKWVLCPNVDVDSWLRLPLYDLDFGGGGPFYFMPSFLPVEGLIFLVPSFIGDG  416

Query  1306  SIDAFIPLFQDNLPTFKQICYSLD  1377
             SI+A + LF  N  +FKQICYSL+
Sbjct  417   SIEAHVALFDHNQASFKQICYSLE  440



>gb|EYU36114.1| hypothetical protein MIMGU_mgv1a007666mg [Erythranthe guttata]
Length=399

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/393 (68%), Positives = 318/393 (81%), Gaps = 10/393 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MKVK+ S++ ++P YEGNPP TT ++PLSVFDKV+YD  +A+IYAYRPPT PN+TIELGL
Sbjct  1     MKVKIGSSKLVQPLYEGNPPPTTNYIPLSVFDKVTYDQHVAIIYAYRPPTTPNATIELGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             +K+L VYREWAGRLG D  G PV+LLNDEGV+FVEAS D  LD+ +   PS SLL+LHPS
Sbjct  61    KKSLAVYREWAGRLGKDSNGEPVILLNDEGVRFVEASVDRALDQTVSIGPSASLLSLHPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             L+GV ELVQVQVTRF+CGS+VVGFTAHHLVADGH+TS+FLVAWG+A R + I PLP  DR
Sbjct  121   LEGVEELVQVQVTRFSCGSMVVGFTAHHLVADGHATSSFLVAWGQASRGLEISPLPFHDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
             TIF PR+PP ++++H G EY+ K IKK    ++++    +DDIV HKVH+T EFL+KLKA
Sbjct  181   TIFSPRDPPILDFEHRGVEYVSKNIKKVYPLIDNS----VDDIVAHKVHYTAEFLSKLKA  236

Query  778   KASAMNG-GARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARL-NPKVPNDY  951
             +AS+MNG   RP+STFESLVAHLWRAIT+AR L G E T +RISVDGRARL NPKVPN Y
Sbjct  237   RASSMNGPHDRPFSTFESLVAHLWRAITRARGLNGQENTQVRISVDGRARLKNPKVPNGY  296

Query  952   FGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLV  1131
             FGNLVLWAF  A+  DLLREPL Y AKL+HDAV  V ++Y +SFIDFAN K  A+E+ LV
Sbjct  297   FGNLVLWAFAKARANDLLREPLPYVAKLLHDAVVNVQDDYFKSFIDFANHK--AKEEDLV  354

Query  1132  PT--ADMDKHILCPNLEVDSWLRFPFYDLDFGT  1224
             P   AD  + IL PNLEVDSWLRFPFYDLDFG+
Sbjct  355   PNAVADSKESILWPNLEVDSWLRFPFYDLDFGS  387



>ref|XP_009413296.1| PREDICTED: agmatine coumaroyltransferase-2 {ECO:0000303|PubMed:18270436, 
ECO:0000312|EMBL:BAF97627.1}-like [Musa acuminata 
subsp. malaccensis]
Length=439

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/445 (59%), Positives = 322/445 (72%), Gaps = 10/445 (2%)
 Frame = +1

Query  46    EKKTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTI  225
             + K+MKV+VE ++ +KP ++G P  T  HVPLSVFDK++YD  +AVIYA+RPPTP N+ I
Sbjct  4     DGKSMKVRVERSKIVKPLHKGEPTSTCLHVPLSVFDKITYDTHMAVIYAFRPPTPSNTDI  63

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             E GL   L  YREWAGRLG D  G PVVLLND G +  +AS D  LD     KPS +LL 
Sbjct  64    EKGLATVLSEYREWAGRLGEDARGEPVVLLNDAGAQVFQASSDAPLDVAGLLKPSPALLT  123

Query  406   LHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
             LHP ++GV ELVQVQ+TRF CGSLVVGFTAHHLVADGH+ S FLVAWG A R + I P+P
Sbjct  124   LHPGIQGVEELVQVQLTRFACGSLVVGFTAHHLVADGHAASKFLVAWGAATRGLPIHPIP  183

Query  586   LRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
              R R+ +F+PR PPR+E+ H GAE+  K++       N+ D    DDIVVHK HFT  FL
Sbjct  184   FRGRSALFVPREPPRVEFQHRGAEFTTKKM------FNAKDDPLKDDIVVHKAHFTKPFL  237

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
               LK KAS   G  R YSTFESLVAHLWR I+KAR L    T+ +RISVDGR RL+P VP
Sbjct  238   TALKTKASL--GSKRQYSTFESLVAHLWRVISKARGLDERTTSDVRISVDGRRRLSPPVP  295

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
             ++Y GNLVLWAFP  +V +L+  PL YAA LIH+ + +V++ Y RSFIDFA S  V E +
Sbjct  296   DEYLGNLVLWAFPRTQVGELINSPLQYAAALIHEGIERVDDRYFRSFIDFAKSAAV-EAE  354

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
             GLV TADM++ ++ PNLEV SWLRFPFYD++FG G P+ FMPT+ P EGM+ LLPS +GD
Sbjct  355   GLVTTADMNEWVVSPNLEVHSWLRFPFYDVNFGGGTPFCFMPTYSPVEGMLVLLPSTVGD  414

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             GSI+ ++PLF  NL TFK +C  LD
Sbjct  415   GSIEVYVPLFNHNLATFKHLCCLLD  439



>ref|XP_009412963.1| PREDICTED: agmatine coumaroyltransferase-2 {ECO:0000303|PubMed:18270436, 
ECO:0000312|EMBL:BAF97627.1}-like [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   522 bits (1344),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 248/433 (57%), Positives = 313/433 (72%), Gaps = 9/433 (2%)
 Frame = +1

Query  76    STRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGV  255
             S++ +KPSYEG  P     +PLSVFDKVSYD  +AV+YA+RPPTP NS IE GL  AL  
Sbjct  18    SSKLVKPSYEGEQPCADVCIPLSVFDKVSYDVHVAVVYAFRPPTPSNSDIEKGLATALSE  77

Query  256   YREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLKGVVE  435
             YREWAGRLG D  G PV+LLND G + VE S D  L + +   PS +L+ L P +KG+ E
Sbjct  78    YREWAGRLGEDSRGEPVILLNDAGSRLVEVSSDDVLGRTVLLGPSPALVPLSPIIKGMEE  137

Query  436   LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDRTIFIPR  615
             L+QVQ+TRF CG+L VG TAHHL+ADGH+ SNFLVAWGKA R + + P PL DR  FIPR
Sbjct  138   LLQVQLTRFACGTLTVGITAHHLIADGHAASNFLVAWGKATRGLQMDPRPLHDRGAFIPR  197

Query  616   NPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMN  795
             NPP +EY+H G E+ PK         ++ +     DIV+HK HFT EFL  LKAKAS   
Sbjct  198   NPPCVEYEHRGVEFKPKNAS------DTKNVPLTADIVIHKAHFTREFLESLKAKAS--R  249

Query  796   GGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWA  975
             G  R Y+TFESL+AHLWRA++KAR L    TTH+RISVDGRARL P+VP +YFGNLVLWA
Sbjct  250   GADRRYNTFESLMAHLWRAVSKARGLDEHITTHVRISVDGRARLRPRVPGEYFGNLVLWA  309

Query  976   FPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKH  1155
             FP AKV DL+ +PL +AA L+ + ++++++ Y RSFIDFA+S+ V EE GL  TA++ + 
Sbjct  310   FPRAKVGDLVNKPLQFAAALVREGITRLDDGYFRSFIDFASSEKVKEE-GLEATAEVHER  368

Query  1156  ILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQ  1335
             ++ PNLEV SWLRFPF D+DFG G P++FMPT+   EGM+ L+PS IGDGSI+ +  L +
Sbjct  369   VMSPNLEVHSWLRFPFRDVDFGGGNPFLFMPTYTREEGMLVLMPSAIGDGSIEVYASLLR  428

Query  1336  DNLPTFKQICYSL  1374
              N+  FKQ+CY L
Sbjct  429   HNVAAFKQLCYLL  441



>ref|XP_009412962.1| PREDICTED: agmatine coumaroyltransferase-2 {ECO:0000303|PubMed:18270436, 
ECO:0000312|EMBL:BAF97627.1}-like [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   521 bits (1341),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 248/438 (57%), Positives = 319/438 (73%), Gaps = 9/438 (2%)
 Frame = +1

Query  61    KVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLR  240
             K++VES++ +KPSYEG  P     +PLSVFDKVSYD  +AV+YA+RPPTP NS IE GL 
Sbjct  9     KLRVESSKIVKPSYEGEQPCADVCIPLSVFDKVSYDVHVAVVYAFRPPTPSNSDIEKGLA  68

Query  241   KALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSL  420
             KAL  YREWAGRLG D  G PV+LLND G + VE S D  L + +   PS +L+ L P +
Sbjct  69    KALSEYREWAGRLGEDSRGEPVILLNDAGSRLVEVSSDDVLVRTVLLGPSPALVPLSPII  128

Query  421   KGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDRT  600
             KG+ EL+QVQ+TRFTCG+L VG T+HHL+ADGH+ SNFLVAWGKA R + + P PL DR 
Sbjct  129   KGMEELLQVQLTRFTCGTLTVGITSHHLIADGHAASNFLVAWGKATRGLPMDPRPLHDRG  188

Query  601   IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAK  780
              FIPRNPP +EY+H G E+ PK+        ++ +     DIV+HK HFT EFL  LKA 
Sbjct  189   AFIPRNPPCVEYEHRGVEFNPKKAS------DTENVPLTADIVIHKAHFTREFLESLKAM  242

Query  781   ASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGN  960
             AS   G  R Y+TFESL+AHLWR +++AR L    TTH+RISVDGRARL P VP +YFGN
Sbjct  243   ASL--GADRRYNTFESLMAHLWRVVSEARGLDEHITTHVRISVDGRARLRPSVPGEYFGN  300

Query  961   LVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTA  1140
             LVLWAFP AKV DL+ +PL +AA L+ + ++++++ Y RSFIDFA+S+ V EE GL  TA
Sbjct  301   LVLWAFPRAKVGDLVNKPLQFAAALVRECITRLDDGYFRSFIDFASSEKVKEE-GLEATA  359

Query  1141  DMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAF  1320
             ++ + ++ PNLEV SWLRFPF D+DFG G P++FMPT+   EGM+ L+PS IGDGSI+ +
Sbjct  360   EVHERVMSPNLEVHSWLRFPFRDVDFGGGNPFLFMPTYTREEGMLVLMPSAIGDGSIEVY  419

Query  1321  IPLFQDNLPTFKQICYSL  1374
             + L + N+  FKQ+C+ L
Sbjct  420   VSLLRHNVAAFKQLCFLL  437



>ref|XP_004982166.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=457

 Score =   514 bits (1323),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 258/457 (56%), Positives = 324/457 (71%), Gaps = 19/457 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNP-PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELG  234
             MKVK+ S++ +KP+Y+G   P T   VPL+VFD+V+YD  IAVIYA+RPP PPN+ +E G
Sbjct  1     MKVKITSSKIVKPAYDGGAAPSTGESVPLNVFDRVTYDVYIAVIYAFRPPNPPNAALEQG  60

Query  235   LRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
             L +AL VYREWAGRLG+  +G P VLL+D G +FVEA+ D  L + MPFKPS  LL LHP
Sbjct  61    LARALAVYREWAGRLGDGPDGRPAVLLSDAGARFVEAAVDAPLARSMPFKPSPELLRLHP  120

Query  415   SLKG--VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPL  588
             S+ G  V ELVQVQ+TRFTCGSLVVGFTAHH VADG +T NFLVAWG A R +   PLP+
Sbjct  121   SIDGGPVEELVQVQLTRFTCGSLVVGFTAHHRVADGQATGNFLVAWGLATRRLPAGPLPV  180

Query  589   RDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSN----DATFLDDIVVHKVHFTL  753
              DR T F PR+PPR+E+ H G EY     K++                D I VHKV FT 
Sbjct  181   CDRATRFQPRDPPRVEFPHRGTEYHLPAAKRHGGEDVDEEEEIGGAAHDKIKVHKVLFTK  240

Query  754   EFLAKLKAKASAMNGGA----------RPYSTFESLVAHLWRAITKARNLGGFETTHIRI  903
             EF+A+LKA+AS+  G            R YSTFES+V HLWR +T AR LG  E T +RI
Sbjct  241   EFVARLKARASSSPGPDLPPPPTAQQRRGYSTFESVVGHLWRTVTAARGLGAGEATKLRI  300

Query  904   SVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSF  1083
             SV+GR+R+ P VP +YFGN+VLWAFP A   DL+  P+ +AA LIH AVS+V++ Y RSF
Sbjct  301   SVNGRSRMRPPVPREYFGNMVLWAFPVADAGDLVSRPVQHAADLIHRAVSRVDDAYFRSF  360

Query  1084  IDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPT  1263
             +DFA+S   AE +GL PTAD  + +LCP+LEVDSWL   FYD+DFG GCP+ FMP++ P 
Sbjct  361   VDFASSG-AAEAEGLAPTADESQVVLCPDLEVDSWLGINFYDVDFGGGCPFYFMPSYLPM  419

Query  1264  EGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             EG MFLLPSF+GDG I+A++ LF+ +L  FK+ICY++
Sbjct  420   EGTMFLLPSFLGDGGIEAYVSLFEGHLEEFKRICYNI  456



>ref|XP_002533025.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF29356.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=446

 Score =   510 bits (1314),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 247/445 (56%), Positives = 329/445 (74%), Gaps = 10/445 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M V++ES RT+KP Y G  PL    +PLSVFDK +Y+   +  +AY PPTPPN  IE GL
Sbjct  1     MDVRIESIRTVKPIYNGICPLVLPFIPLSVFDKFTYNTDESFCFAYGPPTPPNEIIEYGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             ++AL  YRE+AGRLG DE+G+ V+LLND G+K VEAS D+ LD+VMP +PS  L +L+PS
Sbjct  61    KRALSEYREFAGRLGEDEKGDIVILLNDTGLKLVEASVDSRLDQVMPMEPSPVLFSLYPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             L    EL+QVQ+TRFTCGSLVV  TA H V DGH   +FL  WG+A R + + PLP  DR
Sbjct  121   LNDEKELLQVQLTRFTCGSLVVAITAKHSVVDGHGLVDFLFNWGRASRGLDMSPLPFHDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
             TIFIPR+PPR E++H G +++ K +K   +  N+     +DDI VH+V+FTL+ L+K+KA
Sbjct  181   TIFIPRDPPRFEHEHRGLDFIRKLVKDCPNHENNRS---VDDITVHRVNFTLDILSKIKA  237

Query  778   KASAMNGG----ARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPN  945
              ASA + G     +PYST  SL AHLWRA+TKAR L GFETTH+ +SV+GR R+ P VPN
Sbjct  238   MASASSNGNSCNNKPYSTCVSLTAHLWRAMTKARGLDGFETTHVIVSVNGRKRMIPGVPN  297

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG  1125
             +YFGN+VLWAFP+ ++ D+L++PL YA KL+HDA++ VNNNY +SFIDFA  K  A+++ 
Sbjct  298   EYFGNVVLWAFPSGRINDILQKPLPYAGKLVHDAIANVNNNYFKSFIDFAAYK--AKKEV  355

Query  1126  LVPTADM-DKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
             + P   + +K  LCPNLEVDSWL+FP++++DFG G P++F+P++FP EGM++LL S   D
Sbjct  356   MSPIMKLSNKSALCPNLEVDSWLQFPYHEIDFGGGSPFLFLPSYFPMEGMIYLLQSLKRD  415

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             GS+DA + L++ NL TFKQI YSLD
Sbjct  416   GSVDALVFLYRKNLATFKQIVYSLD  440



>ref|XP_002533026.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF29357.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=440

 Score =   509 bits (1311),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 240/444 (54%), Positives = 333/444 (75%), Gaps = 10/444 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M V++ES +T+KP Y+G  P     +PLSVFDK +Y+   A  +AYRPPTPPN  I  GL
Sbjct  1     MDVRIESIQTVKPIYDGICPPILHFIPLSVFDKFTYNTHAAFCFAYRPPTPPNEIIVYGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
             ++AL  YRE+AGRL  DEEG+PV+LLND+GVK VEAS D+ LD+VMP +PS     L+PS
Sbjct  61    KRALSEYREFAGRLWEDEEGDPVILLNDKGVKLVEASVDSRLDQVMPMEPSPVSFGLYPS  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             L  V EL+QVQ+TRFTCGSLVV   +HH VADG +T +FL+ WG+A R + + PLPL DR
Sbjct  121   LNDVEELLQVQLTRFTCGSLVVAIRSHHFVADGQATIDFLLNWGRATRGLDMSPLPLHDR  180

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
             +IF+PR+PP+ E+ H G  ++ + +K      N  D   +DDI+VH+V+FTL+FL+K+KA
Sbjct  181   SIFVPRDPPQFEFQHRGVGFIKELVKDCP---NHKDNRSVDDIIVHRVNFTLDFLSKIKA  237

Query  778   KASAMNGG----ARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPN  945
              ASA + G     +PYST+ SL AHLWRA+TKAR LGG ETTH+ +SV+GR R+ P+VP+
Sbjct  238   MASASSNGNSYNNKPYSTYVSLTAHLWRAMTKARGLGGLETTHVIVSVNGRKRMVPRVPD  297

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG  1125
             +YFGN+VLWAFP+ ++ D+L++PL YA KL+H+A++ VNNNY +SFIDFA  K  A+++ 
Sbjct  298   EYFGNVVLWAFPSGRINDILQKPLPYAGKLVHEAIANVNNNYFQSFIDFATYK--AKKED  355

Query  1126  LVPTADM-DKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
             + P   + +K + CPNLEV+SW++FP++++DFG G PY+F+P++FP EGM++LL S    
Sbjct  356   MCPIMKLSNKSVSCPNLEVNSWVQFPYHEIDFGGGSPYLFLPSYFPMEGMIYLLRSLKRR  415

Query  1303  GSIDAFIPLFQDNLPTFKQICYSL  1374
             GS+DAF+ L++ NL TFKQ+ +SL
Sbjct  416   GSMDAFVFLYRKNLATFKQVVHSL  439



>ref|XP_009412964.1| PREDICTED: agmatine coumaroyltransferase-2 {ECO:0000303|PubMed:18270436, 
ECO:0000312|EMBL:BAF97627.1}-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   503 bits (1295),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 242/442 (55%), Positives = 317/442 (72%), Gaps = 9/442 (2%)
 Frame = +1

Query  52    KTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             + +KV+VES++ +KP Y+G PP     +PLSVFDK++ +  +AVIYA+ PP+P NS IE 
Sbjct  6     EALKVRVESSKHVKPLYKGEPPRADLCIPLSVFDKITCNNYMAVIYAFEPPSPSNSDIEK  65

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL  AL  YR+WAGRL  D+ G PV+LLND G +FVEAS D  LD+ +    S +LL L 
Sbjct  66    GLATALTEYRDWAGRLREDDRGEPVILLNDSGPRFVEASSDAVLDRTVLLGSSPALLPLS  125

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P +KG  EL+ VQ+TRF CG+LV+GFT  HL+ADGH+ S FLVAWG A R + + P PL 
Sbjct  126   PCIKGAEELLLVQLTRFACGTLVLGFTTQHLIADGHAVSKFLVAWGLATRGLPMDPRPLH  185

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             DR  FIPRNPP +E++H G E+ PK+        ++ D     DIV+HK HFT EFL  L
Sbjct  186   DRGAFIPRNPPCVEFEHRGVEFKPKKAS------DTEDLPLTVDIVIHKTHFTREFLESL  239

Query  772   KAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDY  951
             KAKAS   G  R YS+FESL+AHLWR +TKAR L    T+H+RISVDGRARL P+VP +Y
Sbjct  240   KAKASL--GADRSYSSFESLMAHLWRVVTKARGLDEHITSHVRISVDGRARLRPRVPGEY  297

Query  952   FGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLV  1131
             FGNLVLWAFP AKV DL+ +PL +AA L+ + ++++++ Y RSFIDFA+S+ V EE GL 
Sbjct  298   FGNLVLWAFPRAKVGDLVNKPLQFAAALVREGITRLDDGYFRSFIDFASSETVKEE-GLE  356

Query  1132  PTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
              TA++ + ++ PNLEV SWL FPF D+DFG G P++FMPT+   EGM+FL+PS IGDGSI
Sbjct  357   ATAEVHERVMSPNLEVHSWLMFPFRDVDFGGGNPFMFMPTYTREEGMLFLMPSAIGDGSI  416

Query  1312  DAFIPLFQDNLPTFKQICYSLD  1377
             + ++   + N+  FKQ+CY LD
Sbjct  417   EVYVSSLRHNVAPFKQLCYLLD  438



>emb|CAH65973.1| H1005F08.2 [Oryza sativa Indica Group]
 gb|EAY95939.1| hypothetical protein OsI_17806 [Oryza sativa Indica Group]
Length=446

 Score =   493 bits (1270),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 238/443 (54%), Positives = 317/443 (72%), Gaps = 8/443 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYE-GNPPLTTTHV-PLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MK+ V S++ +KP+Y  G  P TT  V PL+VFDK ++D  I+VIYAYRPP P N+ +E 
Sbjct  1     MKITVHSSKAVKPAYGPGEFPTTTGDVVPLTVFDKANFDTYISVIYAYRPPAPANAALEA  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL KAL  YREWAGRLG D +GN  +LLND G +FVEA+ D TLD VMP KP+  +L+LH
Sbjct  61    GLAKALIEYREWAGRLGVDGDGNRAILLNDGGARFVEATADVTLDSVMPLKPTAEVLSLH  120

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             PS    VEL+ +QVTRF CGSLVVGFT  H+VADG +T+NF +AW +A R     P+P+ 
Sbjct  121   PSGDDAVELMLIQVTRFACGSLVVGFTTQHIVADGRATNNFFLAWSQATRGAAFHPVPVH  180

Query  592   DR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAK  768
             DR + F PR+ P++E++H G E+ P    ++ H   S      D++V++KVH + EF++K
Sbjct  181   DRVSFFAPRDTPKVEFEHRGVEFKPYDDDEDVH--ASGGGGDDDEVVINKVHLSREFISK  238

Query  769   LKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPND  948
             LK++ASA  G  RPYST + +VAHLWR +TKAR L G E+T + I+VDGRAR++P VP+ 
Sbjct  239   LKSQASA--GAHRPYSTLQCVVAHLWRCMTKARGLDGRESTSVCIAVDGRARMSPPVPDG  296

Query  949   YFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGL  1128
             Y GN+VLWA PTA   +L+  PL +A +LI+  V ++N+ Y +SFIDFANS  V EE+ L
Sbjct  297   YTGNVVLWARPTATAGELVTRPLKHAVELINREVIRINDGYFKSFIDFANSGAV-EEERL  355

Query  1129  VPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGS  1308
             V +AD  + +L PN+EVDSWLR PFYDLDFG G P+ FMP++ P EG++ LLPSF GDGS
Sbjct  356   VASADAAEMVLSPNIEVDSWLRIPFYDLDFGGGRPFFFMPSYLPVEGLLILLPSFFGDGS  415

Query  1309  IDAFIPLFQDNLPTFKQICYSLD  1377
             +DA++PLF  ++  FK  CYS D
Sbjct  416   VDAYVPLFSRDMDVFKNCCYSFD  438



>gb|AEV40930.1| putative transferase family protein [Oryza punctata]
Length=451

 Score =   491 bits (1265),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 235/448 (52%), Positives = 319/448 (71%), Gaps = 13/448 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MK+ V S++ +KP+Y  +  P  T   +PL+VFDK ++D  I+VIYA+RPP P N+ +E 
Sbjct  1     MKITVHSSKAVKPAYGPSEFPTTTGDLIPLTVFDKANFDTYISVIYAFRPPAPANAVLEA  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL KAL  YREWAGRLG D +GN  +LLNDEG +FVEA+ D TLD VMP KP+  +L+LH
Sbjct  61    GLAKALVEYREWAGRLGVDGDGNRAILLNDEGARFVEATADVTLDSVMPLKPTAQVLSLH  120

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             PS    VEL+ +QVTRF CGSLVVGFT  H+VADG +T+NF +AW +A R     P+P+ 
Sbjct  121   PSGDDAVELMLIQVTRFACGSLVVGFTTQHIVADGRATNNFFLAWSQATRGAAFHPVPVH  180

Query  592   DR-TIFIPRNPPRIEYDHVGAEYMPKQIK-----KNDHFLNSNDATFLDDIVVHKVHFTL  753
             DR + F PR+ P++E++H G E+ P   K     ++ H     D    D++V++KVH + 
Sbjct  181   DRVSFFTPRDTPKVEFEHRGVEFKPYDDKVDCSDEDGHAAGGGDDD--DEVVINKVHLSR  238

Query  754   EFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNP  933
             EF++KLK++ASA  G  RPYST + +VAHLWR++TKAR L   E+T + I+VDGRAR++P
Sbjct  239   EFISKLKSQASA--GAHRPYSTLQCVVAHLWRSMTKARGLDERESTSVCIAVDGRARMSP  296

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVA  1113
              VP+ Y GN+VLWA PT    +L+  PL +A +LI+  V+++N+ Y +SFIDFANS  V 
Sbjct  297   PVPDGYTGNVVLWARPTETAGELVTRPLKHAVELINREVTRINDGYFKSFIDFANSGAV-  355

Query  1114  EEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSF  1293
             E++ LV +AD  + +L PN+EVDSWLR PFYDLDFG G P+ FMP++ P EG++ LLPSF
Sbjct  356   EKERLVASADAAEMVLSPNIEVDSWLRIPFYDLDFGGGRPFFFMPSYLPVEGLLILLPSF  415

Query  1294  IGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
              GDGS+DA++PLF  N+  FK  CYSLD
Sbjct  416   FGDGSVDAYVPLFSRNMDVFKNCCYSLD  443



>ref|XP_006652971.1| PREDICTED: agmatine coumaroyltransferase-1-like [Oryza brachyantha]
Length=450

 Score =   490 bits (1262),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 232/447 (52%), Positives = 321/447 (72%), Gaps = 10/447 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSY---EGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MK+ V+S++ +KP+Y   +  P  T   VPL+VFDK ++D  I+VIYA+RPP P N+ +E
Sbjct  1     MKITVQSSKAVKPAYGTGDATPVNTGDVVPLTVFDKANFDTYISVIYAFRPPAPANAVLE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
              GL +AL  YREWAGRLG D++GN  +LLND G +FVEA+ D TLD VMP KP+  +L+L
Sbjct  61    AGLARALVEYREWAGRLGVDDDGNRAILLNDAGARFVEATADVTLDSVMPLKPTAQVLSL  120

Query  409   HPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPL  588
             HPS    VEL+ +QVTRF CGSLVVGFT  H+VADG  T+NF +AW +A R     P+P+
Sbjct  121   HPSGDDAVELMLIQVTRFACGSLVVGFTTQHIVADGRGTNNFFLAWSQATRGAAFDPVPV  180

Query  589   RDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATF---LDDIVVHKVHFTLE  756
              DR + F PR+ P++E++H G E+ P   + +   + +  A      D++V++KVH + E
Sbjct  181   HDRVSFFTPRDTPKVEFEHRGVEFKPCDERVDSVDVGAERAAGDEDDDEVVINKVHLSRE  240

Query  757   FLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPK  936
             F++KLK++ASA  G  RPYST + +VAHLWR +TKAR L G E+T + I+VDGRAR++P 
Sbjct  241   FISKLKSQASA--GAHRPYSTLQCVVAHLWRCMTKARGLDGRESTSVCIAVDGRARMSPP  298

Query  937   VPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAE  1116
             VP+ Y GN+VLWA PTA   +L+  PL +A +LI+  V++++++Y +SFIDFANS  V E
Sbjct  299   VPDGYAGNVVLWARPTATAGELVARPLKHAVELINREVARISDSYFKSFIDFANSGAV-E  357

Query  1117  EDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFI  1296
             ++ LV +AD  + +L PN+EVDSWLR PFYDLDFG G P+ FMP++ P EG++ LLPSF 
Sbjct  358   KERLVASADAAEMVLSPNIEVDSWLRIPFYDLDFGGGRPFFFMPSYLPVEGLLILLPSFF  417

Query  1297  GDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             GDGS+DA++PLF  ++  FK  CYSLD
Sbjct  418   GDGSVDAYVPLFSRDMNVFKNCCYSLD  444



>ref|XP_009412968.1| PREDICTED: agmatine coumaroyltransferase-2 {ECO:0000303|PubMed:18270436, 
ECO:0000312|EMBL:BAF97627.1}-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   489 bits (1260),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 236/443 (53%), Positives = 313/443 (71%), Gaps = 11/443 (2%)
 Frame = +1

Query  52    KTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             + +KV+ ES++ +KP Y+G PP     +PLSVFDK++Y+  + +IYA+RPPTP NS IE 
Sbjct  6     EALKVRAESSKLVKPLYQGEPPCADLCIPLSVFDKITYNLHVELIYAFRPPTPSNSDIEK  65

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL +AL  YREWAGRL  D +G  V+LLND G++FVEA+ D  L + +  +PS +LL LH
Sbjct  66    GLARALSEYREWAGRLREDAQGELVILLNDAGIRFVEATSDDVLGRDV-LEPSRALLRLH  124

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P + GV EL+QVQ+TRF CG+LVVGFT+HH+VADGHS S F+VAWG A R + + PLPL 
Sbjct  125   PWVNGVEELLQVQLTRFACGTLVVGFTSHHMVADGHSMSRFIVAWGLATRGLPMDPLPLH  184

Query  592   DR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAK  768
              R   FIPRNPPR+E++H G E+  K     +      D     D+VVHK HF+ EFL  
Sbjct  185   GRGAFFIPRNPPRVEFEHRGVEFTAKNASDTE-----EDVPLTADLVVHKAHFSREFLES  239

Query  769   LKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPND  948
             LKAKAS   G  R Y+TFESL+AHLWR +  AR L    T+ + ISV+GRARL P VP++
Sbjct  240   LKAKASL--GADRRYTTFESLMAHLWRVVNVARGLDEHITSTVHISVNGRARLRPPVPDE  297

Query  949   YFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGL  1128
             YFGNLV+WA P AKV +L+  PL   A+++ + ++K+++ Y RS IDFA+SK V E  GL
Sbjct  298   YFGNLVVWACPRAKVGELVNRPLQSIAEVVREGIAKMDDRYFRSLIDFASSKEVTE--GL  355

Query  1129  VPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGS  1308
               T +  +   CPN EV+SW+RFPF+DLDFG+G P++FMP+F+  EGM+FL+ S  GDGS
Sbjct  356   KGTIEAKEAAFCPNFEVNSWVRFPFWDLDFGSGKPFLFMPSFYAVEGMIFLVESPTGDGS  415

Query  1309  IDAFIPLFQDNLPTFKQICYSLD  1377
             ID ++ LF  NL +FKQ+CY LD
Sbjct  416   IDVYVTLFSHNLDSFKQLCYLLD  438



>ref|XP_002466666.1| hypothetical protein SORBIDRAFT_01g011860 [Sorghum bicolor]
 gb|EER93664.1| hypothetical protein SORBIDRAFT_01g011860 [Sorghum bicolor]
Length=460

 Score =   490 bits (1262),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 253/463 (55%), Positives = 319/463 (69%), Gaps = 28/463 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN---PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MKVK+ S++ +KP++ G    PP     VPL+VFD+V+YD  IAVIYA+RPPTPPN+ +E
Sbjct  1     MKVKITSSKIVKPAHGGGRAAPPSADESVPLNVFDRVTYDVHIAVIYAFRPPTPPNAALE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
              GL +AL VYREWAGRLG+  +G P VLLND G + VEA+ D  L   MPFKPS  LL L
Sbjct  61    QGLARALAVYREWAGRLGDGPDGRPAVLLNDAGARLVEAAVDAPLATSMPFKPSPELLRL  120

Query  409   HPSLKG--VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPL  582
             HPS+    V ELVQVQ+TRF CGSLVVGFTAHH VADG +T NFLVAWG A R + ++PL
Sbjct  121   HPSIVAGRVEELVQVQLTRFACGSLVVGFTAHHRVADGQATGNFLVAWGLATRRLPVEPL  180

Query  583   PLRDR-TIFIPRNPPRIEYDHVGAEYM----PKQIKKNDHFLNSNDATFLDDIVVHKVHF  747
             P+ DR T F+PR  P +E+ H G EY     P + + +D           D I VHKV F
Sbjct  181   PVCDRATRFLPRGTPLVEFPHRGTEYYLPVPPAKKRGDDDDDEGIGGVAHDKIKVHKVLF  240

Query  748   TLEFLAKLKAKASAMNGGARP-------------YSTFESLVAHLWRAITKARNLGGFET  888
             T EF+A+LKA+ S+   G  P             YSTFES+V HLWRA+T AR LG  ET
Sbjct  241   TKEFVARLKARVSS---GVPPPTHHHHHHHRRGHYSTFESVVGHLWRAVTAARGLGAGET  297

Query  889   THIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNN  1068
             T +RISV+GR R+ P VP+ YFGN+VLWAFP     DL+  P+ +AA+LI  AVS+V++ 
Sbjct  298   TTLRISVNGRTRMRPPVPHTYFGNVVLWAFPRCDAADLVSRPVQHAAELIRRAVSRVDDA  357

Query  1069  YIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMP  1248
             Y RSFIDFA+S  V E +GL  TAD  + ++CP+LEVDSWL   FYDLDFG G P+ FMP
Sbjct  358   YFRSFIDFASSGAV-EREGLATTADESEVVMCPDLEVDSWLGISFYDLDFGGGGPFHFMP  416

Query  1249  TFFPTEGMMFLLPSFIGD-GSIDAFIPLFQDNLPTFKQICYSL  1374
             ++ P EG MFLLPSF+GD G I+A++ LF+ +L  FK+ICY++
Sbjct  417   SYLPMEGTMFLLPSFLGDGGGIEAYVSLFEGHLEEFKRICYNI  459



>ref|XP_004960195.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=438

 Score =   485 bits (1249),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 232/442 (52%), Positives = 316/442 (71%), Gaps = 6/442 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN-PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELG  234
             M + V S++ +KP+Y G   P     VPL+V DK ++D  I+VIYA+RPP P N+ +E G
Sbjct  1     MNITVHSSKAVKPAYPGGVAPAGERAVPLTVLDKANFDTYISVIYAFRPPVPANAALEDG  60

Query  235   LRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
             L + L  YREWAGRLG D EGN  +LLND G +FVEA+ D TLD VMP KP+  +L+LHP
Sbjct  61    LARVLVEYREWAGRLGVDAEGNRAILLNDAGARFVEATADVTLDSVMPLKPTPEVLSLHP  120

Query  415   SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRD  594
             S  G  EL+ +QVTRF CGSLVVGFT  H+VADG  T+NF +AW +A R   + P+P+ D
Sbjct  121   SGDGATELMLIQVTRFACGSLVVGFTTQHIVADGRGTNNFFLAWSQATRGAALDPVPVHD  180

Query  595   R-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             R + F P +PP +E+ H G E+ P + K  D  +++ D    +++V+HKVHF+ EF++KL
Sbjct  181   RESFFRPHDPPLVEFQHRGVEFKPYE-KHVDEKIHAGDEDEEEEVVIHKVHFSREFISKL  239

Query  772   KAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDY  951
             KA+ASA  G  RPYST + +VAHLWR +T AR L   ++T + I+VDGRAR+NP+VP+ Y
Sbjct  240   KAQASA--GLPRPYSTLQCVVAHLWRCMTTARGLEEGQSTSVCIAVDGRARMNPQVPDGY  297

Query  952   FGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLV  1131
              GN+VLWA PTA   +L+  PL +A  LI+  V+++N+ Y +SFIDFA+S  V E++ LV
Sbjct  298   TGNVVLWARPTATAGELVARPLQHAVGLINREVARINDAYFKSFIDFASSGAV-EKERLV  356

Query  1132  PTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
               AD D+ +L PN+EVDSWLR PFYDLDFG G P+ FMP++ P EG++ LLPSF+GDGS+
Sbjct  357   AAADADEMVLSPNIEVDSWLRIPFYDLDFGGGRPFFFMPSYLPVEGLLILLPSFVGDGSV  416

Query  1312  DAFIPLFQDNLPTFKQICYSLD  1377
             DA++PLF  ++ TFK  CY++D
Sbjct  417   DAYVPLFSRDMDTFKNCCYAMD  438



>dbj|BAK00935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   484 bits (1245),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 241/448 (54%), Positives = 322/448 (72%), Gaps = 18/448 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEG---NPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MK+ V S+R +KP Y     +P  T   VPL+V DK ++DA I+VIYA+RPP PPN+ +E
Sbjct  1     MKITVLSSRAVKPDYGACGAHPGSTDDVVPLTVLDKANFDAYISVIYAFRPPAPPNAVLE  60

Query  229   LGLRKALGVYREWAGRLGNDE-EGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
              GL +AL  YREWAGRLG D   G+  +LL D G +FVEA+ D  LD VMP KP+  +L+
Sbjct  61    AGLARALVDYREWAGRLGVDAASGDRAILLCDAGARFVEATADVALDSVMPMKPTPEVLS  120

Query  406   LHPSLK-GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPL  582
             LHPS   G  EL+ +QVTRF CGSLVVGFTA HLV+DG +TSNF +AW +A R V + P+
Sbjct  121   LHPSGDDGPEELMLIQVTRFACGSLVVGFTAQHLVSDGRATSNFFLAWSQATRGVAVDPV  180

Query  583   PLRDR-TIFIPRNPPRIEYDHVGAEY-MP-KQIKKNDHFLNSNDATFLDDIVVHKVHFTL  753
             P+ DR + F PR+PP++EY+H G E+ +P K+  +ND+     D    D +VV+KVH +L
Sbjct  181   PVHDRASFFKPRDPPQVEYEHRGVEFKLPCKEADENDY----GDG---DVVVVNKVHLSL  233

Query  754   EFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNP  933
             EF++KLK++ASA  G  RPYST   LVAHLWR +TKAR L G  +T + I+VDGRAR++P
Sbjct  234   EFISKLKSQASA--GAHRPYSTLRCLVAHLWRCVTKARGLDGSVSTSVAIAVDGRARMSP  291

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVA  1113
             +VP+ Y GN+VLWA PTA  ++L+  PL +A +LI+  V+++N +Y  SFIDFA+S+ V 
Sbjct  292   QVPDGYTGNVVLWARPTATAQELVTRPLQHAVELINREVARINGSYFESFIDFASSEAVR  351

Query  1114  EEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSF  1293
             +E  LVP AD  + +L PN+EVDSWLR PFYDLDFG G P+ FMP++ P EG++ LLPSF
Sbjct  352   KER-LVPAADAAEMVLSPNIEVDSWLRIPFYDLDFGGGQPFFFMPSYLPVEGLLILLPSF  410

Query  1294  IGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
              GDGS+DA++PLF  ++  FK  CY+LD
Sbjct  411   AGDGSVDAYVPLFSRDMDAFKNCCYNLD  438



>gb|EAZ32318.1| hypothetical protein OsJ_16526 [Oryza sativa Japonica Group]
Length=449

 Score =   484 bits (1246),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 233/447 (52%), Positives = 319/447 (71%), Gaps = 10/447 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MK+ V S++ +KP Y      P T   VPLSVFD+ ++D  ++VIYA+RPP P NS +E 
Sbjct  1     MKITVHSSKAVKPVYGDAVAAPSTADVVPLSVFDRANFDTYVSVIYAFRPPAPANSVLEA  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL KAL  YREWAGRLG D +G+  +LLND G +FVEA+ D TLD V+P +P+  + +LH
Sbjct  61    GLAKALAEYREWAGRLGVDGDGDRAILLNDAGARFVEATADVTLDSVVPLEPTPRVTSLH  120

Query  412   PSLK---GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPL  582
             PS        E++ VQVTRF CGSL VGFTAHH+V+DG +TSNF +AW +A R V I P+
Sbjct  121   PSADDDGAEAEVMMVQVTRFACGSLAVGFTAHHMVSDGRATSNFFLAWSQATRGVAIHPV  180

Query  583   PLRDR-TIFIPRNPPRIEYDHVGAEYMP-KQIKKNDHFLNSNDATFLDDIVV-HKVHFTL  753
             P+ DR + F PR+PPR++Y+H G E+   +++ +N++  + +      ++VV HKVHF+ 
Sbjct  181   PVHDRASFFTPRDPPRVDYEHRGVEFKTCEKLDRNENNDDGHGHGHDGEVVVTHKVHFSR  240

Query  754   EFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNP  933
             EF++KLKA ASA  GG R YST + +VAHLWR IT AR L G   T + I+VDGRAR++P
Sbjct  241   EFISKLKALASA-GGGQRSYSTLQCVVAHLWRCITMARGLEGSVATSVSIAVDGRARMSP  299

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVA  1113
              VP+ Y GN+VLWA PTA  ++L+  PL +A  LI+ AV+++N+ Y +SF+DFANS  V 
Sbjct  300   PVPDGYTGNVVLWARPTATARELVTMPLQHAMGLINRAVARINDGYFKSFVDFANSGAV-  358

Query  1114  EEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSF  1293
             EE+ LV +AD  + +L PN+EVDSWLR PFY+LDFG+G P++F P++ P EG++ LLPSF
Sbjct  359   EEERLVASADAAEMVLSPNIEVDSWLRIPFYELDFGSGQPFLFTPSYLPVEGLLILLPSF  418

Query  1294  IGDGSIDAFIPLFQDNLPTFKQICYSL  1374
              GDGS+DA++PLF  ++ TFK  CY L
Sbjct  419   SGDGSVDAYVPLFSHDMDTFKNCCYVL  445



>sp|A9ZPJ7.1|AGCT2_HORVU RecName: Full=Agmatine coumaroyltransferase-2 [Hordeum vulgare]
 dbj|BAF97627.1| agmatine coumaroyltransferase [Hordeum vulgare subsp. vulgare]
Length=439

 Score =   483 bits (1243),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 235/445 (53%), Positives = 316/445 (71%), Gaps = 11/445 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEG---NPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MK+ V S++ +KP Y      P  T   VPL+V DK ++D  I+VIYA+ PP PPN+ +E
Sbjct  1     MKITVHSSKAVKPEYGACGVAPGCTADVVPLTVLDKANFDTYISVIYAFHPPAPPNAVLE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
              GL +AL  YREWAGRLG D  G+  +LLND G +FVEA+ D  LD VMP KP+  +L+L
Sbjct  61    AGLGRALVDYREWAGRLGVDANGDRAILLNDAGARFVEATADVALDSVMPLKPTSEVLSL  120

Query  409   HPSLK-GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
             HPS   G  EL+ +QVTRF CGSLVVGFTA HLV+DG +TSNF +AW +A R V + P+P
Sbjct  121   HPSGDDGPEELMLIQVTRFACGSLVVGFTAQHLVSDGRATSNFFLAWSQATRGVAVDPVP  180

Query  586   LRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
             + DR + F PR P  +EY+H G E+ P + K +D    ++     D++VV+KVHF+ EF+
Sbjct  181   VHDRASFFHPREPLHVEYEHRGVEFKPYE-KAHDVVCGADGDE--DEVVVNKVHFSREFI  237

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
             +KLKA+ASA  G  RP ST + +VAHLWR++T AR L G ETT + I+VDGRAR++P+VP
Sbjct  238   SKLKAQASA--GAPRPCSTLQCVVAHLWRSMTMARGLDGGETTSVAIAVDGRARMSPQVP  295

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
             + Y GN++LWA PT    +L+  P+ +A +LI   V+++N+ Y +SFIDFANS  V E++
Sbjct  296   DGYTGNVILWARPTTTAGELVDRPVKHAVELISREVARINDGYFKSFIDFANSGAV-EKE  354

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
              LV TAD    +L PN+EVDSWLR PFYD+DFG G P+ FMP++ P EG++ LLPSF+GD
Sbjct  355   RLVATADAADMVLSPNIEVDSWLRIPFYDMDFGGGRPFFFMPSYLPVEGLLILLPSFLGD  414

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             GS+DA++PLF  ++ TFK  CYSLD
Sbjct  415   GSVDAYVPLFSRDMNTFKNCCYSLD  439



>ref|XP_004969955.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=446

 Score =   483 bits (1243),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 226/445 (51%), Positives = 314/445 (71%), Gaps = 8/445 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTH----VPLSVFDKVSYDAQIAVIYAYRPPTPPNSTI  225
             MK+ V+S+R ++P Y  +     +     V LSVFDKV++D  ++VIY +RPP PPN+ +
Sbjct  1     MKITVQSSRAVRPDYGSDGAAAGSAAGDVVTLSVFDKVNFDTYVSVIYVFRPPMPPNAAL  60

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             E GL +AL  YREWAGRLG D +GN  +LL DEG +FVEA+ D TL  V+P +P+  + +
Sbjct  61    EAGLARALAEYREWAGRLGVDADGNRAILLTDEGARFVEATADVTLHSVLPLRPTKEVRS  120

Query  406   LHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
             LHPS  G  EL+ VQVTRF CGS+ VGFTA H V+DG +TSNF VAW +A R   + P P
Sbjct  121   LHPSSDGAKELMLVQVTRFACGSVAVGFTAQHHVSDGRATSNFFVAWSQATRGAAVDPAP  180

Query  586   LRDR-TIFIPRNPPRIEYDHVGAEYMPKQ-IKKNDHFLNSNDATFLDDIVVHKVHFTLEF  759
             + DR + F PR+PP++E++H G EY  KQ  +  ++ ++++D    D++ VHKVHF+ EF
Sbjct  181   VHDRASFFAPRDPPQVEFEHRGVEYKQKQPARVKEYAISADDDGADDEVAVHKVHFSREF  240

Query  760   LAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKV  939
             ++KLK++AS   G  RP ST   +VAHLWR +T AR L    +T +RI+VDGR R+ P V
Sbjct  241   ISKLKSQASP-PGTHRPCSTLRCIVAHLWRCVTAARGLPPGASTSVRIAVDGRVRMTPPV  299

Query  940   PNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEE  1119
             P  Y GN+VLWA+P A  +DL+  PL +A +LI+  +++VN +Y RSF+DFA+S  V EE
Sbjct  300   PEGYTGNVVLWAWPAATARDLVTRPLQHAVELINRGLARVNESYFRSFVDFASSGAV-EE  358

Query  1120  DGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIG  1299
             +GLVPTAD  + +L PN+EVDSWLR PFY+LDFG G P+ FMP++   EG++ +LPS+ G
Sbjct  359   EGLVPTADAAETVLSPNIEVDSWLRMPFYELDFGGGRPFFFMPSYLAVEGLLIVLPSYFG  418

Query  1300  DGSIDAFIPLFQDNLPTFKQICYSL  1374
             DGSIDA++PLF  ++  FK +CYS+
Sbjct  419   DGSIDAYVPLFSRHIDAFKNLCYSM  443



>gb|EMT32981.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=441

 Score =   482 bits (1240),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 237/447 (53%), Positives = 322/447 (72%), Gaps = 13/447 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYE--GNPPLTTTHV-PLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MKV V S+R +KP Y   G PP +T  V PL+V DK +++A I+VIYA+RPP PPN+ +E
Sbjct  1     MKVTVLSSRAVKPDYGACGAPPGSTADVVPLTVLDKANFNAYISVIYAFRPPAPPNAVLE  60

Query  229   LGLRKALGVYREWAGRLGNDE-EGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
              GL +AL  YREWAGRLG D   G+  +LL D G +FVEA+ D  LD VMP KP+  +LN
Sbjct  61    AGLARALVDYREWAGRLGVDAASGDRAILLCDAGARFVEATADVALDSVMPMKPTPEVLN  120

Query  406   LHPSLK-GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPL  582
             LHPS   G  EL+ +QVTRF CGS+VVGFTA HLV+DG +TSNF +AW +A R + + P+
Sbjct  121   LHPSGDDGPEELMLIQVTRFACGSIVVGFTAQHLVSDGRATSNFFLAWSQATRGLAVDPV  180

Query  583   PLRDR-TIFIPRNPPRIEYDHVGAEYMP-KQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
             P+ DR + F PR+PPR+E++H G E+ P +++++ND   ++ D    D +VV+KVH +LE
Sbjct  181   PVHDRASFFKPRDPPRVEFEHRGVEFKPYEKVEENDDERHAGDG---DVVVVNKVHLSLE  237

Query  757   FLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPK  936
             F++KLK++AS   G  RP+ST   LVAHLWR +TKAR L G  +T + I+VDGRAR++P+
Sbjct  238   FISKLKSRASV--GAHRPHSTLRCLVAHLWRCVTKARGLDGRVSTSVAIAVDGRARMSPQ  295

Query  937   VPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAE  1116
             VP+ Y GN+VLWA PTA  ++L+  PL +A +LI+  V+++N  Y  SFIDFA+S+ V +
Sbjct  296   VPDGYTGNVVLWARPTATAQELVTRPLQHAVELINREVARINGGYFESFIDFASSEAVQK  355

Query  1117  EDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFI  1296
             E  LV  AD  +  L PN+EVDSWLR PFYDLDFG G P+ FMP++ P EG++ LLPSF 
Sbjct  356   ER-LVAPADAAEMALSPNIEVDSWLRIPFYDLDFGGGQPFFFMPSYLPVEGLLILLPSFA  414

Query  1297  GDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             GDGS+DA++PLF  ++  FK  CY+L+
Sbjct  415   GDGSVDAYVPLFSRDMDAFKNCCYNLE  441



>emb|CAH65974.1| H1005F08.3 [Oryza sativa Indica Group]
 gb|EAY95940.1| hypothetical protein OsI_17807 [Oryza sativa Indica Group]
Length=449

 Score =   481 bits (1239),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 232/447 (52%), Positives = 318/447 (71%), Gaps = 10/447 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MK+ V S++ +KP Y      P T   VPLSVFD+ ++D  ++VIYA+RPP P NS +E 
Sbjct  1     MKITVHSSKAVKPVYGDAVAAPSTADVVPLSVFDRANFDTYVSVIYAFRPPAPANSVLEA  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL KAL  YREWAGRLG D +G+  +LLND G +FVEA+ D TLD V+P +P+  + +LH
Sbjct  61    GLAKALAEYREWAGRLGVDGDGDRAILLNDAGARFVEATADVTLDSVVPLEPTPRVTSLH  120

Query  412   PSLK---GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPL  582
             PS        E++ VQVTRF CGSL VGFTAHH+V+DG +TSNF +AW +A R V I P+
Sbjct  121   PSADDDGAEAEVMMVQVTRFACGSLAVGFTAHHMVSDGRATSNFFLAWSQATRGVAIHPV  180

Query  583   PLRDR-TIFIPRNPPRIEYDHVGAEYMP-KQIKKNDHFLNSNDATFLDDIVV-HKVHFTL  753
             P+ DR + F PR+PPR++Y+H G E+   +++ +N++  + +      ++VV HKVHF+ 
Sbjct  181   PVHDRASFFTPRDPPRVDYEHRGVEFKTCEKLDRNENNDDGHGHGHDGEVVVTHKVHFSR  240

Query  754   EFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNP  933
             EF++KLKA ASA  GG R YST + +VAHLWR IT AR L G   T + I+VDGRAR++P
Sbjct  241   EFISKLKALASA-GGGQRSYSTLQCVVAHLWRCITMARGLEGSVATSVSIAVDGRARMSP  299

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVA  1113
              VP+ Y GN+VLWA PTA  ++L+  PL +A  LI+ AV+++N+ Y +SF+DFANS  V 
Sbjct  300   PVPDGYTGNVVLWARPTATARELVTMPLQHAMGLINRAVARINDGYFKSFVDFANSGAV-  358

Query  1114  EEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSF  1293
             E + LV +AD  + +L PN+EVDSWLR PFY+LDFG+G P++F P++ P EG++ LLPSF
Sbjct  359   EAERLVSSADAAEMVLSPNIEVDSWLRIPFYELDFGSGQPFLFTPSYLPVEGLLILLPSF  418

Query  1294  IGDGSIDAFIPLFQDNLPTFKQICYSL  1374
              GDGS+DA++PLF  ++ TFK  CY L
Sbjct  419   SGDGSVDAYVPLFSHDMDTFKNCCYVL  445



>ref|XP_004957522.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=443

 Score =   481 bits (1238),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 248/452 (55%), Positives = 319/452 (71%), Gaps = 21/452 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSY-EGNP-PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV S++ ++PSY  G P P TT HVP SVFDK +Y  Q+A+IYA+ PP P  + IE 
Sbjct  1     MEVKVLSSKLVRPSYPAGAPRPDTTEHVPSSVFDKATYHIQMAIIYAFSPPGPSTADIER  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL   LG YR +AG++    +G P VLLND G +FVEAS D  L  + P KPS ++L LH
Sbjct  61    GLAAVLGAYRLFAGQVRAGPDGAPGVLLNDHGARFVEASVDAHLADIAPTKPSPAVLRLH  120

Query  412   PSLKG-VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMI-QPLP  585
             P L+G + E+VQVQ+TRF CGSL VGFTA+H VADGH+TS+FLVAWG+A R + I  P P
Sbjct  121   PDLEGEISEVVQVQLTRFACGSLAVGFTANHAVADGHATSDFLVAWGRAARGLPIGHPPP  180

Query  586   LRDRTIFIPRNPPRIEYDHVGAEY-------MPKQIKKNDHFLNSNDATFLDDIVVHKVH  744
             +    +F PR+PPR+E++H G EY        P     + H      A     IV+HK H
Sbjct  181   VHHPDLFPPRDPPRVEFEHRGVEYYRPASTTAPASGHGHGH---GEAAQQHSSIVIHKAH  237

Query  745   FTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGG-FETTHIRISVDGRA  921
             FT +F+A L+AKAS   G  RP+S FE+++AH+WR +T+AR LG   +T+ IRISVDGR 
Sbjct  238   FTKDFVAGLRAKAS--EGRGRPFSRFETILAHVWRTMTRARGLGNPLQTSTIRISVDGRP  295

Query  922   RLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANS  1101
             RL    P  YFGNLVLWAFP A V DLL  PL +AA+ IHDAV++V+  Y RSF+DFA+S
Sbjct  296   RL--AAPPGYFGNLVLWAFPRATVGDLLNRPLRHAAQAIHDAVARVDGAYFRSFVDFASS  353

Query  1102  KVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFL  1281
               V E++GL  TA + K +LCP+LEVDSWL FPFYDLDFG GCP  FMP++FPTEGM+FL
Sbjct  354   GAV-EKEGLEATAVL-KDVLCPDLEVDSWLTFPFYDLDFGGGCPSYFMPSYFPTEGMLFL  411

Query  1282  LPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             +PS++GDGS+DAF+P+F+ NL  FKQ  YS++
Sbjct  412   VPSYLGDGSVDAFVPVFEHNLEAFKQCAYSME  443



>ref|NP_001054171.2| Os04g0664600 [Oryza sativa Japonica Group]
 emb|CAE03579.1| OSJNBa0087O24.2 [Oryza sativa Japonica Group]
 dbj|BAF16085.2| Os04g0664600 [Oryza sativa Japonica Group]
Length=449

 Score =   480 bits (1236),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 232/447 (52%), Positives = 318/447 (71%), Gaps = 10/447 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MK+ V S++ +KP Y      P T   VPLSVFD+ ++D  ++VIYA+RPP P NS +E 
Sbjct  1     MKITVHSSKAVKPVYGDAVAAPSTADVVPLSVFDRANFDTYVSVIYAFRPPAPANSVLEA  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL KAL  YREWAGRLG D +G+  +LLND G +FVEA+ D TLD V+P +P+  + +LH
Sbjct  61    GLAKALAEYREWAGRLGVDGDGDRAILLNDAGARFVEATADVTLDSVVPLEPTPRVTSLH  120

Query  412   PSLK---GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPL  582
             PS        E++ VQVTRF CGSL VGFTAHH+V+DG +TSNF +AW +A R V I P+
Sbjct  121   PSADDDGAEAEVMMVQVTRFACGSLAVGFTAHHMVSDGRATSNFFLAWSQATRGVAIHPV  180

Query  583   PLRDR-TIFIPRNPPRIEYDHVGAEYMP-KQIKKNDHFLNSNDATFLDDIVV-HKVHFTL  753
             P+ DR + F PR+PPR++Y+H G E+   +++ +N++  + +      ++VV HKVHF+ 
Sbjct  181   PVHDRASFFTPRDPPRVDYEHRGVEFKTCEKLDRNENNDDGHGHGHDGEVVVTHKVHFSR  240

Query  754   EFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNP  933
             EF++KLKA ASA  GG R YST + +VAHLWR IT AR L G   T + I+VDGRAR++P
Sbjct  241   EFISKLKALASA-GGGQRSYSTLQCVVAHLWRCITMARGLEGSVATSVSIAVDGRARMSP  299

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVA  1113
              V + Y GN+VLWA PTA  ++L+  PL +A  LI+ AV+++N+ Y +SF+DFANS  V 
Sbjct  300   PVLDGYTGNVVLWARPTATARELVTMPLQHAMGLINRAVARINDGYFKSFVDFANSGAV-  358

Query  1114  EEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSF  1293
             EE+ LV +AD  + +L PN+EVDSWLR PFY+LDFG+G P++F P++ P EG++ LLPSF
Sbjct  359   EEERLVASADAAEMVLSPNIEVDSWLRIPFYELDFGSGQPFLFTPSYLPVEGLLILLPSF  418

Query  1294  IGDGSIDAFIPLFQDNLPTFKQICYSL  1374
              GDGS+DA++PLF  ++ TFK  CY L
Sbjct  419   SGDGSVDAYVPLFSHDMDTFKNCCYVL  445



>ref|XP_009412965.1| PREDICTED: agmatine coumaroyltransferase-2 {ECO:0000303|PubMed:18270436, 
ECO:0000312|EMBL:BAF97627.1}-like [Musa acuminata 
subsp. malaccensis]
Length=460

 Score =   480 bits (1236),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 236/452 (52%), Positives = 316/452 (70%), Gaps = 16/452 (4%)
 Frame = +1

Query  52    KTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             K +KV+VES++ +KPSYEG PP T   + LSVFDK++Y    AVIYA+RPPTPPN+ IE 
Sbjct  6     KAVKVRVESSKLVKPSYEGEPPSTDLCIRLSVFDKINYKVHGAVIYAFRPPTPPNTDIEK  65

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL  AL  +REWAGRL  D +G PV+LLND G +F+E S D  LD+ +  +PS +LL LH
Sbjct  66    GLVTALSEHREWAGRLHEDSQGEPVILLNDAGARFIEVSSDDVLDRAVIHEPSTALLPLH  125

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P +KGV EL+QVQ+TRF CG+LVVGFT+HH VADGHS S F+VAWG A R + + PLPL 
Sbjct  126   PWVKGVEELLQVQLTRFACGTLVVGFTSHHWVADGHSMSKFIVAWGLATRGLPMDPLPLH  185

Query  592   DR-TIFIPRNPPRIEYDHVGAEYMPKQ-----------IKKNDHFLNS-NDATFLDDIVV  732
              R   FIPRNPPR+E++H G E+  ++           +      L++ +D    DDIV 
Sbjct  186   GRGAFFIPRNPPRVEFEHRGVEFAARKAFDAEDAADDIVSTAKKALDTEDDVAKADDIVF  245

Query  733   HKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVD  912
             HK HF+ EFL  LKAK S   G  R Y+TFESL+AHLWR ++ AR +    T+ +RISV+
Sbjct  246   HKAHFSREFLEMLKAKVSI--GADRRYNTFESLMAHLWRVVSVARGVDERITSGLRISVN  303

Query  913   GRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDF  1092
             GRARL P VP++Y GNLVLWAFP  KV DL+  PL +AA LIH+  +++++ Y RS IDF
Sbjct  304   GRARLRPPVPDEYLGNLVLWAFPRVKVGDLVNRPLQFAAALIHEETARMDDGYFRSLIDF  363

Query  1093  ANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGM  1272
             A+ + V +E  L  TA+ +  ++ PNLEV +  RFPF+DLDFG+G P++FMP + P EG+
Sbjct  364   ASLEDVKDE-ALEATAEANYRVMNPNLEVHNLARFPFWDLDFGSGKPFMFMPCYVPVEGI  422

Query  1273  MFLLPSFIGDGSIDAFIPLFQDNLPTFKQICY  1368
             MFL+PS   DGS+D ++ L + N+ +F+Q+C+
Sbjct  423   MFLVPSPTRDGSMDVYVALLKHNVSSFEQLCH  454



>dbj|BAJ89224.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=439

 Score =   478 bits (1229),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 233/445 (52%), Positives = 311/445 (70%), Gaps = 11/445 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEG---NPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MK+ V S++ +KP Y      P  T   VPL+V DK ++D  I+VIYA+  P PPN+ +E
Sbjct  1     MKITVHSSKAVKPEYGACGVAPGCTADVVPLTVLDKANFDTYISVIYAFHAPAPPNAVLE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
              GL +AL  YREWAGRLG D  G   +LLND G +FVEA+ D  LD VMP KP+  +L+L
Sbjct  61    AGLGRALVDYREWAGRLGVDASGGRAILLNDAGARFVEATADVALDSVMPLKPTSEVLSL  120

Query  409   HPSLK-GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
             HPS   G  EL+ +QVTRF CGSLVVGFT  H+V+DG ST NF VAW +A R   I P+P
Sbjct  121   HPSGDDGPEELMLIQVTRFACGSLVVGFTTQHIVSDGRSTGNFFVAWSQATRGAAIDPVP  180

Query  586   LRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
             + DR + F PR P  +EY+H G E+ P + K +D    ++     D++VV+KVHF+ EF+
Sbjct  181   VHDRASFFHPREPLHVEYEHRGVEFKPYE-KAHDVVCGADGDE--DEVVVNKVHFSREFI  237

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
             +KLKA+ASA  G  RP ST + +VAHLWR++T AR L G ETT + I+VDGRAR++P+VP
Sbjct  238   SKLKAQASA--GAPRPCSTLQCVVAHLWRSMTMARGLDGGETTSVAIAVDGRARMSPQVP  295

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
             + Y GN++LWA PT    +L+  P+ +A +LI   V+++N+ Y +SFIDFANS  V E++
Sbjct  296   DGYTGNVILWARPTTTAGELVTRPVKHAVELISREVARINDGYFKSFIDFANSGAV-EKE  354

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
              LV TAD    +L PN+EVDSWLR PFYD+DFG G P+ FMP++ P EG++ LLPSF+GD
Sbjct  355   RLVATADAADMVLSPNIEVDSWLRIPFYDMDFGGGRPFFFMPSYLPVEGLLILLPSFLGD  414

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             GS+DA++PLF  ++ TFK  CYSLD
Sbjct  415   GSVDAYVPLFSRDMNTFKNCCYSLD  439



>dbj|BAJ86518.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=439

 Score =   477 bits (1228),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 233/445 (52%), Positives = 312/445 (70%), Gaps = 11/445 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEG---NPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MK+ V S++ +KP Y      P  T   VPL+V DK ++D  I+VIYA+  P PPN+ +E
Sbjct  1     MKITVHSSKAVKPEYGACGVAPGCTADVVPLTVLDKANFDTYISVIYAFHAPAPPNAVLE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
              GL +AL  YREWAGRLG D  G+  +LLND G +FVEA+ D  LD VMP KP+  +L+L
Sbjct  61    AGLGRALVDYREWAGRLGVDANGDRAILLNDAGARFVEATADVALDNVMPLKPTSEVLSL  120

Query  409   HPSLK-GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
             HPS   G  EL+ +QVTRF CGSLVVGFT  H+V+DG ST NF VAW +A R   I P+P
Sbjct  121   HPSGDDGPEELMLIQVTRFACGSLVVGFTTQHIVSDGRSTGNFFVAWSQATRGAAIDPVP  180

Query  586   LRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
             + DR + F PR P  +EY+H G E+ P + K +D    ++     D++VV+KVHF+ EF+
Sbjct  181   VHDRASFFHPREPLHVEYEHRGVEFKPYE-KAHDVVCGADGDE--DEVVVNKVHFSREFI  237

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
             +KLKA+ASA  G  RP ST + +VAHLWR++T AR L G ETT + I+VDGRAR++P+VP
Sbjct  238   SKLKAQASA--GAPRPCSTLQCVVAHLWRSMTMARGLDGGETTSVAIAVDGRARMSPQVP  295

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
             + Y GN++LWA PT    +L+  P+ +A +LI   V+++N+ Y +SFIDFANS  V E++
Sbjct  296   DGYTGNVILWARPTTTAGELVDRPVKHAVELISREVARINDGYFKSFIDFANSGAV-EKE  354

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
              LV TAD    +L PN+EVDSWLR PFYD+DFG G P+ FMP++ P EG++ LLPSF+GD
Sbjct  355   RLVATADAADMVLSPNIEVDSWLRIPFYDMDFGGGRPFFFMPSYLPVEGLLILLPSFLGD  414

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             GS+DA++PLF  ++ TFK  CYSLD
Sbjct  415   GSVDAYVPLFSRDMNTFKNCCYSLD  439



>ref|XP_004957521.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=434

 Score =   477 bits (1228),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 236/445 (53%), Positives = 318/445 (71%), Gaps = 16/445 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV S++ ++P+Y     PP    ++PLSVFD+V+Y  Q+A+IYA+ PP P  + IE 
Sbjct  1     MEVKVLSSKLVRPAYNAGAAPPAGGEYIPLSVFDRVTYKMQMAIIYAFPPPAPSTAAIEK  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL   L  YR +AG+LG+  +G P VLLND G +FVEA+ D  L  + P KP+  LL LH
Sbjct  61    GLATVLSEYRAFAGQLGSAPDGTPAVLLNDRGARFVEATVDADLVDMAPAKPTPELLRLH  120

Query  412   PSLKG--VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
             P L+G  + E+V +Q+TRF CGSL VGFT++H+ ADGH+TSNFLVAWG+A R +   P P
Sbjct  121   PDLEGEELQEVVLLQLTRFRCGSLAVGFTSNHVAADGHATSNFLVAWGRATRGLPTGPSP  180

Query  586   LRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
             +  +  +F PR  PR+E+DH   EY P    + DH          ++IV+HK HFT +F+
Sbjct  181   VYHQAGLFKPRASPRVEHDHRRREYRPAG-GEPDH----GHGEGAENIVIHKAHFTKDFI  235

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
             A L+ +AS   G  RP+S FE+++AHLWR +T+AR L   ET+ IR+SVDGR RL   +P
Sbjct  236   ASLRGRAS--EGRGRPFSRFETILAHLWRTMTRARGLNPDETSQIRLSVDGRHRLG--LP  291

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
              +YFGNLVLWAFPTA V DLL  PL +AA++IHD V++V+  Y RSFIDFA+S  V E +
Sbjct  292   AEYFGNLVLWAFPTATVADLLGRPLKHAAQVIHDEVARVDGAYFRSFIDFASSGAV-ERE  350

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
             GL P+A + K +LCP++EVDSWL FPFY+LDFGTG P  FMP++FPTEGM+FL+PS+IGD
Sbjct  351   GLTPSA-VCKDVLCPDVEVDSWLTFPFYELDFGTGSPTYFMPSYFPTEGMLFLVPSYIGD  409

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             GS+DAF+P+FQ NL  FK+ CY+++
Sbjct  410   GSVDAFVPVFQHNLEAFKECCYAME  434



>sp|A9ZPJ6.1|AGCT1_HORVU RecName: Full=Agmatine coumaroyltransferase-1 [Hordeum vulgare]
 dbj|BAF97626.1| agmatine coumaroyltransferase [Hordeum vulgare subsp. vulgare]
Length=439

 Score =   476 bits (1226),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 233/445 (52%), Positives = 310/445 (70%), Gaps = 11/445 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEG---NPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MK+ V S++ +KP Y      P  T   VPL+V DK ++D  I+VIYA+  P PPN+ +E
Sbjct  1     MKITVHSSKAVKPEYGACGLAPGCTADVVPLTVLDKANFDTYISVIYAFHAPAPPNAVLE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
              GL +AL  YREWAGRLG D  G   +LLND G +FVEA+ D  LD VMP KP+  +L+L
Sbjct  61    AGLGRALVDYREWAGRLGVDASGGRAILLNDAGARFVEATADVALDSVMPLKPTSEVLSL  120

Query  409   HPSLK-GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
             HPS   G  EL+ +QVTRF CGSLVVGFT  H+V+DG ST NF VAW +A R   I P+P
Sbjct  121   HPSGDDGPEELMLIQVTRFACGSLVVGFTTQHIVSDGRSTGNFFVAWSQATRGAAIDPVP  180

Query  586   LRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
             + DR + F PR P  +EY+H G E+ P + K +D    ++     D++VV+KVHF+ EF+
Sbjct  181   VHDRASFFHPREPLHVEYEHRGVEFKPCE-KAHDVVCGADGDE--DEVVVNKVHFSREFI  237

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
             +KLKA ASA  G  RP ST + +VAHLWR++T AR L G ETT + I+VDGRAR++P+VP
Sbjct  238   SKLKAHASA--GAPRPCSTLQCVVAHLWRSMTMARGLDGGETTSVAIAVDGRARMSPQVP  295

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
             + Y GN++LWA PT    +L+  P+ +A +LI   V+++N+ Y +SFIDFANS  V E++
Sbjct  296   DGYTGNVILWARPTTTAGELVTRPVKHAVELISREVARINDGYFKSFIDFANSGAV-EKE  354

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
              LV TAD    +L PN+EVDSWLR PFYD+DFG G P+ FMP++ P EG++ LLPSF+GD
Sbjct  355   RLVATADAADMVLSPNIEVDSWLRIPFYDMDFGGGRPFFFMPSYLPVEGLLILLPSFLGD  414

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             GS+DA++PLF  ++ TFK  CYSLD
Sbjct  415   GSVDAYVPLFSRDMNTFKNCCYSLD  439



>gb|AAO73071.1| agmatine coumaroyltransferase [Hordeum vulgare]
Length=439

 Score =   474 bits (1220),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 232/445 (52%), Positives = 310/445 (70%), Gaps = 11/445 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEG---NPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MK+ V S++ +KP Y      P  T   VPL+V DK ++D  I+VIYA+  P PPN+ +E
Sbjct  1     MKITVHSSKAVKPEYGACGLAPGCTADVVPLTVLDKANFDTYISVIYAFHAPAPPNAVLE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
              GL +AL  YREWAGRLG D  G   +LLND G +FVEA+ D  LD VMP KP+  +L+L
Sbjct  61    AGLGRALVDYREWAGRLGVDASGGRAILLNDAGARFVEATADVALDSVMPLKPTSEVLSL  120

Query  409   HPSLK-GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
             HPS   G  EL+ +QVTRF CGSLVVGFT  H+V+DG ST NF VAW +A R   I P+P
Sbjct  121   HPSGDDGPEELMLIQVTRFACGSLVVGFTTQHIVSDGRSTGNFFVAWSQATRGAAIDPVP  180

Query  586   LRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
             + DR + F PR P  +EY+H G E+ P + K +D    ++     D++VV+KVHF+ EF+
Sbjct  181   VHDRASFFHPREPLHVEYEHRGVEFKPYE-KAHDVVCGADGDE--DEVVVNKVHFSREFI  237

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
             +KLKA+ASA  G  RP ST + +VAHLWR++T AR L G ETT + I+VDGRAR++P+VP
Sbjct  238   SKLKAQASA--GAPRPCSTLQCVVAHLWRSMTMARGLDGGETTSVAIAVDGRARMSPQVP  295

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
             + Y GN++LWA PT    +L+  P+ +A +LI   V+++N+ Y +SFIDFANS  V E++
Sbjct  296   DGYTGNVILWARPTTTAGELVTRPVKHAVELISREVARINDGYFKSFIDFANSGAV-EKE  354

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
              LV TAD    +L PN+EVDSWL  PFYD+DFG G P+ FMP++ P EG++ LLPSF+GD
Sbjct  355   RLVATADAADMVLSPNIEVDSWLLIPFYDMDFGGGRPFFFMPSYLPVEGLLILLPSFLGD  414

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             GS+DA++PLF  ++ TFK  CYSLD
Sbjct  415   GSVDAYVPLFSRDMNTFKNCCYSLD  439



>gb|AEV40931.1| putative transferase family protein [Oryza punctata]
Length=422

 Score =   469 bits (1207),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 223/422 (53%), Positives = 302/422 (72%), Gaps = 9/422 (2%)
 Frame = +1

Query  115   PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEE  294
             P T   VPLSVFDK ++D  ++VIYA+RPP P NS +E GL KAL  YREWAGRLG D +
Sbjct  4     PSTADVVPLSVFDKANFDTYVSVIYAFRPPAPANSVLEAGLAKALAEYREWAGRLGVDGD  63

Query  295   GNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCG  471
             G+  ++LND G +FVEA+ D TLD V+P +P+  + +LHPS   G  E++ +QVTRF CG
Sbjct  64    GDRAIVLNDAGARFVEATADVTLDSVVPLEPTPRVTSLHPSADDGAEEVMMIQVTRFACG  123

Query  472   SLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDRT-IFIPRNPPRIEYDHVG  648
             SL VGFTAHH+V+DG +TSNF +AW +A R V I P+P+ DR+  F PR+PPR++Y+H G
Sbjct  124   SLAVGFTAHHMVSDGRATSNFFLAWSQATRGVAIHPVPVHDRSSFFTPRDPPRVDYEHRG  183

Query  649   AEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFES  828
              E+        D   ++++     ++V HKVHF+ EF++KLKA ASA  GG R YST + 
Sbjct  184   VEFKTCDKMHRDDDGDADNG----EVVTHKVHFSREFISKLKALASA--GGHRSYSTLQC  237

Query  829   LVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLR  1008
             +VAHLWR IT AR L G   T + I+VDGRAR++P VP+ Y GN+VLWA PTA  ++L+ 
Sbjct  238   VVAHLWRCITMARGLEGSVATSVSIAVDGRARMSPPVPDGYTGNVVLWARPTATARELVT  297

Query  1009  EPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSW  1188
              PL +A  LI+ AV+++N+ Y +SF+DFAN   V EE+ LV +AD  + +L PN+EVDSW
Sbjct  298   MPLQHAVGLINRAVARINDGYFKSFVDFANCGAV-EEERLVSSADAAEMVLSPNIEVDSW  356

Query  1189  LRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICY  1368
             LR PFY+LDFG+G P++F P++ P EG++ LLPSF GDGS+DA++PLF  ++ TFK  C 
Sbjct  357   LRIPFYELDFGSGQPFLFTPSYLPVEGLLILLPSFSGDGSVDAYVPLFSHDMDTFKNCCC  416

Query  1369  SL  1374
              L
Sbjct  417   VL  418



>ref|XP_002460595.1| hypothetical protein SORBIDRAFT_02g031580 [Sorghum bicolor]
 gb|EER97116.1| hypothetical protein SORBIDRAFT_02g031580 [Sorghum bicolor]
Length=445

 Score =   469 bits (1208),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 244/451 (54%), Positives = 317/451 (70%), Gaps = 17/451 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSY-EGNP-PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV S++ +KPSY  G P P TT HVP SVFDKV+Y  Q+A+IYA+ PP P    IE 
Sbjct  1     MEVKVLSSKLVKPSYPAGAPRPDTTEHVPSSVFDKVTYHMQMAIIYAFSPPGPSPGDIER  60

Query  232   GLRKALGVYREWAG--RLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             GL   LG YR +AG  R G D++G P VLLND G + VEAS D  L  + P KPS  +L 
Sbjct  61    GLAAVLGAYRLFAGQVRPGPDDDGAPGVLLNDHGARLVEASVDAHLADIAPTKPSPLVLR  120

Query  406   LHPSLKG-VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPL  582
             LHP L+G + E+VQVQ+TRF CGSL VGFTA+H VADGH+TS+FLVAWG+A R + + P 
Sbjct  121   LHPDLEGDIREVVQVQLTRFACGSLAVGFTANHAVADGHATSDFLVAWGRAARGLPVGPS  180

Query  583   P-LRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKN----DHFLNSNDATFLDDIVVHKVHF  747
             P +  R +F PR+PP +E+ H G EY       +     H     D T   +IV+HK HF
Sbjct  181   PPVHHRGLFPPRHPPFVEFAHRGVEYCRPAPSSHPPAAAHGHGHGDDTQQHNIVIHKAHF  240

Query  748   TLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGG-FETTHIRISVDGRAR  924
             T +F+A ++AKAS   G  RP+S FE+++AH+WR +T+AR LG   +T+ IRISVDGR R
Sbjct  241   TKDFVAGIRAKAS--EGRGRPFSRFETILAHVWRTMTRARGLGNPLQTSTIRISVDGRPR  298

Query  925   LNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSK  1104
             L    P  YFGNLVLWAFP   V +L+  PL +AA+ IHDAV++ +  Y +SF+DFA+S 
Sbjct  299   L--AAPPGYFGNLVLWAFPRTTVGNLVNRPLKHAAQAIHDAVARADGAYFQSFVDFASSG  356

Query  1105  VVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLL  1284
              V E++GL  TA + K +LCP+LEVDSWL FPFY+LDFG G P  FMP++FPTEGM+FL+
Sbjct  357   AV-EKEGLETTAVL-KDVLCPDLEVDSWLTFPFYELDFGAGSPSYFMPSYFPTEGMLFLV  414

Query  1285  PSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             PS++GDGS+DAF+P+F+ NL  FKQ CYS++
Sbjct  415   PSYLGDGSVDAFVPVFEHNLEAFKQFCYSME  445



>ref|XP_004975399.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=439

 Score =   468 bits (1203),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 229/444 (52%), Positives = 305/444 (69%), Gaps = 11/444 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MK+ V+S++ +KP+    P      VPLSVFDKV++D  ++VIY +RPPTPPN+ +E GL
Sbjct  1     MKITVKSSKAVKPA--NGPAAAPDVVPLSVFDKVNFDTYVSVIYVFRPPTPPNAALEAGL  58

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
              +AL  Y EWAGRLG D  GN  +LLN EG + VEA+ D  LD V+P  P+  + +LHPS
Sbjct  59    ARALAEYPEWAGRLGVDGRGNRAILLNGEGARLVEATADVALDAVLPLSPAPEVRSLHPS  118

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
               G  E++ VQ+TRF CG L VGFTAHHLV+DG +TSNF VAW +A R V + P+P+ DR
Sbjct  119   EDGAEEVMLVQLTRFACGGLAVGFTAHHLVSDGRATSNFFVAWSQATRGVPVDPVPVHDR  178

Query  598   -TIFIPRNPPRIEYDHVGAEY-MPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
              + F PR+PPR+E+DH G E+  P+      H    N+    D+++VHK HF+ EF+A+L
Sbjct  179   ASFFKPRDPPRVEFDHRGVEFKKPEPAAPPLHAEAGNNVD--DEVLVHKAHFSREFIARL  236

Query  772   KAKASAMNGGARPYSTFESLVAHLWRAITKARNL--GGFETTHIRISVDGRARLNPKVPN  945
             K++AS   G  RP ST   +VAHLWR IT AR L   G  TT + I+VDGRAR+   VP+
Sbjct  237   KSQASPPGG--RPCSTLRCVVAHLWRCITAARGLDAAGAATTSVCIAVDGRARMIQPVPD  294

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG  1125
              Y GN+VLWA PTA  +DL+  PL +A +LI+  +++V+ +Y  SF+DFA S  V E +G
Sbjct  295   GYTGNVVLWARPTAAARDLVARPLRHAVELINRELARVDGSYFGSFVDFAASGAV-EAEG  353

Query  1126  LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDG  1305
             LVP AD  + +L PN+EVDSWLR PFYDLDFG G P  FMP++ P EG++ LLPS  GDG
Sbjct  354   LVPAADAAEMVLSPNIEVDSWLRIPFYDLDFGGGRPCFFMPSYLPVEGLLILLPSCYGDG  413

Query  1306  SIDAFIPLFQDNLPTFKQICYSLD  1377
             S+DA++PLF  ++  FK  CYS+D
Sbjct  414   SVDAYVPLFSRHMDAFKSCCYSID  437



>ref|XP_008670362.1| PREDICTED: agmatine coumaroyltransferase-2-like [Zea mays]
 tpg|DAA40670.1| TPA: hypothetical protein ZEAMMB73_540218 [Zea mays]
Length=445

 Score =   468 bits (1203),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 244/450 (54%), Positives = 314/450 (70%), Gaps = 15/450 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSY-EGNP-PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV S++ +KPSY  G P P TT HVP SVFDK +Y  Q+A+IYA+ PP P    IE 
Sbjct  1     MEVKVLSSKLVKPSYPAGAPRPDTTEHVPSSVFDKATYHMQMAIIYAFSPPVPSPDAIER  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL   LG YR +AG++    +G P VLLND G + VEAS D  L  + P KPS ++L LH
Sbjct  61    GLAAVLGAYRLFAGQVRPGPDGAPGVLLNDHGARLVEASVDARLADIAPTKPSPAVLRLH  120

Query  412   PSLKGV-VE--LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPL  582
             P L G  +E  +VQVQ+TRF CGSL VGFTA+H VADGH+TS+FLVAWG+A R + + P 
Sbjct  121   PDLDGSDIEEPVVQVQLTRFACGSLAVGFTANHAVADGHATSDFLVAWGRAARGLPVGPS  180

Query  583   PLRDR-TIFIPR-NPPRIEYDHVGAEYM-PKQIKKNDHFLNSNDATFLDDIVVHKVHFTL  753
             P   R  +F PR +PPR  ++H G EY  P     + H     D T    IV+HK HFT 
Sbjct  181   PPVHRPGLFPPRHDPPRAGFEHRGVEYYKPAPSSAHVHVHGHGDTTTQHSIVIHKAHFTK  240

Query  754   EFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGG--FETTHIRISVDGRARL  927
             +F+A L+A+AS   G  RP+S FE+++AH+WR +T+AR LG    +T+ IRISVDGR RL
Sbjct  241   DFVAGLRARAS--EGRGRPFSRFETILAHVWRTMTRARGLGSNPLQTSTIRISVDGRPRL  298

Query  928   NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKV  1107
                 P DYFGNLVLWAFP A V  LL  PL +AA++IHDAV++V+  Y +SF+DFA S  
Sbjct  299   A-AAPADYFGNLVLWAFPRATVGSLLGRPLKHAAQVIHDAVARVDGAYFQSFVDFAGSGA  357

Query  1108  VAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLP  1287
             V E++GL  TA + K +LCP+LEVDSWL FPFY+LD G G P  FMP++FPTEGM+FL+P
Sbjct  358   V-EKEGLETTALL-KDVLCPDLEVDSWLTFPFYELDLGAGNPSYFMPSYFPTEGMLFLVP  415

Query  1288  SFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             S++GDGS+DAF+P+F+ NL  FKQ CYS++
Sbjct  416   SYLGDGSVDAFVPMFEQNLEAFKQCCYSME  445



>tpg|DAA62504.1| TPA: agmatine coumaroyltransferase [Zea mays]
Length=449

 Score =   466 bits (1199),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 241/454 (53%), Positives = 315/454 (69%), Gaps = 20/454 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSY-EGNP-PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M VKV S++ +KPSY  G P P TT HVP SVFD+ +Y+ Q+A+IYA+ PP P    IE 
Sbjct  1     MDVKVLSSKLVKPSYPAGAPRPDTTEHVPSSVFDRATYNMQMAIIYAFSPPGPSPGAIER  60

Query  232   GLRKALGVYREWAG--RLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             GL   LG YR +AG  R G D+ G P VLLND G + VEAS D  L  + P KPS ++L 
Sbjct  61    GLAAVLGAYRLFAGQVRAGPDDGGAPGVLLNDHGARLVEASVDARLADIAPTKPSPAVLR  120

Query  406   LHPSLKG-VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQ  576
             LHP L G + E+VQVQ+TRF CGSL VGFTA+H VADGH+TS+FLVAWG+A R +     
Sbjct  121   LHPDLDGDIQEVVQVQLTRFACGSLAVGFTANHAVADGHATSDFLVAWGRAARGLGPSSS  180

Query  577   PLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLD-----DIVVHKV  741
             P+P+    +F PR+PPR E++H G EY   +          + A          +V+HK 
Sbjct  181   PVPVHRPGLFPPRHPPRAEFEHRGVEYCYYRPAPPSPAHAHHPAAAHGGDTRHSVVIHKA  240

Query  742   HFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLG--GFETTHIRISVDG  915
             HFT +F+A L+A+AS   G  RP+S FE+++AH+WRA+T+AR LG    +T+ +RISVDG
Sbjct  241   HFTKDFVAGLRARAS--QGRGRPFSRFETILAHVWRAMTRARGLGVDPLQTSTVRISVDG  298

Query  916   RARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFA  1095
             R RL    P  YFGNLVLWAFP A V DLL  PL +AA+ IHDAV++V+  Y +SF+D+A
Sbjct  299   RPRL--AAPAGYFGNLVLWAFPRATVGDLLSRPLKHAAQAIHDAVARVDGAYFQSFVDWA  356

Query  1096  NSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMM  1275
             +S  V +E  ++ T  + K +LCP+LEVDSWL FPFY+LDFGTG P  FMP++FPTEGM+
Sbjct  357   SSGAVDKE--VLQTTAVLKDVLCPDLEVDSWLTFPFYELDFGTGSPTYFMPSYFPTEGML  414

Query  1276  FLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             FL+PS++GDGS+DAF+PLF+ NL  FKQ CYS++
Sbjct  415   FLVPSYLGDGSVDAFVPLFEHNLEAFKQCCYSME  448



>ref|XP_003578560.1| PREDICTED: agmatine coumaroyltransferase-2-like [Brachypodium 
distachyon]
Length=443

 Score =   465 bits (1196),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 236/451 (52%), Positives = 311/451 (69%), Gaps = 19/451 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNP--PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV S++ +KP Y      P T+ HVP SVFD  +Y  Q+A+IYA+  P P  + IE 
Sbjct  1     MEVKVVSSKLVKPRYPRGAARPDTSEHVPSSVFDAATYHIQMAIIYAFSAPAPSTADIER  60

Query  232   GLRKALGVYREWAGRLG-NDEEGNPVVLLNDEGVKFVEASGD-TTLDKVMPFKPSVSLLN  405
             GL   L  YR +AG++G    EG+P VLLND G + VEA  +   L  V P KP+  +L 
Sbjct  61    GLADVLAAYRLFAGQVGRGGPEGSPGVLLNDHGARLVEARVEGARLVDVAPAKPTPEILK  120

Query  406   LHPSLKGVVE-LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMI--Q  576
             LHP L G +E +VQVQ+TRF CGSL VGFTA+H VADGH+TS+FL AWG+A R + I  Q
Sbjct  121   LHPDLDGEIEEVVQVQLTRFACGSLAVGFTANHAVADGHATSDFLAAWGRATRGLPIFQQ  180

Query  577   PLPLRDRTIFIPRNPPRIEYDHVGAEY----MPKQIKKNDHFLNSNDATFLDDIVVHKVH  744
             P     + +F PR  PR+E++H G EY    +P    +  H   +N+    + +V+HK H
Sbjct  181   PPVHHHKELFKPRLSPRVEFEHRGVEYYRPVLPSATDEKQHHGGANN----NGVVIHKTH  236

Query  745   FTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRAR  924
             FT +F+A L+A+AS   G  RP+S FE+ +AHLWRA+T+AR LG +ET+ IR+SVDGR R
Sbjct  237   FTKDFIAGLRARAS--EGRGRPFSRFETTLAHLWRAMTRARGLGPYETSTIRVSVDGRRR  294

Query  925   LNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSK  1104
             L+ + P  YFGNLVLWAFP A   DLL  PL +AA+ IHDAV++V+  Y RSF+DFA   
Sbjct  295   LD-EAPAGYFGNLVLWAFPRATAGDLLNRPLKHAAQTIHDAVARVDEAYFRSFVDFAAGS  353

Query  1105  VVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLL  1284
                E +GL  TA + K +LCP+LEVDSWL FPFY+LDFGTG P  FMP++FPTEGM+FL+
Sbjct  354   GAVEREGLEKTAVL-KDVLCPDLEVDSWLTFPFYELDFGTGSPSYFMPSYFPTEGMLFLV  412

Query  1285  PSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             PS++GDGS+DAF+P+F+ NL  FKQ CYS++
Sbjct  413   PSYLGDGSVDAFVPVFEHNLEAFKQCCYSME  443



>gb|KDP34699.1| hypothetical protein JCGZ_10904 [Jatropha curcas]
Length=394

 Score =   462 bits (1190),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 230/386 (60%), Positives = 288/386 (75%), Gaps = 13/386 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTH-VPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MKV VE T  +KP  + N  P    +H VPLSVFDKVSY+  +A+IYAY PPTP N+TIE
Sbjct  1     MKVTVERTEIVKPFCDSNKIPSDPKSHFVPLSVFDKVSYNTHVAIIYAYNPPTPTNATIE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
             LGL+K L  YREWAGRLG +E G+PV+ LND+GV FVEAS D  L++VMP +PS  LL+L
Sbjct  61    LGLQKVLSEYREWAGRLGENENGDPVIFLNDKGVNFVEASIDIKLEQVMPLQPSPFLLSL  120

Query  409   HPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPL  588
             HP +K V  L+QVQ+TRF CGSLV+GFTAHHLVADGHS SNFLVAWGKA R + I PLPL
Sbjct  121   HPKVKDVEALLQVQLTRFACGSLVIGFTAHHLVADGHSASNFLVAWGKATRGLDINPLPL  180

Query  589   RDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAK  768
              DRTIF PRNPP  E++H G E+  K +  ND   ++ D   ++++ VHKVHFT+EFL++
Sbjct  181   HDRTIFNPRNPPYFEFEHKGVEFKCKNL-VND--CSNYDGMSVEEVEVHKVHFTMEFLSE  237

Query  769   LKAKAS-----AMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNP  933
             LK +AS       NG  +PY+TFESL+AHLWR +TKAR L G E T I+ISV+GRAR+NP
Sbjct  238   LKTRASNSLPNGANGNNKPYTTFESLLAHLWRTMTKARQLNGSENTRIKISVNGRARMNP  297

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVA  1113
             KVPN+YFGNLVLW +P++KV+DL++EPL YAAKL+ DA+  VN+ Y +SFIDFA  K  A
Sbjct  298   KVPNEYFGNLVLWTYPSSKVEDLVQEPLGYAAKLVRDAIESVNDKYFKSFIDFATVK--A  355

Query  1114  EEDGLVPTADMDKHILCPNLEVDSWL  1191
             +E+ LVPTAD +     PNL+   + 
Sbjct  356   KEEDLVPTADANVSTCIPNLKASCFF  381



>gb|EMT23728.1| hypothetical protein F775_42423 [Aegilops tauschii]
Length=439

 Score =   464 bits (1193),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 244/453 (54%), Positives = 315/453 (70%), Gaps = 27/453 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSY-EGNP-PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV S++ +KP Y EG   P TT HVP SVFDKV+Y  Q+A+IYA++ P P    IE 
Sbjct  1     MEVKVLSSKIVKPQYAEGTARPDTTEHVPSSVFDKVTYHIQMAIIYAFQAPAPSTEDIER  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGD-TTLDKVMPFKPSVSLLNL  408
             GL + LGVYR +AG++    +G P VLLND G + VEA  D  TL +  P KPS  +L L
Sbjct  61    GLAQVLGVYRLFAGQVRAGPDGAPGVLLNDHGARLVEARVDGATLVEFAPPKPSPVVLQL  120

Query  409   HPSLKG-VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQ---  576
             HP L+G V E+VQVQ+TRF CGSL VGFTA+H VADGH+TS+FLVAWG+A R + I    
Sbjct  121   HPDLEGDVEEVVQVQLTRFACGSLAVGFTANHAVADGHATSDFLVAWGRAARGLDISAPS  180

Query  577   PLPLRDRTIFIPRNPPRIEYDHVGAEYM------PKQIKKNDHFLNSNDATFLDDIVVHK  738
             P P     +F PR+PP ++++H G EY       PKQ +   H          D++++HK
Sbjct  181   PPPHNHLDLFRPRDPPVVDFEHRGVEYYRPTTSNPKQGEGGHHGA--------DNVIIHK  232

Query  739   VHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGR  918
              HFT +F+A L+AKAS   G  RP+S FE+ +AHLWR +T+AR L   E + IRISVDGR
Sbjct  233   AHFTKDFIAGLRAKAS--EGRGRPFSRFETTLAHLWRTMTRARGLSPGEDSTIRISVDGR  290

Query  919   ARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFAN  1098
              RL+   P  YFGNLVLWAFP + V DLL  PL +AA+ IHDAV++++  Y +S +DFA+
Sbjct  291   RRLS--APPGYFGNLVLWAFPRSTVGDLLSRPLKHAAQTIHDAVARLDGAYFQSLVDFAS  348

Query  1099  SKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMF  1278
             S  V E +GL  TA + K +LCP+LEVDSWL FPFY+LDFG G P  FMP++FPTEGM+F
Sbjct  349   SGAV-EREGLEKTAVL-KDVLCPDLEVDSWLTFPFYELDFGAGSPSYFMPSYFPTEGMLF  406

Query  1279  LLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             L+PS++GDGS+DAF+P+FQ NL  FKQ CYS+D
Sbjct  407   LVPSYLGDGSVDAFVPVFQHNLDAFKQCCYSMD  439



>gb|EAZ09943.1| hypothetical protein OsI_32242 [Oryza sativa Indica Group]
Length=437

 Score =   463 bits (1191),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 228/444 (51%), Positives = 306/444 (69%), Gaps = 11/444 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLT--TTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV S++ +KP+Y G         ++PLS+FDKV+Y  Q+A+IYA+ PP P  + IE 
Sbjct  1     MEVKVLSSKLVKPAYNGGVAAAPDVEYIPLSIFDKVTYKMQMAIIYAFPPPAPSTAAIEK  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL   L  YR +AG+LG   +G   V+LND G + VEA+ D  L  + P KP+  LL LH
Sbjct  61    GLAAVLAQYRAFAGQLGESPDGEAAVVLNDRGARLVEAAVDADLVDMAPAKPTPELLRLH  120

Query  412   PSLKG-VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPL  588
             P L+G + E+V +Q+TRF CGSL VGFT++H+VADGH+TSNFLVAWG+A R + +   P+
Sbjct  121   PDLEGELQEVVLLQLTRFRCGSLAVGFTSNHVVADGHATSNFLVAWGRATRGLPMGAPPV  180

Query  589   RDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLA  765
                  +F PR  P +E+DH   EY       + H     D    D+IV+HK HFT +F+A
Sbjct  181   HHHAALFKPRPSPHVEHDHRNREYYLPSAGDDSH--GHGDGGAADNIVIHKAHFTKDFIA  238

Query  766   KLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPN  945
              L+A AS   G  RP+S FE+++AHLWR +T+AR L   E + IR+SVDGR RL    P 
Sbjct  239   GLRAAAS--EGRGRPFSRFETILAHLWRTMTRARGLSPDEASTIRLSVDGRHRLG--APA  294

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG  1125
             +YFGNLVLWAFP A V DLL  PL +AA++IHD V++V+  Y RSF+DFA S    +++G
Sbjct  295   EYFGNLVLWAFPRATVGDLLTRPLKHAAQVIHDEVARVDGAYFRSFLDFALSGAGGDKEG  354

Query  1126  LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDG  1305
             L P+A + K +LCPN EVDSWL FPFY+LDFGTG P  FMP++FPTEGM+FL+PS++GDG
Sbjct  355   LAPSAVL-KDVLCPNAEVDSWLTFPFYELDFGTGSPTYFMPSYFPTEGMLFLVPSYLGDG  413

Query  1306  SIDAFIPLFQDNLPTFKQICYSLD  1377
             S+DAF+P+F  NL  FK+ CYS++
Sbjct  414   SVDAFVPVFNHNLEAFKECCYSME  437



>ref|NP_001063828.1| Os09g0543900 [Oryza sativa Japonica Group]
 dbj|BAC79154.1| putative anthranilate N-benzoyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF25742.1| Os09g0543900 [Oryza sativa Japonica Group]
 dbj|BAG92784.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98872.1| unnamed protein product [Oryza sativa Japonica Group]
Length=437

 Score =   463 bits (1191),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 228/444 (51%), Positives = 306/444 (69%), Gaps = 11/444 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLT--TTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV S++ +KP+Y G         ++PLS+FDKV+Y  Q+A+IYA+ PP P  + IE 
Sbjct  1     MEVKVLSSKLVKPAYNGGVAAAPDVEYIPLSIFDKVTYKMQMAIIYAFPPPAPSTAAIEK  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL   L  YR +AG+LG   +G   V+LND G + VEA+ D  L  + P KP+  LL LH
Sbjct  61    GLAAVLAQYRAFAGQLGESPDGEAAVVLNDRGARLVEAAVDADLVDMAPAKPTPELLRLH  120

Query  412   PSLKG-VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPL  588
             P L+G + E+V +Q+TRF CGSL VGFT++H+VADGH+TSNFLVAWG+A R + +   P+
Sbjct  121   PDLEGELQEVVLLQLTRFRCGSLAVGFTSNHVVADGHATSNFLVAWGRATRGLPMGAPPV  180

Query  589   RDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLA  765
                  +F PR  P +E+DH   EY       + H     D    D+IV+HK HFT +F+A
Sbjct  181   HHHAALFKPRPSPHVEHDHRNREYYLPAAGDDSH--GHGDGGAADNIVIHKAHFTKDFIA  238

Query  766   KLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPN  945
              L+A AS   G  RP+S FE+++AHLWR +T+AR L   E + IR+SVDGR RL    P 
Sbjct  239   GLRAAAS--EGRGRPFSRFETILAHLWRTMTRARGLSPDEASTIRLSVDGRHRLG--APA  294

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG  1125
             +YFGNLVLWAFP A V DLL  PL +AA++IHD V++V+  Y RSF+DFA S    +++G
Sbjct  295   EYFGNLVLWAFPRATVGDLLTRPLKHAAQVIHDEVARVDGAYFRSFLDFALSGAGGDKEG  354

Query  1126  LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDG  1305
             L P+A + K +LCPN EVDSWL FPFY+LDFGTG P  FMP++FPTEGM+FL+PS++GDG
Sbjct  355   LAPSAVL-KDVLCPNAEVDSWLTFPFYELDFGTGSPTYFMPSYFPTEGMLFLVPSYLGDG  413

Query  1306  SIDAFIPLFQDNLPTFKQICYSLD  1377
             S+DAF+P+F  NL  FK+ CYS++
Sbjct  414   SVDAFVPVFNHNLEAFKECCYSME  437



>ref|XP_006838765.1| hypothetical protein AMTR_s00002p00256790 [Amborella trichopoda]
 gb|ERN01334.1| hypothetical protein AMTR_s00002p00256790 [Amborella trichopoda]
Length=435

 Score =   462 bits (1190),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 222/446 (50%), Positives = 322/446 (72%), Gaps = 17/446 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNP--PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MK++ +S+R + PSYE  P  P T+T +PLS FD+ + +A I+VIYAY+ PTPPNS IE 
Sbjct  1     MKIEKQSSRLVTPSYEAKPVTPSTSTTIPLSPFDRAAGNAHISVIYAYKAPTPPNSAIER  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GLR AL  YREWAGRL +DE     ++LND+GV+F+EA+   TLD+  PFK +  L +LH
Sbjct  61    GLRLALSDYREWAGRLSDDERS---IVLNDKGVRFMEATASCTLDEASPFKSTPQLWDLH  117

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P++KG+ EL+QVQ+TRFTCGSLVVG+TA+HL+ADG +T NFL+AWG+A R +M+ P+P  
Sbjct  118   PNIKGIEELMQVQLTRFTCGSLVVGYTANHLIADGEATGNFLLAWGQATRGLMMHPVPTH  177

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             DR +  PR+   +E+DH+G EYM K++ K   +           I + K HF+ +FLA+L
Sbjct  178   DRAMVKPRDQLAVEFDHLGNEYMEKRLVKEVPW-----EKMASQIRLEKFHFSSDFLARL  232

Query  772   KAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDY  951
             KA+AS      R YSTFESL++H+WR +T+AR +G  ET+ +RISV+ RARL P V   Y
Sbjct  233   KARASVRCPSGRGYSTFESLISHVWRKVTRARGVGEEETSQVRISVNVRARLVPPVAQGY  292

Query  952   FGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG--  1125
             FGN+VLWAFP A V++LL +PL + A+++  A+++VN++Y+RSF+DF +++V  E +G  
Sbjct  293   FGNMVLWAFPRATVRELLSQPLEHVAEVVAAAIARVNDSYVRSFVDF-DTRV--EREGCW  349

Query  1126  --LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIG  1299
               LV TA+++  + CPNLE +SWLR P  ++DFG+G P++FMP+FFP EG++ ++P+  G
Sbjct  350   SELVSTAEVESTVYCPNLEANSWLRLPLSEMDFGSGGPHVFMPSFFPLEGVVVIVPAMHG  409

Query  1300  DGSIDAFIPLFQDNLPTFKQICYSLD  1377
              G ID ++ LF  N+  F+ IC+++D
Sbjct  410   KGGIDLYLSLFDSNMAVFQDICHTID  435



>ref|XP_003578558.1| PREDICTED: agmatine coumaroyltransferase-2-like [Brachypodium 
distachyon]
Length=436

 Score =   462 bits (1190),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 235/448 (52%), Positives = 316/448 (71%), Gaps = 20/448 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKP--SYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VK+ S++ +KP  S  G     T ++PLS+FD+V++  Q+A+IYA+ PP P  + IE 
Sbjct  1     MEVKILSSKLVKPACSPHGGDTTETEYIPLSIFDRVTFQMQMAIIYAFAPPAPSTAAIEK  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL   LG YR +AG+LG   +G+P V+LND G + VEAS D  L  + P KP+  LL LH
Sbjct  61    GLAAVLGQYRAFAGQLGESPDGSPAVILNDRGARLVEASVDADLVDMAPAKPTPELLKLH  120

Query  412   PSLKG---VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPL  582
             P L+G   + E+V +Q+TRF CGSL VGFT++H+VADGH+TSNFLVAWG+A R + + P 
Sbjct  121   PDLEGEQPLEEVVLLQLTRFRCGSLAVGFTSNHVVADGHATSNFLVAWGRATRGLPMGPP  180

Query  583   PLRD-RTIFIPRNPPRIEYDHVGAEY-MPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
             P+     +F PR+ PR+E+DH   EY +P     ND   +  DA   D IV+HK HFT +
Sbjct  181   PVHHYHGLFKPRSSPRVEHDHRRREYYLPS---PNDVVGHHGDAA--DSIVIHKAHFTKD  235

Query  757   FLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPK  936
             F+A L+AK S   G  RP+S FE+++AHLWR +T+AR LG  ET+ IR+SVDGR RL   
Sbjct  236   FIAGLRAKVS--EGRGRPFSRFEAILAHLWRTMTRARGLGPEETSAIRLSVDGRHRLGK-  292

Query  937   VPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAE  1116
              P +YFGN+VLWAFP + V DLL  PL +AA++IHD V++V+  Y +SF+DFA S  V +
Sbjct  293   -PAEYFGNMVLWAFPRSTVGDLLSRPLKHAAQVIHDEVARVDGAYFQSFVDFACSGAVQK  351

Query  1117  EDGLVPTADM-DKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSF  1293
             E  L P+A + D H  CP++EVDSWL FPFY+LDFGTG P  FMP++FPTEGM+FL PS+
Sbjct  352   EK-LAPSAVLKDAH--CPDVEVDSWLTFPFYELDFGTGSPSYFMPSYFPTEGMLFLAPSY  408

Query  1294  IGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             IGDGS+DAF+P+FQ NL  FK+ CYS++
Sbjct  409   IGDGSVDAFVPVFQHNLQAFKECCYSME  436



>ref|XP_003578556.1| PREDICTED: agmatine coumaroyltransferase-2-like [Brachypodium 
distachyon]
Length=435

 Score =   462 bits (1190),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 236/447 (53%), Positives = 319/447 (71%), Gaps = 19/447 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTT-HVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELG  234
             M+VKV S++ +KP+   N   T T ++PLS+FD+V++  Q+A+IYA+ PP P  + IE G
Sbjct  1     MEVKVLSSKLVKPAACNNGGATETEYIPLSIFDRVTFQMQMAIIYAFAPPAPSTAAIEKG  60

Query  235   LRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
             L   LG YR +AG+LG   +G+P V+LND G + VEAS D  L  + P KP+  LL LHP
Sbjct  61    LALVLGQYRAFAGQLGESPDGSPAVILNDRGARLVEASVDADLVDMAPAKPTPELLKLHP  120

Query  415   SLKG---VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
              L+G   + E+V +Q+TRF CGSL VGFT++H+VADGH+TSNFLVAWG+A R + + P P
Sbjct  121   DLEGEQPLEEVVLLQLTRFRCGSLAVGFTSNHVVADGHATSNFLVAWGRATRGLPMGPPP  180

Query  586   LRD-RTIFIPRNPPRIEYDHVGAEY-MPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEF  759
             +     +F PR+ PR+E+DH   EY +P     ND   +  DA   D+IV+HK HFT +F
Sbjct  181   VHHYHGLFKPRSSPRVEHDHRRREYHLPS---PNDVVGHHGDAA--DNIVIHKAHFTKDF  235

Query  760   LAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKV  939
             +A L+A AS   G  RP+S FE+++AHLWRA+T+AR LG  E++ IR+SVDGR RL    
Sbjct  236   IAGLRADASVGRG--RPFSRFETILAHLWRAMTRARGLGPEESSAIRLSVDGRHRLGK--  291

Query  940   PNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEE  1119
             P +YFGN+VLWAFP + V DLL  PL +AA++IHD V++V+  Y +SF+DFA S  V +E
Sbjct  292   PAEYFGNMVLWAFPRSTVGDLLNRPLKHAAQVIHDEVARVDGAYFQSFVDFACSGAVQKE  351

Query  1120  DGLVPTADM-DKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFI  1296
               L P+A + D H  CP++EVDSWL FPFY+LDFGTG P  FMP++FPTEGM+FL PS+I
Sbjct  352   K-LAPSAVLKDAH--CPDVEVDSWLTFPFYELDFGTGSPSYFMPSYFPTEGMLFLAPSYI  408

Query  1297  GDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             GDGS+DAF+P+FQ NL  FK+ CYS++
Sbjct  409   GDGSVDAFVPVFQHNLQAFKECCYSVE  435



>ref|XP_006838766.1| hypothetical protein AMTR_s00002p00256910 [Amborella trichopoda]
 gb|ERN01335.1| hypothetical protein AMTR_s00002p00256910 [Amborella trichopoda]
Length=435

 Score =   458 bits (1178),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 214/443 (48%), Positives = 310/443 (70%), Gaps = 11/443 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNP--PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MK++  S+R + PS+E  P  P T+T +PLS FD+ + +A I+VIYAY+ PTPPNS IE 
Sbjct  1     MKIEKHSSRLVYPSFEAKPFTPSTSTTIPLSPFDRAAGNAYISVIYAYKAPTPPNSAIER  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GLR  L  YREWAGRL +D+     ++LND+GV+ +EA+   TLD+  P K +  L +LH
Sbjct  61    GLRLVLSNYREWAGRLSDDKRA---IVLNDKGVRLIEATASCTLDEARPLKSTPQLWDLH  117

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P  KG+ EL+ VQ+TRFTCGSLVVG+T++HL+ADG +T NFL+AWG+A R +M+ P+P  
Sbjct  118   PGSKGIEELMLVQLTRFTCGSLVVGYTSNHLIADGEATGNFLLAWGQATRGLMVHPVPTH  177

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             DR +  PR P  +E+DH+G EYM K++ KN  +           I + K+H++ +FLA+L
Sbjct  178   DRAMVKPREPLDVEFDHLGNEYMEKRLVKNVPW-----EKMPSPIRIEKIHYSPDFLARL  232

Query  772   KAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDY  951
             KA AS      R YSTFE LV+HLWR +T  R++G  ET+ +RISV+ R RL P + + Y
Sbjct  233   KALASVRCSSERRYSTFECLVSHLWRKVTHVRSVGEEETSQVRISVNVRTRLVPPIADGY  292

Query  952   FGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDF-ANSKVVAEEDGL  1128
             FGNLVLWAFP A V++L+ +PL Y A+++H A+++VN+ Y+RSF++F A  +  A    L
Sbjct  293   FGNLVLWAFPRATVRELVSQPLEYVAEVVHAAIAQVNDMYVRSFVNFDALVEKEARWSEL  352

Query  1129  VPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGS  1308
             VPTA+++  + CPNLE +SWLR PF ++DFG+G P +FMP++FP EG+M ++P+  G G 
Sbjct  353   VPTAEVESTVYCPNLEANSWLRLPFGEMDFGSGGPDVFMPSYFPLEGVMVIVPAIHGKGG  412

Query  1309  IDAFIPLFQDNLPTFKQICYSLD  1377
              D ++ L + N+  F+ IC+++D
Sbjct  413   TDVYLSLLESNMDVFQDICHTID  435



>ref|XP_006838769.1| hypothetical protein AMTR_s00002p00257440 [Amborella trichopoda]
 gb|ERN01338.1| hypothetical protein AMTR_s00002p00257440 [Amborella trichopoda]
Length=444

 Score =   458 bits (1178),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 225/449 (50%), Positives = 297/449 (66%), Gaps = 14/449 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRP-PTPPNSTIELG  234
             M+V+ ES+R IKP YE  PP  T  VPLS FD V+Y+A  AVI+A+       N  +   
Sbjct  1     MEVREESSRLIKPLYESEPPSLTESVPLSAFDMVTYNASEAVIFAFESMEAVGNHVVVEA  60

Query  235   LRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
             L K L  +R WAGR G D EG   +LLND GV  VE +   TL +  P  P+ +LL+LHP
Sbjct  61    LEKVLAEFRVWAGRFGRDSEGRRAILLNDAGVHLVEVTVGFTLHQAFPTAPTPALLHLHP  120

Query  415   SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRD  594
             S  G  EL+QVQ+TRF+CG L VG T HH VADG S   F  +W +  R + +   PL D
Sbjct  121   SADGTEELLQVQLTRFSCGGLAVGLTCHHFVADGTSAMAFFTSWSRVARGLPLLQHPLHD  180

Query  595   RTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDA--------TFLDDIVVHKVHFT  750
             RTIF+PR  PR  ++H+G EYM  +++   H  NS D         + +  +VVH+ HF+
Sbjct  181   RTIFMPRESPRCPFEHLGVEYM--RLRSTSHKTNSVDIRPLPPPRDSIVQGLVVHRTHFS  238

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              EFLA LKAKAS  N   +PYSTF  L+AH+WR +TKAR + G  TT +RISVDGRARL 
Sbjct  239   CEFLAMLKAKASICNPD-KPYSTFTCLIAHVWRVVTKARGIEGPVTTSVRISVDGRARLK  297

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P VP +YFGN++LWAFP A+  +LL+EPL +AAKL++DAV  ++N Y RSFIDF  +K+ 
Sbjct  298   PAVPREYFGNVILWAFPQAQAGELLKEPLHFAAKLVYDAVKSLDNEYFRSFIDF--TKMN  355

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
                +GLVP+A+M++ +LCPNLEVD WL  PFY+ DFG G P IFMP++ P EG + +LPS
Sbjct  356   EGGEGLVPSAEMEQLVLCPNLEVDCWLNLPFYEFDFGRGPPSIFMPSWLPYEGFILVLPS  415

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
                DG +D  +PL ++N+  FK+IC+S+D
Sbjct  416   RGRDGGVDVLVPLLENNMTIFKEICFSMD  444



>ref|NP_001147611.1| agmatine coumaroyltransferase [Zea mays]
 gb|ACG28075.1| agmatine coumaroyltransferase [Zea mays]
Length=447

 Score =   458 bits (1178),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 243/452 (54%), Positives = 316/452 (70%), Gaps = 18/452 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPL--TTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV S++ +KPSY    PL  TT HVP SVFD+ +Y+ Q+A+IYA+ PP P    IE 
Sbjct  1     MEVKVLSSKLVKPSYPAGAPLPDTTEHVPSSVFDRATYNMQMAIIYAFSPPGPSPGAIER  60

Query  232   GLRKALGVYREWAG--RLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             GL   LG YR +AG  R G D  G P VLLND G + VEAS D  L  + P KPS ++L 
Sbjct  61    GLAAVLGAYRLFAGQVRAGPDGGGAPGVLLNDHGARLVEASVDARLADIAPTKPSPAVLR  120

Query  406   LHPSLKG-VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQ  576
             LHP L G + E+VQVQ+TRF CGSL VGFTA+H VADGH+TS+FLVAWG+A R +     
Sbjct  121   LHPDLDGDIQEVVQVQLTRFACGSLAVGFTANHAVADGHATSDFLVAWGRAARGLGPSSS  180

Query  577   PLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDA---TFLDDIVVHKVHF  747
             P+P+    +F PR+PPR +++H G EY         H      A   T    +V+HK HF
Sbjct  181   PVPVHRPGLFPPRHPPRADFEHRGVEYYRPAPPSPAHAHPPAAAHGDTRHSVVVIHKAHF  240

Query  748   TLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLG--GFETTHIRISVDGRA  921
             T +F+A L+A+AS   G  RP+S FE+++AH+WRA+T+AR LG    +T+ +RISVDGR 
Sbjct  241   TKDFVAGLRARAS--EGRGRPFSRFETILAHVWRAVTRARGLGVDPLQTSTVRISVDGRP  298

Query  922   RLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANS  1101
             RL    P  YFGNLVLWAFP A V DLL  PL +AA+ IHDAV++V+  Y +SF+D+A+S
Sbjct  299   RL--AAPAGYFGNLVLWAFPRATVGDLLSRPLKHAAQAIHDAVARVDGAYFQSFVDWASS  356

Query  1102  KVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFL  1281
               V +++GL  TA + K +LCP+LEVDSWL FPFY+LDFGTG P  FMP++FPTEGM+FL
Sbjct  357   GAV-DKEGLQTTAVL-KDVLCPDLEVDSWLTFPFYELDFGTGSPTYFMPSYFPTEGMLFL  414

Query  1282  LPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             +PS++GDGS+DAF+PLF+ NL  FKQ CYS++
Sbjct  415   VPSYLGDGSVDAFVPLFEHNLEAFKQCCYSME  446



>ref|XP_006838764.1| hypothetical protein AMTR_s00002p00256740 [Amborella trichopoda]
 gb|ERN01333.1| hypothetical protein AMTR_s00002p00256740 [Amborella trichopoda]
Length=437

 Score =   457 bits (1175),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 218/445 (49%), Positives = 308/445 (69%), Gaps = 13/445 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNP----PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTI  225
             MK++ +S+R + PSYE         +TT VPLS FD+ + +A +A+IYAY+ PTPPNS +
Sbjct  1     MKIQKQSSRLVTPSYETKSYSYLSTSTTTVPLSPFDRAAGNAHMAIIYAYKAPTPPNSAL  60

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             E+GLR  L  YREWAGRL +D      ++LND+GV+FVEA+   TL++  PFK +  L  
Sbjct  61    EIGLRLVLADYREWAGRLTDDRRA---IVLNDKGVRFVEATASCTLEEATPFKSTRQLWA  117

Query  406   LHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
             LHPS+KG+ EL+QVQ+TRFTCGSLV+G+T +HLVADG +T  FL AWG+A R +   P+ 
Sbjct  118   LHPSMKGIEELMQVQLTRFTCGSLVIGYTTNHLVADGEATGRFLAAWGQATRGLSDYPVA  177

Query  586   LRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLA  765
             + DR +  PR+P  IE+DH G EYM K + K+  +        + D+ +HK HF+ +FLA
Sbjct  178   IHDRVMLKPRDPLSIEFDHSGNEYMGKTLVKDVPW-----EKMVSDVRLHKAHFSPDFLA  232

Query  766   KLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPN  945
             KLKA+ S      R YSTFE LVAHLWR +T+AR +   ET+ +RI V+ R RL P +P+
Sbjct  233   KLKARVSVRCLPGRGYSTFECLVAHLWRKVTRARGVPATETSQLRIPVNVRGRLVPPIPH  292

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANS-KVVAEED  1122
             +YFGN+VLWAFP   V+DLL EPL++ A+ +  A+++VN+ Y+RSF+DF    ++    +
Sbjct  293   EYFGNMVLWAFPRVTVRDLLGEPLNHVAEWVRAAIAQVNDRYVRSFVDFDTCVEIEGLWN  352

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
              LVPTA++D  + CPN+EV+SWLR PF D+DFG+G P +FMP+ FP EG+M ++PS    
Sbjct  353   ELVPTAEVDSTVFCPNMEVNSWLRLPFQDVDFGSGGPDLFMPSCFPLEGVMVIVPSAHEK  412

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             G I+ ++ LF+ N   F++IC S+D
Sbjct  413   GGIEVYLSLFEANKAAFQRICQSID  437



>ref|XP_008653003.1| PREDICTED: agmatine coumaroyltransferase-2-like [Zea mays]
 tpg|DAA62503.1| TPA: hypothetical protein ZEAMMB73_649594 [Zea mays]
Length=444

 Score =   457 bits (1176),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 237/451 (53%), Positives = 317/451 (70%), Gaps = 18/451 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYE---GNPPLTTT--HVPLSVFDKVSYDAQIAVIYAYRPPTPPNST  222
             M+VKV S++ +KP+Y    G  P  +   + PL++FD V+Y  Q+A+IYA+ PP P  + 
Sbjct  1     MEVKVLSSKLVKPAYNAGAGPAPAVSADEYTPLTIFDVVTYKMQMAIIYAFPPPAPSTAA  60

Query  223   IELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLL  402
             IE GL   L  YR +AG+LG   +G P VLLND G + VEA+ D  L  + P KP+  LL
Sbjct  61    IENGLAAVLAEYRAFAGQLGVAPDGTPAVLLNDRGARLVEAAVDADLVDMAPAKPTPELL  120

Query  403   NLHP--SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--M  570
              LHP    + + E+V +Q+TRF CGSL VGFT++H+VADGH+TSNFLVAWG+A R +   
Sbjct  121   RLHPDLEEEELQEVVLLQLTRFRCGSLAVGFTSNHVVADGHATSNFLVAWGRATRGLPTG  180

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAE-YMPKQIK-KNDHFLNSNDATFLDDIVVHKVH  744
             + P+P R   +F PR  PR+++DH   E Y+P   + +  H      A   + IV+ K H
Sbjct  181   LPPVP-RQAGLFKPRPSPRVDFDHRSREWYLPSPAETEKQHGHGREGAAAAESIVIQKAH  239

Query  745   FTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRAR  924
             FT +F+A+L+AKAS   G  RP+S FE+++AHLWRA+T+AR L   ET+ IR+SVDGR R
Sbjct  240   FTKDFIARLRAKAS--EGRGRPFSRFETVLAHLWRAMTRARGLSPDETSQIRLSVDGRHR  297

Query  925   LNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSK  1104
             L   +P +YFGNLVLWAFPTA V DLL  PL +AA++IHD V+ V+ +Y RSFIDFA S 
Sbjct  298   LG--LPAEYFGNLVLWAFPTATVADLLGRPLKHAAQVIHDEVASVDGSYFRSFIDFATSG  355

Query  1105  VVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLL  1284
               AE +GL P+A + K +LCPN+EVDSWL FPFY+LDFGTG P  FMP++FPTEGM+FL+
Sbjct  356   A-AEREGLAPSA-VCKDVLCPNVEVDSWLTFPFYELDFGTGSPTYFMPSYFPTEGMLFLV  413

Query  1285  PSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             PS+IGDGS+DAF+P+FQ NL  FK+ CY++D
Sbjct  414   PSYIGDGSVDAFVPVFQQNLEAFKECCYAMD  444



>ref|NP_001063829.1| Os09g0544000 [Oryza sativa Japonica Group]
 dbj|BAC79155.1| putative anthranilate N-benzoyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF25743.1| Os09g0544000 [Oryza sativa Japonica Group]
 gb|EAZ09944.1| hypothetical protein OsI_32243 [Oryza sativa Indica Group]
 gb|EAZ45541.1| hypothetical protein OsJ_30201 [Oryza sativa Japonica Group]
Length=452

 Score =   454 bits (1168),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 239/463 (52%), Positives = 316/463 (68%), Gaps = 34/463 (7%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTH-VPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELG  234
             M+VKV S+R ++PSY  +        VP S+FDKV+YD Q+A+IYA+RPP P  + IE G
Sbjct  1     MEVKVLSSRLVRPSYPASAAAPEEEFVPSSMFDKVTYDMQMAIIYAFRPPGPSVADIEKG  60

Query  235   LRKALGVYREWAGRL----GNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLL  402
             L   LGVYR +AG++    G +  G   V+LND G + VEA  D +L  + P KPS  +L
Sbjct  61    LAAVLGVYRLFAGQVVRGGGGELRG---VVLNDHGARLVEACVDGSLADIAPAKPSPVVL  117

Query  403   NLHPSLKGVVE-LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQP  579
              LHPSL+G +E +VQVQ+TRF CGSL VGFTA+H VADGH+TS+FLVAWG+A R + +  
Sbjct  118   RLHPSLEGEIEEVVQVQLTRFACGSLAVGFTANHAVADGHATSDFLVAWGRAARGLAVAA  177

Query  580   LPLRDRT----IFIPRNPPRIEYDHVGAEYM---PKQI---------KKNDHFLNSNDAT  711
                        +F PR+PP +E++H G EY    P             K  H     +A+
Sbjct  178   TAAAPPHHHPGMFRPRDPPLVEFEHRGVEYYRPPPPAAGVDGDVGGDHKQQHGHGGEEAS  237

Query  712   FLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGG-FET  888
                 IV+HK HFT +F+A+L+A AS   G  RP+S FE+++AH+WR +T+AR LG   ++
Sbjct  238   --HGIVIHKAHFTKDFIARLRAAAS--EGRGRPFSRFETILAHVWRTMTRARGLGNPLQS  293

Query  889   THIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNN  1068
             + IRISVDGR RL+   P  YFGNLVLWAFP A V DLL  PL +AA++IHDAV++ +  
Sbjct  294   STIRISVDGRQRLS--APAGYFGNLVLWAFPRATVGDLLGRPLKHAAQVIHDAVARADAA  351

Query  1069  YIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMP  1248
             Y RSF+DFA+S  V E +GL PTA + K +LCP+LEVDSWL FPFY+LDFG GCP  FMP
Sbjct  352   YFRSFVDFASSGAV-EGEGLAPTAVL-KDVLCPDLEVDSWLTFPFYELDFGGGCPTYFMP  409

Query  1249  TFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             ++FPTEGM+FL+PS++GDGS+DAF+P+F  NL  FKQ CYS++
Sbjct  410   SYFPTEGMLFLVPSYLGDGSVDAFVPVFDHNLEAFKQSCYSIE  452



>ref|XP_006660921.1| PREDICTED: agmatine coumaroyltransferase-2-like [Oryza brachyantha]
Length=432

 Score =   453 bits (1165),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 235/443 (53%), Positives = 312/443 (70%), Gaps = 14/443 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M+VKV S++ +KP+Y G   + T ++PLSVFDKV+Y  Q+A+IYA+ PP P  + IE GL
Sbjct  1     MEVKVLSSKLVKPAYNGGVAVETEYIPLSVFDKVTYRMQMAIIYAFPPPAPSPAAIEKGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
                L  YR +AG+LG   +G P V+LND G + VEA+ D  L  + P KP+  LL LHP 
Sbjct  61    AAVLAEYRAFAGQLGESPDGEPAVVLNDRGARLVEATVDADLVDMAPAKPTPELLRLHPD  120

Query  418   LKG-VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRD  594
             L+  + E+V +Q+TRF CGSL VGFT++H+VADGH+TSNFLVAWG+A R +     P+  
Sbjct  121   LEEELQEVVLLQLTRFRCGSLAVGFTSNHVVADGHATSNFLVAWGRATRGLPTGLQPVHH  180

Query  595   RT-IFIPRNPPRIEYDHVGAEY-MPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAK  768
                +F PR+ PR+EYDH   EY +P    K+ H   S+     D+IV+HK HFT +F+A 
Sbjct  181   HAGLFKPRSSPRVEYDHRNREYYLPAAGDKHGH---SDGGA--DNIVIHKAHFTKDFIAG  235

Query  769   LKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPND  948
             L+AKAS   G  RP+S FE+++AHLWR +  AR LG  ET+ IR+SVDGR RL   VP +
Sbjct  236   LRAKAS--EGRGRPFSRFETILAHLWRTMACARGLGPDETSTIRLSVDGRHRLG--VPAE  291

Query  949   YFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGL  1128
             YFGN+VLWAFP A   DLL  PL +AA+ IHD V++V+  Y RSF  FA S   A+E GL
Sbjct  292   YFGNMVLWAFPRATASDLLTRPLKHAAQAIHDEVARVDGAYFRSFGAFARSGAAAKE-GL  350

Query  1129  VPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGS  1308
              P+A + K +LCP++EVDSWL FPFY+LDFGTG P  FMP++FPTEGM+FL+PS++GDGS
Sbjct  351   APSAVL-KDVLCPDVEVDSWLTFPFYELDFGTGSPTYFMPSYFPTEGMLFLVPSYLGDGS  409

Query  1309  IDAFIPLFQDNLPTFKQICYSLD  1377
             +DAF+P+F  NL  FK+ CYS++
Sbjct  410   VDAFVPVFTHNLDAFKECCYSME  432



>gb|EAY91421.1| hypothetical protein OsI_13046 [Oryza sativa Indica Group]
Length=462

 Score =   454 bits (1167),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 238/463 (51%), Positives = 315/463 (68%), Gaps = 26/463 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MKVKVES+R +KP Y+   P     +PLSVFD  +YD  IA+IYA+RPP PP++ +ELGL
Sbjct  1     MKVKVESSRIVKPLYDAAAP-APEWMPLSVFDTATYDESIAIIYAFRPPNPPSAAMELGL  59

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPF----KPSVSLLN  405
              + L VYREWAGRLG   +G   VLL+D G +  EA+ D  L    PF    +PS  +  
Sbjct  60    ARTLAVYREWAGRLGVGPDGRRSVLLSDAGARLDEAAVDAPLAAAAPFIISRRPSPEVKR  119

Query  406   LHPSLKGV---VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQ  576
             LHPS+ G     EL++VQVTRF+CGS+V+G  AHH VADG +T+ FLVAWG A R   + 
Sbjct  120   LHPSVDGAPAEEELLRVQVTRFSCGSMVLGVAAHHRVADGQATAGFLVAWGLATRRGGLL  179

Query  577   P---LPLRDR-TIFIPRNPPRIEYDHVGAEYM----PKQIKKN-----DHFLNSNDATFL  717
             P   +P+RDR T F+PR+PP +E+ H   EY     P +IK       D       A   
Sbjct  180   PAVGVPVRDRATRFVPRDPPLVEFPHRETEYKAPPPPAKIKSGVAGEDDDDDELGAAPAH  239

Query  718   DDIVVHKVHFTLEFLAKLKAKASAM---NGGARPYSTFESLVAHLWRAITKARNLGGFET  888
             D I +HKVH+T +F+A+LK++AS+    +   R Y+TFESLVAHLWRA+T AR LG   T
Sbjct  240   DKIKMHKVHYTKDFVARLKSRASSGLPPSRRGRGYTTFESLVAHLWRAVTAARGLGAAAT  299

Query  889   T-HIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNN  1065
             T  +RI+V+GRAR+ P VP DYFGNLVLWAFP     +L+  P  +AA+LIH AV+ +++
Sbjct  300   TTRVRIAVNGRARMRPPVPRDYFGNLVLWAFPRCDAGELVARPSHHAAELIHRAVAGIDD  359

Query  1066  NYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFM  1245
              Y RSF+DFA+S  V E +GLVPTAD  + ++CP++EVDSWL   FYDLDFG GCP  FM
Sbjct  360   AYFRSFVDFASSGAV-EAEGLVPTADAGEVVVCPDMEVDSWLGMSFYDLDFGGGCPLYFM  418

Query  1246  PTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             P++   EG +FL+PSF+GDGSID ++PLF+++L  FK+ICY++
Sbjct  419   PSYLAMEGTIFLVPSFLGDGSIDVYVPLFENHLEEFKKICYNI  461



>gb|AAP68378.1| putative hydroxycinnamoyl transferase [Oryza sativa Japonica 
Group]
 gb|ABF98229.1| Transferase family protein [Oryza sativa Japonica Group]
Length=462

 Score =   454 bits (1167),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 238/463 (51%), Positives = 315/463 (68%), Gaps = 26/463 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MKVKVES+R +KP Y+   P     +PLSVFD  +YD  IA+IYA+RPP PP++ +ELGL
Sbjct  1     MKVKVESSRIVKPLYDAAAP-APEWMPLSVFDTATYDESIAIIYAFRPPNPPSAAMELGL  59

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPF----KPSVSLLN  405
              + L VYREWAGRLG   +G   VLL+D G +  EA+ D  L    PF    +PS  +  
Sbjct  60    ARTLAVYREWAGRLGVGPDGRRSVLLSDAGARLDEAAVDAPLAAAAPFIIRRRPSPEVKR  119

Query  406   LHPSLKGV---VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQ  576
             LHPS+ G     EL++VQVTRF+CGS+V+G  AHH VADG +T+ FLVAWG A R   + 
Sbjct  120   LHPSVDGAPAEEELLRVQVTRFSCGSMVLGVAAHHRVADGQATAGFLVAWGLATRRGGLL  179

Query  577   P---LPLRDR-TIFIPRNPPRIEYDHVGAEYM----PKQIKKN-----DHFLNSNDATFL  717
             P   +P+RDR T F+PR+PP +E+ H   EY     P +IK       D       A   
Sbjct  180   PAVGVPVRDRATRFVPRDPPLVEFPHRETEYKAPPPPAKIKSGVAGEDDDDDELGAAPAH  239

Query  718   DDIVVHKVHFTLEFLAKLKAKASAM---NGGARPYSTFESLVAHLWRAITKARNLGGFET  888
             D I +HKVH+T +F+A+LK++AS+    +   R Y+TFESLVAHLWRA+T AR LG   T
Sbjct  240   DKIKMHKVHYTKDFVARLKSRASSGLPPSRRGRGYTTFESLVAHLWRAVTAARGLGAAAT  299

Query  889   T-HIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNN  1065
             T  +RI+V+GRAR+ P VP DYFGNLVLWAFP     +L+  P  +AA+LIH AV+ +++
Sbjct  300   TTRVRIAVNGRARMRPPVPRDYFGNLVLWAFPRCDAGELVARPSHHAAELIHRAVAGIDD  359

Query  1066  NYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFM  1245
              Y RSF+DFA+S  V E +GLVPTAD  + ++CP++EVDSWL   FYDLDFG GCP  FM
Sbjct  360   AYFRSFVDFASSGAV-EAEGLVPTADAGEVVVCPDMEVDSWLGMSFYDLDFGGGCPLYFM  418

Query  1246  PTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             P++   EG +FL+PSF+GDGSID ++PLF+++L  FK+ICY++
Sbjct  419   PSYLAMEGTIFLVPSFLGDGSIDVYVPLFENHLEEFKKICYNI  461



>gb|EMT15624.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=434

 Score =   451 bits (1161),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 230/445 (52%), Positives = 311/445 (70%), Gaps = 16/445 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV  ++ +KP+Y     P  +T ++PLS+FDKV+++ Q+A+IYA+  P P  + IE 
Sbjct  1     MEVKVLGSKLVKPAYNAGAAPAPSTEYIPLSIFDKVTFNMQMAIIYAFAAPAPSTAAIEN  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL   L  YR +AG+LG   +G P  +LND G + VEA+ D  L  + P KP+  LL LH
Sbjct  61    GLATVLAQYRAFAGQLGEAPDGTPSFILNDRGARLVEATVDAVLIDMAPAKPTPELLKLH  120

Query  412   PSLKGV-VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV-MIQPLP  585
             P L+    E+V +Q+TRF CGSL VGFT++H+VADGH+TSNFLVAWG+  R + M  P  
Sbjct  121   PDLEAEHEEVVLLQLTRFRCGSLAVGFTSNHVVADGHATSNFLVAWGRGTRGLPMGLPPV  180

Query  586   LRDRTIFIPRNPPRIEYDHVGAEY-MPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
                + +F PR+ PR+E+DH   EY +P       H    +DA   D+IV+HK HFT +F+
Sbjct  181   HHHKDLFKPRSSPRVEHDHRNREYYLPSPTDVVGH---HSDAA--DNIVIHKAHFTKDFI  235

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
             A L+AKAS   G  RP+S FE+++AHLWR +T+AR+L   ETT IR+SVDGR RL    P
Sbjct  236   AGLRAKAS--EGRGRPFSRFETILAHLWRTMTRARDLSPEETTKIRLSVDGRHRLGQ--P  291

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
              +YFGN+VLWAFP + V DLL  PL +AA++IHD V+KV+  Y +SF+DFA+S   AE++
Sbjct  292   AEYFGNMVLWAFPRSTVGDLLNRPLKHAAQVIHDEVAKVDGAYFQSFVDFASSGA-AEKE  350

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
             GL  +A + K   CP++EVDSWL FPFY+LDFGTG P  FMP +FPTEGM+FL+PS  GD
Sbjct  351   GLARSA-VCKDAQCPDVEVDSWLTFPFYELDFGTGSPSYFMPAYFPTEGMLFLVPSNFGD  409

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             GS+DAF+PLFQ+NL  FK+ CYS++
Sbjct  410   GSVDAFVPLFQENLQAFKECCYSME  434



>ref|XP_004958859.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=494

 Score =   441 bits (1135),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 219/440 (50%), Positives = 299/440 (68%), Gaps = 12/440 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MK+ V S++ +KP+    P      VPLSVFDKV++D  ++VIY +RPPTPPN+ +E GL
Sbjct  1     MKITVNSSKAVKPATADAP--RPDVVPLSVFDKVNFDTYVSVIYVFRPPTPPNAALEAGL  58

Query  238   RKALGVYREWAGRLGNDEEGN-PVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
              +AL  Y EWAGRLG D  GN  ++LLN EG + VEA+ D  LD V+P  P+  + +LHP
Sbjct  59    ARALAEYPEWAGRLGVDGRGNRAILLLNGEGARLVEATADVALDSVLPLSPAPEVRSLHP  118

Query  415   SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRD  594
             S  G  E++ +Q+TRF CG L VGFTAHHLV+DG +T+NF +AW +A R V + P+P+ D
Sbjct  119   SEDGAEEVMLIQLTRFACGGLAVGFTAHHLVSDGRATNNFFLAWSQATRGVPVDPVPVHD  178

Query  595   R-TIFIPRNPPRIEYDHVGAEY-MPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAK  768
             R + F PR+PPR+E+DH G E+  P+      H    N+    D+++VHK HF+ EF+A+
Sbjct  179   RASFFKPRDPPRVEFDHSGVEFKKPEPAAAPLHSEAGNNVN--DEVLVHKAHFSREFIAR  236

Query  769   LKAKASAMNGGARPYSTFESLVAHLWRAITKARNL--GGFETTHIRISVDGRARLNPKVP  942
             LK++AS   G  RP ST   +VAHLWR IT AR L   G  TT + I+VDGRAR+   VP
Sbjct  237   LKSQASPPGG--RPCSTLRCVVAHLWRCITAARGLHAAGAATTSVCIAVDGRARMIHPVP  294

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
             + Y GN+VLWA PTA  +DL+  PL +A +LI+  +++V+ +Y  SF+DFA S  V E +
Sbjct  295   DGYTGNVVLWARPTAAARDLVARPLRHAVELINRELARVDGSYFGSFVDFATSGAV-EAE  353

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
             GLVP AD  + +L PN+EVDSWLR PFYDLDFG   P  FMP++ P EG++ L+PS+  D
Sbjct  354   GLVPVADAAEMVLSPNIEVDSWLRIPFYDLDFGGSRPCFFMPSYLPVEGLLILVPSYYRD  413

Query  1303  GSIDAFIPLFQDNLPTFKQI  1362
             GSIDA++ LF  ++  FK +
Sbjct  414   GSIDAYVTLFSRHMDAFKTL  433



>gb|EMT13704.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=431

 Score =   436 bits (1120),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 227/445 (51%), Positives = 306/445 (69%), Gaps = 19/445 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSY-EGNPPL-TTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MKVKV S+R +KP+Y  G  P+  T ++PLS+FDKV+++ Q+A+IYA+ PP P  ++IE 
Sbjct  1     MKVKVLSSRLVKPAYTAGEAPVPATEYIPLSIFDKVTFEMQMAIIYAFAPPAPTTASIEK  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL   L  YR +AG+LG   +G P V+LND G + +EAS D  L  + P KP+  LL LH
Sbjct  61    GLALVLAQYRAFAGQLGESPDGTPSVILNDRGARLIEASVDADLVDMAPSKPTPELLKLH  120

Query  412   PSLKGV-VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV-MIQPLP  585
             P L+    E+V +Q+TRF CGSL VGFT++H+VADGH+TSNFLVAWG+A R + M  P  
Sbjct  121   PDLEAEHQEVVLLQLTRFRCGSLAVGFTSNHVVADGHATSNFLVAWGRATRGLPMGLPPV  180

Query  586   LRDRTIFIPRNPPRIEYDHVGAEY-MPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
                + +F PR+ PR+E++H   EY +P       H     DA   D+IV+HK HFT +F+
Sbjct  181   HHQKDLFKPRSSPRVEHEHRNREYYLPSPTDVVGHH---GDAA--DNIVIHKAHFTKDFI  235

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
             A L+AKAS   G  RP+S FE+++AHLWR +T+AR+L   ET+ IR+SVDGR RL     
Sbjct  236   AGLRAKAS--EGRGRPFSRFETILAHLWRTMTRARDLSPEETSKIRLSVDGRHRLRAGG-  292

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
                    V WA P + V DLL  PL +AA++IHD V++V+  Y +SF+DFA+S   AE++
Sbjct  293   ----RGCVRWASPRSAVGDLLNRPLKHAAQVIHDEVARVDGAYFQSFVDFASSGA-AEKE  347

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
             GL  +A + K   CP++EVDSWL FPFY+LDFGTG P  FMP +FPTEGM+FL PS  GD
Sbjct  348   GLARSA-VCKDAHCPDVEVDSWLTFPFYELDFGTGSPSYFMPAYFPTEGMLFLAPSNFGD  406

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             GS+DAF+PLFQ+NL  FK+ CYS++
Sbjct  407   GSVDAFVPLFQENLQAFKECCYSME  431



>dbj|BAK03392.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   435 bits (1119),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 231/445 (52%), Positives = 311/445 (70%), Gaps = 16/445 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV S++ +KP+Y     P  +T ++PLS+FDKV+++ Q+A+IYA+ PP P  + IE 
Sbjct  1     MEVKVLSSKLVKPAYNAGATPAPSTEYIPLSIFDKVTFNMQMAIIYAFAPPAPSPAAIEK  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL   L  YR +AG+LG   +G P V+LND G + VEA+ D  L  + P KP+  LL LH
Sbjct  61    GLAAVLAQYRAFAGQLGEAPDGTPSVILNDRGARLVEATVDADLVDMAPAKPTPELLKLH  120

Query  412   PSLKGV-VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV-MIQPLP  585
             P L+    E+V +Q+TRF CGSL VGFT++H+VADGH+TSNFLVAWG+A R + M  P  
Sbjct  121   PDLEAEHEEVVLLQLTRFRCGSLAVGFTSNHVVADGHATSNFLVAWGRATRGLPMGLPPV  180

Query  586   LRDRTIFIPRNPPRIEYDHVGAEY-MPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
                + +F PR  PR+E+DH   EY +P       H     DA   D+IV+HK HF+ +F+
Sbjct  181   HHHKDLFKPRPSPRVEHDHRNREYYLPSPTDVVGH---HGDAA--DNIVIHKAHFSKDFI  235

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
             A L+AKAS   G  RP+S FE+++AHLWR +T+AR+L   ET+ IR+SVDGR RL    P
Sbjct  236   AGLRAKAS--EGRGRPFSRFETILAHLWRTMTRARDLSPEETSKIRLSVDGRHRLGQ--P  291

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
              +YFGN+VLWAFP A V D L  PL +AA++IHD V+KV+  Y +SF+DFA S   AE++
Sbjct  292   AEYFGNMVLWAFPRATVGDPLNRPLKHAAQVIHDEVAKVDGAYFQSFVDFACSGA-AEKE  350

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
             GL  +A + K   CP++EVDSWL FPFY+L+FGTG P  FMP +FPTEGM+FL+PS  GD
Sbjct  351   GLARSA-VCKDAQCPDVEVDSWLTFPFYELNFGTGSPSYFMPAYFPTEGMLFLVPSNFGD  409

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             GS+DAF+PLFQ+NL  FK+ CYS++
Sbjct  410   GSVDAFVPLFQENLQAFKECCYSME  434



>ref|XP_003580760.1| PREDICTED: agmatine coumaroyltransferase-1-like [Brachypodium 
distachyon]
Length=451

 Score =   436 bits (1120),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 220/458 (48%), Positives = 309/458 (67%), Gaps = 25/458 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNP-PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELG  234
             MK+ V S++ +KP Y   P P T   +PL+V DK ++D  I+VIYA+ PP+PPN+T+E G
Sbjct  1     MKITVHSSKAVKPDYGSRPAPGTDEVIPLTVLDKANFDCYISVIYAFHPPSPPNTTLEAG  60

Query  235   LRKALGVYREWAGRL----GNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLL  402
             L K L  YREWAGRL    G    G   ++LND G +FVEA+ D  LD VMP +P+  +L
Sbjct  61    LAKCLAEYREWAGRLTLAPGAHGRG---IVLNDAGARFVEATADVALDSVMPLEPTPDVL  117

Query  403   NLHPSL----KGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
              LHP +    +   EL+ +QVTRF CGS+ VGFT  H+V+DG +T NF VAW +A R V 
Sbjct  118   ALHPCVGEEDEPEPELMLIQVTRFACGSITVGFTTQHIVSDGRATGNFFVAWSQATRGVP  177

Query  571   IQPLPLRDRTIFIPRNP---PRIEYDHVGAEYMPKQIKKNDH--FLNSNDATFLDDIVVH  735
             + P+P+ DR  F   +    P++++ H G ++ P  +   D+   +  +D    D++VV 
Sbjct  178   LDPVPVHDRASFFSPSSTLVPKVQHQHRGVDFKPANLDNGDNGTAVREDDE---DEVVVS  234

Query  736   KVHFTLEFLAKLKAKASAMNGG-ARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVD  912
             KVHF+ +F++KLK++ASA  G   RPYST + LVAHLWR ITKAR L   E T + I+VD
Sbjct  235   KVHFSRDFISKLKSEASASAGHHQRPYSTLQCLVAHLWRRITKARGLLPHEPTSVSIAVD  294

Query  913   GRARLNP--KVPNDYFGNLVLWAFPTAKVKDLLR-EPLSYAAKLIHDAVSKVNNNYIRSF  1083
             GRAR++   ++P  Y GN+VLWA PT   +DL+   PL +A +LI+ AVS++++ Y RSF
Sbjct  295   GRARIHTPRQIPEGYTGNVVLWARPTCTAQDLVESRPLGHAVELINKAVSRIDDGYFRSF  354

Query  1084  IDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPT  1263
             +DFA S  V E++ LVP AD  + +L PN+EVDSWLR PFYD+DFG G P+ FMP++ P 
Sbjct  355   VDFAGSGAV-EKERLVPAADAKEMVLSPNIEVDSWLRMPFYDVDFGAGRPFFFMPSYLPV  413

Query  1264  EGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             EG++ LLPSF+GDGS+DA++PLF  ++ TFK  C++L+
Sbjct  414   EGLLILLPSFLGDGSVDAYVPLFGRHVDTFKNSCHTLE  451



>ref|XP_002446382.1| hypothetical protein SORBIDRAFT_06g015030 [Sorghum bicolor]
 gb|EES10710.1| hypothetical protein SORBIDRAFT_06g015030 [Sorghum bicolor]
Length=458

 Score =   434 bits (1115),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 238/461 (52%), Positives = 308/461 (67%), Gaps = 24/461 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYE-GNP-PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV S+R +KPSY  G P P TT HVP SVFDK++Y  Q+A+IYA+ PP P  + IE 
Sbjct  1     MEVKVMSSRLVKPSYPPGVPQPDTTEHVPCSVFDKITYHIQMAIIYAFSPPVPSIADIEH  60

Query  232   GLRKALGVYREWAGRLG-NDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
             GL   LGVYR +AG++     +G   VLLND G + +EAS D  L  V P KPS  +  L
Sbjct  61    GLAAVLGVYRAFAGQVRPGPADGELGVLLNDHGARLIEASVDARLADVAPAKPSPDVQLL  120

Query  409   HPSLKG--VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQ-P  579
             HP L    + E+VQVQ+TRF CGSL+VGFTA+H VADG +TSNFLVAWG+  R V I  P
Sbjct  121   HPGLHDAEIEEVVQVQLTRFGCGSLMVGFTANHAVADGRATSNFLVAWGRTVRGVPIGLP  180

Query  580   LPLRDR-TIFIPRNPPRIEYDHVGAEY-----MPKQIKKNDHFLNSNDA---TFLDDIVV  732
              PL     +F  R+PPR E++H G E+      P        FL +      T   DIV+
Sbjct  181   PPLHHHPGLFRLRDPPRFEFEHRGVEFHDRRPTPTTPAAASSFLTAAHGETKTTRHDIVI  240

Query  733   HKVHFTLEFLAKLKAKAS-AMNGGARPYSTFESLVAHLWRAITKARNLGG-----FETTH  894
             HK HFT EF+A L+AKAS         +S FE++V H+WRA+T+AR LG       + + 
Sbjct  241   HKAHFTKEFIAALRAKASEGRRHHHHHFSRFETIVGHVWRAMTRARGLGDGGGDPCQASA  300

Query  895   IRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYI  1074
             IR+SVDGR RL   VP  YFGNLVLWAFP   V +LL +PL++AA++IHDAV +V++ Y 
Sbjct  301   IRLSVDGRPRLG--VPEAYFGNLVLWAFPRTTVGNLLTQPLTHAAQVIHDAVKQVDDAYF  358

Query  1075  RSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTF  1254
             +SF+DFA+S VV EE+GL  TA + + +LCP+L+VDSWL FPF +LD GTG P  FMP +
Sbjct  359   QSFVDFASSGVV-EEEGLETTAVLTRDVLCPDLDVDSWLTFPFQELDLGTGGPSYFMPPY  417

Query  1255  FPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
              PTEGM FL+PS +GDGS+DAF+P+F+ +L  FKQ C S++
Sbjct  418   IPTEGMFFLVPSCLGDGSVDAFVPVFKHSLEAFKQCCCSVE  458



>gb|EMS52764.1| Agmatine coumaroyltransferase-2 [Triticum urartu]
Length=451

 Score =   432 bits (1111),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 225/457 (49%), Positives = 305/457 (67%), Gaps = 23/457 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYE--GNPPLTTTHV-PLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MKV V S+R +KP Y   G PP +   V PL+V DK ++DA I+VIYA+RPP PPN+ +E
Sbjct  1     MKVTVLSSRPVKPDYGACGVPPGSAADVVPLTVLDKANFDAYISVIYAFRPPAPPNAVLE  60

Query  229   LGLRKALGVYREWAGRLGNDEE---------GNPVVLLNDEGVKFVEAS---GDTTLDKV  372
              GL KAL  YREWAGRLG D E           P  L+  +  +F   S   G T    V
Sbjct  61    AGLAKALVDYREWAGRLGVDAEVLSLHPSGDDGPEELMLIQVTRFACGSIVVGFTAQHLV  120

Query  373   MPFKPSVSLLNLHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGK  552
                + + +           V +  V VTRF CGS+VVGFTA HLV+DG +TSNF +AW +
Sbjct  121   SDGRATSNFFLAWSQATRGVAVDPVPVTRFACGSIVVGFTAQHLVSDGRATSNFFLAWSQ  180

Query  553   ACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMP-KQIKKNDHFLNSNDATFLDDI  726
             A R V + P+P+ DR + F PR+PP++EY+H G E+ P +++ +ND   ++ D    D +
Sbjct  181   ATRGVAVDPVPVHDRASFFKPRDPPQVEYEHRGVEFKPYEEVDENDDEGHAGDG---DVV  237

Query  727   VVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRIS  906
             VV+KVH +LEF++KLK++AS   G  RPYST   LVAHLWR +TKAR L G  +T + I+
Sbjct  238   VVNKVHLSLEFISKLKSRASV--GAHRPYSTLRCLVAHLWRCVTKARGLDGSVSTSVAIA  295

Query  907   VDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFI  1086
             VDGRAR++P+VP+ Y GN+VLWA PTA  ++L+  PL +A +LI+  V+++N +Y  SFI
Sbjct  296   VDGRARMSPQVPDGYTGNVVLWARPTATAQELVTRPLQHAVELINREVARINGDYFESFI  355

Query  1087  DFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTE  1266
             DFA+S+ V +E  LVPTAD  +  L PN+EVDSWLR PFYDLDFG G P+ FMP++ P E
Sbjct  356   DFASSEAVQKER-LVPTADAAEMALSPNIEVDSWLRIPFYDLDFGGGQPFFFMPSYLPVE  414

Query  1267  GMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             G++ LLPSF GDGS+DA++PLF  ++  FK  CY+L+
Sbjct  415   GLLILLPSFAGDGSVDAYVPLFSRDMDAFKNCCYNLE  451



>dbj|BAJ96183.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92359.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   434 bits (1116),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 225/453 (50%), Positives = 306/453 (68%), Gaps = 23/453 (5%)
 Frame = +1

Query  55    TMKVKVESTRTIKPSYEGNPPLTT--THVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
              ++V+V S++ ++P+   +  +     +VPLSVFD+V+Y  Q+A+IY + PP+P  + +E
Sbjct  104   AIEVQVLSSKLVRPAASTDAAVDAGLEYVPLSVFDRVTYQIQMAIIYVFAPPSPSTAALE  163

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
              GL  AL  YR +AG+LG    G P VLLND G + VEA  D  L  V P  P   LL L
Sbjct  164   KGLAAALARYRGFAGQLGEAPGGGPAVLLNDHGARVVEACVDADLVDVAPPMPKPELLLL  223

Query  409   HPSLK-GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
             HP+L+ G+ E+V +Q+TRF CGSL VGFT++H V DG  TSNFLVAWG+A R V +   P
Sbjct  224   HPNLEEGMDEVVVLQLTRFRCGSLAVGFTSNHAVTDGRGTSNFLVAWGRATRGVDMGLPP  283

Query  586   LRDR-TIFIPRNPPRIEYDHVGAEY------MPKQIKKNDHFLNSNDATFLDDIVVHKVH  744
             + +   +F  R+ PR+E+DH   EY      +P ++  +       D     +IV+HK H
Sbjct  284   VYNHDELFKSRSVPRVEFDHRNREYYMPVPPLPTKVGSD------ADGKIKKNIVIHKAH  337

Query  745   FTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRAR  924
             FT +++A+L+A AS   G  RP+S F+S++AHLWRA T+AR L   ET+ IR+SVDGR R
Sbjct  338   FTKDWIARLRASAS--EGRGRPFSRFQSILAHLWRATTRARGLRHNETSKIRLSVDGRDR  395

Query  925   LNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNN-NYIRSFIDFANS  1101
             L   VP +Y GNLVLWAFP A   DLL  PL YAA+ IHD V++V +  Y RSF+DF +S
Sbjct  396   LG--VPAEYAGNLVLWAFPQATAGDLLNRPLKYAAQTIHDEVARVADAEYFRSFVDFTSS  453

Query  1102  KVVAEEDGLVPTADMD-KHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMF  1278
              V+ EE+GL P+A ++ + +LCP+LEV SWL FPFYDLDFGTG P   MP++FP EG++F
Sbjct  454   GVI-EEEGLAPSAALNLREVLCPDLEVHSWLTFPFYDLDFGTGTPSYIMPSYFPFEGLIF  512

Query  1279  LLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             L+PS+IGDGS+DAF+P+FQ NL  FKQ  YS+D
Sbjct  513   LMPSYIGDGSVDAFVPVFQHNLEAFKQCVYSID  545



>dbj|BAJ97586.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=456

 Score =   430 bits (1106),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 217/444 (49%), Positives = 299/444 (67%), Gaps = 16/444 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN----PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTI  225
             MK+ V+S+++IKP Y G+    PP T   VPLSVFDK + D  ++VIYA+ PP PPN  +
Sbjct  18    MKITVQSSKSIKPDYGGHRPVAPPFTANAVPLSVFDKANLDTHVSVIYAFHPPAPPNDVL  77

Query  226   ELGLRKALGVYREWAGRLGNDEEGN-PVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLL  402
             E GL +AL  YR++AGRL  D +G+   +LLND G +FVEA+   +L  VMP +P+ ++L
Sbjct  78    EAGLARALVEYRQFAGRLARDADGSRSAILLNDAGARFVEATAGVSLGSVMPLQPTPAVL  137

Query  403   NLHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPL  582
             +LHPS  G  EL+ +Q TRF CGSLVVG T HH V DG    NF++AWG+A R   + P+
Sbjct  138   SLHPS--GGDELMLLQATRFACGSLVVGITVHHKVTDGRGFWNFMLAWGQATRGAAVDPV  195

Query  583   PLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEF  759
             P+ DR   F PR+PP IE++H G E+ P   +K+       D      +VV +VHF+ E 
Sbjct  196   PVHDRPACFPPRSPPMIEHEHRGVEFKPHDARKDHDAGGGCDGEV---VVVERVHFSAER  252

Query  760   LAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKV  939
             +A+LKA+ASA   GAR YST + ++AHLW  +T+AR LGG + T + I VDGR R++P V
Sbjct  253   IAELKAQASA---GAR-YSTVQCVLAHLWPCVTRARGLGGRDATALLIGVDGRRRMSPPV  308

Query  940   PNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEE  1119
             P+ Y GN+VLWA PTA   +L+  PL   A+LI  AV++V++ Y RSFIDFA S  V E 
Sbjct  309   PDWYPGNVVLWARPTATAGELVDMPLRRTAELIGRAVARVDDAYCRSFIDFACSGTV-EA  367

Query  1120  DGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIG  1299
             + LVPTAD    +L PN+EV+SW+R P YDLD G G P++FMP++ P EG++FL+PSF+G
Sbjct  368   ERLVPTADAADMVLSPNVEVNSWVRLPHYDLDLGGGRPFLFMPSYVPVEGVVFLVPSFVG  427

Query  1300  DGSIDAFIPLFQDNLPTFKQICYS  1371
               S+DA++ LF+ +   F+  C S
Sbjct  428   GDSVDAYVSLFRRDRDAFRNCCTS  451



>ref|XP_003573713.2| PREDICTED: agmatine coumaroyltransferase-2-like [Brachypodium 
distachyon]
Length=469

 Score =   427 bits (1097),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 237/457 (52%), Positives = 306/457 (67%), Gaps = 23/457 (5%)
 Frame = +1

Query  46    EKKTMKVKVESTRTIKPSYE--GNPPLTTTH-VPLSVFDKVSYDAQIAVIYAYRPPTPPN  216
             +  TM+V++ S++ +KP+ E   N  L     +PLSVFDKV+Y  Q+A+IYA+ PP P  
Sbjct  23    KAATMEVQILSSKLVKPAAEPTNNDTLAEPECIPLSVFDKVTYQIQMAIIYAFAPPAPTT  82

Query  217   STIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEAS-GDTTLDKVMPFKPSV  393
             + +E GL  AL  +R +AG+L   EEG P VLLND G + VEA   D  L  V P KP  
Sbjct  83    AALEKGLALALADHRAFAGQLVTREEG-PAVLLNDRGARVVEARVDDADLIDVAPPKPKP  141

Query  394   SLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR--D  564
              LL LHP L     E+V +Q+TRF CGSLVVGFTAHH VADG  TS+FLVAWG+A R  D
Sbjct  142   ELLMLHPDLAVEHEEVVVLQLTRFRCGSLVVGFTAHHAVADGRGTSSFLVAWGRATRGLD  201

Query  565   VMIQPLPLRDRTIFIPRNPPRIEYDHVGAEY-MPKQIKKNDHFLNSNDATFLDDIVVHKV  741
             + + PL      +F+PR  PR+E+DH   EY +P          +       + I+VHK 
Sbjct  202   MGLPPL-YHHEGLFMPRLSPRVEFDHRNREYYLPPSPFAVASIADK------ESILVHKA  254

Query  742   HFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRA  921
             HFT +F+A L+A AS  +G +RP+S FE+++AH+WR IT+AR L   ET+ IR+SVDGR 
Sbjct  255   HFTKDFIAHLRAAAS--HGLSRPFSRFETILAHIWRTITRARGLAPNETSTIRLSVDGRD  312

Query  922   RLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNN-NYIRSFIDFAN  1098
             RL   VP  Y  NLVLWAFP   V DLL +PL +AA+LIHD V +V +  Y +SFIDFA 
Sbjct  313   RLG--VPARYANNLVLWAFPHTTVSDLLTKPLMHAAQLIHDEVGRVADAGYFQSFIDFAC  370

Query  1099  SKVVAEEDGLVPTADMD-KHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMM  1275
             S  + EE GL P+A ++ + +LCP+LEV SWL FPFYDLDFGTG P   MP++FP EG++
Sbjct  371   SGNIKEE-GLSPSAALNLRDVLCPDLEVHSWLTFPFYDLDFGTGSPAYVMPSYFPAEGLI  429

Query  1276  FLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD*TG  1386
             FL+PS+IGDGSIDAF+P+FQDNL  FKQ CYS+   G
Sbjct  430   FLMPSYIGDGSIDAFVPVFQDNLEAFKQCCYSISMDG  466



>dbj|BAK03149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   424 bits (1091),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 227/446 (51%), Positives = 307/446 (69%), Gaps = 21/446 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYE-GNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELG  234
             M+VKV S+R +KP+Y+ G PP  T ++PLS+FD V+Y  ++A+IYA+ PP PP + IE G
Sbjct  1     MEVKVLSSRLVKPAYKAGAPP--TEYIPLSIFDTVTYQIRMAIIYAFAPPAPPTAAIEKG  58

Query  235   LRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
             L   L  YR +AG++G   +G P V+LND G + VEAS D  L  + P KP+ +LL LHP
Sbjct  59    LAAVLAQYRAFAGQVGVSPDGAPAVVLNDRGARLVEASVDADLVDMAPAKPTPALLKLHP  118

Query  415   SLKGV-VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
              L     E+V +Q+TRF CGSL VGFT+ H+VADGH+TSNFLVAWG+A R + +   P+ 
Sbjct  119   DLDAEHQEVVVLQLTRFRCGSLAVGFTSKHVVADGHATSNFLVAWGRATRGLPMGVPPVH  178

Query  592   D-RTIFIPR-NPPRIE--YDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEF  759
               + +F PR +P R+E  +DH   EY   Q    D   +S        +V+HK HFT +F
Sbjct  179   HHKDLFKPRPSPARLEQEHDHRSREYHRPQQGDGDGAESSI-------VVIHKAHFTKDF  231

Query  760   LAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKV  939
             +A L+AKAS   G  RP+S FE+++AHLWR +T+AR L   E + IRISVDGR RL    
Sbjct  232   IAGLRAKAS--EGRGRPFSRFETILAHLWRTMTRARGLSPGEASSIRISVDGRHRLG--R  287

Query  940   PNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEE  1119
             P +YFGNLVLWAFP +   DLL  PL +AA+ IHD V++V+  Y +S +DFA S   AE+
Sbjct  288   PAEYFGNLVLWAFPRSTAGDLLSRPLRHAAQAIHDEVARVDGAYFQSLVDFAASGA-AEK  346

Query  1120  DGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIG  1299
             +GL P+A + K  +CP++EVDSWL  PFY+LDFGTG P  FMP++FPTEGM+F+ PS++G
Sbjct  347   EGLAPSAVL-KDAVCPDVEVDSWLTLPFYELDFGTGSPSYFMPSYFPTEGMLFMAPSYLG  405

Query  1300  DGSIDAFIPLFQDNLPTFKQICYSLD  1377
             DGS+DAF+P+F  NL  FK+ CYS++
Sbjct  406   DGSVDAFVPVFHRNLQAFKECCYSME  431



>dbj|BAJ92466.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   421 bits (1083),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 203/376 (54%), Positives = 269/376 (72%), Gaps = 8/376 (2%)
 Frame = +1

Query  256   YREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVV  432
             YREWAGRLG D  G   +LLND G +FVEA+ D  LD VMP KP+  +L+LHPS   G  
Sbjct  2     YREWAGRLGVDASGGRAILLNDAGARFVEATADVALDSVMPLKPTSEVLSLHPSGDDGPE  61

Query  433   ELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFI  609
             EL+ +QVTRF CGSLVVGFT  H+V+DG ST NF VAW +A R   I P+P+ DR + F 
Sbjct  62    ELMLIQVTRFACGSLVVGFTTQHIVSDGRSTGNFFVAWSQATRGAAIDPVPVHDRASFFH  121

Query  610   PRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASA  789
             PR P  +EY+H G E+ P + K +D    ++     D++VV+KVHF+ EF++KLKA+ASA
Sbjct  122   PREPLHVEYEHRGVEFKPYE-KAHDVVCGADGDE--DEVVVNKVHFSREFISKLKAQASA  178

Query  790   MNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVL  969
               G  RP ST + +VAHLWR++T AR L G ETT + I+VDGRAR++P+VP+ Y GN++L
Sbjct  179   --GAPRPCSTLQCVVAHLWRSMTMARGLDGGETTSVAIAVDGRARMSPQVPDGYTGNVIL  236

Query  970   WAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMD  1149
             WA PT    +L+  P+ +A +LI   V+++N+ Y +SFIDFANS  V E++ LV TAD  
Sbjct  237   WARPTTTAGELVTRPVKHAVELISREVARINDGYFKSFIDFANSGAV-EKERLVATADAA  295

Query  1150  KHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPL  1329
               +L PN+EVDSWLR PFYD+DFG G P+ FMP++ P EG++ LLPSF+GDGS+DA++PL
Sbjct  296   DMVLSPNIEVDSWLRIPFYDMDFGGGRPFFFMPSYLPVEGLLILLPSFLGDGSVDAYVPL  355

Query  1330  FQDNLPTFKQICYSLD  1377
             F  ++ TFK  CYSLD
Sbjct  356   FSRDMNTFKNCCYSLD  371



>ref|XP_006853055.1| hypothetical protein AMTR_s00038p00060070 [Amborella trichopoda]
 gb|ERN14522.1| hypothetical protein AMTR_s00038p00060070 [Amborella trichopoda]
Length=435

 Score =   424 bits (1089),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 205/443 (46%), Positives = 295/443 (67%), Gaps = 11/443 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MK++  S+R + PSYE     P  +T + LS FD+ + +  IA+IY Y+ PTP NS+IE 
Sbjct  1     MKIEKLSSRLVTPSYEAKLFTPSISTTILLSPFDRAAGNFHIALIYTYKAPTPTNSSIEH  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GLR AL  YREWAGRL +D      ++L+D+GV+FVEA    TLD+  P K +  L +LH
Sbjct  61    GLRLALADYREWAGRLTDDAGA---IVLDDKGVRFVEAMASCTLDEASPLKLTPQLCDLH  117

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             PS++G+ EL+QVQ+TRF CGSLVVGFT++HL+ADG +T +FL+AWG+A R +   P+P+ 
Sbjct  118   PSVEGIEELMQVQLTRFMCGSLVVGFTSNHLIADGEATGSFLLAWGQATRGLTDYPVPIH  177

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             DR +  PR+P  IE+DH+G EY  K + K   +           + V K  F+ EFLAKL
Sbjct  178   DRAVVKPRDPLSIEFDHLGKEYREKSLVKEVPW-----EEMASQVRVEKTPFSPEFLAKL  232

Query  772   KAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDY  951
             KA+AS      R YSTFESLV+H+W+ +T+AR +G  ET+ +RI ++ R R+ P + + Y
Sbjct  233   KARASVRCPSGRGYSTFESLVSHIWQKVTRARGVGEEETSQLRIPINMRTRVVPPIAHGY  292

Query  952   FGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDF-ANSKVVAEEDGL  1128
             FGN+VLWAFP A V++LL +PL   A+++H A+++VN+ Y RSF+DF A  +       L
Sbjct  293   FGNMVLWAFPRATVRELLSQPLDRVAEVVHAAIAQVNDRYARSFVDFDAGVEREGRWSEL  352

Query  1129  VPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGS  1308
             V T D++  + CPNLE +SWLR PF ++DFG+G P  FMP F P EG+M ++P+    G+
Sbjct  353   VSTGDLESTVCCPNLEANSWLRIPFDEMDFGSGAPDAFMPCFIPLEGIMAIVPAMHEMGA  412

Query  1309  IDAFIPLFQDNLPTFKQICYSLD  1377
             +D ++ L       FK+IC+++D
Sbjct  413   MDVYLSLLDSQRAVFKEICHTID  435



>gb|EMT28099.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=446

 Score =   424 bits (1089),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 220/446 (49%), Positives = 303/446 (68%), Gaps = 13/446 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M+V++ S++ +KP+   +      +VPLS FD+V+Y  Q+A+IY + PP P  + +E GL
Sbjct  1     MEVQILSSKLVKPAASTDAAAVDEYVPLSTFDRVTYQIQMAIIYVFAPPVPSTAALEKGL  60

Query  238   RKALGVYREWAGRL---GNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
               AL  YR +AG+L   G    G P VLLND G + VEAS D  L  V P KP   LL L
Sbjct  61    AVALAQYRVFAGQLVVRGEAPGGGPAVLLNDHGARVVEASVDADLVDVAPPKPKPELLWL  120

Query  409   HPSLKGVV-ELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
             HP+L+  + E+V +Q+TRF CGSL VGFTA+H V DG  TSNFLVAWG+A R + +   P
Sbjct  121   HPNLEEAMDEVVVLQLTRFRCGSLAVGFTANHAVTDGRGTSNFLVAWGRATRGLAMGLPP  180

Query  586   LRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
             + +   +F+PR+  R+E+DH   EY    +  N      +D    + IV+HK HFT +++
Sbjct  181   VYNHDELFMPRSVSRVEFDHRNREYYLPPLLTNIGSEAVDDVK-KNSIVIHKTHFTKDWI  239

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
               L+A+AS   G  RP+S FE+++AHLWRA+T+AR LG  ET+ IR+S DG  R  P+VP
Sbjct  240   TLLRARAS--EGLDRPFSRFETILAHLWRAMTRARGLGHNETSTIRLSGDGGDR--PRVP  295

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNN-NYIRSFIDFANSKVVAEE  1119
              +Y GNLVLWAFP A   DLL  PL +AA++IH+ V++V + +Y RSF+DFA+S  V EE
Sbjct  296   AEYAGNLVLWAFPQATAGDLLNRPLKHAAQVIHNEVARVADADYFRSFVDFASSGTV-EE  354

Query  1120  DGLVPTADMD-KHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFI  1296
             +GL P+A ++ + +LCP+LEV SWL FPFYDLDFGTG P   MP++FP EG++FL+PS+I
Sbjct  355   EGLAPSAALNLREVLCPDLEVHSWLTFPFYDLDFGTGTPSYVMPSYFPAEGLIFLMPSYI  414

Query  1297  GDGSIDAFIPLFQDNLPTFKQICYSL  1374
             GDGS+DAF+P+FQ N+  FKQ  Y +
Sbjct  415   GDGSVDAFVPVFQCNVEAFKQCVYCI  440



>ref|XP_004978049.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=448

 Score =   422 bits (1084),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 216/447 (48%), Positives = 297/447 (66%), Gaps = 14/447 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTI-E  228
             MK+ V S++ ++P+Y  N  P      VPL+VFDK S+D  I+ I  +RPP PPN+ + E
Sbjct  1     MKITVHSSKAVRPAYGANGVPFPAADAVPLTVFDKASFDEYISGISFFRPPAPPNNAVLE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMP--FKPSVSLL  402
              GL +AL  YREWAGRLG +  G+  ++L D G +F+EA+ D  LD VMP   +PS ++ 
Sbjct  61    AGLARALAEYREWAGRLGTNARGSRAIILCDAGARFIEATADVALDSVMPALLQPSSAVS  120

Query  403   NLHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPL  582
              LHP+     EL+ VQVTRF CGSL VG T  H VADG +  NFL+AWG+A R V I P 
Sbjct  121   GLHPAAD-EEELLMVQVTRFACGSLAVGHTMSHAVADGQAACNFLLAWGQATRGVPIDPA  179

Query  583   PLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEF  759
             P+ DR ++F+PR PPR+E+DH G E+ P    K      SNDA   D +VVH+ HFT E 
Sbjct  180   PVHDRASLFLPRVPPRVEFDHRGVEFKPPHGAKAARS-RSNDAD--DVVVVHRAHFTREL  236

Query  760   LAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN--P  933
             L++L+++AS+    ARPYST   LVAHLWR +T+AR L G   T +R++V+GRAR+N  P
Sbjct  237   LSELRSRASSARA-ARPYSTTVCLVAHLWRCVTRARGLDGGAVTRLRVAVNGRARMNGAP  295

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVA  1113
             ++P  Y GN+VLWA+P A  ++L+  PL +AA+L+  AV++V+  Y RSF+DFA S  V 
Sbjct  296   RIPEGYTGNVVLWAWPAATARELVNRPLRHAAELVSRAVARVDGGYFRSFVDFAGSGAV-  354

Query  1114  EEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSF  1293
             EE+GLVP AD  + +L P++EVDS L   F DLD G G P++FMP + P EG +F++  F
Sbjct  355   EEEGLVPAADAAEKVLSPDVEVDSLLHAAFCDLDLGGGRPFLFMPGYLPNEGSVFIVRDF  414

Query  1294  IGDGSIDAFIPLFQDNLPTFKQICYSL  1374
              GDG + A++PLF   +  F + CYS+
Sbjct  415   SGDGGVSAYVPLFSRAMERFGRCCYSV  441



>ref|XP_004980736.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=451

 Score =   421 bits (1082),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 217/447 (49%), Positives = 297/447 (66%), Gaps = 11/447 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNP------PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNS  219
             MK+ V++++ + P+Y G            T VPL+VFDKV+YD  I+ I  +RPP PPN+
Sbjct  1     MKITVQTSKAVNPAYGGGSGGAPLAAANATAVPLTVFDKVNYDLYISGINFFRPPAPPNA  60

Query  220   TIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSL  399
              +  GL +AL  YREWAGRLG D  G   +LLND G +FVEA+ D  L  VMP +P+ ++
Sbjct  61    VLAAGLARALAEYREWAGRLGVDAAGTRAILLNDAGARFVEATADVALGSVMPLEPTPAV  120

Query  400   LNLHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQP  579
             L+LHP   G  EL+ VQVTRF CGSL +G T HH VADG +  NFL+AWG+A R   + P
Sbjct  121   LSLHPDGDGAEELMLVQVTRFKCGSLAIGHTMHHAVADGRAACNFLLAWGQATRGAALDP  180

Query  580   LPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
             +P  DR ++F+PR PPR+ ++H G E+ P++ KK     +       D++VV +V F+ E
Sbjct  181   VPAHDRASLFLPRQPPRVAFEHRGVEFKPREQKKPGRRSDVAVVDNDDEVVVQRVRFSRE  240

Query  757   FLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARL-NP  933
             F+A+L+++ASA  G  RP+ST   + AHLWR ITKAR L G E T + ++VDGR R+ +P
Sbjct  241   FVAELRSRASA--GAPRPHSTLLCVAAHLWRCITKARGLNGGEVTRLCVAVDGRMRMRDP  298

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVA  1113
              V   Y GN+VLWA P A   +L+  PL  A +LI   V++V++ Y RSFIDFA+S  V 
Sbjct  299   LVSEGYTGNVVLWARPAAAAGELVSMPLRRAVELISREVARVDDGYFRSFIDFASSSAV-  357

Query  1114  EEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSF  1293
             EE+GLVPTAD  K    P++EVDS L  PFYDLDFG G P+ FMP++ P EG +F++ SF
Sbjct  358   EEEGLVPTADAAKTAYIPDVEVDSLLHAPFYDLDFGGGPPFFFMPSYLPVEGSVFIVRSF  417

Query  1294  IGDGSIDAFIPLFQDNLPTFKQICYSL  1374
              GD S+DA++P+F+  + TF + CYSL
Sbjct  418   SGDHSVDAYVPIFRRAMDTFNKCCYSL  444



>dbj|BAF97632.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=372

 Score =   413 bits (1062),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 203/377 (54%), Positives = 273/377 (72%), Gaps = 10/377 (3%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEE-GNPVVLLN  318
             +V DK ++DA I+VIYA+RPP PPN+ +E GL +AL  YREWAGRLG D   G+  +LL 
Sbjct  1     TVLDKANFDAYISVIYAFRPPAPPNAVLEAGLARALVDYREWAGRLGVDAATGDRAILLT  60

Query  319   DEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTA  495
             D G +FVEA+ D  LD VMP KP+  +L+LHPS   G  EL+ +QVTRF CGS+VVGFTA
Sbjct  61    DAGARFVEATADVALDSVMPMKPTTEVLSLHPSGDDGPEELMLIQVTRFACGSIVVGFTA  120

Query  496   HHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMP-KQ  669
              HLV+DG +TSNF +AW +A R V + P+P+ DR + F PR+ P+ EY+H G E+ P ++
Sbjct  121   QHLVSDGRATSNFFLAWSQATRGVAVDPVPVHDRASFFKPRDLPQAEYEHRGVEFKPYEE  180

Query  670   IKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWR  849
             I +ND   ++ D    D +VV+KVH +LEF++KLK++AS   G  RPYST   LVAHLWR
Sbjct  181   IDENDDEGHAGDG---DVVVVNKVHLSLEFISKLKSRASV--GAQRPYSTLRCLVAHLWR  235

Query  850   AITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAA  1029
              +TKAR L G  +T++ I+VDGRAR++P+VP+ Y GN+VLWA PTA  ++L+  PL +A 
Sbjct  236   CVTKARGLDGSVSTNVAIAVDGRARMSPQVPDGYTGNVVLWARPTATAQELVMRPLQHAV  295

Query  1030  KLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYD  1209
             +LI+  V++++  Y  SFIDFA+S+ V +E  LVPTAD  +  L PN+EVDSWLR PFYD
Sbjct  296   ELINREVARISGGYFESFIDFASSEAVQKER-LVPTADAAEMALSPNIEVDSWLRIPFYD  354

Query  1210  LDFGTGCPYIFMPTFFP  1260
             LDFG G P+ FMP++ P
Sbjct  355   LDFGGGQPFFFMPSYLP  371



>gb|KDP34339.1| hypothetical protein JCGZ_11222 [Jatropha curcas]
Length=362

 Score =   411 bits (1057),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/335 (61%), Positives = 253/335 (76%), Gaps = 11/335 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTH-VPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MKV +E T  +KP  +GN  P    +H VPLSVFDKVSY+  +A+IYA  PPTP N TIE
Sbjct  1     MKVTIEKTEIVKPFCDGNKIPTDPKSHLVPLSVFDKVSYNTHVAIIYADNPPTPTNGTIE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
             LGL+K L  YREWAGRLG DE G+PV+ LND+GV FVEAS D  L++VMP +PS  LL+L
Sbjct  61    LGLQKVLSEYREWAGRLGEDENGDPVIFLNDKGVNFVEASIDIKLEQVMPLQPSPFLLSL  120

Query  409   HPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPL  588
             HP +K V  L+QVQ+TRF CGSLV+GFTAHHLVADGHS SNFLVAWGKA R + I PLPL
Sbjct  121   HPKVKDVEALLQVQLTRFACGSLVIGFTAHHLVADGHSASNFLVAWGKATRGLDINPLPL  180

Query  589   RDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAK  768
              DRTIF PRNPP  E++H G E+  K +  +    ++ D   ++++ VHKVHFT+EFL++
Sbjct  181   HDRTIFNPRNPPYFEFEHKGVEFKCKNLVND---CSNYDGMSVEEVEVHKVHFTMEFLSE  237

Query  769   LKAKAS-----AMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNP  933
             LK +AS       NG  +PY+TFESL+AHLWR +TKAR L GFE + IRISV+G AR+NP
Sbjct  238   LKTRASNSLPNGANGNNKPYTTFESLLAHLWRTMTKARQLNGFENSSIRISVNGCARMNP  297

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLI  1038
             KVPN+YF NLVLWA+P++KV+DL++E   YAA+LI
Sbjct  298   KVPNEYFRNLVLWAYPSSKVEDLVQETSGYAAELI  332



>ref|XP_004958863.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=452

 Score =   414 bits (1064),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 207/441 (47%), Positives = 290/441 (66%), Gaps = 9/441 (2%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLT---TTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MK+ V+S++ +KP+   N          VPLSVFDKV+ D  ++ IY +RPPTPPN+ +E
Sbjct  1     MKITVKSSKAVKPAATANANAPRPDVVVVPLSVFDKVNIDMYVSGIYVFRPPTPPNAALE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
              GL +AL  Y EWAGRLG D  GN  +LLN  G + VEA+ D  LD V+P  P+  + +L
Sbjct  61    AGLARALAEYPEWAGRLGVDGRGNRAILLNGAGARLVEATADVALDAVLPLSPAPEVRSL  120

Query  409   HPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPL  588
             HPS  G  E+  VQ+TRF CG L +G TAHHL++DG +  NF +AW +A R V + P+P+
Sbjct  121   HPSADGAEEVRLVQLTRFACGGLAIGSTAHHLISDGRAAYNFFLAWSQATRGVPVDPVPV  180

Query  589   RDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLA  765
              DR + F PR+PPR+E+DH G E+   +        +       D+++VH+ H + EF+A
Sbjct  181   HDRASFFKPRDPPRVEFDHRGVEFKKPEPPAAAAPHSEAGNNIDDEVLVHRAHCSREFIA  240

Query  766   KLKAKASAMNGGARPYSTFESLVAHLWRAITKARNL--GGFETTHIRISVDGRARLNPKV  939
             +LK++ASA  G  RP ST   +VAHLWR IT AR L   G  TT + I+VDGRAR+   V
Sbjct  241   RLKSQASAPGG--RPCSTLLCVVAHLWRCITAARGLHAAGAATTSVCIAVDGRARMIHPV  298

Query  940   PNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEE  1119
             P+ Y GN+VLWA PTA  +DL+  PL +A +LI+  +++V+ +Y  SF+DF+ S  V E 
Sbjct  299   PDGYTGNVVLWARPTAAARDLVARPLRHAVELINRELARVDGSYFGSFVDFSASGAV-EA  357

Query  1120  DGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIG  1299
             +GLVP AD  + +L PN+EV+SWL+ PFY+LDFG   P  FMP++ P EG++ L+PS+  
Sbjct  358   EGLVPAADAAEMVLSPNIEVNSWLQTPFYNLDFGGCRPCFFMPSYLPMEGLLILVPSYYR  417

Query  1300  DGSIDAFIPLFQDNLPTFKQI  1362
             DGSIDA++ LF  ++ TFK +
Sbjct  418   DGSIDAYVALFSRHMDTFKTL  438



>ref|XP_004979694.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=445

 Score =   411 bits (1057),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 216/441 (49%), Positives = 295/441 (67%), Gaps = 5/441 (1%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             MK+ V +++ +KP+Y G      T VPL+VFDK ++D  I+ I  +R P PPN+ +  GL
Sbjct  1     MKITVHTSKAVKPAYGGGIGGDATAVPLTVFDKANFDQHISGINFFRQPAPPNAALAAGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
              +AL  YREWAGRLG D  G+  +LLND G +FVEA+ D  L  VMP +P+  +L LHP 
Sbjct  61    ARALAEYREWAGRLGVDAAGSRAILLNDAGARFVEATADVVLGDVMPLEPTPDVLRLHPD  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
               G  EL+ VQVTRF CGSL VG T HH VADG +  NFL+AWG+A R     P+P  DR
Sbjct  121   GDGAEELMLVQVTRFKCGSLAVGHTIHHAVADGRAACNFLLAWGQATRGAAFDPVPAHDR  180

Query  598   -TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLK  774
              ++F+PR PPR+ ++H G E+ P++ KK     +       D++VV +V F+ EF+A+L+
Sbjct  181   ASLFLPRQPPRVAFEHRGVEFKPREEKKPGRRSDVAVVDNDDEVVVQRVRFSREFVAELR  240

Query  775   AKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARL-NPKVPNDY  951
             ++ASA  G  RPYST + + AHLWR ITKAR L   E T + ++VDGR R+ +P VP  Y
Sbjct  241   SRASA--GAPRPYSTLQCVAAHLWRCITKARGLDAREITRLCVAVDGRMRMRHPPVPEGY  298

Query  952   FGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLV  1131
              GN+VLWA P A   DL+  PL  A +LI   V++V+++Y RSFIDFA+S  V EE+ LV
Sbjct  299   TGNVVLWARPAAAAGDLVSMPLRLAVELISREVARVDDSYFRSFIDFASSGAV-EEERLV  357

Query  1132  PTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
             P+AD  + +L P++EVDS L  PFYDLDFG G P+ FMP++   EG +F++ SF GD S+
Sbjct  358   PSADSSETVLSPDVEVDSLLHAPFYDLDFGGGPPFFFMPSYLSVEGTVFIVRSFSGDRSM  417

Query  1312  DAFIPLFQDNLPTFKQICYSL  1374
             DA++PLF+  + TF + CYSL
Sbjct  418   DAYVPLFRRAMDTFNKCCYSL  438



>ref|XP_006838768.1| hypothetical protein AMTR_s00002p00257270 [Amborella trichopoda]
 gb|ERN01337.1| hypothetical protein AMTR_s00002p00257270 [Amborella trichopoda]
Length=437

 Score =   410 bits (1055),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 203/448 (45%), Positives = 298/448 (67%), Gaps = 19/448 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNP--PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MK++ +S+R + PS E  P  P T T + L+ FD+ + +  I +I+AY+ PTPPNS IE 
Sbjct  1     MKIEKQSSRLVTPSCETKPLTPSTCTIITLNPFDRAAGNDHIPIIFAYKAPTPPNSAIER  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL   L  YR WAGRL +DE     V+LND+GV+FVEA+   TLD+  PFK +  L +LH
Sbjct  61    GLGLVLSDYRVWAGRLTDDERA---VVLNDKGVRFVEATAFCTLDEASPFKSNTQLWDLH  117

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             PS++ V EL+Q Q+TRFTCGSLVVGFT++H++ADG +T  FL AWG+A R ++  P+P+ 
Sbjct  118   PSVEDVEELMQAQLTRFTCGSLVVGFTSNHMIADGEATGRFLAAWGQATRGLLDYPVPIH  177

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             DR +  PR+P  IE+DH+G EYM K++ K   +        ++ + + K HF+ +FLAKL
Sbjct  178   DRAMLKPRDPLSIEFDHLGNEYMEKRLVKEFSW-----EGIVNQLRMQKFHFSPDFLAKL  232

Query  772   KAKASAMNGGARPYSTFESLVAHLWRAITKAR--NLGGFETTHIRISVDGRARLNPKVPN  945
             KA+AS        YST+ES+V+H+W+ +T+AR  ++G  E + + ISV+ R RL P +P 
Sbjct  233   KARASVRCPSGGGYSTYESVVSHVWQKVTRARGASVGEEEISQVGISVNLRTRLVPPIPR  292

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG  1125
             +YFGN+VLWAFP   V +LL +PL   A L+H A+++VN+ Y RSF+DF     + E +G
Sbjct  293   EYFGNMVLWAFPRTTVHELLSQPLDRVAALVHAAIAQVNDRYARSFVDF---DALVEREG  349

Query  1126  ----LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSF  1293
                 LVPT +++  + CPNLE  SWL  PF ++DFG+G P +FMP+F P +G + ++   
Sbjct  350   RWGELVPTGEVESAVFCPNLEASSWLWLPFDEMDFGSGGPDVFMPSFIPYDGDVVIVSPM  409

Query  1294  IGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
              G   ID ++ LF++ +P F+ I ++LD
Sbjct  410   KGKRGIDVYVCLFENIMPVFQDIWHTLD  437



>dbj|BAF97635.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=371

 Score =   404 bits (1038),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 198/375 (53%), Positives = 261/375 (70%), Gaps = 7/375 (2%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLND  321
             +V DK ++D  I+VIYA+  P PPN  +E GL KAL  YREWAGRLG D  G+  ++LND
Sbjct  1     TVLDKANFDTYISVIYAFHAPAPPNDVLEAGLAKALVDYREWAGRLGVDANGDRAIMLND  60

Query  322   EGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAH  498
              G +FVEA+ D  LD VMP KP+  +LNLHPS   G  EL+ +QVTRF CGSLVVGFT  
Sbjct  61    AGARFVEATADVALDSVMPLKPTSEVLNLHPSGDDGPEELMLIQVTRFPCGSLVVGFTTQ  120

Query  499   HLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIK  675
             H+V+DG ST NF VAW +A R   I P+P+ DR + F PR P  +EY+H G E+ P   +
Sbjct  121   HIVSDGRSTGNFFVAWSQATRGAAIDPVPVHDRASFFHPREPLHVEYEHRGVEFKP--CE  178

Query  676   KNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAI  855
             K    +   D    D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAHLWR++
Sbjct  179   KVHDVVCGADGEDDDEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAHLWRSM  236

Query  856   TKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKL  1035
             T AR L G E+T + I+VDGRAR++P+VP+ Y GN++LWA PT    DL+  PL +A +L
Sbjct  237   TMARGLDGGESTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTAAGDLVARPLKHAVEL  296

Query  1036  IHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLD  1215
             I   V+++N+ Y +SFIDFANS  V E++ LV TAD    +L PN+EVDSWLR PFYD+D
Sbjct  297   ISREVARINDGYFKSFIDFANSGAV-EKERLVATADAADMVLSPNIEVDSWLRIPFYDMD  355

Query  1216  FGTGCPYIFMPTFFP  1260
             FG G P+ FMP++ P
Sbjct  356   FGGGRPFFFMPSYLP  370



>dbj|BAF97633.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=370

 Score =   400 bits (1027),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 194/375 (52%), Positives = 260/375 (69%), Gaps = 8/375 (2%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLND  321
             +V DK ++D  I+VIYA+  P PPN  +E GL + L  YREWAGRLG D  G   +LLND
Sbjct  1     TVLDKANFDTYISVIYAFHAPAPPNDVLEAGLARVLVDYREWAGRLGVDANGERAILLND  60

Query  322   EGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAH  498
              G +FVEA+ D  LD VMP KP+  +L+LHPS   G  EL+ +QVTRF+CGSLVVGFT  
Sbjct  61    AGARFVEATADVALDSVMPLKPTPEVLSLHPSGDDGPEELMLIQVTRFSCGSLVVGFTTQ  120

Query  499   HLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIK  675
             H+V+DG ST NF VAW +A R   + P+P+ DR + F PR P  +EY+H G E+ P +  
Sbjct  121   HIVSDGRSTGNFFVAWSQATRGAAVDPVPVHDRASFFHPREPLHVEYEHRGVEFKPYEKV  180

Query  676   KNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAI  855
              +D      D    D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAHLWR +
Sbjct  181   HDDVVRADGDD---DEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAHLWRTM  235

Query  856   TKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKL  1035
             T AR L G E+T + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  P+ +A +L
Sbjct  236   TMARGLDGGESTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVSRPVKHAVEL  295

Query  1036  IHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLD  1215
             I   V+++N+ Y +SFIDFANS  V EE+ LV TAD  + +L PN+EVDSWLR PFYD+D
Sbjct  296   ISREVARINDGYFKSFIDFANSGAV-EEERLVATADAAEMVLSPNIEVDSWLRIPFYDMD  354

Query  1216  FGTGCPYIFMPTFFP  1260
             FG G P+ FMP++ P
Sbjct  355   FGGGRPFFFMPSYLP  369



>dbj|BAF97638.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=370

 Score =   399 bits (1026),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/375 (51%), Positives = 261/375 (70%), Gaps = 8/375 (2%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLND  321
             +V DK ++D  I+VIYA+  P PPN+ +E GL +AL  YREWAGRLG D  G   ++LND
Sbjct  1     TVLDKANFDTYISVIYAFHAPAPPNAVLEAGLARALVDYREWAGRLGVDPNGERAIMLND  60

Query  322   EGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAH  498
              G +FVEA+ D  LD VMP KP+  +L+LHPS   G  EL+ +QVTRF+CGSLVVGFT  
Sbjct  61    AGARFVEATADVALDSVMPLKPTPEVLSLHPSGDDGPEELMLIQVTRFSCGSLVVGFTTQ  120

Query  499   HLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIK  675
             H+V+DG ST NF VAW +A R   + P+P+ DR + F PR P  +EY+H G E+ P +  
Sbjct  121   HIVSDGRSTGNFFVAWSQATRGAAVDPVPVHDRASFFHPREPLHVEYEHRGVEFKPYEKV  180

Query  676   KNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAI  855
              +D      D    D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAHLWR +
Sbjct  181   HDDVVRADGDD---DEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAHLWRTM  235

Query  856   TKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKL  1035
             T AR L G E+T + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  PL +A +L
Sbjct  236   TMARGLDGGESTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVARPLKHAVEL  295

Query  1036  IHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLD  1215
             I   V+++N+ Y +SFIDFANS  V E++ L  TAD  + +L PN+EVDSWLR PFYD+D
Sbjct  296   ISREVARINDGYFKSFIDFANSGAV-EKERLAATADAAEMVLSPNIEVDSWLRIPFYDMD  354

Query  1216  FGTGCPYIFMPTFFP  1260
             FG G P+ FMP++ P
Sbjct  355   FGGGRPFFFMPSYLP  369



>dbj|BAF97639.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=370

 Score =   398 bits (1022),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 193/375 (51%), Positives = 260/375 (69%), Gaps = 8/375 (2%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLND  321
             +V DK ++D  I+VIYA+  P PPN  +E GL + L  YREWAGRLG D  G   +LLND
Sbjct  1     TVLDKANFDTYISVIYAFHAPAPPNDVLEAGLARVLVDYREWAGRLGVDANGERAILLND  60

Query  322   EGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAH  498
              G +FVEA+ D  LD VMP KP+  +L+LHPS   G  EL+ +QVTRF+CGSLVVGFT  
Sbjct  61    AGARFVEATADVALDSVMPLKPTPEVLSLHPSGDDGPEELMLIQVTRFSCGSLVVGFTTQ  120

Query  499   HLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIK  675
             H+V+DG ST NF VAW +A R   + P+P+ DR + F PR P  +EY+H G E+ P +  
Sbjct  121   HIVSDGRSTGNFFVAWSQATRGAAVDPVPVHDRASFFHPREPLHVEYEHRGVEFKPYEKV  180

Query  676   KNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAI  855
              +D      D    D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAHLWR +
Sbjct  181   HDDVVRADGDD---DEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAHLWRTM  235

Query  856   TKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKL  1035
             T AR L G E+T + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  PL +A +L
Sbjct  236   TMARGLDGGESTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVARPLKHAVEL  295

Query  1036  IHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLD  1215
             I   V+++N+ Y +SFIDFANS  V E++ L+ TAD  + +L PN+EVDSWLR PFYD+D
Sbjct  296   ISREVARINDGYFKSFIDFANSGAV-EKERLLATADAAEMVLSPNIEVDSWLRIPFYDMD  354

Query  1216  FGTGCPYIFMPTFFP  1260
             FG G P+ FMP++ P
Sbjct  355   FGGGRPFFFMPSYLP  369



>dbj|BAF97637.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=370

 Score =   398 bits (1022),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 193/375 (51%), Positives = 259/375 (69%), Gaps = 8/375 (2%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLND  321
             +V DK ++D  I+VIYA+  P PPN  +E GL + L  YREWAGRLG D  G   +LLND
Sbjct  1     TVLDKANFDTYISVIYAFHAPAPPNDVLEAGLARVLVDYREWAGRLGVDANGERAILLND  60

Query  322   EGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAH  498
              G +FVEA+ D  LD VMP KP+  +L+LHPS   G  EL+ +QVTRF+CGSLVVGFT  
Sbjct  61    AGARFVEATADVALDSVMPLKPTPEVLSLHPSGDDGPEELMLIQVTRFSCGSLVVGFTTQ  120

Query  499   HLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIK  675
             H+V+DG ST NF VAW +A R   + P+P+ DR + F PR P  +EY+H G E+ P +  
Sbjct  121   HIVSDGRSTGNFFVAWSQATRGAAVDPVPVHDRASFFHPREPLHVEYEHRGVEFKPYEKV  180

Query  676   KNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAI  855
              +D      D    D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAHLWR +
Sbjct  181   HDDVVRADGDD---DEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAHLWRTM  235

Query  856   TKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKL  1035
             T AR L G E+T + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  PL +A +L
Sbjct  236   TMARGLDGGESTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVARPLKHAVEL  295

Query  1036  IHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLD  1215
             I   V+++N+ Y +SFIDFANS  V E++ L  TAD  + +L PN+EVDSWLR PFYD+D
Sbjct  296   ISREVARINDGYFKSFIDFANSGAV-EKERLAATADAAEMVLSPNIEVDSWLRIPFYDMD  354

Query  1216  FGTGCPYIFMPTFFP  1260
             FG G P+ FMP++ P
Sbjct  355   FGGGRPFFFMPSYLP  369



>ref|XP_010276127.1| PREDICTED: agmatine coumaroyltransferase-2-like [Nelumbo nucifera]
Length=433

 Score =   399 bits (1026),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 199/423 (47%), Positives = 271/423 (64%), Gaps = 13/423 (3%)
 Frame = +1

Query  115   PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEE  294
             P + T VPL++FDK ++D  +AV+YA+RPP P N  ++ GL KAL  Y   AGR   DE 
Sbjct  22    PASNTLVPLTIFDKAAFDLHVAVLYAFRPPMPSNEVMKDGLAKALVHYPHLAGRFTTDEH  81

Query  295   GNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLKGVVELVQVQVTRFTCGS  474
             G P ++LN+ GV+ +E    T L + +PF PS  + +L P L+GV  L+Q+Q+ R+ CG 
Sbjct  82    GRPCIILNNAGVRVIETYVPTALAEQLPFTPSSEMSHLLPPLEGVEPLLQIQLNRYACGG  141

Query  475   LVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGA  651
             LV+G TAHH V DG S S+F ++W K  R + ++ LP  DR  + +PRNPPR E+DH   
Sbjct  142   LVIGQTAHHHVCDGQSMSSFFISWAKLVRGLNLESLPYHDRAAVSVPRNPPRTEFDHRSI  201

Query  652   EYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESL  831
             E+       N+ FL+S        IV   +H +  F+ KLK K S    G + YSTFE L
Sbjct  202   EFRKSAASNNNEFLSS--------IVNLTLHLSPGFITKLKQKVSQ---GNQRYSTFECL  250

Query  832   VAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLRE  1011
             ++H+W+ IT+AR L   E + +R++V+GRAR+ P+VP +YFGNLVLWA+P  K K+LL E
Sbjct  251   LSHMWKKITQARGLPPEELSQVRVAVNGRARMKPQVPMEYFGNLVLWAYPKLKAKELLNE  310

Query  1012  PLSYAAKLIHDAVSKVNNNYIRSFIDFAN-SKVVAEEDGLVPTADMDKHILCPNLEVDSW  1188
               +Y AK IHDAV++V+N Y +SFIDF   SK   EE  LV TA    + LCPNLEVDSW
Sbjct  311   SHAYIAKAIHDAVARVDNQYFQSFIDFGELSKGEEEEKELVATAPEVGNALCPNLEVDSW  370

Query  1189  LRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICY  1368
             LRF F+DLDFG G P  F+P   P EG++  +PS    G +D F+ L   ++  FK+ICY
Sbjct  371   LRFQFHDLDFGGGGPCAFIPPDLPVEGLLIFVPSCKEKGGVDVFLALLHHHVQYFKEICY  430

Query  1369  SLD  1377
             SLD
Sbjct  431   SLD  433



>ref|XP_008677985.1| PREDICTED: agmatine coumaroyltransferase-2-like [Zea mays]
 gb|AFW60400.1| hypothetical protein ZEAMMB73_139373 [Zea mays]
Length=455

 Score =   394 bits (1012),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 217/456 (48%), Positives = 294/456 (64%), Gaps = 26/456 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYE----GNP-PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNST  222
             MK+ VES + + PS      G P P     VPL+ FDKV+YD  +  +Y + PP PP+S 
Sbjct  2     MKITVESWKVVTPSSSCCSGGRPSPDADGAVPLTAFDKVTYDLYMHGLYLFPPPAPPSSV  61

Query  223   IELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVS-L  399
             +  GL  AL  Y EWAGRLG D  GN  +LLN +G +FVEA+ D  L  V+P +P+ S  
Sbjct  62    LVAGLAAALAEYPEWAGRLGVDAHGNRAILLNGKGARFVEATADVPLRSVLPLEPATSET  121

Query  400   LNLHPSLKGVV-------ELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKAC  558
             L+LHP+            E++ +QVTRF CGS VVG  A HLV+DG +  +FL AW +A 
Sbjct  122   LSLHPAAGAESDDAAVGGEVLLLQVTRFPCGSFVVGTAAQHLVSDGAALRSFLNAWAQAS  181

Query  559   RDVMIQ-PLPLRDRTIF-IPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVV  732
             R   I  P+PL DR  F +PR+P R+E++H GAEY P    + +   N  D    D +V+
Sbjct  182   RGAAIDDPVPLHDRVCFFLPRDPLRVEFEHRGAEYKPH--PRTEKSRNKVD----DRVVI  235

Query  733   HKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFET-THIRISV  909
             H+V+F+ +F+A+LKA+ASA  G  RP ST + + AHLWR +TKAR LG   T T +RI+V
Sbjct  236   HRVNFSRKFVAELKARASA--GAPRPRSTLQCVAAHLWRCVTKARRLGDLRTATELRIAV  293

Query  910   DGRARL-NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFI  1086
             +GR R+ NP+VP +Y GN+VLWA PT    +LLR PL    +L+  AV+ +++ Y RSF+
Sbjct  294   NGRRRMKNPRVPEEYTGNVVLWARPTTTSAELLRSPLRQVVELVSKAVTAMDDVYFRSFV  353

Query  1087  DFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTE  1266
             DFA+S VV EE+GL+PTAD  + +L PN+EVDS L  PF D DFG G P+ FMP++ P E
Sbjct  354   DFASSGVV-EEEGLLPTADPLETVLSPNVEVDSMLGLPFQDFDFGGGPPFFFMPSYSPVE  412

Query  1267  GMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             G++ ++ SF GDGSIDA++PLF   +  FK  C SL
Sbjct  413   GLICIVSSFSGDGSIDAYVPLFSQAMDVFKNCCRSL  448



>ref|XP_004973036.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=461

 Score =   394 bits (1012),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 210/455 (46%), Positives = 296/455 (65%), Gaps = 20/455 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEG-NPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELG  234
             MK+ V+S++ +KP Y+G + P   T VPL+VFD +S+D  +  I+A+ PP+P  + +E G
Sbjct  1     MKITVQSSKAVKPDYDGGDAPAAATVVPLTVFDLISFDDYMFGIHAFHPPSPTTAALEAG  60

Query  235   LRKALGVYREWAGRLGND-EEGNPVVLLNDEGVKFVEASG--DTTLDKVMPF-KPSVSLL  402
             L +AL  YREWAGRL  D   G   +LLND GV+FVEAS     TL+  MP  +P+  + 
Sbjct  61    LARALAEYREWAGRLCADPATGRRGILLNDAGVRFVEASAADGATLESAMPLLQPTPEVR  120

Query  403   NLHPSLKGV-VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQP  579
               HPS  G   EL+ VQVTRF CGSLV+G   HH V DG + S FLVAWG+A R V I P
Sbjct  121   RFHPSAGGAGEELMLVQVTRFACGSLVIGHAMHHAVGDGFAISRFLVAWGQATRGVAIDP  180

Query  580   LPLRDRT-IFIPRNPPRIEYDHVGAEYM-PKQIKKNDHF------LNSNDATFLDDIVVH  735
             +P+ DRT  F+PR+PPR+E++H G E+  P++ KKN           + D    D++VV 
Sbjct  181   VPVHDRTSFFVPRDPPRVEFEHRGTEFKKPREDKKNARMRGGDGGAGAGDDDDDDEVVVQ  240

Query  736   KVHFTLEFLAKLKAKASAMNGG-ARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVD  912
              V F+ EF+++LK++ASA  G   RPYST + L AHLWR +T  R L G   T + ++V+
Sbjct  241   LVRFSREFVSELKSRASATAGAPGRPYSTTQCLAAHLWRCVTAVRGLDGGRATTLHLAVN  300

Query  913   GRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDF  1092
             GRAR+  +VP  Y GN VLWA P    ++L+  PL  AA+LI   V++V++ Y RSFIDF
Sbjct  301   GRARM--RVPEGYTGNAVLWAHPATTARELVAGPLGRAAELIRGEVARVDDAYFRSFIDF  358

Query  1093  ANSKVVAEEDGLVP-TADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEG  1269
             A+S  V EE+GLVP +AD +  +L P++ V   LR PFYD+DFG G  + + P ++P EG
Sbjct  359   ASSGAV-EEEGLVPASADPEAMVLGPDVAVYCLLRVPFYDVDFGGGRQFFYTPGYYPAEG  417

Query  1270  MMFLL-PSFIGDGSIDAFIPLFQDNLPTFKQICYS  1371
             ++++L PS +GDGS++A + L++  + TFK  C+S
Sbjct  418   VVYILSPSPLGDGSVEAHVSLYRRAMETFKGCCFS  452



>dbj|BAF97630.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=372

 Score =   390 bits (1002),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 193/375 (51%), Positives = 262/375 (70%), Gaps = 6/375 (2%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLND  321
             +V DK ++D  I+VIYA+R   PPN+ +E GL +AL  YREWAGRLG D  G   ++LND
Sbjct  1     TVLDKANFDTYISVIYAFRASAPPNAVLEAGLARALVDYREWAGRLGVDPNGERAIMLND  60

Query  322   EGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAH  498
              G +F+EA+ D  LD VMP KP+  +LNLHPS   G  EL+ +QVTRF CGSLVVGFT  
Sbjct  61    AGARFMEATADVALDSVMPLKPTPEVLNLHPSGDDGPEELMLIQVTRFACGSLVVGFTTQ  120

Query  499   HLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIK  675
             H+V+DG ST NF VAW +A R   I P+P+ DR + F PR P  +EY+H G E+ P + K
Sbjct  121   HIVSDGRSTGNFFVAWSQATRGSAIDPVPVHDRASFFQPREPLHVEYEHRGVEFKPYK-K  179

Query  676   KNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAI  855
               D  +  +     D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAHLWR +
Sbjct  180   VYDDIVCGDGDDEDDEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAHLWRTM  237

Query  856   TKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKL  1035
             T AR L G E+T + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  P+ +A +L
Sbjct  238   TMARGLDGGESTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVARPVKHAVEL  297

Query  1036  IHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLD  1215
             I   V+++N+ Y +SFIDFANS  V E++ L+ TAD  + +L PN+EVDSWLR PFYD+D
Sbjct  298   ISREVARINDGYFKSFIDFANSGAV-EKERLLATADAAEMVLSPNIEVDSWLRIPFYDMD  356

Query  1216  FGTGCPYIFMPTFFP  1260
             FG G P+ FMP++ P
Sbjct  357   FGGGRPFFFMPSYLP  371



>dbj|BAF97640.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=372

 Score =   390 bits (1002),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 196/375 (52%), Positives = 265/375 (71%), Gaps = 6/375 (2%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLND  321
             +V DK ++D  I+VIYA+  P PPN+ +E GL +AL  YREWAGRLG D  G   ++LND
Sbjct  1     TVLDKANFDTYISVIYAFHAPAPPNAVLEAGLARALVDYREWAGRLGVDPNGERAIMLND  60

Query  322   EGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAH  498
              G +FVEA+ D  LD VMP KP+  +L+LHPS   G  EL+ +QVTRF CGSLVVGFT  
Sbjct  61    AGARFVEATADVALDSVMPLKPTPEVLSLHPSGDDGPEELMLIQVTRFPCGSLVVGFTTQ  120

Query  499   HLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIK  675
             H+V+DG ST NF VAW +A R   I P+P+ DR + F PR P  +EY+H G E+ P + K
Sbjct  121   HIVSDGRSTGNFFVAWSQATRGAAIDPVPVHDRASFFHPREPLHVEYEHRGVEFKPYK-K  179

Query  676   KNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAI  855
               D  +  +     D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAHLWR++
Sbjct  180   VYDDVVCGDGDDEDDEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAHLWRSM  237

Query  856   TKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKL  1035
             TKAR L G ETT + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  P+ +A +L
Sbjct  238   TKARGLDGGETTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVARPVKHAVEL  297

Query  1036  IHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLD  1215
             I  AV+++N+ Y +SFIDFANS  V E++ L+ TAD  + +L PN+EVDSWLR PFYD+D
Sbjct  298   ISRAVARINDGYFKSFIDFANSGAV-EKERLLATADAVEMVLSPNIEVDSWLRIPFYDMD  356

Query  1216  FGTGCPYIFMPTFFP  1260
             FG G P+ FMP++ P
Sbjct  357   FGGGRPFFFMPSYLP  371



>gb|AFW60402.1| hypothetical protein ZEAMMB73_955248 [Zea mays]
Length=462

 Score =   392 bits (1007),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 207/466 (44%), Positives = 295/466 (63%), Gaps = 26/466 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYE-----GNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNST  222
             M++ V S+R++KP+Y      G    +   V LSVFDK+SYD  I  + A+ PP PPN  
Sbjct  1     MEIIVHSSRSVKPNYGDRSDGGAVAASVEVVHLSVFDKISYDEYITGVCAFHPPAPPNHI  60

Query  223   IELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDK--VMPFKPSVS  396
             +E GL  AL VYREWAGRLG D  GN  ++LND G ++VEA+ D  L    V+      +
Sbjct  61    LEAGLATALAVYREWAGRLGMDGTGNRAIVLNDAGARYVEATADAELSSSVVLELTTGAN  120

Query  397   LLNLH-PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMI  573
             LL+L+ PS  G  EL+  QVTRF CGS++VG + HH VADGH+   FL AWG+A R V I
Sbjct  121   LLSLYPPSCDGAKELLLAQVTRFRCGSIIVGVSVHHRVADGHAIWAFLFAWGQATRGVRI  180

Query  574   -QPLPLRDR----TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHK  738
                +P++ R    ++F PR+PP++++DH G E+ P      D    +  A   D++V+H+
Sbjct  181   DDSIPVQQRHDRLSLFAPRDPPQVKFDHRGNEFKP---HVGDASGGNGAAHAGDEVVIHR  237

Query  739   VHFTLEFLAKLKAKAS-----AMNGGARPY-STFESLVAHLWRAITKARNLGGFETTHIR  900
             VHF+ E++ +LK+++           ARPY +T + + AHLWR IT AR L G +TT +R
Sbjct  238   VHFSKEWIMELKSQSQAAASEGAAATARPYTTTLQCVAAHLWRCITAARGLDGNQTTRMR  297

Query  901   ISVDGRARL-NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIR  1077
             I+V+GR+R+ +P+VP  Y GN VLWA+PT   ++L R+ +    +LI   V+++++ Y R
Sbjct  298   IAVNGRSRMKDPRVPVGYTGNAVLWAWPTTTARELGRQHIRETVELISREVARIDDAYFR  357

Query  1078  SFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTF-  1254
             SFIDFA S  V E++ LVPTAD  +  L PN+EVDS L  PFYD+DFG   P+ F+P + 
Sbjct  358   SFIDFAGSGAV-EKEQLVPTADSLELTLSPNVEVDSLLGIPFYDMDFGGARPFFFVPGYS  416

Query  1255  -FPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD*TGK  1389
               P +G +++L SF GDGS+DA++PLF   +  FK+ CYSL  T  
Sbjct  417   TVPVDGFIYVLQSFEGDGSVDAYVPLFSTTIEAFKRCCYSLQPTAS  462



>ref|XP_010251819.1| PREDICTED: agmatine coumaroyltransferase-2-like [Nelumbo nucifera]
Length=429

 Score =   389 bits (1000),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 196/442 (44%), Positives = 278/442 (63%), Gaps = 15/442 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M +++ +   +K S     P +   VPLS+FDK ++D  + ++YA+R P P N  +  GL
Sbjct  1     MAIELINDTILKASPSSEHPTSNALVPLSIFDKAAFDLHVPILYAFRAPVPSNEAMREGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
              KAL  Y   AGR   D++G   ++LN+ GV+ +E     TL + +PF P   + NL P 
Sbjct  61    SKALAHYPHLAGRFTTDDQGRTCIILNNAGVRIIETYVPITLAEQLPFTPDSEVGNLLPP  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             L+GV EL+QVQ+ R+ CG LV+G ++HH VADG S S F ++W    R + I+  P  DR
Sbjct  121   LEGVEELLQVQLNRYACGGLVLGLSSHHRVADGQSMSYFTISWSSLVRGLDIEAFPYHDR  180

Query  598   -TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLK  774
              ++ +PRNPPR+E+DH   E+  K    N + L+S+    +       VH + +F+ KLK
Sbjct  181   DSVSVPRNPPRVEFDHPNIEFR-KNTSSNTNELSSSITNLI-------VHLSADFVTKLK  232

Query  775   AKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYF  954
             AK      G + YSTFE L++HLW+ +T+AR L   E T +R++V+GRAR+ P VP +YF
Sbjct  233   AKVCQ---GNKRYSTFECLLSHLWKKMTQARGLERDEFTQVRVAVNGRARMKPPVPMEYF  289

Query  955   GNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFAN-SKVVAEEDGLV  1131
             GNLVLWA+P  +VK+LL E  +Y AK IH+AV+K+++ Y +SFIDF   SK   +ED LV
Sbjct  290   GNLVLWAYPRLRVKELLNESCAYVAKAIHEAVAKIDHEYFQSFIDFGELSK--GKEDELV  347

Query  1132  PTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
              TA    + LCPNLEVDSWLRF F+DLDFG G P  FMP   P EG++  +PS    G +
Sbjct  348   ATAPEAGNALCPNLEVDSWLRFHFHDLDFGGGAPCAFMPPDLPVEGLLVFVPSCKEIGGV  407

Query  1312  DAFIPLFQDNLPTFKQICYSLD  1377
             D F+ L  +++  FKQICY+LD
Sbjct  408   DVFLALLDEHVEHFKQICYALD  429



>ref|XP_002527426.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF34918.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=280

 Score =   384 bits (985),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 192/283 (68%), Positives = 227/283 (80%), Gaps = 7/283 (2%)
 Frame = +1

Query  58   MKVKVESTRTIKPSYEGNPPLTTTH-VPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELG  234
            MKVK+ESTRTIKP+YEG  P  T H +PLSVFDK +Y+  IAVIYAYRPPTPPN+TIE G
Sbjct  1    MKVKIESTRTIKPAYEGISPSPTLHFIPLSVFDKATYNTHIAVIYAYRPPTPPNATIEYG  60

Query  235  LRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
            L++AL  YREWAGRLG +E+G+PV+L+N++GVKFVEAS +  LD VMP KPS  +L+LHP
Sbjct  61   LKRALSEYREWAGRLGENEKGDPVILMNEKGVKFVEASVNDKLDHVMPLKPSSVILSLHP  120

Query  415  SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRD  594
            SLK V ELVQVQ+TRFTCGSLVVGFTAHHLVADG STSNFLVAWG+A R + + PLP+ D
Sbjct  121  SLKDVEELVQVQLTRFTCGSLVVGFTAHHLVADGQSTSNFLVAWGRASRGLDMNPLPIHD  180

Query  595  RTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLK  774
            RTIF PR PP  E+DH G EY  K++ KN     + D    DDI+VHK+HFTL+FL+KLK
Sbjct  181  RTIFNPRKPPHFEFDHRGVEYKSKKMVKN---CPNVDNIVDDDIIVHKIHFTLDFLSKLK  237

Query  775  AKA---SAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTH  894
            A+A   S  +  ++P STFESLVAHLWRAITKAR LGGFETTH
Sbjct  238  ARASSSSNGHSNSKPSSTFESLVAHLWRAITKARGLGGFETTH  280



>ref|XP_009795806.1| PREDICTED: agmatine coumaroyltransferase-2-like [Nicotiana sylvestris]
Length=284

 Score =   384 bits (985),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 189/282 (67%), Positives = 228/282 (81%), Gaps = 5/282 (2%)
 Frame = +1

Query  58   MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
            MK+++ES+R +KP Y+   P T +H+ LSVFDKV+YDA IA+IYAY PPTPPN+ IELGL
Sbjct  1    MKMRIESSRIVKPIYDEISP-TKSHISLSVFDKVTYDAHIAIIYAYCPPTPPNTAIELGL  59

Query  238  RKALGVYREWAGRLGNDEEGNPV-VLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
            +KAL +Y E+AGRL  DE GNPV +LLNDEGV+FVEAS ++TLD+VMP+KPS SLLNLHP
Sbjct  60   QKALAIYPEFAGRLSKDEHGNPVNILLNDEGVRFVEASANSTLDQVMPYKPSPSLLNLHP  119

Query  415  SLKG-VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
            SL   V ELVQVQ+T FTCGSL VGFT++H++ADG STSNFLVAWG+ACR + + P+PL 
Sbjct  120  SLNDDVKELVQVQLTWFTCGSLAVGFTSNHMIADGQSTSNFLVAWGQACRGLRVNPIPLH  179

Query  592  DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
            DRTIF PRNPP +E +H G E+  K +KK +H LN      L+DIVVHKVHFT+EFLAKL
Sbjct  180  DRTIFNPRNPPLVENEHKGVEFTSKLVKK-EHLLNQAHH-ILEDIVVHKVHFTIEFLAKL  237

Query  772  KAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHI  897
            KAKAS+MNG  +PYSTF SL+AHLWRAITKAR    FETT I
Sbjct  238  KAKASSMNGNNKPYSTFVSLIAHLWRAITKARGRNAFETTQI  279



>gb|AAO73072.1| putative agmatine coumaroyltransferase [Triticum aestivum]
Length=353

 Score =   386 bits (992),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 188/359 (52%), Positives = 256/359 (71%), Gaps = 8/359 (2%)
 Frame = +1

Query  307   VLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVV  483
             +LLND G +FVEA+ D  LD VMP KP+  +L+LHP+   G  EL+ +QVTRF CGSLVV
Sbjct  1     ILLNDAGARFVEATADVALDSVMPLKPTPEVLSLHPNGDDGPEELMLIQVTRFPCGSLVV  60

Query  484   GFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYM  660
             GFT  H+V+DG ST NF VAW +A R   I P+P+ DR + F PR P  +EY+H G E+ 
Sbjct  61    GFTTQHIVSDGRSTGNFFVAWSQATRGAAIDPVPVHDRASFFHPREPLHVEYEHRGVEFK  120

Query  661   PKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAH  840
             P + K +D    ++     D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAH
Sbjct  121   PCE-KVHDVVCGADGDD--DEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAH  175

Query  841   LWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLS  1020
             LWR++T AR L G E+T + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  PL 
Sbjct  176   LWRSMTMARGLDGGESTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVARPLK  235

Query  1021  YAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFP  1200
             +A +LI   VS++N+ Y +SFIDFANS  V E++ LV TAD    +L PN+EVDSWLR P
Sbjct  236   HAVELIIREVSRINDGYFKSFIDFANSGTV-EKERLVATADAADMVLSPNIEVDSWLRIP  294

Query  1201  FYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             FYD+D G G P+ FMP++ P EG++ LLPSF+GDGS+ A++PLF  ++ TFK  CY+LD
Sbjct  295   FYDMDLGGGRPFFFMPSYLPVEGLLILLPSFLGDGSVGAYVPLFSRDMNTFKNCCYTLD  353



>dbj|BAF97628.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=372

 Score =   385 bits (989),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 193/375 (51%), Positives = 260/375 (69%), Gaps = 6/375 (2%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLND  321
             +V DK ++D  I+VIYA+  P P N  +E GL +AL  YREWAGRLG D  G+  +LLND
Sbjct  1     TVLDKANFDTYISVIYAFHAPAPHNDVLEAGLARALVDYREWAGRLGVDANGDRAILLND  60

Query  322   EGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAH  498
              G +FVEA+ D  L  VMP KP+  +L+LHPS   G  EL+ +QVTRF CGS+VVGFT  
Sbjct  61    AGARFVEATADVALVSVMPLKPTSEVLSLHPSGDDGPEELMLIQVTRFPCGSIVVGFTTQ  120

Query  499   HLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIK  675
             H+V+DG ST NF VAW +A R   I P+P+ DR + F PR P  +EY+H G E+ P + K
Sbjct  121   HIVSDGRSTGNFFVAWSQATRGSAIDPVPVHDRASFFQPREPLHVEYEHRGVEFKPYK-K  179

Query  676   KNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAI  855
               D  +  +     D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAHLWR +
Sbjct  180   VYDDIVCGDGDDEDDEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAHLWRTM  237

Query  856   TKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKL  1035
             T AR L G E+T + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  P+ +A +L
Sbjct  238   TMARGLDGGESTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVSRPVKHAVEL  297

Query  1036  IHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLD  1215
             I   V+++N+ Y +SFIDFANS  V EE+ LV TAD  + +L PN+EVDSWLR PFYD+D
Sbjct  298   ISREVARINDGYFKSFIDFANSGAV-EEERLVATADAAEMVLSPNIEVDSWLRIPFYDMD  356

Query  1216  FGTGCPYIFMPTFFP  1260
             FG G P+ FMP++ P
Sbjct  357   FGGGRPFFFMPSYLP  371



>emb|CAE03578.1| OSJNBa0087O24.1 [Oryza sativa Japonica Group]
Length=430

 Score =   386 bits (992),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 209/445 (47%), Positives = 284/445 (64%), Gaps = 28/445 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYE-GNPPLTTTHV-PLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MK+ V S++ +KP+Y  G  P TT  V PL VFDK ++D  I+VIYAYRPP P N+ +E 
Sbjct  1     MKITVHSSKAVKPAYGPGEFPTTTGDVVPLKVFDKANFDTYISVIYAYRPPAPANAALEA  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL KAL  YREWAGRLG D +GN  +LLND G +FVEA+ D TLD VMP KP+       
Sbjct  61    GLAKALIEYREWAGRLGVDGDGNRAILLNDGGARFVEATADVTLDSVMPLKPTA------  114

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVA--WGKACRDVMIQPLP  585
                    E  ++   R  C +     + H+   D   T+  L+A  W        I P+P
Sbjct  115   -------ERGRLTSVRGACTN-----SKHNHGQDXPRTTKQLLACAWEPGHPRRRIPPVP  162

Query  586   LRDRTIFI-PRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
                  + +      ++E++H G E+ P    ++ H   S  A   D++V++KVH + EF+
Sbjct  163   RARPRLLLRAARHSQVEFEHRGVEFKPYDDDEDVH--ASAAAGDDDEVVINKVHLSREFI  220

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
             +KLK++ASA  G  RPYST + +VAHLWR +TKAR L G E+T + I+VDGRAR++P VP
Sbjct  221   SKLKSQASA--GAHRPYSTLQCVVAHLWRCMTKARGLDGRESTSVCIAVDGRARMSPPVP  278

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
             + Y GN+VLWA PTA   +L+  PL +A +LI+  V ++N+ Y +SFIDFANS  V EE+
Sbjct  279   DGYTGNVVLWARPTATAGELVTRPLKHAVELINREVIRINDGYFKSFIDFANSGAV-EEE  337

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGD  1302
              LV +AD  + +L PN+EVDSWLR PFYDLDFG G P+ FMP++ P EG++ LLPSF GD
Sbjct  338   RLVASADAAEMVLSPNIEVDSWLRIPFYDLDFGGGRPFFFMPSYLPVEGLLILLPSFFGD  397

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             GS+DA++PLF  ++  FK  CYS D
Sbjct  398   GSVDAYVPLFSRDMDVFKNCCYSFD  422



>ref|XP_002449839.1| hypothetical protein SORBIDRAFT_05g024230 [Sorghum bicolor]
 gb|EES08827.1| hypothetical protein SORBIDRAFT_05g024230 [Sorghum bicolor]
Length=477

 Score =   387 bits (995),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 208/477 (44%), Positives = 296/477 (62%), Gaps = 30/477 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSY--------EGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPP  213
             MK+ V+S++++KP Y              T   VPL+VFDKV+ D  ++ IY +RPP PP
Sbjct  1     MKITVQSSKSVKPDYGSCGGRRSSAASFATADFVPLTVFDKVTVDVYVSRIYFFRPPAPP  60

Query  214   NSTIELGLRKALGVYREWAGRLGNDEE---GNPVVLLNDEGVKFVEASGDTTLDKVMPFK  384
             +S +E GL KAL  YREWAGRL  D      N  +LLND G +FVEA+ D  LD VMP++
Sbjct  61    SSAMEAGLAKALAEYREWAGRLAMDATTSGNNRGILLNDAGARFVEAAADVALDSVMPWE  120

Query  385   PSVSLLNLHPSLKGVV----ELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGK  552
             P+    +LHP+         EL+ +QVTRF CGS  VG TAHHLV DG +  +F+VAWG+
Sbjct  121   PTPETTSLHPTGDDDDDGADELMLLQVTRFACGSFAVGTTAHHLVGDGPAVRSFVVAWGQ  180

Query  553   ACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMPK-QIKKNDHFLNSNDATFLDDI  726
             A R   + P+P+ DR + F+PR+PPR+++ H GAE+ P+ +        +S+ A     +
Sbjct  181   ATRGAAVDPVPVHDRVSFFVPRDPPRVQFAHRGAEFKPRGETPTGTRTSDSSPAAGGQVV  240

Query  727   VVHKVHFTLEFLAKLKAKASAMNGGAR----PYSTFESLVAHLWRAITKARNLGGFET-T  891
             VVH+ HF+ E + +L+++AS+   G R    PY+T + +VAHLW+ ITKAR +    T T
Sbjct  241   VVHRAHFSREMILELRSRASSSAAGVRFRPYPYTTLQCVVAHLWQCITKARRISTDSTAT  300

Query  892   HIRISVDGRARLN-PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNN  1068
              + I+V+GRAR+  P VP+ Y GN VLWA PTA   DL+  PL +  +LI   VS++++ 
Sbjct  301   ELHIAVNGRARMRRPPVPDGYTGNAVLWARPTATAGDLVAMPLRHVVELIRQGVSRIDDG  360

Query  1069  YIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGC------  1230
             Y RSFIDFA+S    E + LVPTAD  +    P++ V S L  PF+++DFG         
Sbjct  361   YFRSFIDFASSGGAVENEQLVPTADASETAKSPHVAVYSVLGSPFHEIDFGGAGAGGHGG  420

Query  1231  -PYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD*TGKLML  1398
              P+ FMP++ P EG++ ++PSF  DGS+DA++ LF  N+  FK  CYSL+  G+  L
Sbjct  421   QPFFFMPSYVPVEGLVVVVPSFCNDGSVDAYVSLFSHNVDEFKTCCYSLEAAGEARL  477



>ref|XP_010251817.1| PREDICTED: agmatine coumaroyltransferase-2-like [Nelumbo nucifera]
Length=429

 Score =   384 bits (985),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 191/441 (43%), Positives = 274/441 (62%), Gaps = 13/441 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M + + S   +K S   + P +   +PL++FDK ++D  + V+YA+R PTP N  ++ GL
Sbjct  1     MAIGLISNTILKASSSPDFPTSNDLIPLNLFDKAAFDIHVPVLYAFRAPTPSNEAMKEGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPS  417
              KAL  Y + AGR   D+ G   ++LN+ GV+ +E    T+L K +PF P+  + NL P 
Sbjct  61    SKALVHYPQLAGRFITDDHGRTCIILNNAGVRVIETYVPTSLAKQLPFSPASEVGNLLPP  120

Query  418   LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR  597
             L+GV EL+Q+Q+ R+ CG +V+G TAHH VADG S S F ++W    R + I+ LP  DR
Sbjct  121   LEGVQELLQIQLNRYACGGVVIGVTAHHRVADGQSMSYFTISWASLMRGLDIETLPYHDR  180

Query  598   -TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLK  774
               + +PRNPP++E+DH   E+             SN   F   I    VH + +F+ KLK
Sbjct  181   AAVSVPRNPPKVEFDHSSIEFRKSTA--------SNTNNFSSSIANLVVHLSADFITKLK  232

Query  775   AKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYF  954
              K      G + +STFE L++H+W+ IT+AR L   E T +R++V+GRAR+ P VP ++F
Sbjct  233   TKVCQ---GHQRFSTFECLLSHMWKKITQARGLAQDEFTQVRVAVNGRARMKPPVPMEFF  289

Query  955   GNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVP  1134
             GNLVLWA+P   V++LL E  ++ AK IH+AV+KV+N Y  SFIDF       +E  +V 
Sbjct  290   GNLVLWAYPRLMVEELLNESHAHVAKAIHEAVAKVDNEYFHSFIDFGELS-TGKEGEMVA  348

Query  1135  TADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSID  1314
             TA      LCPNLEVDSWLRF F+DLDFG G P +F+P   P EG++  +PS   +G++D
Sbjct  349   TAPEIGDSLCPNLEVDSWLRFHFHDLDFGGGGPCVFLPPDLPVEGLLIFVPSCKDEGAVD  408

Query  1315  AFIPLFQDNLPTFKQICYSLD  1377
              F+ L  +++  FKQICYSLD
Sbjct  409   VFLALLHEHVELFKQICYSLD  429



>ref|XP_006838773.1| hypothetical protein AMTR_s00002p00257740 [Amborella trichopoda]
 gb|ERN01342.1| hypothetical protein AMTR_s00002p00257740 [Amborella trichopoda]
Length=435

 Score =   378 bits (971),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/441 (44%), Positives = 284/441 (64%), Gaps = 14/441 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHV--PLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MK++ +S++ + PSYE    +++T    PL  FD+ + D  + +I+AY+ PTPPNST+E 
Sbjct  1     MKIQQQSSKLVTPSYENKSHVSSTSTTTPLGPFDRAAGDFHVPMIFAYKDPTPPNSTLEH  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL   L  YREWAGRL +D      +++ND+GV F+EA    TLD+ MP + +  LL+LH
Sbjct  61    GLSLILADYREWAGRLTDDRR---TIIVNDKGVPFIEAMASCTLDEAMPLESNPQLLDLH  117

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             PSLK + EL+QVQ+TRFTCGSLVVG T  HLVADG +   FL+AWGKA R   + P  + 
Sbjct  118   PSLKCMEELLQVQLTRFTCGSLVVGCTTSHLVADGQAVCFFLIAWGKATRGQWVSPTTMH  177

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
              R +  PR P  IE+DH+G EY  K++ +     +      + ++ +HK HF+ +FLA+L
Sbjct  178   CRAVIQPREPLSIEFDHLGVEYTEKRLVR-----DIPQGEMVRNLRLHKAHFSPDFLARL  232

Query  772   KAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDY  951
             K +AS      R YST ESLVAHLW+ + +  ++G  ET+ +R++V+  +RL P +P DY
Sbjct  233   KGQASLGCTSGRGYSTVESLVAHLWQKVAQL-SMGRSETSRLRMTVNVHSRLVPPIPKDY  291

Query  952   FGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDF-ANSKVVAEEDGL  1128
             FGN+VL       V +LL +PL   A+++  A++KVN+ Y RSF+DF A+ +   +   L
Sbjct  292   FGNMVLLGDVRIGVSELLSKPLHQVAEVVRAAIAKVNDRYARSFVDFDAHIERHGDWSEL  351

Query  1129  VPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGS  1308
             VPT ++D    CPNLEV+SWL F F D+DFG+G P++F+P+  P EG+M ++P   G   
Sbjct  352   VPTPELDG--FCPNLEVNSWLGFAFDDMDFGSGGPHVFLPSCLPDEGVMVIMPPMHGKRG  409

Query  1309  IDAFIPLFQDNLPTFKQICYS  1371
             ID ++PL   N   F++I +S
Sbjct  410   IDIYLPLSDPNKALFQRITHS  430



>gb|AFW60401.1| hypothetical protein ZEAMMB73_175715 [Zea mays]
Length=464

 Score =   376 bits (966),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 209/463 (45%), Positives = 292/463 (63%), Gaps = 33/463 (7%)
 Frame = +1

Query  58    MKVKVESTRTIKPS------YEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNS  219
             M++ V S++ +KP        +GN  +    VPLSVFDKV+YD  I  +YA+ PP PPN+
Sbjct  1     MEITVHSSKAVKPEPDYGGHSDGNASVAV--VPLSVFDKVNYDEYIFYVYAFHPPAPPNA  58

Query  220   TIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSL  399
              +E  L KAL  YREWAGRLG +  GNP ++LND G +FVEA+ D           +V+L
Sbjct  59    VLEAALAKALAEYREWAGRLGVEASGNPAIVLNDAGARFVEATADAEFG-----GSTVAL  113

Query  400   LN--------LHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKA  555
             L+        L+PS  GV EL+ VQVTRF C SLV+GFT HH VADG    NF+VAWG+A
Sbjct  114   LSTGGKVLSRLYPSCDGVEELLLVQVTRFRCASLVLGFTMHHKVADGPGMWNFMVAWGQA  173

Query  556   CRDVMIQPLPLRDRT--IFIPRNP--PRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDD  723
              R V I P+P+ DRT  +F  R     R++++H GAE+  K   +     +   A    D
Sbjct  174   TRGVAIDPVPVHDRTSSLFARRRERDSRVKFEHRGAEFKVKPRGEGPPASDGVGAVVRAD  233

Query  724   ---IVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTH  894
                +VVH+VHF+ E++ +LK++AS     +R Y+T + + AHLWR IT+AR L G E T 
Sbjct  234   DEVVVVHRVHFSREWITELKSRAS-QGAPSRQYTTLQCVAAHLWRCITEARGLHGREATR  292

Query  895   IRISVDGRARL-NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNY  1071
             IRI+V+GRAR+  P VP  Y G++VLWA+P   V++LL  PL YA +LI   V+++++ Y
Sbjct  293   IRIAVNGRARMVRPPVPEGYTGSVVLWAWPATTVRELLDRPLRYAVELISREVARIDDAY  352

Query  1072  IRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPT  1251
              RSF+DFA S  V E++ LVPTAD  +  LC +++VD  L  PF+ L+FG G P+ F P 
Sbjct  353   FRSFVDFAGSGAV-EKEQLVPTADAAEVPLCTDIDVDCLLAIPFHKLNFGCGPPFYFRPG  411

Query  1252  F--FPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             +   P  G +++L SF GDGS+DA++PLF+  +  FK+ C+S 
Sbjct  412   YGHAPVAGAIYVLRSFQGDGSVDAYVPLFRRTMDAFKKCCHSF  454



>ref|XP_010251818.1| PREDICTED: agmatine coumaroyltransferase-2-like [Nelumbo nucifera]
Length=428

 Score =   372 bits (956),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 187/433 (43%), Positives = 269/433 (62%), Gaps = 15/433 (3%)
 Frame = +1

Query  85    TIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYRE  264
             TI  +   + P +   +PL++FDK ++D  + ++YA+R P P N  ++ GL KAL  Y +
Sbjct  9     TILKASSSHHPTSNDLIPLNLFDKAAFDIHVPILYAFRAPMPSNEVLKEGLSKALVHYPQ  68

Query  265   WAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLKGVVELVQ  444
              AGR   D+ G   ++LN+ GV+ +E    T+L + +PF P+  +  L P L GV EL+Q
Sbjct  69    LAGRFITDDHGRTCIILNNAGVRVIETYVPTSLAEQLPFTPASEVDKLLPPLDGVQELLQ  128

Query  445   VQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNP  621
             +Q+ R+ CG +V+G T+HH VADG S S F ++W    R + I+ LP  DR  + +PRNP
Sbjct  129   IQLNRYACGGVVIGLTSHHRVADGQSMSYFTISWASLVRGLDIETLPYHDRAAVSVPRNP  188

Query  622   PRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGG  801
             P++E+DH   E+             SN   F   I    VH + +F+ KLK K      G
Sbjct  189   PKVEFDHSSIEFQKSTA--------SNTNNFSSSIANLVVHLSADFITKLKTKVCQ---G  237

Query  802   ARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFP  981
              + +STFE L++H+W+ IT+AR L   E T +R++V+GRAR+ P VP ++FGNLVLWA+P
Sbjct  238   HQRFSTFECLLSHMWKKITQARGLAPDEYTQVRVAVNGRARMKPPVPMEFFGNLVLWAYP  297

Query  982   TAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG-LVPTADMDKHI  1158
                VK+LL E  ++ AK IH+AV+KV+N Y  SFIDF   ++  E+DG LV TA      
Sbjct  298   RLVVKELLNESHAHIAKAIHEAVAKVDNEYFHSFIDFG--ELSKEKDGELVATAPDIGDS  355

Query  1159  LCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQD  1338
             LCPN+EVDSWLRF F+DLDFG G P  F+P   P EG++  +PS    G++D F+ L  +
Sbjct  356   LCPNMEVDSWLRFHFHDLDFGGGGPCAFLPPDLPVEGLLIFVPSCKEKGAVDVFLALLHE  415

Query  1339  NLPTFKQICYSLD  1377
             ++  FKQICYSLD
Sbjct  416   HVELFKQICYSLD  428



>ref|XP_008671764.1| PREDICTED: agmatine coumaroyltransferase-2-like [Zea mays]
 tpg|DAA40667.1| TPA: hypothetical protein ZEAMMB73_908255 [Zea mays]
Length=406

 Score =   367 bits (942),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 214/447 (48%), Positives = 272/447 (61%), Gaps = 48/447 (11%)
 Frame = +1

Query  58    MKVKVESTRTIKPSY-EGNP-PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV S++ +KPSY  G P P TT HVP SVFDK +Y  Q   IY   PP P    IE 
Sbjct  1     MEVKVLSSKLVKPSYPAGAPRPDTTKHVPSSVFDKATYHTQTVTIYYISPPVPSPDAIER  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             G   ALG YR +AG++    +G P VLLND G + VEAS D  L  + P KP  ++L LH
Sbjct  61    GYATALGAYRLFAGQVRPGPDGAPGVLLNDHGARLVEASVDARLADIAPTKPPPAVLRLH  120

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P L  +VE+VQVQ+TRF CGSL VGFTA+  VADGH+TS+FLVAW +A R + + P P  
Sbjct  121   PDLD-IVEVVQVQLTRFACGSLAVGFTANPAVADGHATSDFLVAWDRAARGLPVGPSP--  177

Query  592   DRTIFIPR-NPPRIEYDHVGAEYM-PKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLA  765
                 F PR +PPR  ++H G EY  P     + H    +  T    IVVHK HFT +F+A
Sbjct  178   -PVHFPPRHDPPRAGFEHRGVEYYRPAPSLAHGHV---HGDTTQHSIVVHKAHFTKDFVA  233

Query  766   KLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGG--FETTHIRISVDGRARLNPKV  939
              L+A+AS   G  RP+S FE+++AH+WR +T+AR LG    + + IRISVDGR RL    
Sbjct  234   GLRARAS--EGRGRPFSRFETILAHVWRTMTRARGLGSNPLQISTIRISVDGRPRLA-AA  290

Query  940   PNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNY-IRSFIDFANSKVVAE  1116
             P  YFGNLVLWAFP A V  LL  PL +AA+ IHDAV++V+  Y  +SF+DFA S  V E
Sbjct  291   PAGYFGNLVLWAFPRATVGSLLGRPLKHAAQAIHDAVARVDGAYDFQSFVDFAGSGTV-E  349

Query  1117  EDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFI  1296
             ++GL  TA                              P      +FPTEGM+ L+PS+I
Sbjct  350   KEGLETTA------------------------------PAQGGRAYFPTEGMLLLVPSYI  379

Query  1297  GDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             GDGSIDA +P+F+ NL  FKQ CYS++
Sbjct  380   GDGSIDAIVPVFEHNLDAFKQCCYSME  406



>emb|CDM81057.1| unnamed protein product [Triticum aestivum]
Length=454

 Score =   363 bits (933),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 210/457 (46%), Positives = 289/457 (63%), Gaps = 25/457 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNST--IEL  231
             M+V V S++ +KP+          ++PLSVFDKV+Y   +A+I+A+  P P  +   +E 
Sbjct  1     MEVHVLSSKLVKPASTKLAAGAPEYIPLSVFDKVTYQMHMAMIFAFAAPAPAPTAAALEK  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPF----KPSVSL  399
             GL  AL  YR  AG+L  +    PV+LLND G + VEA  D  +  V       KP +  
Sbjct  61    GLAAALSEYRTLAGQLVRNRSEGPVMLLNDRGARVVEACVDADMVDVDVAQPNPKPELLQ  120

Query  400   LNLHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQP  579
             L L    + + E+V VQ+TRF CGSL VGF  +H VADG +TSNFLVAWG+A R + +  
Sbjct  121   LLLDLEEEAIKEVVVVQLTRFRCGSLAVGFARNHAVADGRATSNFLVAWGRATRGLTMGL  180

Query  580   LPLRDRT---IFIPR------NPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVV  732
              P+       +F PR      N   +E+DH   EY             + D      IVV
Sbjct  181   PPMYKYNHLDLFQPRLTSHCINELELEFDHRNREYYLPPPPAPAPTATAADKKV---IVV  237

Query  733   HKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVD  912
             HK HF+ +++A L+   S   G  RP++ FE+++A LWRA+T+AR L   + + +RISVD
Sbjct  238   HKAHFSKDWIAGLRDTTS--QGRDRPFTRFETILAQLWRAMTRARGLSHDDISTVRISVD  295

Query  913   GRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNN-NYIRSFID  1089
             GR+RL   +P +Y GNLVLWAFP A+V DLL +PLS+AA+LIHD V++V +  Y RSF+D
Sbjct  296   GRSRLG--MPAEYAGNLVLWAFPRARVSDLLGQPLSHAAQLIHDEVARVADPAYFRSFVD  353

Query  1090  FANSKVVAEEDGLVPTADMD-KHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTE  1266
             FA S VV E++GL P+++++ + +LCP+LEV SWL F FYD+DFGTG P   MP++ P E
Sbjct  354   FATSGVV-EQEGLAPSSEINMRDVLCPDLEVHSWLTFQFYDMDFGTGTPTYVMPSYIPAE  412

Query  1267  GMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             G++FL PS+IGDGSIDAF+P+FQDNL  FKQ  YS+D
Sbjct  413   GLIFLAPSYIGDGSIDAFVPVFQDNLEAFKQCLYSID  449



>ref|XP_004979693.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=467

 Score =   364 bits (934),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 194/426 (46%), Positives = 265/426 (62%), Gaps = 17/426 (4%)
 Frame = +1

Query  133   VPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLG--NDEEGNPV  306
             +PL+VFD+ ++D  +  I+A+ PP PP   +E GL K L  YR WAGR+   +   G   
Sbjct  37    IPLTVFDEANHDEYVPGIFAFHPPAPPVDALEAGLAKMLAEYRHWAGRIVTVDATSGKRA  96

Query  307   VLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK---GVVELVQVQVTRFTCGSL  477
             +LLND GV+ VEA+ D  L  V P +P+   L L PS        EL+ +QVTRF CGS 
Sbjct  97    ILLNDAGVRLVEATADVALTDVTPLEPTPEALRLQPSSDDDGAEGELMLLQVTRFRCGSF  156

Query  478   VVGFTAHHLVADGHSTSNFLVAWGKACRDVM-IQPLPLRDR-TIFIPRNPPRIEYDHVGA  651
              VG++ HH VADG++T   L+AWG+A R      P P+ DR ++F+PR+PP +E++H GA
Sbjct  157   AVGYSMHHSVADGYATCTSLLAWGQAVRGAAAFDPAPVHDRASLFVPRDPPLVEFEHRGA  216

Query  652   EYMPKQIKKNDHFLNSNDATF-LDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFES  828
             E+ P+  KK    L+  D     +++V+  V F+ EF+A+LK++ASA  G  RPYS  + 
Sbjct  217   EFKPRAEKKKA--LDVVDVVGDGNEVVMQTVRFSREFVARLKSEASA--GRRRPYSAAQC  272

Query  829   LVAHLWRAITKARNLGGFETTHIRISVDGRARL-NPKVPNDYFGNLVLWAFPTAKVKDLL  1005
             + AHLWR +T AR LG  E T + I+V+GR R+ +P VP  Y GN VLWA P    +DLL
Sbjct  273   VAAHLWRCVTAARGLGAHEVTKLHIAVNGRFRMTDPPVPKGYTGNAVLWARPATTARDLL  332

Query  1006  REPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDS  1185
               PL  AA+LI  AVS V+  Y  SF+DFA+S  V E +GLV TA   + +   N+EVDS
Sbjct  333   HSPLRRAAQLISKAVSGVDGRYFHSFVDFASSGAV-EREGLVRTAVSSELVARTNIEVDS  391

Query  1186  WLRFPFYDLDFGTGCPYIFMPTFF---PTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFK  1356
              L  PFYDLDFGTG P++FMPT+    P EG  FL+P   G G + A++PL++  +  F 
Sbjct  392   VLGIPFYDLDFGTGKPFLFMPTYSTPQPVEGAAFLVPEADGGGGVVAYVPLYRRAVDAFA  451

Query  1357  QICYSL  1374
               CYSL
Sbjct  452   SCCYSL  457



>dbj|BAF97631.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=372

 Score =   353 bits (907),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 240/351 (68%), Gaps = 8/351 (2%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLND  321
             +V DK ++D  I+VIYA+  P PPN  +E GL + L  YREWAGRLG D  G   +LLND
Sbjct  1     TVLDKANFDTYISVIYAFHAPAPPNDVLEAGLARVLVDYREWAGRLGVDANGERAILLND  60

Query  322   EGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAH  498
              G +FVEA+ D  LD VMP KP+  +L+LHPS   G  EL+ +QVTRF+CGSLVVGFT  
Sbjct  61    AGARFVEATADVALDSVMPLKPTPEVLSLHPSGDDGPEELMLIQVTRFSCGSLVVGFTTQ  120

Query  499   HLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIK  675
             H+V+DG ST NF VAW +A R   + P+P+ DR + F PR P  +EY+H G E+ P +  
Sbjct  121   HIVSDGRSTGNFFVAWSQATRGAAVDPVPVHDRASFFHPREPLHVEYEHRGVEFKPYEKV  180

Query  676   KNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAI  855
              +D      D    D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAHLWR +
Sbjct  181   HDDVVRADGDD---DEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAHLWRTM  235

Query  856   TKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKL  1035
             T AR L G E+T + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  P+ +A +L
Sbjct  236   TMARGLDGGESTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVARPVKHAVEL  295

Query  1036  IHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSW  1188
             I   V+++N+ Y +SFIDFA+S  V E++ L+ TAD  + +L PN+EV+ W
Sbjct  296   ISREVARINDGYFKSFIDFASSGAV-EKERLLATADAAEMVLSPNIEVEWW  345



>tpg|DAA64271.1| TPA: hypothetical protein ZEAMMB73_959583 [Zea mays]
Length=416

 Score =   355 bits (911),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 204/447 (46%), Positives = 276/447 (62%), Gaps = 38/447 (9%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLT--TTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M+VKV+S++ +KP++   PP      +VPLSVFD V+Y  Q+A+IYA+ PP P  + IE 
Sbjct  1     MEVKVQSSKLVKPAFIAAPPREHDDEYVPLSVFDTVTYQMQMAIIYAFPPPAPSTAAIEK  60

Query  232   GLRKALGVYREWAGRLGNDEEGN-PVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
             GL   L  YR +AG++    +G    VLLND G + VEA+ D     + P KP+  LL L
Sbjct  61    GLAAVLAEYRTFAGQIRVPRDGGTAAVLLNDHGARIVEATVDANFVDLAPAKPTPELLLL  120

Query  409   HPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPL  588
             HP ++   EL +V +    C S   G      VA   S S    +     R     P   
Sbjct  121   HPDIEQ--ELQEVVL----CSSPGSG------VAPSPSGSRPTTS-----RPTATPPATS  163

Query  589   RDRTIFIPRNPPRI----EYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
                    P   PR     EY H     +P     N+H     D   +D IV+HK HFT E
Sbjct  164   SWPGDAPPGASPRACRLPEYYH-----LPSPAADNNHGYGDEDV--IDSIVIHKAHFTKE  216

Query  757   FLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPK  936
             F+A L+++AS   G  RP+S FE+++AHLWR +T+AR L   ET+ IR+SVDGR RL   
Sbjct  217   FIAGLRSRAS--EGRGRPFSRFETILAHLWRTLTRARALSPDETSQIRLSVDGRHRLG--  272

Query  937   VPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAE  1116
             +P +YFGNLVLWAFPTA V DLL +PL +AA++IHD V++V+ NY RSFIDFA S  V E
Sbjct  273   LPAEYFGNLVLWAFPTATVADLLAQPLKHAAQVIHDEVARVDGNYFRSFIDFATSGAV-E  331

Query  1117  EDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFI  1296
             ++GL P+A + K +LCPN+ VDSWL FPF +LDFGTG P  FMP+++P+EG ++L+PSF 
Sbjct  332   KEGLAPSA-VCKDVLCPNVSVDSWLTFPFCELDFGTGSPTYFMPSYYPSEGTLYLVPSF-  389

Query  1297  GDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             GDGS+DAF+P+F+ NL  FK+ CY ++
Sbjct  390   GDGSVDAFVPVFKHNLEAFKECCYHVE  416



>gb|KDP43925.1| hypothetical protein JCGZ_05392 [Jatropha curcas]
Length=376

 Score =   351 bits (901),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 206/450 (46%), Positives = 258/450 (57%), Gaps = 84/450 (19%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTH-VPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MKV +E T  +KP  + N  P    +H VPLSVFDKV Y+  +A+IYAY PPTP N+TIE
Sbjct  1     MKVTIEKTEIVKPFCDSNKIPTDPKSHFVPLSVFDKVRYNTHVAIIYAYNPPTPTNATIE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
             +GL+K L  YREWAGRLG DE G+PV+ LND+G  FVEAS    L++VMP + S  L +L
Sbjct  61    VGLKKVLSEYREWAGRLGEDENGDPVIFLNDKGGNFVEASIGIKLEQVMPLQSSPFLRSL  120

Query  409   HPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPL  588
             HP +K V  L+QVQ+TRF C SLV+G TAH L+ADGHS  NFLVAWGKA R + I PLPL
Sbjct  121   HPKVKDVEALLQVQLTRFACVSLVIGLTAHQLIADGHSAGNFLVAWGKATRGLDINPLPL  180

Query  589   RDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIV------VHKVHFT  750
               RTIF PRN P  E++H G E+  K I         ND +  D ++         VHFT
Sbjct  181   HGRTIFNPRNQPYFEFEHKGVEFKCKNI--------VNDCSNYDGMLVEEVEVHKVVHFT  232

Query  751   LEFLAKLKAKAS-AMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARL  927
             +EFL++LK +AS ++  GA    T                   G+    IR +V+     
Sbjct  233   MEFLSELKTRASNSLPNGANVQET------------------SGYAAKLIRDAVES----  270

Query  928   NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKV  1107
                V + YF + +                                        DFA  K 
Sbjct  271   ---VNDKYFKSFI----------------------------------------DFATVKA  287

Query  1108  VAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLP  1287
               +E+ LVPTAD +  +  PNL+VDSWLR PFY+LDFG G P IFMP++   EG MFLLP
Sbjct  288   KKDEE-LVPTADANVFMYTPNLKVDSWLRVPFYELDFGGGSPCIFMPSYIAKEGFMFLLP  346

Query  1288  SFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             SF GDGS+DA I LF+ N+ TFKQI YSLD
Sbjct  347   SFKGDGSVDACITLFRKNMATFKQIVYSLD  376



>dbj|BAF97636.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=377

 Score =   350 bits (898),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 180/353 (51%), Positives = 243/353 (69%), Gaps = 7/353 (2%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLND  321
             +V DK ++D  I+VIYA+  P PPN  +E GL KAL  YREWAGRLG D  G+  ++LND
Sbjct  1     TVLDKANFDTYISVIYAFHAPAPPNDVLEAGLAKALVDYREWAGRLGVDANGDRAIMLND  60

Query  322   EGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAH  498
              G +FVEA+ D  LD VMP KP+  +LNLHPS   G  EL+ +QVTRF CGSLVVGFT  
Sbjct  61    AGARFVEATADVALDSVMPLKPTSEVLNLHPSGDDGPEELMLIQVTRFPCGSLVVGFTTQ  120

Query  499   HLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMP--KQ  669
             H+V+DG ST NF VAW +A R   I P+P+ DR + F PR P  +EY+H G E+ P  K 
Sbjct  121   HIVSDGRSTGNFFVAWSQATRGAAIDPVPVHDRASFFHPREPLHVEYEHRGVEFKPYKKV  180

Query  670   IKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWR  849
                  H    +D    D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAHLWR
Sbjct  181   HDDVVHGDGDDDEDDDDEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAHLWR  238

Query  850   AITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAA  1029
             ++TKAR L G ETT + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  P+ +A 
Sbjct  239   SMTKARGLDGGETTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVARPVKHAV  298

Query  1030  KLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSW  1188
             +LI   V+++N+ Y +SFIDFA+S  V E++ L+ TAD  + +L PN+EV+ W
Sbjct  299   ELISREVARINDGYFKSFIDFASSGAV-EKERLLATADAAEMVLSPNIEVEWW  350



>dbj|BAF97641.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=377

 Score =   347 bits (891),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 243/353 (69%), Gaps = 7/353 (2%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLND  321
             +V DK ++D  I+VIYA+R   PPN+ +E GL +AL  YREWAGRLG D  G   ++LND
Sbjct  1     TVLDKANFDTYISVIYAFRASAPPNAVLEAGLARALVDYREWAGRLGVDPNGERAIMLND  60

Query  322   EGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAH  498
              G +FVEA+ D  LD VMP KP+  +L+LHPS   G  EL+ +QVTRF CGSLVVGFT  
Sbjct  61    AGARFVEATADVALDSVMPLKPTPEVLSLHPSGDDGPEELMLIQVTRFACGSLVVGFTTQ  120

Query  499   HLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMP--KQ  669
             H+V+DG ST NF VAW +A R   I P+P+ DR + F PR P  +EY+H G E+ P  K 
Sbjct  121   HIVSDGRSTGNFFVAWSQATRGAAIDPVPVHDRASFFHPREPLHVEYEHRGVEFKPYKKV  180

Query  670   IKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWR  849
                  H    +D    D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAHLWR
Sbjct  181   HDDVVHGDGDDDEDDDDEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAHLWR  238

Query  850   AITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAA  1029
             ++TKAR L G ETT + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  P+ +A 
Sbjct  239   SMTKARGLDGGETTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVARPVKHAV  298

Query  1030  KLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSW  1188
             +LI   V+++N+ Y +SFIDFA+S  V E++ L+ TAD  + +L PN+EV+ W
Sbjct  299   ELISREVARINDGYFKSFIDFASSGAV-EKERLLATADAAEMVLSPNIEVEWW  350



>dbj|BAF97629.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=377

 Score =   347 bits (891),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 243/353 (69%), Gaps = 7/353 (2%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLND  321
             +V DK ++D  I+VIYA+  P PPN+ +E GL +AL  YREWAGRLG D  G   ++LND
Sbjct  1     TVLDKANFDTYISVIYAFHAPAPPNAVLEAGLARALVDYREWAGRLGVDPNGERAIMLND  60

Query  322   EGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAH  498
              G +FVEA+ D  LD VMP KP+  +L+LHPS   G  EL+ +QVTRF CGSLVVGFT  
Sbjct  61    AGARFVEATADVALDSVMPLKPTPEVLSLHPSGDDGPEELMLIQVTRFACGSLVVGFTTQ  120

Query  499   HLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMP--KQ  669
             H+V+DG ST NF VAW +A R   I P+P+ DR + F PR P  +EY+H G E+ P  K 
Sbjct  121   HIVSDGRSTGNFFVAWSQATRGAAIDPVPVHDRASFFHPREPLHVEYEHRGVEFKPYKKV  180

Query  670   IKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWR  849
                  H    +D    D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAHLWR
Sbjct  181   HDDVVHGDGDDDEDDDDEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAHLWR  238

Query  850   AITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAA  1029
             ++TKAR L G ETT + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  P+ +A 
Sbjct  239   SMTKARGLDGGETTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVARPVKHAV  298

Query  1030  KLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSW  1188
             +LI   V+++N+ Y +SFIDFA+S  V E++ L+ TAD  + +L PN+EV+ W
Sbjct  299   ELISREVARINDGYFKSFIDFASSGAV-EKERLLATADAAEMVLSPNIEVEWW  350



>gb|AAV44204.1| hypothetical protein [Oryza sativa Japonica Group]
Length=433

 Score =   348 bits (894),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 201/453 (44%), Positives = 264/453 (58%), Gaps = 36/453 (8%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M V++ES++ +KP Y+                 V+YD  +AVIYA+RPPTPPN+ +ELGL
Sbjct  1     MNVRIESSKIVKPLYDAG---GGARRRRRPARAVTYDVYMAVIYAFRPPTPPNAALELGL  57

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEG-VKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
              K L VYREWAG L +   G   VLLND G   FVEA+    L  VMP            
Sbjct  58    AKTLAVYREWAGELAD---GGDAVLLNDRGGALFVEAAVSAPLAAVMP----CCGCTRAG  110

Query  415   SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRD  594
               +   ELV+VQ+TRF CGSLV+GFT+HH VA G +  NFLVAWG A R + + PLP+ D
Sbjct  111   GGRAGRELVRVQLTRFACGSLVIGFTSHHRVAYGQAAGNFLVAWGLASRRLPVAPLPVCD  170

Query  595   R-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDD---IVVH---KVHFTL  753
             R T F PR+PP +++ H   EY   + KK +H   +      DD    V H   KVHFT 
Sbjct  171   RATRFPPRHPPLVQFPHRDTEYYAPKKKKKNHDAGAVAVEDDDDELATVAHDKIKVHFTK  230

Query  754   EFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITK---ARNLGGFETTHIRISVDGRAR  924
             EF+A      +             +      R   +   AR L   E T +R+SV+GR R
Sbjct  231   EFVAGACVVVAVAV----------AAWVQHVRERGRPPLARGLAAGEATTLRVSVNGRTR  280

Query  925   LNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSK  1104
             + P VP  YFGNLVLWAFP     +L   P+ +AAKLI  AV++ ++ Y RSF+DFA+S 
Sbjct  281   MRPAVPRGYFGNLVLWAFPRCAAGELASRPVQHAAKLIRRAVARADDAYFRSFVDFASSG  340

Query  1105  VVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDF----GTGCPYIFMPTFFPTEGM  1272
              V E +GL  TAD  + +LCP++EVDSWL   FY+LDF    G G P+ F P++ P EG 
Sbjct  341   AV-EAEGLAATADESQAVLCPDVEVDSWLGIDFYELDFGGGGGGGGPFYFTPSYLPMEGT  399

Query  1273  MFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYS  1371
             +FL+PSF GDG IDA++ LF+ +L  FK+ICY+
Sbjct  400   VFLVPSFAGDGGIDAYVALFETHLDEFKKICYT  432



>dbj|BAF97634.1| agmatine coumaroyltransferase [Triticum aestivum]
Length=377

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 241/353 (68%), Gaps = 7/353 (2%)
 Frame = +1

Query  142   SVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLND  321
             +V DK ++D  I+VIYA+  P PPN  +E GL + L  YREWAGRLG D  G   +LLND
Sbjct  1     TVLDKANFDTYISVIYAFHAPAPPNDVLEAGLARVLVDYREWAGRLGVDANGERAILLND  60

Query  322   EGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAH  498
              G +FVEA+ D  LD VMP KP+  +L+LHPS   G  EL+ +QVTRF CGSLVVGFT  
Sbjct  61    AGARFVEATADVALDSVMPLKPTPEVLSLHPSGDDGPEELMLIQVTRFACGSLVVGFTTQ  120

Query  499   HLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMP--KQ  669
             H+V+DG ST NF VAW +A R   I P+P+ DR + F PR P  +EY+H G E+ P  K 
Sbjct  121   HIVSDGRSTGNFFVAWSQATRGAAIDPVPVHDRASFFHPREPLHVEYEHRGVEFKPYKKV  180

Query  670   IKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWR  849
                  H    +D    D++VV+KVHF+ EF+++LKA+ASA  G  RP ST + +VAHLWR
Sbjct  181   HDDVVHGDGDDDEDDDDEVVVNKVHFSREFISRLKAQASA--GAPRPCSTLQCVVAHLWR  238

Query  850   AITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAA  1029
             ++TKAR L G ETT + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  P+ +A 
Sbjct  239   SMTKARGLDGGETTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVARPVKHAV  298

Query  1030  KLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSW  1188
             +LI   V+++N+ Y +SFIDFA+S  V E++ L+ TAD  + +L PN+EV+ W
Sbjct  299   ELISREVARINDGYFKSFIDFASSGAV-EKERLLATADAAEMVLSPNIEVEWW  350



>ref|XP_008670871.1| PREDICTED: agmatine coumaroyltransferase-2-like [Zea mays]
 tpg|DAA42293.1| TPA: hypothetical protein ZEAMMB73_654125 [Zea mays]
Length=467

 Score =   347 bits (890),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 197/461 (43%), Positives = 285/461 (62%), Gaps = 23/461 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPL---TTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MK+ V+S++ +  S  G  P        VPL+VFDK+ YD  +  +Y + PP PP+S +E
Sbjct  1     MKITVQSSKLVTGSSSGGRPSSADAAEAVPLTVFDKLHYDLYVHALYFFHPPAPPSSVLE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDT----TLDKVMPFKPSV-  393
              GL  AL  Y EWAGRLG D  GN  +LLN  G + VEA+       +LD V+P +P+  
Sbjct  61    AGLAAALAEYPEWAGRLGVDARGNRAILLNGAGARLVEATAAAADVCSLDSVVPPEPATP  120

Query  394   SLLNLHPSLKGVV--ELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV  567
             + ++LHPS +  V  E++ +QVTRF CGS VVG    H+V DG +   F+ AWG+A R  
Sbjct  121   ATMSLHPSAEDAVDGEVLLLQVTRFACGSFVVGTAVQHVVGDGAAFHCFVSAWGQASRGA  180

Query  568   MIQPLPLRDR-TIFIPRNPPRIEYDHVGAEY-MPKQIKKNDHFLNSNDA---------TF  714
              + P P+ DR + F+PR+PP +E++H GAEY  P + ++ +     +++           
Sbjct  181   AVDPAPVHDRVSFFVPRHPPLVEFEHRGAEYKRPPRPREGEEKAGGSESGAKAKANADVG  240

Query  715   LDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTH  894
                +V  +V+F+ EF+A+LK +ASA     R YST + + AHLWR +T+AR L     T 
Sbjct  241   EKQLVTRRVNFSREFVAELKTRASAGAPLPRRYSTLQCVAAHLWRCVTRARRLDARARTT  300

Query  895   IRISVDGRARL-NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNY  1071
             +RI+V+GR+R+ NP+VP  Y GN+VLWA  TA    L+R PL  A +L+ +AV+ V++ Y
Sbjct  301   LRIAVNGRSRMRNPRVPEAYAGNVVLWARATAAAGGLVRSPLPEAVRLVSEAVAAVDDAY  360

Query  1072  IRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPT  1251
              RS IDFA+S  + EE+GLVP AD  + +  P++EV S L   F D DFG G P+ FMP+
Sbjct  361   FRSVIDFASSGAL-EEEGLVPAADPLETVFSPDVEVYSLLGASFQDFDFGGGPPFFFMPS  419

Query  1252  FFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             + P EG +F++ SF GDGSIDA++PLF   +  F + C+SL
Sbjct  420   YSPVEGAVFVVSSFSGDGSIDAYVPLFSHAMDIFDKCCHSL  460



>ref|XP_008680089.1| PREDICTED: agmatine coumaroyltransferase-2-like [Zea mays]
Length=837

 Score =   355 bits (910),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 193/419 (46%), Positives = 266/419 (63%), Gaps = 15/419 (4%)
 Frame = +1

Query  157   VSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKF  336
             V+YD  I  +YA+ PP PPN+ +E  L KAL  YREWAGRLG +  GNP ++LND G +F
Sbjct  411   VNYDEYIFYVYAFHPPAPPNAVLEAALAKALAEYREWAGRLGVEASGNPAIVLNDAGARF  470

Query  337   VEASGDTTLDKVMPFKPSVS---LLNLHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLV  507
             VEA+ D           S     L  L+PS  GV EL+ VQVTRF C SLV+GFT HH V
Sbjct  471   VEATADAEFGGSTVALLSTGGKVLSRLYPSCDGVEELLLVQVTRFRCASLVLGFTMHHKV  530

Query  508   ADGHSTSNFLVAWGKACRDVMIQPLPLRDRT--IFIPRNP--PRIEYDHVGAEYMPKQIK  675
             ADG    NF+VAWG+A R V I P+P+ DRT  +F  R     R++++H GAE+  K   
Sbjct  531   ADGPGMWNFMVAWGQATRGVAIDPVPVHDRTSSLFARRRERDSRVKFEHRGAEFKVKPRG  590

Query  676   KNDHFLNSNDATFLDD---IVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLW  846
             +     +   A    D   +VVH+VHF+ E++ +LK++AS     +R Y+T + + AHLW
Sbjct  591   EGPPASDGVGAVVRADDEVVVVHRVHFSREWITELKSRAS-QGAPSRQYTTLQCVAAHLW  649

Query  847   RAITKARNLGGFETTHIRISVDGRARL-NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSY  1023
             R IT+AR L G E T IRI+V+GRAR+  P VP  Y G++VLWA+P   V++LL  PL Y
Sbjct  650   RCITEARGLHGREATRIRIAVNGRARMVRPPVPEGYTGSVVLWAWPATTVRELLDRPLRY  709

Query  1024  AAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPF  1203
             A +LI   V+++++ Y RSF+DFA S  V E++ LVPTAD  +  LC +++VD  L  PF
Sbjct  710   AVELISREVARIDDAYFRSFVDFAGSGAV-EKEQLVPTADAAEVPLCTDIDVDCLLAIPF  768

Query  1204  YDLDFGTGCPYIFMPTF--FPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             + L+FG G P+ F P +   P  G +++L SF GDGS+DA++PLF+  +  FK+ C+S 
Sbjct  769   HKLNFGCGPPFYFRPGYGHAPVAGAIYVLRSFQGDGSVDAYVPLFRRTMDAFKKCCHSF  827


 Score =   340 bits (871),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 184/414 (44%), Positives = 261/414 (63%), Gaps = 24/414 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYE-----GNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNST  222
             M++ V S+R++KP+Y      G    +   V LSVFDK+SYD  I  + A+ PP PPN  
Sbjct  1     MEIIVHSSRSVKPNYGDRSDGGAVAASVEVVHLSVFDKISYDEYITGVCAFHPPAPPNHI  60

Query  223   IELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDK--VMPFKPSVS  396
             +E GL  AL VYREWAGRLG D  GN  ++LND G ++VEA+ D  L    V+      +
Sbjct  61    LEAGLATALAVYREWAGRLGMDGTGNRAIVLNDAGARYVEATADAELSSSVVLELTTGAN  120

Query  397   LLNLH-PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMI  573
             LL+L+ PS  G  EL+  QVTRF CGS++VG + HH VADGH+   FL AWG+A R V I
Sbjct  121   LLSLYPPSCDGAKELLLAQVTRFRCGSIIVGVSVHHRVADGHAIWAFLFAWGQATRGVRI  180

Query  574   -QPLPLRDR----TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHK  738
                +P++ R    ++F PR+PP++++DH G E+ P      D    +  A   D++V+H+
Sbjct  181   DDSIPVQQRHDRLSLFAPRDPPQVKFDHRGNEFKP---HVGDASGGNGAAHAGDEVVIHR  237

Query  739   VHFTLEFLAKLKAKAS-----AMNGGARPY-STFESLVAHLWRAITKARNLGGFETTHIR  900
             VHF+ E++ +LK+++           ARPY +T + + AHLWR IT AR L G +TT +R
Sbjct  238   VHFSKEWIMELKSQSQAAASEGAAATARPYTTTLQCVAAHLWRCITAARGLDGNQTTRMR  297

Query  901   ISVDGRARL-NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIR  1077
             I+V+GR+R+ +P+VP  Y GN VLWA+PT   ++L R+ +    +LI   V+++++ Y R
Sbjct  298   IAVNGRSRMKDPRVPVGYTGNAVLWAWPTTTARELGRQHIRETVELISREVARIDDAYFR  357

Query  1078  SFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYI  1239
             SFIDFA S  V E++ LVPTAD  +  L PN+EVDS L  PFYD+DFG   P +
Sbjct  358   SFIDFAGSGAV-EKEQLVPTADSLELTLSPNVEVDSLLGIPFYDMDFGGARPAL  410



>gb|EMS45531.1| Agmatine coumaroyltransferase-1 [Triticum urartu]
Length=313

 Score =   335 bits (859),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 225/314 (72%), Gaps = 6/314 (2%)
 Frame = +1

Query  445   VQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNP  621
             +QVTRF CGSLVVGFT  H+V+DG ST NF VAW +A R   I P+P+ DR + F PR P
Sbjct  3     IQVTRFACGSLVVGFTTQHIVSDGRSTGNFFVAWSQATRGAAIDPVPVHDRASFFHPREP  62

Query  622   PRIEYDHVGAEYMP--KQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMN  795
               +EY+H G E+ P  K      H    +D    D++VV+KVHF+ EF+++LKA+ASA  
Sbjct  63    LHVEYEHRGVEFKPYKKVHDDVVHGDGDDDEDDDDEVVVNKVHFSREFISRLKAQASA--  120

Query  796   GGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWA  975
             G  RP ST + +VAHLWR++TKAR L G ETT + I+VDGRAR++P+VP+ Y GN++LWA
Sbjct  121   GAPRPCSTLQCVVAHLWRSMTKARGLDGGETTSVAIAVDGRARMSPQVPDGYTGNVILWA  180

Query  976   FPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKH  1155
              PT    +L+  P+ +A +LI   V+++N+ Y +SFIDFA+S  V E++ L+ TAD  + 
Sbjct  181   RPTTTAGELVARPVKHAVELISREVARINDGYFKSFIDFASSGAV-EKERLLATADAAEM  239

Query  1156  ILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQ  1335
             +  PN+EVDSWLR PFYD+DFG G P+ FMP++ P EG++ LLPSF+GDGS+DA++PLF 
Sbjct  240   VPSPNIEVDSWLRIPFYDMDFGGGRPFFFMPSYLPVEGLLILLPSFLGDGSVDAYVPLFS  299

Query  1336  DNLPTFKQICYSLD  1377
              ++ TFK  CY+LD
Sbjct  300   RDMNTFKNCCYTLD  313



>ref|XP_006844995.1| hypothetical protein AMTR_s00058p00196910 [Amborella trichopoda]
 gb|ERN06670.1| hypothetical protein AMTR_s00058p00196910 [Amborella trichopoda]
Length=429

 Score =   336 bits (862),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 181/450 (40%), Positives = 271/450 (60%), Gaps = 31/450 (7%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M +++ ++ T+K +      +    +PL++FD+ ++D  + ++YA+R PTP N  ++ GL
Sbjct  1     MDLEILNSTTVKAAAT----VVEGSIPLTIFDRAAFDLHVPILYAFRAPTPSNDALKHGL  56

Query  238   RKALGVYREWAGRLGNDE-EGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
              + L  YR  AGRL  D   G P + LN+ G + +EA   T L   +P  PS +L  LHP
Sbjct  57    SEVLSHYRMLAGRLSTDPVSGLPCIRLNNAGARVIEARVSTPLANHLPLHPSPALSILHP  116

Query  415   SL-KGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM-------  570
              + +GV EL+QVQ+TRF+CG +++G T+ H   DG S S F + W +  R  +       
Sbjct  117   PIDEGVEELLQVQITRFSCGGIILGTTSQHKAGDGQSMSIFFIEWARTVRATIEGQDPPP  176

Query  571   -IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHF  747
                  P+ DR++  PR+PP  +++H   E+     +       S      +++VVH   F
Sbjct  177   PPALAPVHDRSMLAPRDPPCPKFEHREIEF-----QSGAEAPGSQPPAQFENVVVH---F  228

Query  748   TLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARL  927
               EF+A LKA      GG R YSTFE L+AH+W+ +T AR +     TH+RI+V+GRARL
Sbjct  229   PAEFVATLKAA-----GGGR-YSTFECLLAHVWQKLTIARGIDAQVDTHVRIAVNGRARL  282

Query  928   NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKV  1107
              P+VP  YFGNLVLWA P  K ++L+    + AA+ IH+AVSK+++ Y RSFIDF +   
Sbjct  283   RPRVPMGYFGNLVLWAHPKLKAEELVDLNTANAARAIHEAVSKIDDAYFRSFIDFGS---  339

Query  1108  VAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLP  1287
             +A+E+ LV +A  +   L PNLEVDSWLRF F +LDFGTG P  F+P + P EG++  +P
Sbjct  340   LAQEEDLVASAAAEGISLSPNLEVDSWLRFDFGELDFGTGGPCAFLPPWLPIEGLLVFVP  399

Query  1288  SFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             S+   G++D F+ +  D+LP F +I +SLD
Sbjct  400   SYKQKGAVDMFLAISPDHLPKFGEISHSLD  429



>gb|EMT23769.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=629

 Score =   340 bits (871),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 179/381 (47%), Positives = 243/381 (64%), Gaps = 13/381 (3%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M+V + S++ +KP Y      ++  +PLSVFDKVSYD  I  + A+ PP P N  +E GL
Sbjct  1     MEVTLHSSKPVKPEYGDRGGPSSYVIPLSVFDKVSYDEYITGLCAFHPPAPANDVLEAGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTL-DKVMPFKPSVSLLNLHP  414
              KAL  YREWAGRL  D  GN V++LND G +FVEA+ D  L   +M       LL+++P
Sbjct  61    AKALAEYREWAGRLSWDAGGNRVIVLNDAGARFVEATADAELASSLMQLTTGDKLLSMYP  120

Query  415   SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRD  594
             S  G  EL+  QVTRF CGS+++G + HH VADGH+   FL AWG+A R V I P+P+ D
Sbjct  121   SCHGADELLLAQVTRFRCGSIIIGVSMHHKVADGHAIWTFLFAWGQATRGVAISPVPVHD  180

Query  595   RTI-FIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             RT  F PRNPPRIE+DH G E+     K   H  +       + +++H+VHF+ E +  L
Sbjct  181   RTSQFAPRNPPRIEFDHRGNEFKSHSDKSGAHAGD-------EAVLIHRVHFSRERIMAL  233

Query  772   KAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN-PKVPND  948
             K+KAS   G ARP +T + L AHLW+ ITKAR L    TT +RI+V+GR R++ P+VP  
Sbjct  234   KSKAS--EGAARPCTTLQCLAAHLWQCITKARGLDAGATTRMRIAVNGRTRMSGPQVPPG  291

Query  949   YFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGL  1128
             Y GN+VLWA+P    ++L+   L    +LI   V++V++ Y RSFIDF +S VV E++ L
Sbjct  292   YTGNVVLWAWPMTTTQELVDRSLRDTVELISREVARVDDAYFRSFIDFVSSGVV-EKEQL  350

Query  1129  VPTADMDKHILCPNLEVDSWL  1191
             VPTAD  +  L P++EVDS L
Sbjct  351   VPTADSLELTLSPDVEVDSLL  371


 Score =   173 bits (439),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 137/220 (62%), Gaps = 17/220 (8%)
 Frame = +1

Query  184  IYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTL  363
            +YA+ PP PPN  +E  L +AL  Y EWAGRL +     P ++L D GV+FVEA+ D  L
Sbjct  389  VYAFHPPAPPNVALEAALARALAAYPEWAGRLVD----GPAIVLCDAGVRFVEATADFEL  444

Query  364  DK--VMPFKPSVSLLNLHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFL  537
                V        +L+L+PS  GV EL+ VQ TRF CGSLV+GF+ HH VADG +  NF+
Sbjct  445  GSGAVALLAAGSKVLSLYPSCGGVEELLLVQATRFRCGSLVLGFSMHHKVADGPAMWNFM  504

Query  538  VAWGKACRDVMIQPLPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIK---KNDHFLNSND  705
            VAWG+  R V I P+P+ DRT +F  R PP+I ++H G E  P+  K   + D  +++  
Sbjct  505  VAWGQTTRGVAIDPVPVHDRTSLFARRAPPQIRFEHRGVELKPRDEKPRSRGDGIVHAG-  563

Query  706  ATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFE  825
                D++VVHKVHF+ E++ +LK++ S   GG R YST +
Sbjct  564  ----DEVVVHKVHFSREWIMELKSRVS--EGGPRSYSTLQ  597



>gb|EMT30236.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=505

 Score =   335 bits (859),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 208/506 (41%), Positives = 287/506 (57%), Gaps = 72/506 (14%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNST--IEL  231
             M+V V S++ +KP+          ++PLSVFDKV+Y   +A+I+A+  P P  +   +E 
Sbjct  1     MEVHVLSSKLVKPASTKLAAGAPEYIPLSVFDKVTYQMHMAMIFAFAAPAPAPTAAALEK  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPF--KPSVSLLN  405
             GL  AL  YR  AG+L  +    P VLLND G +  EA  D  +  V      P   LL 
Sbjct  61    GLAVALSEYRTLAGQLVRNRSEGPGVLLNDRGARVGEACVDADMVDVDVALPNPKPELLQ  120

Query  406   LHPSLK--GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQP  579
             L P L+   + E+V +Q+TRF CGSL VGF  +H VA G +TSNFLVAWG+A R + +  
Sbjct  121   LLPDLEEEAIKEVVVLQLTRFRCGSLAVGFARNHAVAGGRATSNFLVAWGRATRGLTMGL  180

Query  580   LPLRDRT---IFIPRNPPRI---EYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKV  741
              P+       +F PR    I   E+DH   EY             + D      IVVHK 
Sbjct  181   PPMYKYNHLDLFQPRPSHCIHEFEFDHRNREYYLPPPPAPAPTATAGDKKV---IVVHKA  237

Query  742   HFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRA  921
             HF+ +++A L+   S   G  RP++ FE+++A LWRA+T+AR L   + + +RISVDGR+
Sbjct  238   HFSKDWIAGLRDTTS--QGRDRPFTRFETILAQLWRAMTRARGLSQDDISTVRISVDGRS  295

Query  922   RLN--------------PK--------------------------------------VPN  945
             RL               P+                                      +P 
Sbjct  296   RLGMPAEYASNLVLWAFPRARVSDLLGQPLSHAAQLIHDEDDISTVRISVDGRSRLGMPA  355

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNN-NYIRSFIDFANSKVVAEED  1122
             +Y  NLVLWAFP A+V DLL +PLS+AA+LIHD V++V +  Y RSF+DFA S +V E++
Sbjct  356   EYASNLVLWAFPRARVSDLLGQPLSHAAQLIHDEVARVADPAYFRSFVDFATSGLV-EQE  414

Query  1123  GLVPTADMD-KHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIG  1299
             GL P+++++ + +LCP+LEV SWL F FYD+DFGTG P   MP++ P EG++FL PS+IG
Sbjct  415   GLAPSSEINMRDVLCPDLEVHSWLTFQFYDMDFGTGTPTYVMPSYIPAEGLIFLAPSYIG  474

Query  1300  DGSIDAFIPLFQDNLPTFKQICYSLD  1377
             DGSIDAF+P+FQDNL  FKQ  YS+D
Sbjct  475   DGSIDAFVPVFQDNLEAFKQCLYSID  500



>dbj|BAJ99837.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=293

 Score =   327 bits (839),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/299 (52%), Positives = 214/299 (72%), Gaps = 7/299 (2%)
 Frame = +1

Query  484   GFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYM  660
             GFT  H+V+DG ST NF VAW +A R   I P+P+ DR + F PR P  +EY+H G E+ 
Sbjct  1     GFTTQHIVSDGRSTGNFFVAWSQATRGAAIDPVPVHDRASFFHPREPLHVEYEHRGVEFK  60

Query  661   PKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAH  840
             P + K +D    ++     D++VV+KVHF+ EF++KLKA+ASA  G  RP ST + +VAH
Sbjct  61    PYE-KAHDVVCGADGDE--DEVVVNKVHFSREFISKLKAQASA--GAPRPCSTLQCVVAH  115

Query  841   LWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLS  1020
             LWR++T AR L G ETT + I+VDGRAR++P+VP+ Y GN++LWA PT    +L+  P+ 
Sbjct  116   LWRSMTMARGLDGGETTSVAIAVDGRARMSPQVPDGYTGNVILWARPTTTAGELVTRPVK  175

Query  1021  YAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFP  1200
             +A +LI   V+++N+ Y +SFIDFANS  V E++ LV TAD    +L PN+EVDSWLR P
Sbjct  176   HAVELISREVARINDGYFKSFIDFANSGAV-EKERLVATADAADMVLSPNIEVDSWLRIP  234

Query  1201  FYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             FYD+DFG G P+ FMP++ P EG++ LLPSF+GDGS+DA++PLF  ++ TFK  CYSLD
Sbjct  235   FYDMDFGGGRPFFFMPSYLPVEGLLILLPSFLGDGSVDAYVPLFSRDMNTFKNCCYSLD  293



>gb|EEE61855.1| hypothetical protein OsJ_16525 [Oryza sativa Japonica Group]
Length=352

 Score =   328 bits (840),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 187/443 (42%), Positives = 244/443 (55%), Gaps = 102/443 (23%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYE-GNPPLTTTHV-PLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             MK+ V S++ +KP+Y  G  P TT  V PL VFDK ++D  I+VIYAYRPP P N+ +E 
Sbjct  1     MKITVHSSKAVKPAYGPGEFPTTTGDVVPLKVFDKANFDTYISVIYAYRPPAPANAALEA  60

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL KAL  YREWAGRLG D +GN  +LLND G +FVEA+ D TLD VMP KP        
Sbjct  61    GLAKALIEYREWAGRLGVDGDGNRAILLNDGGARFVEATADVTLDSVMPLKP--------  112

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
                                              DG S         +A R     P+P+ 
Sbjct  113   ---------------------------------DGGS---------QATRGAAFHPVPVH  130

Query  592   DR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAK  768
             DR + F PR+ P++E++H G E+ P                + DD  VH           
Sbjct  131   DRVSFFAPRDTPKVEFEHRGVEFKP----------------YDDDEDVH-----------  163

Query  769   LKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPND  948
                   A  GG                   +AR L G E+T + I+VDGRAR++P VP+ 
Sbjct  164   ------ASGGGGDD---------------DEARGLDGRESTSVCIAVDGRARMSPPVPDG  202

Query  949   YFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGL  1128
             Y GN+VLWA PTA   +L+  PL +A +LI+  V ++N+ Y +SFIDFANS  V EE+ L
Sbjct  203   YTGNVVLWARPTATAGELVTRPLKHAVELINREVIRINDGYFKSFIDFANSGAV-EEERL  261

Query  1129  VPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGS  1308
             V +AD  + +L PN+EVDSWLR PFYDLDFG G P+ FMP++ P EG++ LLPSF GDGS
Sbjct  262   VASADAAEMVLSPNIEVDSWLRIPFYDLDFGGGRPFFFMPSYLPVEGLLILLPSFFGDGS  321

Query  1309  IDAFIPLFQDNLPTFKQICYSLD  1377
             +DA++PLF  ++  FK  CYS D
Sbjct  322   VDAYVPLFSRDMDVFKNCCYSFD  344



>ref|XP_009796118.1| PREDICTED: agmatine coumaroyltransferase-2-like, partial [Nicotiana 
sylvestris]
Length=251

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 189/229 (83%), Gaps = 4/229 (2%)
 Frame = +1

Query  139  LSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPV-VLL  315
            LSVFDKV+YDA IA+IYAY PPTPPN+ IELGL+KAL +Y E+AGRL  DE GNPV +LL
Sbjct  2    LSVFDKVTYDAHIAIIYAYCPPTPPNTAIELGLQKALAIYPEFAGRLSKDEHGNPVNILL  61

Query  316  NDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLKG-VVELVQVQVTRFTCGSLVVGFT  492
            NDEGV+FVEAS ++TLD+VMP+KPS SLLNLHPSL   V ELVQVQ+T FTCGSL VGFT
Sbjct  62   NDEGVRFVEASANSTLDQVMPYKPSPSLLNLHPSLNDDVKELVQVQLTWFTCGSLAVGFT  121

Query  493  AHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQI  672
            ++H++ADG STSNFLVAWG+ACR + + P+PL DRTIF PRNPP +E +H G E+  K +
Sbjct  122  SNHMIADGQSTSNFLVAWGQACRGLRVNPIPLHDRTIFNPRNPPLVENEHKGVEFTSKLV  181

Query  673  KKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYST  819
            KK +H LN      L+DIVVHKVHFT+EFLAKLKAKAS+MNG  +PYST
Sbjct  182  KK-EHLLNQAHH-ILEDIVVHKVHFTIEFLAKLKAKASSMNGNNKPYST  228



>ref|XP_006844996.1| hypothetical protein AMTR_s00058p00197140 [Amborella trichopoda]
 gb|ERN06671.1| hypothetical protein AMTR_s00058p00197140 [Amborella trichopoda]
Length=429

 Score =   329 bits (844),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 186/450 (41%), Positives = 264/450 (59%), Gaps = 31/450 (7%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M V++ S+ ++K S      +    +PL++FD+ ++D  + VIYA+R P P N  ++ GL
Sbjct  1     MDVEILSSTSVKASAA----VVEGLIPLTIFDRAAFDLHVPVIYAFRAPMPSNDALKHGL  56

Query  238   RKALGVYREWAGRLGNDE-EGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHP  414
              + L  Y + AGRL  D   G P +LLN+ G + VEA     L   +P   S +L  LHP
Sbjct  57    SEVLSHYPKLAGRLSTDPVSGLPCILLNNAGARVVEARVSAPLATYLPLHSSPALSILHP  116

Query  415   SLKGVVE-LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--------  567
              +   VE L+QVQ+TRF+CG +++G T HH  ADG S S F + W +  R +        
Sbjct  117   LIDETVEELLQVQITRFSCGGIILGTTGHHKAADGQSMSIFFLEWSRTVRAMSEGGDPPP  176

Query  568   MIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHF  747
             +    P+ DR +  PR+PP   + H   E+  + + K      S      +++VVH   F
Sbjct  177   LPALAPVHDRLMLAPRDPPCPMFGHREIEF--QSVSKAP---ASEPPAQFENVVVH---F  228

Query  748   TLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARL  927
               EF+A LKA      GG R YSTFE L+AH+W+ +T AR +     TH+RI+V+GRARL
Sbjct  229   PAEFVASLKAA-----GGGR-YSTFECLLAHVWKKVTIARGINTKADTHVRIAVNGRARL  282

Query  928   NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKV  1107
              P VP  YFGNLVLWA P  K ++LL   ++  A+ IH+ V K+++ Y RSFIDF     
Sbjct  283   WPHVPMGYFGNLVLWAHPKLKAEELLALNIADTARAIHENVGKIDDAYFRSFIDFG---A  339

Query  1108  VAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLP  1287
             +A+E+ LV TA  +   L PNLEVDSWLRF F DL+FGTG P  F+P + P EG++  +P
Sbjct  340   LAQEEELVATAPAEGTSLSPNLEVDSWLRFDFGDLNFGTGGPCAFLPPWLPIEGLLVFVP  399

Query  1288  SFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             S+   G +D F+ +  D+LP F+QIC SLD
Sbjct  400   SYKEKGGVDMFMAISPDHLPKFQQICRSLD  429



>ref|XP_006653854.1| PREDICTED: agmatine coumaroyltransferase-2-like [Oryza brachyantha]
Length=356

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 181/451 (40%), Positives = 245/451 (54%), Gaps = 111/451 (25%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHV--------PLSVFDKVSYDAQIAVIYAYRPPTPP  213
             MK+ V S++ +KP+Y G                 PL+VFDK ++D  ++VIYA+R     
Sbjct  1     MKITVHSSKPVKPAYGGAVSAAAVTTTTADDDVVPLTVFDKANFDTYVSVIYAFR-----  55

Query  214   NSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSV  393
                                                              LD V+P +P+ 
Sbjct  56    -----------------------------------------------VALDSVLPLEPTP  68

Query  394   SLLNLHPSLK-GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
              + +LHPS   G  E++ VQ+TRF CGSLVVGFTAHH+V+DG +TSNF            
Sbjct  69    RVTSLHPSADDGAEEVMMVQLTRFACGSLVVGFTAHHMVSDGRATSNF------------  116

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
                                         +M      + H  N +D      +V+HKVHF+
Sbjct  117   ----------------------------FMADPADGDGHADNDDDV-----VVIHKVHFS  143

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              EF++KLK  ASA  GG R YST + +VAHLWR IT AR L G E T + I+VDGRAR++
Sbjct  144   REFISKLKTFASA--GGHRSYSTLQCVVAHLWRCITMARGLDGREATSVSIAVDGRARMS  201

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P VP+ Y GN+VLWA PTA  ++L+  PL +A  LI+  VS++N+ Y +SFIDFA+S  V
Sbjct  202   PPVPDGYTGNVVLWARPTATARELVTAPLQHAVGLINREVSRINDGYFKSFIDFASSGAV  261

Query  1111  AEE---DGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFL  1281
              EE     LV +AD  + +L PN+EVDSWLR PFY+LDFG G P++F P++ P EG++ L
Sbjct  262   EEERLGSRLVSSADAAEMVLSPNIEVDSWLRIPFYELDFGGGQPFLFTPSYLPVEGLLIL  321

Query  1282  LPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             LPSF GDGS+DA++PLF  ++ TFK  CY L
Sbjct  322   LPSFSGDGSVDAYVPLFSHDMDTFKNCCYVL  352



>ref|XP_002991344.1| BAHD family acyltransferase, clade IV [Selaginella moellendorffii]
 gb|EFJ07642.1| BAHD family acyltransferase, clade IV [Selaginella moellendorffii]
Length=424

 Score =   321 bits (823),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 173/416 (42%), Positives = 243/416 (58%), Gaps = 18/416 (4%)
 Frame = +1

Query  133   VPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVL  312
             +PLS  D V     + +IYA++ P PP + +E GL K L  YREWAGRLG DE G  V+ 
Sbjct  25    IPLSSSDLVVPRVHVEIIYAFKAPAPPVADLEEGLAKVLSDYREWAGRLGKDENGRAVID  84

Query  313   LNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLKGVVELVQVQVTRFTCGSLVVGFT  492
             LNDEGV F+EA  D  L+ VMPF PS  LL+L P  +GV EL+ +QVT+FTCG + VG  
Sbjct  85    LNDEGVVFIEAEIDGELESVMPFNPSPLLLDLVPVNRGVPELLLIQVTKFTCGGITVGVA  144

Query  493   AHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQI  672
               H VADG   S F+ AW    +   I P P  DR+  +  +PP+ +++H   +  P + 
Sbjct  145   RQHQVADGEGASAFMNAWASIVKKTPIVP-PKHDRSFLMANDPPQPKFEHPEYKRPPPK-  202

Query  673   KKNDHFLNSNDATFLD--DIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLW  846
                       DAT  +   + V K+HF+++ L K+K  A+   G AR  STF SL +HLW
Sbjct  203   ---------ADATQPEYPPLSVKKLHFSIDLLKKIKQSATT-EGDARGPSTFVSLTSHLW  252

Query  847   RAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYA  1026
             + IT+AR + G   T + I+ +GR RL P +P+DYFGN++  A   +  KDLL +P SYA
Sbjct  253   KCITRARGIDGEVQTRVLIAANGRKRLVPPIPDDYFGNVISHASSHSTAKDLLEKPASYA  312

Query  1027  AKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFY  1206
               LI  ++ +++N YIRS +D     V  ++   V  A   K +L PNL V SW++ P Y
Sbjct  313   TDLIQASIKRLDNEYIRSQMDC----VELQQKNPVQIARSGKTVLSPNLSVTSWVQLPIY  368

Query  1207  DLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             +LDFG G P      + P EG+  +LPS+  DGSID  I LF+ ++   + IC+ +
Sbjct  369   ELDFGYGTPVFAGGPYVPFEGISIMLPSYTRDGSIDVIIGLFEPDMAKLQDICFDV  424



>ref|XP_006844997.1| hypothetical protein AMTR_s00058p00197270 [Amborella trichopoda]
 gb|ERN06672.1| hypothetical protein AMTR_s00058p00197270 [Amborella trichopoda]
Length=470

 Score =   322 bits (826),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 179/452 (40%), Positives = 264/452 (58%), Gaps = 30/452 (7%)
 Frame = +1

Query  52    KTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             + M V++ S+ ++K +           +PL++FD+ + D  +  IYA+R P P N  ++ 
Sbjct  39    QKMDVEILSSTSVKAAVAVGE--VEGSIPLTIFDRAAVDLHVPTIYAFRAPMPGNDALKR  96

Query  232   GLRKALGVYREWAGRLGNDEEGN-PVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
             GL + L  YR+ AGRL  D   + P +LLN+ G + VEA   + L   +P  PS +L  L
Sbjct  97    GLSEVLSHYRQLAGRLSTDPVSSLPCILLNNAGARVVEAQVSSPLANHLPLHPSPALSIL  156

Query  409   HPSLKGVVE-LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV------  567
             +P +   VE L+QVQ+TRF+CG +++G T HH  ADG S S F + W +  R +      
Sbjct  157   YPPIDETVEELLQVQITRFSCGGIILGTTGHHKAADGQSMSIFFLEWSRTVRAMTKGQDR  216

Query  568   --MIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKV  741
                    P+ DR++  P +PP  +++H   E+     +       S      +++VVH  
Sbjct  217   PPPPVVAPVHDRSMLAPCDPPCPKFEHREIEF-----QSGAKATASQPPAQFENVVVH--  269

Query  742   HFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRA  921
              F  EF+A LKA      GG R YSTFE L+AH+W+ +T AR L     TH+RI+V+GRA
Sbjct  270   -FPAEFVASLKAA-----GGGR-YSTFECLLAHVWKKLTIARGLDAEVDTHVRIAVNGRA  322

Query  922   RLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANS  1101
             RL P VP  YFGNLVLWA P  K  +LL    +  A+ IH+ V ++++ Y +SF+DF   
Sbjct  323   RLGPHVPMGYFGNLVLWAHPNLKAGELLALNTADVARAIHEGVDEIDDAYFQSFVDFG--  380

Query  1102  KVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFL  1281
               VA+E+ LV +A ++   L PNLEVDSWLRF F++LDFGTG P  F+P + P EG+   
Sbjct  381   -AVAQEE-LVSSAPVEGISLSPNLEVDSWLRFDFWELDFGTGRPCAFLPPWLPFEGLFIF  438

Query  1282  LPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             +PS+   G +D F+ + +D++P FK IC+SLD
Sbjct  439   MPSYKEKGGVDMFLAISRDHIPKFKHICHSLD  470



>ref|NP_001049199.2| Os03g0185700 [Oryza sativa Japonica Group]
 gb|ABF94357.1| Transferase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG98566.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF11113.2| Os03g0185700 [Oryza sativa Japonica Group]
Length=456

 Score =   314 bits (805),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 179/450 (40%), Positives = 250/450 (56%), Gaps = 18/450 (4%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRK  243
             +K+ ST  + P Y    PL    V L+VFD+ ++D  +  + AYR P P N  I+ GL +
Sbjct  1     MKITSTAMLAPVYGTPHPLAGAEVQLTVFDRAAFDLYVPSVLAYRAPAPSNEAIKEGLLR  60

Query  244   ALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTT-LDKVMPFKP---SVSLLNLH  411
             A+  Y   AGRL  D  G   + +ND+GV  VEA+ D   LD V+       +  + +L+
Sbjct  61    AVAAYPHLAGRLAVDHHGRRFLHVNDQGVLVVEATVDGADLDDVLANSGRAMATDVADLY  120

Query  412   PSL---KGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQ  576
             P+L        L+QV++ R+ CG LVVG   HH  ADGHS S F  AW  A R+      
Sbjct  121   PALPEDNVGAALLQVKLVRYRCGGLVVGSICHHHTADGHSMSAFFTAWATAVREGEGFTA  180

Query  577   PLPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTL  753
             P P  DR    +PR PP   +DH   E+   +        +S  A  LD I    VHFT 
Sbjct  181   PTPFLDRAATAVPRTPPVPAFDHRSIEFDGGEAAAAGGGRSSYAAVSLDKIKDLTVHFTA  240

Query  754   EFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNP  933
             EF+ +LKA+A     G R  STF+ L+AH+W+ IT AR+L   E T +R++V+ R R NP
Sbjct  241   EFVGELKARA-----GGR-CSTFQCLLAHVWKKITAARDLSPEEFTQVRVAVNCRGRANP  294

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVA  1113
              VP D+FGN+VLWAFP  + ++LLR         I DAV++V+  YI+SF+DF  +    
Sbjct  295   PVPMDFFGNMVLWAFPRMRARELLRATYGAVVGAIRDAVARVDGEYIQSFVDFGGAAAAG  354

Query  1114  EEDG--LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLP  1287
                G  LV TA     +LCP+LEVDSWL F F+ +D GTG P  F+P   P EG+M  +P
Sbjct  355   GGGGGDLVATAAAAGTMLCPDLEVDSWLGFRFHQMDLGTGSPAAFLPPDLPVEGLMVFVP  414

Query  1288  SFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             S    G +D F+ + + ++  F++I YSL+
Sbjct  415   SRAAKGGVDVFMAVAEHHVEAFERIIYSLE  444



>ref|XP_008651745.1| PREDICTED: agmatine coumaroyltransferase-1-like [Zea mays]
 tpg|DAA43757.1| TPA: hypothetical protein ZEAMMB73_675673 [Zea mays]
Length=443

 Score =   311 bits (796),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 182/455 (40%), Positives = 254/455 (56%), Gaps = 26/455 (6%)
 Frame = +1

Query  52    KTMKVKVESTRT-IKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             +TMK    +TRT ++P Y    PL    VPL+VFD+ ++D  +  + AY  P P N  ++
Sbjct  2     ETMK----ATRTLVQPVYSTPHPLAGEKVPLTVFDRAAFDIFVPTVLAYPAPAPSNEALK  57

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMP---FKPSVSL  399
              GLR+A+ +Y   AGRL  D+ G   + +NDEGV  VEA+    L  V+       +V +
Sbjct  58    DGLRRAVALYPHLAGRLAVDDRGRRFLHVNDEGVLVVEAAISADLSGVLAGGMTDANVVV  117

Query  400   LNLHPSL---KGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR---  561
               L+PSL        L+Q+++ R  CG LVVG   HH VADGHS S F   W  A R   
Sbjct  118   DELYPSLPEDNVGAALLQIKLNRCRCGGLVVGIICHHHVADGHSMSAFFTTWASAVRAGK  177

Query  562   DVMIQPLP-LRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHK  738
             D  +   P L+     +PR  P   +DH   E+M          + S     +D+I    
Sbjct  178   DFSVPAPPFLKRAATAVPRATPTPIFDHRSIEFMGGGDGGRTSRIKSYAVVPMDEIKSLT  237

Query  739   VHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGR  918
             VHFT EF+A LKA+      G R  STF+ L+AH+W+ IT AR+L   E T +R++V+ R
Sbjct  238   VHFTDEFIAGLKARV-----GVR-CSTFQCLLAHVWKKITAARDLNLEEFTQVRVAVNCR  291

Query  919   ARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFAN  1098
              R  P VP D+FGN+VLWAFP  +VKDLL          I DAV++V+  YI+SF+DF  
Sbjct  292   GRAIPAVPTDFFGNMVLWAFPRLQVKDLLNSSYGSVVDAIRDAVARVDGEYIQSFVDFG-  350

Query  1099  SKVVAEEDG--LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGM  1272
                +A+  G  LV TA     +LCP+LEVDSWL F F+ +D GTG P  F+P   P EG+
Sbjct  351   --ALADRSGEELVATAAAAGTMLCPDLEVDSWLGFQFHQMDLGTGPPCAFLPPDLPIEGL  408

Query  1273  MFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             M  +PS    G +D F+ + + ++  F+QIC+S+D
Sbjct  409   MVFVPSRTAKGGVDLFMAVAECHVDAFQQICHSID  443



>gb|EEC78408.1| hypothetical protein OsI_18206 [Oryza sativa Indica Group]
Length=352

 Score =   307 bits (787),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 172/404 (43%), Positives = 229/404 (57%), Gaps = 58/404 (14%)
 Frame = +1

Query  175   IAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGD  354
             +AVIYA+RPPTPPN+ +ELGL K L VYREWAG L +   G   VLLND           
Sbjct  1     MAVIYAFRPPTPPNAALELGLAKTLAVYREWAGELAD---GGDAVLLND-----------  46

Query  355   TTLDKVMPFKPSVSLLNLHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNF  534
                                   +   ELV+VQ+TRF CGSLV+GFT+HH VA G +  NF
Sbjct  47    -------------RGGGGRCGGRAGRELVRVQLTRFACGSLVIGFTSHHRVAYGQAAGNF  93

Query  535   LVAWGKACRDVMIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDAT  711
             LVAWG A R + + PLP+ DR T F PR+PP +++ H   EY   + KK +H   +    
Sbjct  94    LVAWGLASRRLPVAPLPVCDRATRFPPRHPPLVQFPHRDTEYYAPKKKKKNHDAGAVAVE  153

Query  712   FLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETT  891
               DD +    H  ++ + +            RP                 AR L   E T
Sbjct  154   DDDDELATVAHDKIKHVRER----------GRP---------------PLARGLAAGEAT  188

Query  892   HIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNY  1071
              +R+SV+GR R+ P VP  YFGNLVLWAFP     +L   P+ +AA+LI   V++ ++ Y
Sbjct  189   TLRVSVNGRTRMRPAVPRGYFGNLVLWAFPRCAAGELASRPVQHAAELIRHTVARADDAY  248

Query  1072  IRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDF----GTGCPYI  1239
              RSF+DFA+S  V E +GL  TAD  + +LCP++EVDSWL   FY+LDF    G G P+ 
Sbjct  249   FRSFVDFASSGAV-EAEGLAATADESQAVLCPDVEVDSWLGIDFYELDFGGGGGGGGPFY  307

Query  1240  FMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYS  1371
             F P++ P EG +FL+PSF GDG IDA++ LF+ +L  FK+ICY+
Sbjct  308   FTPSYLPMEGTVFLVPSFAGDGGIDAYVALFETHLDEFKKICYT  351



>gb|KDP34340.1| hypothetical protein JCGZ_11223 [Jatropha curcas]
Length=370

 Score =   307 bits (786),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 195/452 (43%), Positives = 246/452 (54%), Gaps = 98/452 (22%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGN--PPLTTTH-VPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
             MKV +E T+ +KP  + N  P    +H VPLSVFDKVSY+  +A+IYAY PPTP N+TIE
Sbjct  1     MKVTIERTKIVKPFCDSNNLPVDPKSHFVPLSVFDKVSYNTHVAIIYAYNPPTPTNATIE  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
             LGL+K L  YREWAGRLG DE G+PV+ LND+GV FVEAS D  L++VMP +PS  LL+L
Sbjct  61    LGLQKVLSEYREWAGRLGEDENGDPVIFLNDKGVNFVEASIDIKLEQVMPLQPSPFLLSL  120

Query  409   HPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPL  588
             HP +K V  L+QVQ+TRF CGSLV+GFT HHLVADGHS SNFLVAWGKA R + I PLPL
Sbjct  121   HPKVKDVEALLQVQLTRFACGSLVIGFTGHHLVADGHSASNFLVAWGKATRGLDINPLPL  180

Query  589   RDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAK  768
              DRTIF PRNPP  E++H G     K++K     L                         
Sbjct  181   HDRTIFNPRNPPYFEFEHKG-----KKLKSIKSILQ------------------------  211

Query  769   LKAKASAMNGGAR-----PYSTFESLVAHLWR-AITKARNLG----GFETTHIRISVDGR  918
                   ++NG AR     P   F +LV  LW    +K  +L     G+    +R +V+  
Sbjct  212   -----CSVNGRARMNPKVPNEYFGNLV--LWTYPSSKVEDLVQEPLGYAAKLVRNAVES-  263

Query  919   ARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFAN  1098
                   V + YF + + +A   AK +DL                           +  A+
Sbjct  264   ------VNDKYFKSFIDFATVKAKEEDL---------------------------VPTAD  290

Query  1099  SKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMF  1278
             + V       +P   +D  +  P  E+           DFG G P IFMP++ P EG MF
Sbjct  291   ANV----STCIPNLKVDSWLRFPFYEL-----------DFGGGSPCIFMPSYIPIEGFMF  335

Query  1279  LLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             LLPS  GDGS DA I LF+ N+  FKQI   L
Sbjct  336   LLPSCNGDGSADACITLFRKNMDIFKQIVSKL  367



>gb|EAY88823.1| hypothetical protein OsI_10296 [Oryza sativa Indica Group]
Length=449

 Score =   309 bits (792),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 176/442 (40%), Positives = 245/442 (55%), Gaps = 18/442 (4%)
 Frame = +1

Query  88    IKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREW  267
             + P Y    PL    V L+VFD+ ++D  +  + AYR P P N  I+ GL +A+  Y   
Sbjct  2     LAPVYGTPHPLAGAEVQLTVFDRAAFDLYVPSVLAYRAPAPSNEAIKEGLLRAVAAYPHL  61

Query  268   AGRLGNDEEGNPVVLLNDEGVKFVEASGDTT-LDKVMPFKP---SVSLLNLHPSL---KG  426
             AGRL  D  G   + +ND+GV  VEA+ D   LD V+       +  + +L+P+L     
Sbjct  62    AGRLAVDRHGRRFLHVNDQGVLVVEATVDGADLDDVLANSGRAMATDVADLYPALPEDNV  121

Query  427   VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQPLPLRDRT  600
                L+QV++ R+ CG LVVG   HH  ADGHS S F  AW  A R+      P P  DR 
Sbjct  122   GAALLQVKLVRYRCGGLVVGSICHHHTADGHSMSAFFTAWATAVREGEGFTAPTPFLDRA  181

Query  601   -IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
                +PR PP   +DH   E+   +        +S  A  LD I    VHFT EF+ +LKA
Sbjct  182   ATAVPRTPPAPAFDHRSIEFDGGEAAAAGGGRSSYAAVSLDKIKDLTVHFTAEFVGELKA  241

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
             +A     G R  STF+ L+AH+W+ IT AR+L   E T +R++V+ R R NP VP D+FG
Sbjct  242   RA-----GGR-CSTFQCLLAHVWKKITAARDLSPEEFTQVRVAVNCRGRANPPVPMDFFG  295

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG--LV  1131
             N+VLWAFP  + ++LLR         I DAV++V+  YI+SF+DF  +       G  LV
Sbjct  296   NMVLWAFPRMRARELLRATYGAVVGAIRDAVARVDGEYIQSFVDFGGAAAAGGGGGGDLV  355

Query  1132  PTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
              TA     +LCP+LEVDSWL F F+ +D GTG P  F+P   P EG+M  +PS    G +
Sbjct  356   ATAAAAGTMLCPDLEVDSWLGFRFHQMDLGTGSPAAFLPPDLPVEGLMVFVPSRAAKGGV  415

Query  1312  DAFIPLFQDNLPTFKQICYSLD  1377
             D F+ + + ++  F++I YSL+
Sbjct  416   DVFMAVAEHHVEAFERIVYSLE  437



>ref|XP_003561974.1| PREDICTED: agmatine coumaroyltransferase-1-like [Brachypodium 
distachyon]
Length=437

 Score =   306 bits (785),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 174/449 (39%), Positives = 255/449 (57%), Gaps = 29/449 (6%)
 Frame = +1

Query  70    VESTRTIKPSY-EGNPP---LTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             +  +  ++P+Y +G+     L+   VPL+VFD+ S D  +  + AY  P P N  ++ GL
Sbjct  4     ITGSEMLRPAYVDGSAAPHRLSGEKVPLTVFDRASLDIFVPSMLAYPAPAPSNDALKDGL  63

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVM-PFKPSVSLLNLHP  414
             R+A+  Y   AGRL  D  G   + +NDEG   +EA+    L +V+   +   S  +L+P
Sbjct  64    RRAVAAYPHLAGRLALDGRGRRYIHVNDEGALLIEATVGVDLAEVLVDGRMVASTDHLYP  123

Query  415   SLKGV---VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQP  579
             ++      V L+Q+++ R+ CG LV+G T+HH  ADGHS S F   W +A R+    + P
Sbjct  124   AIPEENIGVALLQIKLNRYKCGGLVIGITSHHQAADGHSMSTFFTVWARAVREGKGFVAP  183

Query  580   LPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
              P  DR    +PR+ P   +DH   E+     K       S     +D I    VHFT +
Sbjct  184   APFLDRAATAVPRSTPTPVFDHRSVEFTCGGSK-------SYAVVPMDRIKNLTVHFTAD  236

Query  757   FLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPK  936
             F+A LKA+ SA        STF+ L+AH+W+  T AR+L   E T +R++V+ R R NP 
Sbjct  237   FVADLKARVSAR------CSTFQCLLAHVWKKTTAARDLNPEEFTQVRVAVNCRGRANPP  290

Query  937   VPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAE  1116
             VP D+ GN+VLWAFP  +V+DLL   L      I DAV+++++ YI+SF+D+     VA+
Sbjct  291   VPMDFSGNMVLWAFPRLRVRDLLSWSLGAVVGAIRDAVARIDDEYIQSFVDYG---AVAD  347

Query  1117  EDG--LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              DG  LV TA     + CP+LEVDSWL F F+ +D GTG P  F+P   P EG+M  +PS
Sbjct  348   ADGEELVATAADAGTMFCPDLEVDSWLGFKFHQIDLGTGPPSAFLPPDLPIEGLMIFVPS  407

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
                 G +D F+ L ++++  F+QICYSLD
Sbjct  408   RNAKGGVDLFMALAEEHVQAFQQICYSLD  436



>ref|XP_009395154.1| PREDICTED: agmatine coumaroyltransferase-2 {ECO:0000303|PubMed:18270436, 
ECO:0000312|EMBL:BAF97627.1}-like [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   306 bits (784),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 175/443 (40%), Positives = 263/443 (59%), Gaps = 17/443 (4%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M+V+V S+  +     G+P      VPL++FD+ + D  IAV+YA+  PTP N+ I  GL
Sbjct  5     MEVQVRSSTVLA---LGDPNTEPREVPLTIFDRFACDIHIAVLYAFTAPTPSNADIVEGL  61

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFV--EASGDTTLDKVMPFKPSVSLLNLH  411
              + L  +   A +LG+D  G P +++   G   +  EA+  +TL + MP +PS  LL LH
Sbjct  62    SETLAHFPMLAAQLGHDCGGRPCLMVGGGGGGVLVVEATVSSTLAEHMPLEPSPDLLLLH  121

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P  +    L+ VQ+ RF CG LVVG +AHH VADG S S FLVAWG+A R + I PLPL 
Sbjct  122   PRTEDAAHLLLVQLNRFRCGGLVVGLSAHHKVADGQSMSAFLVAWGQAVRGIPIDPLPLY  181

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL-AK  768
             DR+   PR PPR E+ H G ++MP    ++D F + N+      I    + ++ EF+  K
Sbjct  182   DRSWLKPRVPPRCEFQHWGLDFMPIT-PRDDEFASHNNLVEPSRITNILLRYSSEFITGK  240

Query  769   LKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPND  948
             LKA+  A       Y+TFE+L+AH+WR IT AR L G E T IR++V+GR RL P V + 
Sbjct  241   LKAETKAK------YTTFETLLAHVWRKITAARGLEGGEETTIRVTVNGRRRLKPPVSDH  294

Query  949   YFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGL  1128
             YFGNLVL A+P +  + L R  L  AAK++H+A+++ + +Y++S +D  +   +  ++ L
Sbjct  295   YFGNLVLNAYPRSTAEMLARGGLEEAAKVVHEAIARTSGDYVQSMVDLGD---MYGDEEL  351

Query  1129  VPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYI-FMPTFFPTEGMMFLLPSFIGDG  1305
             VP    + ++L P ++ +SWLR  F D+DFG G     F+PT+   EG++  +P     G
Sbjct  352   VPVYGTEGNVLSPLVDAESWLRLRFEDVDFGGGGKLCAFLPTWVALEGLVIFIPVVGEGG  411

Query  1306  SIDAFIPLFQDNLPTFKQICYSL  1374
              +D  + L +++    K+I +SL
Sbjct  412   GVDVMVSLLREHAEVLKRISHSL  434



>ref|XP_003573858.1| PREDICTED: agmatine coumaroyltransferase-2-like [Brachypodium 
distachyon]
Length=432

 Score =   304 bits (778),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 181/451 (40%), Positives = 252/451 (56%), Gaps = 30/451 (7%)
 Frame = +1

Query  58    MKVKVESTRT--IKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYR-PPTPPNSTIE  228
             M VKVE TR+  ++PS  G        VPL+VFD+ S D  I  ++A+  P  P N  ++
Sbjct  1     MAVKVEITRSTVLEPSPRGG---GGEKVPLTVFDRASTDGYIPAVFAWNGPAAPSNDALK  57

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
              GL  A+  +   A R   DE+G     LND GV  VEA+ D  L   +  + S  +  L
Sbjct  58    DGLISAVSRFPHLAARFAIDEQGRKCFHLNDAGVLVVEATADGDLADALANEVSAHINAL  117

Query  409   HPSL---KGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR----DV  567
             +P+    +    L QVQ+TR+ CG +V+G   HH VADG S S F  AW  A R    D+
Sbjct  118   YPNADKERTNEPLFQVQLTRYMCGGIVIGTACHHQVADGQSMSVFYTAWAAAVRTESSDL  177

Query  568   MIQPLPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVH  744
             M  P P  DR+   +PRNPP   +DH   E+  +    + +    N    LD I    VH
Sbjct  178   M--PTPFVDRSATVVPRNPPAPAFDHRNIEFKGEHSTAHSY----NRVLPLDKIKNLVVH  231

Query  745   FTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRAR  924
             +  EF+A LKA+      GAR  STF+ L+AH W+ +T AR+L     TH+R++V+ R R
Sbjct  232   YPDEFIASLKARV-----GAR-CSTFQCLLAHTWKKVTAARDLPPESPTHVRVAVNCRGR  285

Query  925   LNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSK  1104
               P VP D+FGN+VLWAFP  + ++LL          I DAV++V++ YI+SF+DF  + 
Sbjct  286   ARPPVPADFFGNMVLWAFPRMQARELLSSGYPAVVAAIRDAVARVDDEYIQSFVDFGET-  344

Query  1105  VVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLL  1284
               A+E+ L  TA     + CP+LEVDSWL F F+DLDFG G P  F+P   P +G+M  +
Sbjct  345   --ADEE-LESTAATPGMVFCPDLEVDSWLGFRFHDLDFGFGPPCAFLPPDLPFDGLMIFV  401

Query  1285  PSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             PS    G +D F+ L  +++  FKQICYS+D
Sbjct  402   PSCAAKGGVDLFMALDDEHVQAFKQICYSMD  432



>ref|XP_003558643.1| PREDICTED: agmatine coumaroyltransferase-1-like [Brachypodium 
distachyon]
Length=436

 Score =   303 bits (776),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 170/447 (38%), Positives = 257/447 (57%), Gaps = 20/447 (4%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRK  243
             +++ S+  ++P+Y     L+   VPL+VFD+ S D  +  + AY  P P N  ++ GLR+
Sbjct  1     MEITSSAMLRPAYSVPHRLSGEKVPLTVFDRASLDIFVPSMLAYPAPAPSNGALKDGLRR  60

Query  244   ALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEAS-GDTTLDKVMPFKPSVSLLNLHPSL  420
             A+  Y   AGRL  D  G   + +NDEGV  +EA+ G    D ++  +    + +L+P++
Sbjct  61    AVAAYPHLAGRLALDLRGRRYIHVNDEGVLLIEAAVGVYLADVLVDGRMDARVDDLYPAI  120

Query  421   KGVVE-----LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQP  579
                VE     L+Q+++ R+ CG LVVG ++HH  A GHS   F   W  A R+    I P
Sbjct  121   P--VENIGAALLQIKLNRYRCGGLVVGISSHHHAAAGHSMGLFFTTWASAVREGKDFIAP  178

Query  580   LPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
              P  DR T  +PR+ P+  +DH   E+       +  F  S     +D I    VHFT +
Sbjct  179   TPFLDRATTAVPRSTPKPVFDHRSVEF------TDACFGKSYAVVPMDRIRNFTVHFTAD  232

Query  757   FLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPK  936
             F+A LKA+     G     STF+ L+AH+W+ IT AR+L     T +R++V+ R+R NP 
Sbjct  233   FIANLKARVGV--GVDVRCSTFQCLLAHVWKKITAARDLNPEGFTKVRVAVNCRSRANPP  290

Query  937   VPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAE  1116
             VP D+ GN+VLWAFP  +V++LL          I DAV+++++ YI+SF+D+        
Sbjct  291   VPMDFCGNMVLWAFPRLQVRELLNWSHGSVVGAIRDAVARIDDEYIQSFVDYGAVADAGG  350

Query  1117  EDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFI  1296
             E+ LV TA     + CP+LEVDSWL F F++LDFGTG P  F+P   P EG+M  +PS +
Sbjct  351   EE-LVATAADAGTMFCPDLEVDSWLGFRFHELDFGTGAPSAFVPPDLPIEGLMIFVPSRM  409

Query  1297  GDGSIDAFIPLFQDNLPTFKQICYSLD  1377
               G +D F+ + ++++ +F+QICYSLD
Sbjct  410   AKGGVDLFMAIAEEHVASFEQICYSLD  436



>dbj|BAK02716.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   300 bits (769),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 182/450 (40%), Positives = 247/450 (55%), Gaps = 22/450 (5%)
 Frame = +1

Query  58    MKVKVESTR--TIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M V VE T+   ++PS E +       VPL VFD+ S D  I  ++A+  P P N+ ++ 
Sbjct  1     MAVMVEITKNMVLEPSKE-SARGGGKKVPLIVFDRASTDGYIPAVFAWNAPAPTNAALKA  59

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL  A+  +   AGR   D+ G     LND GV  VEA+ D  L   +    S  +  L+
Sbjct  60    GLVAAVARFPHLAGRFAADDHGRKCFHLNDAGVLVVEATADADLADALAHDVSAHINELY  119

Query  412   PSLKGV---VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR-DVMIQP  579
             P  +       + Q Q+TR+ CG LV+G   HH VADG S S F  AW  A R D  + P
Sbjct  120   PKAEKERMNEPIFQAQLTRYACGGLVIGTACHHQVADGQSMSVFYTAWASAVRTDSAVLP  179

Query  580   LPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
              P  DR+   +PR+PP+  YDH   E+     K    + +S     +D I    VHF  E
Sbjct  180   SPFVDRSATVVPRSPPKPAYDHRNIEF-----KGELSWSHSYGVLPMDRIKNLAVHFPDE  234

Query  757   FLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPK  936
             F+A LKA+      G R  STF+ L+AH W+ IT AR+L   + T +R++V+ R R  P 
Sbjct  235   FVADLKARV-----GTR-CSTFQCLLAHAWKKITAARDLAPDDFTQVRVAVNCRGRAKPP  288

Query  937   VPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAE  1116
             VP D+FGN+VLWAFP  +V+DLL          I DAV+ V++ YI+SFIDF  ++    
Sbjct  289   VPMDFFGNMVLWAFPRMQVRDLLSSSYPAVVGAIRDAVALVDDEYIQSFIDFGEAERGVI  348

Query  1117  EDG---LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLP  1287
             EDG   L  TA     + CP+LEVDSWL F F+DLDFG G P  F+P   P EG+M  +P
Sbjct  349   EDGGEELASTAATPGTMFCPDLEVDSWLGFRFHDLDFGCGPPCAFLPPDLPIEGIMIFVP  408

Query  1288  SFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             S    G +D F+ L  +++  FKQICYS+D
Sbjct  409   SCDPKGGVDLFMALDDEHVQAFKQICYSMD  438



>dbj|BAJ87520.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   300 bits (768),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 169/447 (38%), Positives = 254/447 (57%), Gaps = 24/447 (5%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRK  243
             +++  +  +KP+Y    PL    VPL+VFD+ + D  +  + AY  P P N  +  GL K
Sbjct  1     MEITRSTMVKPAYAVPHPLVGEKVPLTVFDRAALDIFVPTVLAYPAPAPSNEALREGLLK  60

Query  244   ALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTL-DKVMPFKPSVSLLNLHPSL  420
             A+  Y   AGRL  D+ G   + +N+EGV  +EA+    L D ++  + +  + +L+P++
Sbjct  61    AVAPYPHLAGRLALDDLGRRFLHVNNEGVLLIEATVPADLADVLVDGRMAAGVDDLYPAI  120

Query  421   KGV---VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQPLP  585
                     L+Q+Q+ R+ CG LVVG + HH  ADGHS S F  AW  A R+      P P
Sbjct  121   PEENIGAALLQIQLNRYKCGGLVVGISCHHHTADGHSMSMFFTAWATAVREGKDFTTPTP  180

Query  586   LRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
               DR    +PR+ P   +DH   E+            +S     +D I    +HFT EF+
Sbjct  181   FLDRARTAVPRSTPTPVFDHRSLEFTSGDGG------DSYAVVPMDRIKNLTLHFTAEFV  234

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
             A LK+       G R  STF+ L+AH+W+ +T AR+L   E T +R++V+ R R +P VP
Sbjct  235   ADLKSLV-----GTR-CSTFQCLLAHVWKKLTAARDLKPEEFTKVRLAVNCRGRADPPVP  288

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
              D+FGN+VLWAFP  +V+D+L         +I DAV+++++ Y++SF+DF     VA+ +
Sbjct  289   MDFFGNMVLWAFPRLQVRDMLDSSHGSVVGVIRDAVARIDDEYVQSFVDFGG---VADAN  345

Query  1123  G--LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFI  1296
             G  LV TA     + CP+ EVDSWL F F+ LDFGTG P  F+P   P EG+M  +PS  
Sbjct  346   GEELVATAAAAGTMFCPDAEVDSWLGFRFHQLDFGTGAPSAFVPPDLPFEGLMIFMPSRK  405

Query  1297  GDGSIDAFIPLFQDNLPTFKQICYSLD  1377
              +G +D F+ + ++++  F+QICYSLD
Sbjct  406   ANGGVDLFMAVAEEHVAAFEQICYSLD  432



>gb|EMT24472.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=419

 Score =   299 bits (766),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 167/429 (39%), Positives = 247/429 (58%), Gaps = 30/429 (7%)
 Frame = +1

Query  115   PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEE  294
             PL    VPL++FD+ + D  +A++ AY  P P N  ++ GL KA+  +   AGRL  D+ 
Sbjct  8     PLVGDKVPLTLFDRAAVDVFVAMVLAYPAPAPSNEALKDGLLKAVAAFPHLAGRLAVDQH  67

Query  295   GNPVVLLNDEGVKFVEASGDTTL-DKVMPFKPSVSLLNLHPSL-----KGVVELVQVQVT  456
             G   + +N+EGV  +E      L D ++  + +  + +L+P+           L+Q+Q+ 
Sbjct  68    GRHFLDVNNEGVLLIETKLPANLADVLVEGRMATRVDHLYPTTPEPGQNNGEALLQIQLN  127

Query  457   RFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM--IQPLPLRDRT-IFIPRNPPR  627
             R+ CG LVVG  +HH VADGHS S F  AW  A R+ M  I P P  +R    +PR+ P 
Sbjct  128   RYGCGGLVVGMCSHHRVADGHSMSMFFTAWATAVREGMDFIMPTPFLNRAETALPRSSPT  187

Query  628   IEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGAR  807
               +DH   E+  ++               ++ I    VHFT EF+AKLKA+  A      
Sbjct  188   PVFDHRSVEFTCRE----------GTVVPVERIKNLTVHFTAEFVAKLKARVCAR-----  232

Query  808   PYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTA  987
               STF+ L+AH+W+ IT AR L   E T +R++V+ R+R  P VP ++FGN+VLWAFP  
Sbjct  233   -CSTFQCLLAHVWKKITAARGLKPEEFTTVRVAVNCRSRAEPPVPMNFFGNMVLWAFPRL  291

Query  988   KVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG--LVPTADMDKHIL  1161
             +V+D+L    S   + I DAV++++  Y++SF+DF     VA  +G  L+ T      +L
Sbjct  292   QVRDVLNSSYSSVVETIRDAVARIDGEYVQSFVDFGG---VANANGQELIATTVPAGSML  348

Query  1162  CPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDN  1341
             CP+ EVDSWLRF F+ LDFGTG P  F+   +P EG+MFL+PS   +G  D FI + +++
Sbjct  349   CPDAEVDSWLRFGFHQLDFGTGEPAAFLLPDWPVEGIMFLVPSHKANGGFDLFISIAEEH  408

Query  1342  LPTFKQICY  1368
             + TF+QICY
Sbjct  409   VATFQQICY  417



>ref|NP_001169239.1| hypothetical protein [Zea mays]
 gb|ACN32052.1| unknown [Zea mays]
 tpg|DAA43759.1| TPA: hypothetical protein ZEAMMB73_834619 [Zea mays]
Length=443

 Score =   300 bits (768),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 175/453 (39%), Positives = 249/453 (55%), Gaps = 23/453 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M++   ++  +KP Y    PL    VPL+VFD+ ++D  + +++AY  P P N  ++ GL
Sbjct  1     MEIITTASTMVKPVYSTPHPLAGEKVPLTVFDRAAFDIFVPIVFAYPAPAPSNEALKEGL  60

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEA--SGDTT--LDKVMPFKPSVSLLN  405
             R+A+ +Y   AGRL  D  G     LNDEGV  VEA  SGD    L   M       L  
Sbjct  61    RRAVALYPHLAGRLAVDGRGRRFFHLNDEGVLVVEAAVSGDLADVLGDGMATANVDELYP  120

Query  406   LHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
               P       L+Q+++ R+ CG LV+G T+HH VADGHS S FL  W  A R      +P
Sbjct  121   TPPEDNFGAALLQIKLNRYKCGGLVIGITSHHQVADGHSMSTFLTTWANAVRAGKDFSVP  180

Query  586   LRDRTIFIPRNPPRIE-------YDHVGAEYMPKQIKKNDHFLNSNDATF--LDDIVVHK  738
                +  F+ R    +        +DH   E+   +   +D    S   T   +D I    
Sbjct  181   AAAKAPFLNRAATAVPRAAPAPAFDHRSIEF---KGGDDDGARASKPYTVVPMDKIKNVT  237

Query  739   VHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGR  918
             VHFT EF+A LKA+      G R  STF+ L+AH+W+ IT AR+L   E T +R++V+ R
Sbjct  238   VHFTDEFIAGLKARV-----GVR-CSTFQCLLAHVWKKITAARDLDLEELTQVRVAVNCR  291

Query  919   ARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFAN  1098
              R +P VP D+FGN+VLWAFP  +V+DLL    S     I DAV++V+  YI+SF+DF  
Sbjct  292   GRASPAVPTDFFGNMVLWAFPRLQVRDLLNSSYSRVVDAIRDAVARVDGEYIQSFVDFGA  351

Query  1099  SKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMF  1278
                 + E+ LV TA     +L P++EVDSWL F F+ +D GTG P  F+P   P EG+M 
Sbjct  352   VADASGEE-LVATAAAPGTMLSPDMEVDSWLGFQFHQMDLGTGPPCAFLPPDLPIEGLMI  410

Query  1279  LLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
              +PS    G +D F+ + + ++  F+QIC+S+D
Sbjct  411   FVPSRTAKGGVDLFMAVAECHVNAFEQICHSID  443



>ref|XP_004983083.1| PREDICTED: agmatine coumaroyltransferase-2-like [Setaria italica]
Length=438

 Score =   297 bits (760),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 178/453 (39%), Positives = 248/453 (55%), Gaps = 29/453 (6%)
 Frame = +1

Query  58    MKVKVESTR--TIKPSYEGNPPLTT----THVPLSVFDKVSYDAQIAVIYAYRPPTPPNS  219
             M V VE TR   ++P     PP T     +  PL+ FD+ S D  I  ++A+  P P N+
Sbjct  2     MAVTVEITRRAVLRP-----PPATCRGGGSKSPLTAFDRASTDGYIPAVFAWNAPAPDNA  56

Query  220   TIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSL  399
              +  GL  A+  Y   AGR G D+ G     LND GV  VEA  D  L   +    +  +
Sbjct  57    ALVDGLLAAVARYPHLAGRFGVDDSGRKCFHLNDAGVLVVEAQADADLADALAHDVAAHI  116

Query  400   LNLHPSL---KGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
              +L+P     +    L Q Q+TR+ CG LV+G    HLVADG + S F  AW  A R   
Sbjct  117   NDLYPKADMERADEPLFQAQLTRYRCGGLVIGTACQHLVADGQAMSFFYTAWATAVRTAS  176

Query  571   IQ-PLPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVH  744
                P P  D T I +PR+PP  ++DH   E+  +    + + +   D   + ++VVH   
Sbjct  177   ATLPSPFTDHTAIAVPRDPPAPKFDHRNIEFRGEHSPSHSYGVLPGDR--IKNLVVH---  231

Query  745   FTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRAR  924
             F  EF+A LKA+ +++ G     STF+ L+AH W+ +T AR+L   E T IR++V+ R R
Sbjct  232   FPEEFIAGLKARVASVGGRC---STFQCLLAHAWKKVTAARDLPPEEPTQIRVAVNCRGR  288

Query  925   LNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSK  1104
               P VP +YFGN+VLWAFP  + +++L    +  A  I DAV++V+  YI+SF+DF    
Sbjct  289   AQPPVPMEYFGNMVLWAFPRMQAREVLSSSYAAVAGAIRDAVARVDAEYIQSFVDFGE--  346

Query  1105  VVAEEDG--LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMF  1278
              VAE  G  L  TA       CP+LEVDSWL F F+DLDFG G P  F+P   P EG+M 
Sbjct  347   -VAERAGEELASTAARPGTAFCPDLEVDSWLGFRFHDLDFGHGPPCAFLPPDLPIEGLMI  405

Query  1279  LLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
              +PS    G +D F+ L  +++  FKQICYS+D
Sbjct  406   FVPSCSAKGGVDLFVALNDEHVDAFKQICYSMD  438



>ref|XP_001779848.1| predicted protein [Physcomitrella patens]
 gb|EDQ55361.1| predicted protein [Physcomitrella patens]
Length=436

 Score =   296 bits (759),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 174/448 (39%), Positives = 243/448 (54%), Gaps = 23/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN-----ST  222
             MK++    R +KP+   N       VPLS  D V     + VIYAY+     +       
Sbjct  1     MKIERGLPRLVKPADRSNA--VPKVVPLSSSDLVVARVHVGVIYAYKASKGVSFDHVVQV  58

Query  223   IELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLL  402
             +E  L + L  YREWAGRL  DE G P + LND+GV FVEA  D  L  V PF PS  L 
Sbjct  59    LEGALGRVLTEYREWAGRLMIDETGRPAIELNDDGVVFVEAVADGCLQDVFPFDPSPLLQ  118

Query  403   NLHPSLKGVVEL--VQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQ  576
             ++ P  +GV EL  VQV VT+F CG L +G   +H VADG   S F+ AW  AC+ + + 
Sbjct  119   SMVPPSRGVPELLLVQVSVTKFKCGGLTLGVARYHQVADGTGASQFMNAWASACKGLPLS  178

Query  577   PLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
              +   DR   +PR+ P   +DH+  EY+   + K D  + SN+      +   K+ F+ +
Sbjct  179   SI-RHDRAALMPRDQPTPTFDHI--EYV-IPLPKPDAEVTSNNRP----VATKKIRFSFD  230

Query  757   FLAKLKAKASAMNG--GARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              + K+++KA   N   G   YSTFESL  HLWR ITKAR L G   T   I  D R RL 
Sbjct  231   MVKKIQSKAVKENDERGFPTYSTFESLTGHLWRCITKARGLSGDIETRTTIICDVRRRLT  290

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P +  DY+GN +  +     V  L  EPLSYAA ++H ++ +++N+YIRS ID+   +  
Sbjct  291   PSISEDYYGNAIFRSCARTLVTQLTEEPLSYAAGVVHASIKRLDNDYIRSAIDYIEHRRQ  350

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
                    P +     +L P+L+V SWL+ P Y LDFG G P    P++ P EG++ L  S
Sbjct  351   NTASFGRPLST----VLSPDLKVTSWLQMPLYKLDFGWGTPVYAGPSYVPFEGLIILNTS  406

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+DA + LF+D++  F+ IC+ +
Sbjct  407   HTQDGSVDAILTLFEDDMAKFENICFEV  434



>dbj|BAJ87102.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   296 bits (757),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 176/451 (39%), Positives = 249/451 (55%), Gaps = 24/451 (5%)
 Frame = +1

Query  58    MKVKVESTRT--IKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M V VE T++  ++PS E +       VPL+VFD+ S D  I  ++A+  P P N  ++ 
Sbjct  1     MAVTVEITQSTVLEPSQE-SAGGGGKKVPLTVFDRASTDGYIPAVFAWNAPAPTNDALKA  59

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL  A+  +   AGR   D+ G     LND GV  +EA+ D  L   +    +  +  L+
Sbjct  60    GLVAAVARFPHLAGRFAADDHGRKCFHLNDAGVLVLEATADADLADALAHDVAAHINELY  119

Query  412   PSLKGVVE---LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRD---VMI  573
             P  +   E   + Q Q+TR++CG LV+G   HH VADG S S F  AW  A R    V++
Sbjct  120   PKAEKERENEPIFQAQLTRYSCGGLVIGTACHHQVADGQSMSVFYTAWASAVRTDSAVLL  179

Query  574   QPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTL  753
              P   R  T+ +PR+PP   YDH   E+     K    + +S     ++ I    VHF  
Sbjct  180   SPFVDRSATV-VPRSPPTPAYDHRNIEF-----KGERSWSHSYGVLPMERIKNLAVHFPD  233

Query  754   EFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNP  933
             EF+A LKA+      G R  STF+ L+AH W+ IT AR+L   + T +R++V+ R R  P
Sbjct  234   EFVADLKARV-----GTR-CSTFQCLLAHSWKKITAARDLAPDDFTQVRVAVNCRGRAKP  287

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVA  1113
              VP D+FGN+VLWAFP  +V+DL+          I DAV+ V++ Y++SF+DF  ++   
Sbjct  288   PVPMDFFGNMVLWAFPRMQVRDLMSSSYPTVVGAIRDAVALVDDEYVQSFVDFGEAERGV  347

Query  1114  EEDG---LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLL  1284
              EDG   L  TA     + CP+LEVDSWL F F+DLDFG G P  F+P   P EG+M  +
Sbjct  348   IEDGGEELASTAATPGTMFCPDLEVDSWLGFRFHDLDFGCGPPCAFLPPDLPIEGIMIFV  407

Query  1285  PSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             PS    G +D F+ L  +++  FKQICYS+D
Sbjct  408   PSCDPKGGVDLFMALDDEHVQAFKQICYSMD  438



>gb|EMT21091.1| Anthranilate N-benzoyltransferase protein 2 [Aegilops tauschii]
Length=440

 Score =   295 bits (755),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 168/462 (36%), Positives = 253/462 (55%), Gaps = 46/462 (10%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRK  243
             +++ S+  +KP+Y    PL    VPL+VFD+ + D  +  + AYR P P N  +  GL K
Sbjct  1     MEITSSTMVKPAYAVPHPLVGEMVPLTVFDRAALDIFVPTVLAYRAPAPSNEALREGLLK  60

Query  244   ALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEAS-----GDTTLDKVMP----------  378
             A+  Y   AGRL  +++G  V+ +N+EGV  +EA+      D  +D  M           
Sbjct  61    AVAPYPHLAGRLALNDQGRRVLHVNNEGVLLIEATVPVDLADVLVDGRMAAGVEDIYRRY  120

Query  379   FKPSVSLLNLHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKAC  558
             +    + +  H ++     L+Q+Q+ R+ CG LVVG  +HH  ADGHS S F  AW  A 
Sbjct  121   YLLGFASVTTHENIGAA--LLQIQLNRYKCGGLVVGICSHHQAADGHSMSMFFTAWATAV  178

Query  559   RDV--MIQPLPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATF----L  717
             R+      P P  DR    +PR+ P   +DH           ++  F   +  T+    +
Sbjct  179   REGKDFTTPAPFLDRARTSVPRSTPTPVFDH-----------RSREFTCGDGDTYAVVPM  227

Query  718   DDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHI  897
             D I    +HFT EF+A LKA+      GAR  S F+ L+AH+W+ IT AR+    E T +
Sbjct  228   DRIRNLTLHFTAEFVADLKARV-----GAR-CSRFQCLLAHVWKKITAARDQKPEEFTKV  281

Query  898   RISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIR  1077
             R++V+ R R +P VP D+FGN+VLWAFP  +V+D+L         +I DAV+++++ Y++
Sbjct  282   RVAVNCRGRADPPVPMDFFGNMVLWAFPRLQVRDVLNSSYGSVVGVIRDAVARIDDEYVQ  341

Query  1078  SFIDFANSKVVAEEDG--LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPT  1251
             S +DF     VA+ +G  L  TA     + CP+ EVDSWL F F+ LDFGTG P  F+P 
Sbjct  342   SLVDFGG---VADTNGEELFATAATAGTMFCPDAEVDSWLGFRFHQLDFGTGAPSAFIPP  398

Query  1252  FFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
               P EG+M  +PS   +G +D F+ + ++++  F+QIC S D
Sbjct  399   DLPIEGLMVFVPSCKANGGVDLFMAVAEEHVAAFEQICCSFD  440



>ref|XP_008788605.1| PREDICTED: agmatine coumaroyltransferase-2-like [Phoenix dactylifera]
Length=428

 Score =   294 bits (752),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 169/445 (38%), Positives = 252/445 (57%), Gaps = 22/445 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M+V V ++ TI P  + NP      VP ++FD+ + D     ++A+ PPT  NS +  GL
Sbjct  1     MEVHVHNS-TIIP--QANPNTEPAEVPFTIFDRYALDIHYTTLFAFTPPTSTNSELIEGL  57

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEG--VKFVEASGDTTLDKVMPFKPSVSLLNLH  411
              K L  +     R+G   +  P  L+   G     VEA+    L   +P +PS     LH
Sbjct  58    SKTLVHFPTLTSRIGYSRDNRPCFLIGGHGGGALVVEATVALNLSDHLPLEPSPDFKLLH  117

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P  K    L QVQ+ RF CG L++  T HH VADG S S F VAWG+  R + I  LP+ 
Sbjct  118   PPTKQSKHLFQVQLNRFKCGGLILTVTVHHKVADGQSMSTFFVAWGQKVRGMPIDRLPVY  177

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDA--TFLDDIVVHKVHFTLEFLA  765
             D+++  PR+PP  ++ H G +++P Q    D  +N  D   + + +I++    ++ E++ 
Sbjct  178   DQSLVKPRSPPESKFQHWGLDFLPDQ---GDFSVNQVDVDPSKITNILLR---YSSEYIT  231

Query  766   KLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPN  945
              +  KAS        Y+TFE+L+ H+WR IT AR L   E T I +SV+GR RL P VP+
Sbjct  232   TM-LKASM----KEKYTTFETLLGHVWRKITIARGLHDGEYTTIELSVNGRPRLKPSVPD  286

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG  1125
             +YFGNLV+ A P A VK L+   L+ AA+LIH+AV +V+++Y++SFIDF  +    E++ 
Sbjct  287   EYFGNLVVDAHPKASVKQLVEGGLADAARLIHEAVVRVDSHYMQSFIDFGTTN---EDED  343

Query  1126  LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPY-IFMPTFFPTEGMMFLLPSFIGD  1302
             LVP   +  ++L P +E +SWLRF F  ++FG G     F PT+ P EG++  LP     
Sbjct  344   LVPVYQLKGNVLSPTVEANSWLRFQFQHVEFGGGGKLRAFFPTWIPVEGVVMFLPGVDEG  403

Query  1303  GSIDAFIPLFQDNLPTFKQICYSLD  1377
             G +D F+ L Q++    +QI +SLD
Sbjct  404   GGVDVFVSLLQEHARILRQISHSLD  428



>ref|XP_010922027.1| PREDICTED: agmatine coumaroyltransferase-2-like [Elaeis guineensis]
Length=431

 Score =   294 bits (752),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 164/446 (37%), Positives = 249/446 (56%), Gaps = 21/446 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M+V V S+  I    +GNP    + VP ++FD+ + +  +AV++A+ PPTP NS +   L
Sbjct  1     MEVHVHSSTIIA---QGNPNAEPSEVPFTIFDRFAINIHVAVLFAFTPPTPTNSALTEAL  57

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEG--VKFVEASGDTTLDKVMPFKPSVSLLNLH  411
              K L  +    GR G      P +L+   G     VEA+  ++L   +P +PS     LH
Sbjct  58    SKTLVHFPTLTGRFGYSHRNRPCLLIGGRGGGALVVEATVASSLSDHLPLEPSPDFELLH  117

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P  K    L+QVQ+ RF CG LV+  TAHH VADG S S F +AWG+  R + I  LP+ 
Sbjct  118   PPRKEAKHLLQVQLNRFKCGGLVIAVTAHHKVADGQSMSTFFIAWGQTVRGMPIDRLPVY  177

Query  592   DRTIFIPRNPPRIEYDHVGAEYMPKQIKKND---HFLNSNDATFLDDIVVHKVHFTLEFL  762
             D++   P+ PP+ E+ H G ++ P Q  ++    H ++ + A   + ++ +   +     
Sbjct  178   DQSWLKPQCPPKPEFQHWGTDFEPIQPNQDGFTVHRVDVDPARITNILLRYSSEY---IT  234

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
              KLKA           ++TFE+L+ H+WR IT AR L   E T   ++V+ R RL P VP
Sbjct  235   GKLKANMK------EKHTTFETLLGHVWRKITIARGLDDSEYTVTNVAVNCRPRLKPAVP  288

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
             +++FGNLVL A+  A VK L+   L+ AA+LIH+A   +N  +I+SFIDF     + E++
Sbjct  289   SEFFGNLVLDAYAKASVKQLIEGGLAEAARLIHEAAVSINRRFIQSFIDFG---AMYEDE  345

Query  1123  GLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPY-IFMPTFFPTEGMMFLLPSFIG  1299
              LV   ++  ++L P +E +SWL F F D+D G G     F+P++ P EGM+  LP    
Sbjct  346   DLVLVYELHGNMLSPIVEANSWLGFKFQDVDIGGGGKLQAFLPSWIPVEGMVMFLPGVDQ  405

Query  1300  DGSIDAFIPLFQDNLPTFKQICYSLD  1377
              G ID F+ L +++  T +QI +SLD
Sbjct  406   GGGIDVFVSLLEEHAQTLRQISHSLD  431



>ref|XP_001763897.1| predicted protein [Physcomitrella patens]
 gb|EDQ71301.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   291 bits (745),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 157/387 (41%), Positives = 218/387 (56%), Gaps = 20/387 (5%)
 Frame = +1

Query  223   IELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLL  402
             +E  L + L  YREWAGRL  +E G P + LND+GV FVEA  D  L  V PF PS  LL
Sbjct  30    LEEALGRVLTEYREWAGRLVINETGRPAIELNDDGVVFVEAVADGCLQDVFPFDPSPLLL  89

Query  403   NLHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPL  582
             ++ P  +GV EL+ VQVT++ CG L +G   HH VADG S S F+ AW  AC+ +   P+
Sbjct  90    SMVPPSRGVPELLLVQVTKYKCGGLTLGVARHHQVADGTSASQFMNAWASACKGIPPSPI  149

Query  583   PLRDRTIFIPRNPPRIEYDHVGAEY---MPKQIKKNDHFLNSNDATFLDDIVVHKVHFTL  753
              L DR   +PR+ P   +DH+  EY   +PK + K D F N         +   K+ F+ 
Sbjct  150   -LHDRAALMPRDQPMPTFDHI--EYVMPLPKPVAK-DTFNNR-------PLARKKIRFSF  198

Query  754   EFLAKLKAKASAMNG--GARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARL  927
             + + K+K+KA   N   G   YSTFESL  HLWR ITKAR L     T   ++ D R RL
Sbjct  199   DMVQKIKSKAVKENDERGFPTYSTFESLTGHLWRCITKARGLSSDIETRTTVACDARRRL  258

Query  928   NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKV  1107
              P +  DY+GN++  +     V  +  EPLSYAA ++H ++ +++N+YIRS ID+   + 
Sbjct  259   TPSISEDYYGNVIFHSCARTLVSQVTEEPLSYAAGVVHASIKRLDNDYIRSAIDYIEHR-  317

Query  1108  VAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLP  1287
                             +L P+L + SWL+ P Y LDFG G P    P + P EG++ L  
Sbjct  318   ---RQNTASYGRTLSTVLSPDLSLTSWLQMPLYKLDFGWGTPVYAGPPYVPFEGLIILNA  374

Query  1288  SFIGDGSIDAFIPLFQDNLPTFKQICY  1368
             S   DGS+DA + LF+D++  F+ IC+
Sbjct  375   SHTQDGSVDAILALFEDDMAKFENICF  401



>gb|EAY78283.1| hypothetical protein OsI_33328 [Oryza sativa Indica Group]
Length=434

 Score =   292 bits (747),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 177/448 (40%), Positives = 244/448 (54%), Gaps = 22/448 (5%)
 Frame = +1

Query  58    MKVKVESTRT--IKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYR-PPTPPNSTIE  228
             M V VE TR+  ++PS            PL+VFD+ + D  I  ++A+     P N  ++
Sbjct  1     MAVAVEITRSEVLRPSETLAAGGGGKRSPLTVFDRAAMDWYIPAVFAWDGAAAPSNDEVK  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
              GL   L  Y   AGR   DE G     LND GV+ +EA+    L   +    +  +  L
Sbjct  61    GGLAAVLARYPHLAGRFDVDERGRRCFNLNDAGVRVLEATVAADLADALAHDVAAHVNEL  120

Query  409   HPS--LKGVVELV-QVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV-MIQ  576
             +P   ++   E V QVQ+TR+ CG LV+G   +H V+DG S S F VAW  A R      
Sbjct  121   YPKADMENADEPVFQVQLTRYACGGLVIGTACNHQVSDGQSMSFFYVAWAAAVRSAGATL  180

Query  577   PLPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTL  753
             P P  DR  I +PR PP   +DH   E+     K    + +S  +  L+ I    VHF  
Sbjct  181   PTPFVDRAAIAVPRGPPAPAFDHRNIEF-----KGEHSWTHSYGSLPLERIRNLAVHFPD  235

Query  754   EFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNP  933
             EF+A LK+       GAR  STF+ L+AH W+ I  AR+L   E T +R++V+ R R +P
Sbjct  236   EFVAGLKSHV-----GAR-CSTFQCLLAHAWKKIMAARDLSPEEYTQVRVAVNCRGRASP  289

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVA  1113
              VP DYFGN+VLWAFP  +V+DLL    +    +I DAV++V+  YI+SF+DF     VA
Sbjct  290   AVPMDYFGNMVLWAFPRMRVRDLLSSSYAAVVGVIRDAVARVDEQYIQSFVDFGE---VA  346

Query  1114  EEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSF  1293
               D L PTA     + CP+LEVDSWL F F+DLDFG G P  F+P   P EG++  +PS 
Sbjct  347   AGDELTPTAAPPGTVFCPDLEVDSWLGFRFHDLDFGRGPPCAFLPPDVPVEGLLIFVPSC  406

Query  1294  IGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
                G ++ F+ L   ++  F+QICYS+D
Sbjct  407   AAKGGVEMFMALDDVHVEAFRQICYSMD  434



>ref|XP_001780270.1| predicted protein [Physcomitrella patens]
 gb|EDQ54934.1| predicted protein [Physcomitrella patens]
Length=436

 Score =   291 bits (745),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 173/448 (39%), Positives = 239/448 (53%), Gaps = 23/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN-----ST  222
             MK++    R +KP+   N       VPLS  D V     + VI+AY+     +       
Sbjct  1     MKIERGLPRLVKPADRSNA--VPKVVPLSSSDLVVPRLHVGVIFAYKASKGVSFDHVVQV  58

Query  223   IELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLL  402
             +E  L + L  YREWAGRL  DE G P + LND+GV FVEA  D  L  V PF PS  L 
Sbjct  59    LEGALGRVLTEYREWAGRLVIDETGRPAIELNDDGVVFVEAVADGCLQDVFPFDPSPLLQ  118

Query  403   NLHPSLKGVVEL--VQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQ  576
             ++ P  +GV EL  VQV VT+F CG L +G   +H VADG   S F+ AW  AC+ + + 
Sbjct  119   SMVPPSRGVPELLLVQVSVTKFKCGGLTLGVARYHQVADGTGASQFMNAWASACKGLPLS  178

Query  577   PLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
              +   DR   +PR+ P   +DH+  EY+   + K D  + SN+      +   K+ F+ +
Sbjct  179   SI-RHDRAALMPRDQPTPTFDHI--EYV-IPLPKPDAEVTSNNRP----VATKKIRFSFD  230

Query  757   FLAKLKAKASAMNG--GARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              + K+K+KA   N   G   YSTFESL  HLWR ITKAR L G   T   I  D R RL 
Sbjct  231   MVKKIKSKAVKENDERGFPTYSTFESLTGHLWRCITKARGLSGDIETRTTIFCDVRRRLT  290

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P +  DY+GN +  +     V  L  EPLSYAA ++H ++ +++N+YIRS ID+   +  
Sbjct  291   PSISEDYYGNAIFHSCARTFVTQLTEEPLSYAAGVVHASIKRLDNDYIRSAIDYIEHR--  348

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
                            +L P+L+V SWL+ P Y LDFG G P    P   P EG++ L  S
Sbjct  349   --RQNTASFGRTLSTVLSPDLKVTSWLQMPLYKLDFGWGTPVYAGPAHVPFEGLIVLNAS  406

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+DA + LF+D++  F+ IC+ +
Sbjct  407   HTQDGSVDAILTLFEDDMAKFENICFEV  434



>gb|EAZ15901.1| hypothetical protein OsJ_31319 [Oryza sativa Japonica Group]
Length=435

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 177/449 (39%), Positives = 246/449 (55%), Gaps = 23/449 (5%)
 Frame = +1

Query  58    MKVKVESTRT--IKPSYEGNPPLTTT-HVPLSVFDKVSYDAQIAVIYA-YRPPTPPNSTI  225
             M V VE TR+  ++PS             PL+VFD+ + D  I  ++A Y    P N  +
Sbjct  1     MAVAVEITRSEVLRPSEASAAGGGGGKRSPLTVFDRAATDWYIPAVFAWYGAAAPSNDEV  60

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             + GL   L  Y   AGR   DE G     LND G++ +EA+    L   +    +  +  
Sbjct  61    KGGLAAVLARYPHLAGRFNVDERGRRCFNLNDAGLRVLEATVAADLADALAHDFAAHVNE  120

Query  406   LHPS--LKGVVELV-QVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV-MI  573
             L+P   ++   E V QVQ+TR+ CG LV+G   +H V+DG S S F VAW  A R     
Sbjct  121   LYPKADMENADEPVFQVQLTRYACGGLVIGTACNHQVSDGQSMSFFYVAWAAAVRSAGAT  180

Query  574   QPLPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
              P P  DR  I +PR PP   +DH   E+     K  + + +S  +  L+ I    VHF 
Sbjct  181   LPTPFVDRAAIAVPRGPPAPAFDHRNIEF-----KGENSWTHSYGSLPLERIRNLAVHFP  235

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              EF+A LK+       GAR  STF+ L+AH W+ IT AR+L   E T +R++V+ R R +
Sbjct  236   DEFVAGLKSHV-----GAR-CSTFQCLLAHAWKKITAARDLSPEEYTQVRVAVNCRGRAS  289

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P VP DYFGN+VLWAFP  +V+DLL    +    +I +AV++V+  YI+SF+DF     V
Sbjct  290   PAVPMDYFGNMVLWAFPRMRVRDLLSASYATVVGVIREAVARVDEQYIQSFVDFGE---V  346

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
             A  D L PTA     + CP+LEVDSWL F F+DLDFG G P  F+P   P EGM+  +PS
Sbjct  347   AVGDELTPTAAPPGTVFCPDLEVDSWLGFRFHDLDFGRGPPCAFLPPDLPVEGMLIFVPS  406

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
                 G ++ ++ L   ++  F+QICYS+D
Sbjct  407   CAAKGGVEMYMALDDLHVDAFRQICYSMD  435



>ref|XP_008788604.1| PREDICTED: agmatine coumaroyltransferase-2-like [Phoenix dactylifera]
Length=432

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 165/447 (37%), Positives = 248/447 (55%), Gaps = 22/447 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
             M+V V  +  I    +GNP    + VP ++FD+ + +  +AV++A+ PPTP NS +   L
Sbjct  1     MEVHVHGSTIIA---QGNPNAEPSEVPFTIFDRYAINIHVAVLFAFTPPTPTNSALIEAL  57

Query  238   RKALGVYREWAGRLGNDEEGNPVVLLNDEGVK--FVEASGDTTLDKVMPFKPSVSLLNLH  411
              K L  +    GR        P +L+   G     VEA+  + L   +P +PS     LH
Sbjct  58    SKTLVHFPTLTGRFSCSHRNRPCLLIGGGGGGALVVEATVASNLSDHLPLEPSPDFELLH  117

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLR  591
             P  +    L+QVQ+ RF CG LV+  TAHH VADG S S F VAWG+  R + I  LP+ 
Sbjct  118   PPREEAKHLLQVQLNRFKCGGLVIAVTAHHKVADGQSMSTFFVAWGRTVRGIPIDRLPVY  177

Query  592   DRTIFIPRNPPRIEYDHVGAEYM---PKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
             DR+   PR PP+ E+ H G +++   P Q     H     D T + +++   + ++ E++
Sbjct  178   DRSWLKPRCPPKPEFQHWGIDFVPISPNQAGFTVHRRVDVDPTKITNVL---LRYSSEYI  234

Query  763   -AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKV  939
              AKLKA           Y+TFE+L+ H+WR IT AR L   E T +  +V+GR RL P V
Sbjct  235   TAKLKANMK------EKYTTFETLLGHVWRKITIARGLEDSEHTAMEFAVNGRPRLKPAV  288

Query  940   PNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEE  1119
             P+++FGNLV+ A   A VK L+   L+ A +LIH+A   +++ +I+SFI+F     + E+
Sbjct  289   PSEFFGNLVVDAHAKASVKQLMEGGLAEATRLIHEAAVSIDSRFIQSFIEFG---AMYED  345

Query  1120  DGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPY-IFMPTFFPTEGMMFLLPSFI  1296
             + LVP  ++  ++L P  E +SWL F F D+D G G     F+P++ P EGM+  LP   
Sbjct  346   EDLVPVYELHGNVLSPIAEANSWLGFKFQDMDIGGGGKLQAFLPSWIPVEGMVMFLPGVD  405

Query  1297  GDGSIDAFIPLFQDNLPTFKQICYSLD  1377
               G ID  +PL +++    +QI +SLD
Sbjct  406   RGGGIDVLVPLLEEHAQRMRQISHSLD  432



>gb|EMT22438.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=430

 Score =   289 bits (739),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 163/446 (37%), Positives = 245/446 (55%), Gaps = 39/446 (9%)
 Frame = +1

Query  88    IKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREW  267
             ++P Y    PL    V L++FD+ + D  + ++ AY  P P N  ++ GL +A+ +Y   
Sbjct  2     LRPVYRVPHPLAGDKVQLTIFDRAAIDTYVPMVLAYLAPAPSNEALKEGLLRAIALYPHL  61

Query  268   AGRLGNDEEGNPVVLLNDEGVKFVEA-----------SGDTTLDKVMPFKPSVSLLNLHP  414
              GR   D  G   + LN+EGV  +EA           +G  T D V  F P+V      P
Sbjct  62    LGRFAVDGHGRRFLHLNNEGVLVIEADVPADLADVLATGGMTTD-VAGFYPTV------P  114

Query  415   SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQPLPL  588
                    L+QV+++R+ CG L++G   HH +ADG + S F  AW  A R+      P P 
Sbjct  115   EESVGAALLQVKLSRYRCGGLLLGVICHHHIADGMAASTFYAAWATAVREGKGFSVPSPF  174

Query  589   RDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLA  765
              DR    +PR+ P+  +DH   E+    I ++   +       +D I    VHF +EF+A
Sbjct  175   LDRAATAVPRSTPKPVFDHRSIEFRGSSISQSHALVP------MDKIKNIAVHFPVEFIA  228

Query  766   KLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPN  945
             +LK++  A      P STF+ L+AH+W+ IT AR L   E T +R+ V+ R R +P VP 
Sbjct  229   ELKSRVDA------PCSTFQCLLAHVWKKITSARGLNPQEFTQVRVGVNCRGRASPPVPM  282

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG  1125
             D+FGN+VLWAFP  +V+D+L          I DAV+++++ YI+S++DF     VA+ +G
Sbjct  283   DFFGNMVLWAFPRLQVRDVLGLSYGCVVGAIRDAVARIDDEYIQSYVDFGG---VADANG  339

Query  1126  --LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIG  1299
               L  T+     +LCP++E +SWL F F+ LDFGTG P  F+P   P EG+M  +PS   
Sbjct  340   EQLAATSSFGA-MLCPDIEAESWLGFRFHQLDFGTGQPSAFLPPGLPVEGLMVFVPSRSA  398

Query  1300  DGSIDAFIPLFQDNLPTFKQICYSLD  1377
              GS+D F+ + +D++  F +ICYSLD
Sbjct  399   KGSVDLFMAIAEDHVTAFNKICYSLD  424



>ref|NP_001176675.1| Os11g0642400 [Oryza sativa Japonica Group]
 gb|ABA95026.1| Transferase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAH01021.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH95403.1| Os11g0642400 [Oryza sativa Japonica Group]
Length=445

 Score =   289 bits (739),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 173/447 (39%), Positives = 246/447 (55%), Gaps = 20/447 (4%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRK  243
             +++ S+  +K +     PL    VPLS FD+ ++D  + +++AYR P P +  ++ GLR 
Sbjct  1     MEITSSAMLKTTTTPPHPLAGEKVPLSAFDRAAFDVFVPLVFAYRAPAPSSEAVKEGLRV  60

Query  244   ALGVYREWAGRLGNDEEGNP----VVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             A+  Y   +GR+  D +G      V+ +N+EGV  ++A+ +  LD V+    +  L    
Sbjct  61    AVAAYPLVSGRIAVDGQGRRRRRRVLHVNNEGVLVLDATVEVDLDAVLAANVATDLYPAL  120

Query  412   PSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRD--VMIQPLP  585
             P       L+QVQ+TRF CG LVVG   HH V DGHS S F   W +A RD    I P P
Sbjct  121   PEHSFGAALLQVQLTRFGCGGLVVGLIGHHHVFDGHSMSTFCATWARAVRDSEAFIVPSP  180

Query  586   LRDRTIF-IPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
               DR I  +PR+PP   +DH   E+  K   K+     +  A  ++ I    V FT +F+
Sbjct  181   SLDRAITGVPRSPPAPVFDHRSIEF--KVGNKSSDSSGAAAAAAVEKIANIGVRFTAKFV  238

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
             A+LKA+      G R  STFE ++AH W+ IT AR L   E T +R++V+ R R NP  P
Sbjct  239   AELKARV-----GGR-CSTFECVLAHAWKKITAARGLKPEEFTRVRVAVNCRRRANPPAP  292

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEED  1122
              D FGN+VLWAFP  +V+ LL          I  AV++V+  YI+SF+D+     VA+  
Sbjct  293   ADLFGNMVLWAFPRLQVRRLLSSSYRDVVGAIRAAVARVDAEYIQSFVDYVE---VADAR  349

Query  1123  G--LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFI  1296
             G  L  TA      LCP+LEVDSWL F F+++D GTG P   +    P EG+M L+P   
Sbjct  350   GEELAATAAEPGETLCPDLEVDSWLGFRFHEMDLGTGPPAAVLSPDLPIEGLMILVPVGG  409

Query  1297  GDGSIDAFIPLFQDNLPTFKQICYSLD  1377
               G +D F+ L  D+   F+QICYSL+
Sbjct  410   DGGGVDLFVALADDHAQAFEQICYSLE  436



>ref|XP_008660165.1| PREDICTED: agmatine coumaroyltransferase-1-like [Zea mays]
 tpg|DAA46909.1| TPA: hypothetical protein ZEAMMB73_733461 [Zea mays]
Length=441

 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 169/418 (40%), Positives = 232/418 (56%), Gaps = 21/418 (5%)
 Frame = +1

Query  148   FDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEG  327
             FD+ S D  I  ++A+  P P N  I  GL   +  Y   + R+G D+ G    LLND G
Sbjct  37    FDRASTDGYIPTVFAWYAPAPDNEAIVDGLLAVVARYPHLSARMGVDDRGRKCFLLNDAG  96

Query  328   VKFVEASGDTTLDKVMPFKPSVSLLN-LHPSLKGVVE---LVQVQVTRFTCGSLVVGFTA  495
             V  VEA+ D  L   +      + +N L+P      E   L QVQ+TR+TCG LV+G   
Sbjct  97    VLVVEATADADLADALVAHDVTAHINELYPKADKEREDEPLFQVQLTRYTCGGLVIGTVC  156

Query  496   HHLVADGHSTSNFLVAWGKACRDVMIQ--PLPLRDRT-IFIPRNPPRIEYDHVGAEYMPK  666
              HLVADG S S+F  AW  A R       P P  DR  I +PRNPP   +DH   E+   
Sbjct  157   QHLVADGQSMSSFYAAWATAVRSASAADLPSPFTDRAAIAVPRNPPVPRFDHRNIEF---  213

Query  667   QIKKNDHFLNSNDATF-LDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHL  843
                + +H  +   A   +D I    ++F  +F+A LKA+      G R  +TF+ L+AH+
Sbjct  214   ---RGEHSSSRPYAVLPMDRIKNLGINFPEQFIADLKARV-----GGR-CTTFQCLLAHV  264

Query  844   WRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSY  1023
             W+ +T AR+L   E T IR++V+ R R +P VP +YFGN+VLWAFP  + ++LL    + 
Sbjct  265   WKKVTAARDLAPEEFTQIRVAVNCRGRADPPVPMEYFGNMVLWAFPRMQARELLSSSYAA  324

Query  1024  AAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPF  1203
                 I DAV++V+  YI+SF+DF +    A E+ L  TA       CP+LEVDSWL F F
Sbjct  325   VVGAIRDAVARVDAEYIQSFVDFGDMAERAGEE-LASTAAGPGTAFCPDLEVDSWLGFRF  383

Query  1204  YDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             +DLDFG G P  F+P   P EG+M L+PS    G +D F+ L  D++  FK ICYS+D
Sbjct  384   HDLDFGYGAPCAFLPPDLPVEGLMILVPSCAAKGGVDLFMALDDDHVDAFKHICYSMD  441



>ref|XP_003561973.1| PREDICTED: agmatine coumaroyltransferase-1-like [Brachypodium 
distachyon]
Length=446

 Score =   288 bits (737),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 167/446 (37%), Positives = 252/446 (57%), Gaps = 16/446 (4%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRK  243
             +++  T  +KP+Y    PL    VPL++FD+ + D  + ++ AY  P P N  ++ GL K
Sbjct  1     MEITGTTMLKPAYPTPHPLAGDRVPLTIFDRAAIDTYVPIVLAYPAPAPSNEALKEGLLK  60

Query  244   ALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTL--DKVMPFKPSVSLLNLHPS  417
              +  Y   AGRL  D  G   + LN+EGV  +EA+  T +  D +     +  + + +P+
Sbjct  61    GVAPYPHMAGRLAVDHRGRRFIHLNNEGVLVIEAAATTAVLADVLAAGGMTTDVADFYPT  120

Query  418   L--KGVVE-LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQPL  582
             +  + V E L+Q++++R+ CG LV+G   HH + DGHS S F   W +A R+      P 
Sbjct  121   VPEESVGEALLQIKLSRYRCGGLVIGVMVHHHIVDGHSASMFCSTWARAVREGNGFRAPS  180

Query  583   PLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEF  759
             P  DR     PR  P+  +DH   E+   Q   +     S +   +D I    VHF  EF
Sbjct  181   PALDRAATAAPRGMPKPAFDHRFIEFKGSQGSSSGGEDKSYEVLPMDKIKNLTVHFPAEF  240

Query  760   LAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKV  939
             +A+LKA+      GAR  STF+ L+AH+W+ +T AR L   E T +R++V+ R R  P V
Sbjct  241   VAELKARV-----GAR-CSTFQCLLAHVWKKMTAARGLKPEEFTQVRVAVNCRGRARPAV  294

Query  940   PNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEE  1119
             P D+FGN+VLWAFP  + +D+LR         I DA +++++ YI+S++DF        E
Sbjct  295   PMDFFGNMVLWAFPRLQARDVLRLSYRGVVAAIRDAAARIDDEYIQSYVDFGGLADANRE  354

Query  1120  DGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIG  1299
             D L+ TA M   +LCP++EVDSWL F  +DLDFGTG    F+P   P EG+M  +PS   
Sbjct  355   D-LLATAAMGT-MLCPDIEVDSWLGFSLHDLDFGTGPASAFLPPGLPVEGLMVFVPSRAS  412

Query  1300  DGSIDAFIPLFQDNLPTFKQICYSLD  1377
              GS+D FI + +D++  F+ +C+SLD
Sbjct  413   KGSVDLFIAVAEDHVAAFQNVCHSLD  438



>gb|AAM74310.1|AC114474_2 Putative anthranilate N-benzoyltransferase [Oryza sativa Japonica 
Group]
 gb|AAP53439.1| Transferase family protein, expressed [Oryza sativa Japonica 
Group]
Length=434

 Score =   287 bits (735),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 175/448 (39%), Positives = 244/448 (54%), Gaps = 22/448 (5%)
 Frame = +1

Query  58    MKVKVESTRT--IKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYR-PPTPPNSTIE  228
             M V VE TR+  ++PS             L+VFD+ + D  I  ++A+     P N  ++
Sbjct  1     MAVAVEITRSEVLRPSETLAAGGGGKRSQLTVFDRAAMDWYIPAVFAWDGAAAPSNDEVK  60

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
              GL   L  Y   AGR   DE G     LN+ GV+ +EA+    L   +    +  +  L
Sbjct  61    GGLAAVLARYPHLAGRFDVDERGRRCFNLNNAGVRVLEATVAADLADALAHDVAAHVNEL  120

Query  409   HPS--LKGVVELV-QVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV-MIQ  576
             +P   ++   E V QVQ+TR+ CG LV+G   +H V+DG S S F VAW  A R      
Sbjct  121   YPKADMENADEPVFQVQLTRYACGGLVIGTACNHQVSDGQSMSFFYVAWAAAVRSAGATL  180

Query  577   PLPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTL  753
             P P  DR  I +PR PP   +DH   E+     K    + +S  +  L+ I    VHF  
Sbjct  181   PTPFVDRAAIAVPRGPPAPAFDHRNIEF-----KGEHSWTHSYGSLPLERIRNLAVHFPD  235

Query  754   EFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNP  933
             EF+A LK+       GAR  STF+ L+AH W+ IT AR+L   E T +R++V+ R R +P
Sbjct  236   EFVAGLKSHV-----GAR-CSTFQCLLAHAWKKITAARDLSPEEYTQVRVAVNCRGRASP  289

Query  934   KVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVA  1113
              VP DYFGN+VLWAFP  +V+DLL    +    +I +AV++V+  YI+SF+DF     VA
Sbjct  290   AVPMDYFGNMVLWAFPRMRVRDLLSSSYAAVVGVIRNAVARVDEQYIQSFVDFGE---VA  346

Query  1114  EEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSF  1293
               D L PTA     + CP+LEVDSWL F F+DLDFG G P  F+P   P EG++  +PS 
Sbjct  347   AGDELTPTAAPPGTVFCPDLEVDSWLGFRFHDLDFGRGPPCAFLPPDVPVEGLLIFVPSC  406

Query  1294  IGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
                G ++ F+ L   ++  F+QICYS+D
Sbjct  407   AAKGGVEMFMALDDVHVEAFRQICYSMD  434



>gb|EMT24916.1| Anthranilate N-benzoyltransferase protein 1 [Aegilops tauschii]
Length=451

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 165/449 (37%), Positives = 248/449 (55%), Gaps = 36/449 (8%)
 Frame = +1

Query  79    TRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVY  258
             +  +KP+Y    PL      L+VFD+ + D  + ++ AY  P P N  ++ GL +A+  Y
Sbjct  17    SAVLKPAYAAPHPLAGGKGQLTVFDRAAIDTYVPIVLAYPAPAPSNQALKEGLLQAIAPY  76

Query  259   REWAGRLGNDEEGNPVVLLNDEGVKFVE-----------ASGDTTLDKVMPFKPSVSLLN  405
                 GR   D  G  V+ LN+EGV  +E           A+G    D V  F P+V   +
Sbjct  77    PHLLGRFALDGHGRRVLHLNNEGVLVIETDVPADLADVLAAGGMATD-VTGFYPTVPEDS  135

Query  406   LHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQP  579
             + P+L      +Q++++R+ CG L++G   HH +ADGH+ S F  +W  A R+      P
Sbjct  136   VGPAL------LQIKLSRYRCGGLLLGVICHHHIADGHAASTFYGSWATAVREGKGFTLP  189

Query  580   LPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
              P  DR    +PR+ P+  +DH   E+   +   +      +    +D I    VHF  E
Sbjct  190   SPFIDRAATAVPRSTPKPVFDHRSIEFKGGEGSGSS---QPHAVLPMDKIRNITVHFPAE  246

Query  757   FLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPK  936
             F+A+L+++      GAR  STF+ L+AH+W+ +T AR L   E T +R++V+ R R NP 
Sbjct  247   FIAELRSRV-----GAR-CSTFQCLLAHVWKKVTAARGLSPEEFTQVRVAVNCRGRANPP  300

Query  937   VPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAE  1116
             VP D+FGN+VLWAFP  +V+D+L          I DA ++++  YI+S++DF     VA+
Sbjct  301   VPMDFFGNMVLWAFPRLQVRDVLGLSYGGVVGAIRDAAARIDEEYIQSYVDFGR---VAD  357

Query  1117  EDG--LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +G  L  T+     +LCP++EVDSWL F F+ LDFGTG P  F+P   P EG+M  +PS
Sbjct  358   ANGEELAATSTFGT-MLCPDIEVDSWLGFRFHQLDFGTGPPSAFLPPGLPVEGLMVFVPS  416

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
                 GS+D F+ L  D++  FK+ICYSLD
Sbjct  417   RTVKGSVDLFMALADDHVAPFKRICYSLD  445



>gb|EMS62369.1| Agmatine coumaroyltransferase-2 [Triticum urartu]
Length=451

 Score =   284 bits (727),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 172/466 (37%), Positives = 253/466 (54%), Gaps = 41/466 (9%)
 Frame = +1

Query  34    VHFVEKKTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPP  213
             V++ E   + V    +  +KP+Y    PL    V L+V  + + D  + ++ AY  P P 
Sbjct  3     VNYAEAGQV-VATSRSAMLKPAYAAPHPLAGGKVQLTVSARAAIDTYVPIVLAYPAPAPS  61

Query  214   NSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEA-----------SGDTT  360
             N  ++ GL +A+  Y    GR   D  G  V+ LN+EGV  +EA           +G   
Sbjct  62    NQALKEGLLRAIAPYPHLLGRFALDGHGRRVLHLNNEGVLVIEADVPADMADVLAAGGMA  121

Query  361   LDKVMPFKPSVSLLNLHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLV  540
              D V  F P+V   ++ P+L      +QV+++R+ CG L++G   H  +ADGH+ S F  
Sbjct  122   TD-VAGFYPTVPEESVGPAL------LQVKLSRYRCGGLLLGVICHPHIADGHAASTFYG  174

Query  541   AWGKACRDV--MIQPLPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDAT  711
             AW  A R+      P P  DR    +P + P+  +DH   E+     K  +    S    
Sbjct  175   AWATAVREGKGFTVPSPFIDRAATAVPGSTPKPVFDHRSIEF-----KGGEGSATSQPHA  229

Query  712   FL--DDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFE  885
              L  D I   KVHF  EF+A+L+++      GAR  STF+ L+AH+W+ +T AR L   E
Sbjct  230   VLPMDKIRNVKVHFPAEFIAELRSRV-----GAR-CSTFQCLLAHVWKKVTAARGLSPEE  283

Query  886   TTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNN  1065
              T +R++V+ R R NP VP D+FGN+VLWAFP  +V+D+L          I DA ++V+ 
Sbjct  284   FTQVRVAVNCRGRANPPVPMDFFGNMVLWAFPRLQVRDVLGLSYGGVVGAIRDAAARVDE  343

Query  1066  NYIRSFIDFANSKVVAEEDG--LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYI  1239
              YI+S++DF     VA+ +G  L  T+     +LCP++EVDSWL F F+ LDFGTG P  
Sbjct  344   EYIQSYVDFGG---VADANGEELAATSTFGT-MLCPDIEVDSWLGFRFHQLDFGTGPPSA  399

Query  1240  FMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             F+P   P EG+M  +PS    GS+D F+ L +D++  FK+ICYSLD
Sbjct  400   FLPPGLPVEGLMVFVPSRTVKGSVDLFMALAEDHVAAFKKICYSLD  445



>ref|NP_001068358.1| Os11g0643100 [Oryza sativa Japonica Group]
 gb|ABA95035.1| Transferase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28721.1| Os11g0643100 [Oryza sativa Japonica Group]
 dbj|BAG87858.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 170/452 (38%), Positives = 243/452 (54%), Gaps = 26/452 (6%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNP-PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLR  240
             +++ S+  +KP+    P PL    VPL+ FD+ ++D  + +++AYR P P +  ++ GLR
Sbjct  1     MEITSSAMLKPAPTPTPHPLAGEKVPLTAFDRAAFDVFVPMVFAYRAPAPSSEAVKEGLR  60

Query  241   KALGVYREWAGRLGNDEEGN--------PVVLLNDEGVKFVEASGDTTLDKVMPFKPSVS  396
              A+  Y   AGRL  D   +         V+ +NDEG   ++A+ +  LD V+    +  
Sbjct  61    MAVAAYPLAAGRLAVDVAADGQGRRRRRRVLHVNDEGALVLDATVEADLDAVLAANVATD  120

Query  397   LLNLHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRD--VM  570
             L    P       ++QVQ+TRF C  LVVG   HH V DGHSTS F   W +A RD    
Sbjct  121   LYPAPPEHSFGAAVLQVQLTRFRCSGLVVGLIVHHHVFDGHSTSAFCTTWARAVRDGEAF  180

Query  571   IQPLPLRDRTIF-IPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHF  747
               P P  DR I  +PR+PP   +DH   E+   ++       +   A  ++ I    V F
Sbjct  181   SVPSPCLDRAITSVPRSPPAPVFDHRSIEF---KVGNKSSDSSGAAAAAVEKITNIGVRF  237

Query  748   TLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARL  927
             T +F+A+LKA+      G R  STFE ++AH W+ +T AR L   E T +R++V+ R R 
Sbjct  238   TAKFVAELKARV-----GGR-CSTFECVLAHAWKKMTAARGLKPEEFTRVRVAVNCRRRA  291

Query  928   NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKV  1107
             NP  P D FGN+VLWAFP  +V+ LL          I  AV++V+  YI+SF+D+     
Sbjct  292   NPPAPADLFGNMVLWAFPRLQVRRLLSASYRDVVGAIRAAVARVDGEYIQSFVDYVE---  348

Query  1108  VAEEDG--LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFL  1281
             VA+  G  L  TA      LCP+LEVDSWL F F+++D GTG P   +    P EG+M L
Sbjct  349   VADARGEELAATAAEPGETLCPDLEVDSWLGFRFHEMDLGTGPPAAVLSPDLPIEGLMIL  408

Query  1282  LPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             +P     G +D F+ L  D    F+QICYSL+
Sbjct  409   VPVGGDGGGVDLFVALADDRAQVFEQICYSLE  440



>dbj|BAJ86667.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=442

 Score =   279 bits (714),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 160/441 (36%), Positives = 243/441 (55%), Gaps = 21/441 (5%)
 Frame = +1

Query  82    RTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYR  261
             + +KP+Y    PL    VPL++FD+ + D  +++I  Y  PTP N  +  GLR+AL  Y 
Sbjct  7     KMLKPAYSAPHPLAGEMVPLTLFDRAAMDIFVSLILVYPAPTPSNEALVEGLRRALAPYP  66

Query  262   EWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLL-NLHPSLKGVVE-  435
               AGRL  D  G   + L+++GV  ++A     +  V+     ++    L+P+L    E 
Sbjct  67    HLAGRLAVDHSGRRSIHLSNDGVLVLDAEVPVDMASVVADGCFITATEGLYPALPLPEEN  126

Query  436   ----LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQPLPLRDR  597
                 L+Q++++R+ CG LV+G   HH  ADGHS SNFL  W  A R       P P  DR
Sbjct  127   VGAALLQIKLSRYKCGGLVIGIIHHHHAADGHSFSNFLTTWASAVRQASEFAAPSPFLDR  186

Query  598   T-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLK  774
                 +PR+ P   +DH   E+  ++  +   +  S+    + ++ +    FT +F+ +LK
Sbjct  187   AATAVPRSVPTPAFDHRCTEFSGEEDDRRSSY--SHPRCKIKNLTLR---FTAQFVRELK  241

Query  775   AKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYF  954
             A+  A      P STF+ L+AH+W+ IT AR L   E T +R++VD RAR +P VP D+F
Sbjct  242   ARVGA------PCSTFQCLLAHVWKKITAARRLKPDEFTQVRVAVDCRARASPAVPPDFF  295

Query  955   GNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVP  1134
             GN+VLWAFP  +V+D+L          I DA+ +V+  YI+SF+DF +    + E+ L  
Sbjct  296   GNMVLWAFPRLQVRDVLGWTYGGVVGAIRDAIGRVDAAYIQSFVDFGSVADASWEE-LAA  354

Query  1135  TADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSID  1314
             TA     +LCP+LEVDS L F F+ +D G G P  F+    P EG+M  +PS    G +D
Sbjct  355   TAPTAGTMLCPDLEVDSSLGFRFHQIDLGNGPPSAFLMPDLPVEGLMTFVPSCSAKGGLD  414

Query  1315  AFIPLFQDNLPTFKQICYSLD  1377
               + + +D++   + ICYSLD
Sbjct  415   VHMAVAEDHVAELEHICYSLD  435



>gb|EMS45123.1| Agmatine coumaroyltransferase-1 [Triticum urartu]
Length=439

 Score =   279 bits (713),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 173/451 (38%), Positives = 242/451 (54%), Gaps = 23/451 (5%)
 Frame = +1

Query  58    MKVKVESTRT--IKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
             M V VE T++  ++PS E +       VPL+VFD+ S D  I  ++A+  P P N  ++ 
Sbjct  1     MAVTVEITQSTVLEPSRE-SARGGGKKVPLTVFDRASTDGYIPAVFAWNAPAPTNEALKA  59

Query  232   GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
             GL  A+  +   AGR   D+       LND GV  +EA+ D  L   +    S  +  L+
Sbjct  60    GLVAAVARFPHLAGRFAADDHDRKCFHLNDAGVLVLEATADADLADALAHDVSAHINELY  119

Query  412   PSL---KGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR-DVMIQP  579
             P     +    + Q Q+TR+ CG LV+G   HH VADG S S F  AW  A R D  +  
Sbjct  120   PKAEKERANEPIFQAQLTRYACGGLVIGTACHHQVADGQSMSVFYTAWASAVRTDSAVLT  179

Query  580   LPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
              P  DR+   +PR+PP   YDH   E+  +  + + + +       +D I    VHF  E
Sbjct  180   SPFVDRSATVVPRSPPTPAYDHRNIEFKGELSRSHSYGVLP-----MDRIKNLAVHFPDE  234

Query  757   FLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPK  936
             F+A LKA+      G R  STF+ L+AH W+ IT AR+L   + T +R++V+ R R  P 
Sbjct  235   FVADLKARV-----GTR-CSTFQCLLAHAWKKITAARDLAPDDFTQVRVAVNCRGRAKPP  288

Query  937   VPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSF-IDFANSKVVA  1113
             VP D+FGN+VLWAFP  +V+DLL          I DAV+  ++   +SF IDF  ++   
Sbjct  289   VPMDFFGNMVLWAFPRMQVRDLLSSSYPAVGAAIRDAVALGDDEDTQSFIIDFGEAERGV  348

Query  1114  EEDG---LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLL  1284
              EDG   L  TA     + CP+LEVDSWL F F+DLDFG G P  F+P   P EG+M  +
Sbjct  349   IEDGGEELASTAATPGTMFCPDLEVDSWLGFRFHDLDFGCGPPCAFLPPDLPIEGIMIFV  408

Query  1285  PSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             PS    G +D F+ L   ++  FKQIC+S+D
Sbjct  409   PSCDPKGGVDLFMALDDQHVQAFKQICHSMD  439



>gb|EMS56126.1| Agmatine coumaroyltransferase-2 [Triticum urartu]
Length=430

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 169/449 (38%), Positives = 251/449 (56%), Gaps = 45/449 (10%)
 Frame = +1

Query  88    IKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREW  267
             +KP Y    PL    V L+VFD+ + D  + + +AY  P P N  ++ GL +A+  Y   
Sbjct  2     LKPVYRVPHPLAGNKVQLTVFDRAAIDTYVPIAFAYPAPAPSNEALKEGLLRAIAPYPHL  61

Query  268   AGRLGNDEEGNPVVLLNDEGVKFVE-----------ASGDTTLDKVMPFKPSVSLLNLHP  414
              GR   D  G   + LN+EGV  +E           A+G      V  F P+V      P
Sbjct  62    LGRFAVDGHGRRFLHLNNEGVLVIEVDVPADLADVLATGGGMTPVVAGFYPTV------P  115

Query  415   SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQPLPL  588
                    L+QV+++R+ CG L++G  +HH +ADG + S+F  AW  A R+      P P 
Sbjct  116   EESVGAALLQVKLSRYRCGGLLLGVISHHHIADGTAASSFYCAWAAAVREGKDFDVPSPF  175

Query  589   RD--RTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
              D      +PR+ P++ +DH   E+  K+     H +       ++ I    VHF  EF+
Sbjct  176   IDPRAATAVPRSTPKLVFDHRSIEF--KRSSSQAHAVLP-----MEKIKNITVHFPAEFI  228

Query  763   AKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVP  942
             A+LK++      GAR  STF+ L+AH+W+ +T AR L   E T +R++++ R R +P VP
Sbjct  229   AELKSRV-----GAR-CSTFQCLLAHVWKKVTAARGLSPDEFTRVRVAINCRGRASPPVP  282

Query  943   NDYFGNLVLWAFPTAKVKDLLREPLSYAAKL--IHDAVSKVNNNYIRSFIDFANSKVVAE  1116
              D+FGN+VLWAFP  +V+DLL   LSY A +  IH+AV++++  YI+S++DF     VA+
Sbjct  283   MDFFGNMVLWAFPRLQVRDLLG--LSYGAVVGGIHEAVARIDGEYIQSYVDFGG---VAD  337

Query  1117  EDG--LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +G  L  TA +   +LCP++EVDSWL F  + LDFGTG P  F+P + P EGMM  +PS
Sbjct  338   ANGEELAATATVGT-MLCPDIEVDSWLGFTAHQLDFGTGPPSAFLP-WLPVEGMMVFVPS  395

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
                 GS+D F+ L +D++  F +I YSLD
Sbjct  396   RTAKGSVDLFMALAEDHVAAFNEIRYSLD  424



>ref|NP_001054170.1| Os04g0664500 [Oryza sativa Japonica Group]
 dbj|BAF16084.1| Os04g0664500, partial [Oryza sativa Japonica Group]
Length=420

 Score =   277 bits (708),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 181/251 (72%), Gaps = 5/251 (2%)
 Frame = +1

Query  625   RIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGA  804
             ++E++H G E+ P    ++ H   S  A   D++V++KVH + EF++KLK++ASA  G  
Sbjct  167   QVEFEHRGVEFKPYDDDEDVH--ASAAAGDDDEVVINKVHLSREFISKLKSQASA--GAH  222

Query  805   RPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPT  984
             RPYST + +VAHLWR +TKAR L G E+T + I+VDGRAR++P VP+ Y GN+VLWA PT
Sbjct  223   RPYSTLQCVVAHLWRCMTKARGLDGRESTSVCIAVDGRARMSPPVPDGYTGNVVLWARPT  282

Query  985   AKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILC  1164
             A   +L+  PL +A +LI+  V ++N+ Y +SFIDFANS  V EE+ LV +AD  + +L 
Sbjct  283   ATAGELVTRPLKHAVELINREVIRINDGYFKSFIDFANSGAV-EEERLVASADAAEMVLS  341

Query  1165  PNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNL  1344
             PN+EVDSWLR PFYDLDFG G P+ FMP++ P EG++ LLPSF GDGS+DA++PLF  ++
Sbjct  342   PNIEVDSWLRIPFYDLDFGGGRPFFFMPSYLPVEGLLILLPSFFGDGSVDAYVPLFSRDM  401

Query  1345  PTFKQICYSLD  1377
               FK  CYS D
Sbjct  402   DVFKNCCYSFD  412



>gb|EMT17289.1| Anthranilate N-benzoyltransferase protein 2 [Aegilops tauschii]
Length=478

 Score =   278 bits (711),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 170/478 (36%), Positives = 249/478 (52%), Gaps = 54/478 (11%)
 Frame = +1

Query  70    VESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKAL  249
             + S+R +KP Y    PL    V L+VFD+ + D  + V+ AY  PTP N  I+ GL +A+
Sbjct  4     ITSSRMLKPVYSTPHPLLGEKVQLTVFDRAALDIFVPVVVAYPAPTPSNEAIKEGLLRAV  63

Query  250   GVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTL----------------------  363
               Y   AGRL  D  G   + +N+EGV  VEA+  + L                      
Sbjct  64    APYPHLAGRLAADHRGRRFLHVNNEGVLVVEATVSSNLADLLAYGGMAADVHGQYHTLPE  123

Query  364   ----DKVMPFKP----------SVSLLNLHPSLKGVVE-LVQVQVTRFTCGSLVVGFTAH  498
                 DKV+  K           + +  ++   L  V E L+Q+++ R  CG LVVG + H
Sbjct  124   GKIQDKVLMLKRKDNLKKKTAYACATFSIMKVLGNVGEALLQIKLNRCKCGGLVVGVSYH  183

Query  499   HLVADGHSTSNFLVAWGKACRDV--MIQPLPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQ  669
             H  ADG + +NF + W  A R     + P P  DR T  + R  P   +DH   E+  K 
Sbjct  184   HQTADGVAMNNFFITWETAVRQGKDFVAPTPFLDRATTAVSRRMPAPVFDHQSIEF--KS  241

Query  670   IKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWR  849
              +         D   +  I   +VH T EFL +L+A+      G R  S F+ L+AH+W+
Sbjct  242   GESRGCTRECGDVVSMVKIKDVRVHLTTEFLTELRARV-----GGR-CSMFQCLLAHVWK  295

Query  850   AITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAA  1029
              IT AR L   E T ++++V+ R R  P VP D+FGN+VLWAFP  +V+D+L        
Sbjct  296   KITAARALKPEEFTQVKVAVNCRGRAKPPVPMDFFGNMVLWAFPRLQVRDVLNWSYRAVV  355

Query  1030  KLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG--LVPTADMDKHILCPNLEVDSWLRFPF  1203
               I DAV+++++ YI+SF+DF +   +A+ +G  L+ TA      LCP+ EVD+WL F +
Sbjct  356   GAIRDAVARIDDEYIQSFVDFGS---LADANGKELMATAAAGT-TLCPDAEVDTWLGFRY  411

Query  1204  YDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             + LDFGTG P  F P   P EG+M  +PS    G +D F+ + +D++  F++ICYSLD
Sbjct  412   HQLDFGTGPPCAFQPPDLPIEGLMVFVPSCTAGGGVDLFMAVAEDHVEAFEKICYSLD  469



>gb|EMT29560.1| Anthranilate N-benzoyltransferase protein 2 [Aegilops tauschii]
Length=443

 Score =   274 bits (701),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 161/447 (36%), Positives = 239/447 (53%), Gaps = 20/447 (4%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRK  243
             ++   ++ +KP Y    PL    VPL++FD+ + D  +++I  Y  PTP N  +  GLR+
Sbjct  1     METTGSKMLKPVYSAPHPLAGEMVPLTLFDRAAMDIFVSLILVYPAPTPSNGALVEGLRR  60

Query  244   ALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKP-SVSLLNLHPSL  420
             A+  Y   AGRL  D  G   + LN+ GV  ++A     +  V+     + +   L+P+L
Sbjct  61    AVAPYPHLAGRLAVDHSGRRSIHLNNHGVLVLDAEVPVDMTSVVADGCFTAATEGLYPAL  120

Query  421   KGVVE-----LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQP  579
                 E     L+Q+++ R+ CG LV+G   HH  ADG S SNFL  W  A R       P
Sbjct  121   PPPEENVGAALLQIKLNRYKCGGLVIGIIHHHHAADGRSFSNFLTTWASAVRQASEFTAP  180

Query  580   LPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
              P  DR    +PR+ P   +DH   E+  ++    D   +S+ +     I    + FT +
Sbjct  181   SPSLDRAATAVPRSVPTPAFDHRCTEFSGEE----DGCRSSSYSHPTCKIKNLTLRFTAQ  236

Query  757   FLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPK  936
             F+ +LKA+         P STF+ L+AH+W+ IT AR L   E T +R++VD R R N  
Sbjct  237   FVTELKARVGT------PCSTFQCLLAHVWKKITAARGLKPDEFTQVRVAVDCRGRANRA  290

Query  937   VPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAE  1116
             VP D+FGN+VLWAFP  +V+D+L          I DA+ +V+  YI+SF+DF  S   A 
Sbjct  291   VPPDFFGNMVLWAFPRLQVRDVLGWTYGSVVGAIRDAIGRVDAAYIQSFVDF-GSVADAN  349

Query  1117  EDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFI  1296
                L  TA     +LCP+LEVDS L F F+ +D G+G P  F+    P EG+M  +PS  
Sbjct  350   WAELAATAPTSGAMLCPDLEVDSSLGFRFHQIDLGSGPPSAFLMPDLPVEGLMTFVPSCS  409

Query  1297  GDGSIDAFIPLFQDNLPTFKQICYSLD  1377
              +GS+D  + + +D++   + ICYSLD
Sbjct  410   AEGSVDVHMAVAEDHVAALEHICYSLD  436



>ref|NP_001064484.1| Os10g0379100 [Oryza sativa Japonica Group]
 gb|ABB47405.1| Transferase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26398.1| Os10g0379100 [Oryza sativa Japonica Group]
Length=436

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 172/450 (38%), Positives = 239/450 (53%), Gaps = 29/450 (6%)
 Frame = +1

Query  64    VKVESTRTI----KPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTP---PNST  222
             V VE TR+      P+  G   +    VPL+VFD+ + D  I  ++A+         N  
Sbjct  4     VTVEITRSEVLRPSPASAGGGEM----VPLTVFDRAATDGYIPTMFAWDAAAAAALSNDA  59

Query  223   IELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLL  402
             I+ GL   L  +   AGR   DE G     LN+ G + +EAS    L   +    +  + 
Sbjct  60    IKDGLAAVLSRFPHLAGRFAVDERGRKCFRLNNAGARVLEASAAGDLADALAHDVAAHVN  119

Query  403   NLHPSL-KGVVE--LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMI  573
              L+P   K  V+  L+QVQ+TR+TCG LV+G  +HH VADG S S F   W  A R    
Sbjct  120   QLYPQADKDRVDEPLLQVQLTRYTCGGLVIGAVSHHQVADGQSMSVFFTEWAAAVRTAGA  179

Query  574   Q-PLPLRDRTIFIPRNPPRIE-YDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHF  747
               P P  DR+       P    +DH   E+  +  + +     S  A  L+ +    VHF
Sbjct  180   ALPTPFLDRSAVAAPRIPPAPAFDHRNVEFRGEGSRSH-----SYGALPLERMRNLAVHF  234

Query  748   TLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARL  927
               EF+A LKA+     GGAR  STF+ L+AH W+ IT AR+L   E T +R++V+ R R 
Sbjct  235   PPEFVAGLKARV----GGAR-CSTFQCLLAHAWKKITAARDLSPKEYTQVRVAVNCRGRA  289

Query  928   NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKV  1107
              P VP DYFGN+VLWAFP  +V+DLL    +    +I DAV++V+  YI+SF+DF     
Sbjct  290   GPAVPTDYFGNMVLWAFPRMQVRDLLSASYAAVVGVIRDAVARVDERYIQSFVDFGE---  346

Query  1108  VAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLP  1287
             VA  D L PTA       CP+LEVDSW+ F F+DLDFG G P  F+P   P +G++  +P
Sbjct  347   VAAGDELAPTAAEPGTAFCPDLEVDSWIGFRFHDLDFGGGPPCAFLPPDVPIDGLLIFVP  406

Query  1288  SFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             S    G ++ F+ L   ++   +QICYS+D
Sbjct  407   SCAAKGGVEMFMALDDQHVEALRQICYSMD  436



>dbj|BAJ96372.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00847.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 160/435 (37%), Positives = 239/435 (55%), Gaps = 21/435 (5%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRK  243
             ++  S+  +KP Y    P+    VPL++FD+ + D  + +I  Y  PTPPN  ++ GLR+
Sbjct  1     MEAASSTMLKPVYSTPHPVAGEMVPLTLFDRATLDIFVPIILVYAAPTPPNEALKKGLRR  60

Query  244   ALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN-LHPSL  420
             A+ VY   AGR   D  G   + +N+EGV  VEA+    L  V+     V+  + L+P++
Sbjct  61    AVAVYPHLAGRFAVDHRGRRCIHVNNEGVLVVEAAVPVDLASVVTDGSFVTDTDELYPAV  120

Query  421   KGVVELV-----QVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQP  579
                 E+V     Q+++ R+ CG LV+GF++HH  ADG+S S FL  W  A R       P
Sbjct  121   PPPEEIVGAALLQIKLNRYKCGGLVIGFSSHHQAADGYSVSTFLSTWASAVRQGRNFTAP  180

Query  580   LPLRDRT-IFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
              P  DR    + R  P   +DH  AE+  K      + +  +  + + ++ V    FT E
Sbjct  181   SPFLDRAATAVARTVPTPVFDHRSAEF--KGQGGRSYRVAPDPMSEIKNVTVR---FTAE  235

Query  757   FLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPK  936
             F+A+LKA+      G R  STF  L+AH W+ +T AR L   E T +R++V+ RAR +P 
Sbjct  236   FIAELKARV-----GIR-CSTFNCLLAHAWKKMTAARGLKPDEFTQVRVAVNCRARASPP  289

Query  937   VPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAE  1116
             VP D+FGN+VLWAFP  +  D+L        + I DAV++V+  YI+SF+DF +    A 
Sbjct  290   VPADFFGNMVLWAFPRLQAGDVLGWSYRGVVEAIRDAVARVDAEYIQSFVDFGSVADAAG  349

Query  1117  EDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFI  1296
             E+ L  TA ++  + CP+LEVDS L F F  +DFG G P  F+    P EG+M  LPS  
Sbjct  350   EE-LPATAAVNGTMFCPDLEVDSSLGFRFNQIDFGAGPPSAFVTPDLPNEGLMIFLPSCT  408

Query  1297  GDGSIDAFIPLFQDN  1341
               G +D  + + +D+
Sbjct  409   ASGGVDLVMAIPEDH  423



>gb|EMS67449.1| Agmatine coumaroyltransferase-1 [Triticum urartu]
Length=450

 Score =   268 bits (686),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 169/478 (35%), Positives = 248/478 (52%), Gaps = 68/478 (14%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRK  243
             +++ S+  +KP      PL    VPL++FD+ + D  +  + AY  P P N  ++ GL K
Sbjct  1     MEITSSTILKPVPH---PLVGEKVPLTIFDRAASDLFVPTVLAYLAPAPSNEALKEGLLK  57

Query  244   ALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEAS-----GD--------TTLDKVMPFK  384
             A+  Y   AGRL  D+ G   + +N+EGV  +E +      D        T +D + P  
Sbjct  58    AVAPYPHLAGRLAVDQLGRRFLHVNNEGVLLIETTVPANLADVLVQGRIATGVDHLYPTV  117

Query  385   PS-------------VSLLNLHPSLKGV--------VELVQVQVTRFTCGSLVVGFTAHH  501
             P              +S LN H  L  +          L+Q+Q+ R+ C         HH
Sbjct  118   PEPEVRIHQSMEILLLSRLNSHACLCLITYIQENIGAALLQIQLNRYNC---------HH  168

Query  502   LVADGHSTSNFLVAWGKACRD----VMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQ  669
               ADGHS S F  AW  A R+     M  P   R++T+ +PR+ P   +DH   E+M   
Sbjct  169   HTADGHSMSMFFTAWATAVREGKDFTMPTPFLDREKTV-VPRSTPTPVFDHRSLEFMCGD  227

Query  670   IKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWR  849
               +N  ++       +  I   KVHFT EF+  LK +      GAR  STF+ L+AH+W+
Sbjct  228   --RNAAYI----VVPMHRIKNLKVHFTAEFVVDLKGRV-----GAR-CSTFQCLLAHVWK  275

Query  850   AITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAA  1029
              +T+AR+L   E T +R++V+ R R NP V  ++FGN+VLWAFP     DL+        
Sbjct  276   KMTEARDLKPEEFTKVRMAVNCRGRANPPVSMNFFGNMVLWAFPRLLAGDLMSSSYGSVV  335

Query  1030  KLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG--LVPTADMDKHILCPNLEVDSWLRFPF  1203
               I DAV++++  Y++SF+DF     VA+ +G  L  TA     +LCP+ EVDSWL F F
Sbjct  336   GAIRDAVARIDGEYVQSFVDFGE---VADTNGEELFATAAAPGSMLCPDAEVDSWLGFSF  392

Query  1204  YDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             + LDFGTG P  F+P   P EG+M  +PS   +G +D F  + +D++  F+QICYSLD
Sbjct  393   HQLDFGTGAPAAFLPPDLPFEGLMLFVPSREANGGVDLFTSIAEDHVAAFEQICYSLD  450



>ref|XP_004983082.1| PREDICTED: agmatine coumaroyltransferase-1-like [Setaria italica]
Length=436

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 171/451 (38%), Positives = 242/451 (54%), Gaps = 26/451 (6%)
 Frame = +1

Query  58    MKVKVESTR--TIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRP-PTPPNSTIE  228
             M V VE TR   + P  + +  +    VPL+VFD+ + D  +  ++A+     P N+ + 
Sbjct  1     MAVPVEITRRAIMSPKPDCDDAVGRM-VPLTVFDRAATDGYVPAVFAWTAQAAPANTAVV  59

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVS--LL  402
              GL   +  +   AGRLG D+ G     LN+ GV  +EA     L   +  +P +S  + 
Sbjct  60    DGLLATVARFPHLAGRLGVDDRGRRCFHLNNAGVLVLEADAAADLADAL-ARPDISEHID  118

Query  403   NLHPS---LKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR-DVM  570
              L P     +    L+ VQ+TR+ CG LV+G    HLVADG + S F  AW  A    + 
Sbjct  119   QLFPKADMYRADEPLLHVQLTRYRCGGLVIGTACQHLVADGQAMSFFYAAWATAVSTGLA  178

Query  571   IQPLPLRDRTI-FIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATF-LDDIVVHKVH  744
             I P P  DRT   +PR+PP   +DH   E+      K +H  + +     +D I    VH
Sbjct  179   ILPSPFIDRTTAVVPRSPPSPAFDHRNIEF------KGEHSPSRSYPVIPMDRIKNLTVH  232

Query  745   FTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRAR  924
             F+ EF+A+LKA       GAR  S F+ L+AH W+  T AR L   E T IR++V+ R+R
Sbjct  233   FSEEFVARLKAHV-----GAR-CSMFQCLLAHAWKKATAARRLAPEELTQIRVAVNCRSR  286

Query  925   LNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSK  1104
               P VP D+FGN+VLWAFP  +  +LL    +    +I DAV++V+  Y++SF+DF  + 
Sbjct  287   AKPPVPTDFFGNMVLWAFPRMRAGELLSSSYAAVVGVIRDAVARVDAEYVQSFVDFGEAL  346

Query  1105  VVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLL  1284
               + E  L  TA +     CP+LEVDSWL F F+DLDFG G P  F+P   P EG++F +
Sbjct  347   ERSGER-LTATAAVAGTAYCPDLEVDSWLGFGFHDLDFGGGPPCAFLPPVLPLEGLIFFV  405

Query  1285  PSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
              S    G +D F  L  ++   FKQICYSLD
Sbjct  406   RSCTAKGGVDLFAALHNEHADAFKQICYSLD  436



>gb|EMS47778.1| Agmatine coumaroyltransferase-2 [Triticum urartu]
Length=336

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 164/215 (76%), Gaps = 6/215 (3%)
 Frame = +1

Query  733   HKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVD  912
              + HF+ +F+A L+AKAS   G  RP+S FE+++AHLWR +T+AR+L   ETT IR+SVD
Sbjct  128   EEAHFSKDFIAGLRAKAS--EGRGRPFSRFETILAHLWRTMTRARDLSPEETTKIRLSVD  185

Query  913   GRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDF  1092
             GR RL    P +YFGN+VLWAFP + V DLL  PL +AA++IHD V+KV+  Y +SF+DF
Sbjct  186   GRHRLGQ--PAEYFGNMVLWAFPRSTVGDLLNRPLKHAAQVIHDEVAKVDGAYFQSFVDF  243

Query  1093  ANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGM  1272
             A+S   AE++GL  +A + K   CP++EVDSWL FPFY+LDFGTG P  FMP +FPTEGM
Sbjct  244   ASSGA-AEKEGLARSA-VCKDAQCPDVEVDSWLTFPFYELDFGTGSPSYFMPAYFPTEGM  301

Query  1273  MFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             +FL+PS  GDGS+DAF+PLFQ+NL  FK+ CYS++
Sbjct  302   LFLVPSNFGDGSVDAFVPLFQENLQAFKECCYSME  336


 Score =   110 bits (274),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 78/125 (62%), Gaps = 2/125 (2%)
 Frame = +1

Query  58   MKVKVESTRTIKPSYEGN--PPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL  231
            M+V V  ++ +KP+Y     P  +T ++PLS+FDKV+++ Q+A+IYA+  P P  + IE 
Sbjct  1    MEVTVLGSKLVKPAYNAGAAPAPSTEYIPLSIFDKVTFNMQMAIIYAFAAPAPSTAAIEN  60

Query  232  GLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLH  411
            GL   L  YR +AG+LG   +G P  +LND G + VEA+ D  L  + P KP+  LL LH
Sbjct  61   GLATVLAQYRAFAGQLGEAPDGTPSFILNDRGARLVEATVDADLIDMAPAKPTPELLKLH  120

Query  412  PSLKG  426
            P L+ 
Sbjct  121  PDLEA  125



>gb|EMS65979.1| Agmatine coumaroyltransferase-1 [Triticum urartu]
Length=440

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 163/448 (36%), Positives = 244/448 (54%), Gaps = 25/448 (6%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRK  243
             ++  S+  +KP+Y    PL    VPL++FD+ + D  + +I  Y  PTP N  ++ GLR+
Sbjct  1     MEAASSTMLKPAYSTPHPLAGEMVPLTLFDRATLDIFVPLILVYPAPTPSNEALKEGLRR  60

Query  244   ALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN-LHPSL  420
             A+ VY   AGRL  D      + +N+EGV  VEA+    L   +     ++  + L+P++
Sbjct  61    AVAVYPHLAGRLAVDHRSRRFIHVNNEGVLVVEAAVPVDLASAVTDGSFITNTDGLYPAV  120

Query  421   KGVVE-----LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQP  579
                 E     L+Q+Q+ R+ CG L +GF++HH   DG+S S+FL  W  A R       P
Sbjct  121   PPPEESIGAALLQIQLNRYKCGGLAIGFSSHHQATDGYSVSSFLSTWASAVRQGPNFTAP  180

Query  580   LPLRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLE  756
              P  DR    +PR  P   +DH   E+   Q  ++   +    ++ + ++ V    FT E
Sbjct  181   SPFLDRGATAVPRAVPTPVFDHRSTEFK-GQGGRSYPVVCDPMSSKIKNVTVR---FTAE  236

Query  757   FLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPK  936
             F+A+LKA+      G R  STF+ L+AH W+  T AR L   E T +R++V+ RAR NP 
Sbjct  237   FIAELKARV-----GIR-CSTFQCLLAHAWKKTTAARGLKPEEFTQVRVAVNCRARANPP  290

Query  937   VPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAE  1116
              P ++FGN+VLWAFP  + +D+L        + I +AV++V+  YI+SF+DF  S   A 
Sbjct  291   APPEFFGNMVLWAFPRLQARDVLGWTYRGVVEAIRNAVARVDAEYIQSFLDF-GSVADAN  349

Query  1117  EDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFI  1296
              + LV TA  +  + CP+LEVDS L F F  +DFGTG P  F+    P EG+M  LPS  
Sbjct  350   AEELVATAAANGTMFCPDLEVDSSLGFRFNQIDFGTGPPSAFVTPDLPNEGLMIFLPSCT  409

Query  1297  GDGSIDAFIPLFQD-NLPTFKQICYSLD  1377
               G +D  + + +D +  TF    YSLD
Sbjct  410   ASGGVDLIMAIPEDHDTATF----YSLD  433



>gb|EMT08552.1| hypothetical protein F775_42891 [Aegilops tauschii]
Length=429

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 163/443 (37%), Positives = 241/443 (54%), Gaps = 26/443 (6%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRK  243
             ++V S+  +KP+Y    PL    VPL++FD+ + D  + +I  Y  PTP N  +  GLR+
Sbjct  1     MEVSSSTMLKPAYSTPHPLAGEMVPLTLFDRATLDIFVPLILVYPAPTPSNDALTEGLRR  60

Query  244   ALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN-LHPSL  420
             A+ VY   AGRL  D  G   + +N+EGV  VEA+    L   +     V+  + L+P++
Sbjct  61    AVAVYPHLAGRLAVDHRGRRFIHVNNEGVLVVEAAVPVDLASAVTDGSFVTDTDGLYPAV  120

Query  421   KGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV--MIQPLPLRD  594
                      ++ R+ CG L +GF++HH  ADG+S S FL  W  A R       P P  D
Sbjct  121   P------PPELNRYKCGGLAIGFSSHHQAADGYSVSTFLSTWASAVRQGWNFTAPSPFLD  174

Query  595   RTI-FIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKL  771
             R    +PR  P   +DH   E+   Q  ++   ++   ++ + ++ V    FT EF+A+L
Sbjct  175   RGAPAVPRAVPTPVFDHRSTEFK-GQGSRSYPVVSDPMSSNIKNVTVR---FTAEFIAEL  230

Query  772   KAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDY  951
             KA+      G R  STF+ L+AH W+ IT AR L   E T +R++V+ RAR NP  P D+
Sbjct  231   KARV-----GIR-CSTFQCLLAHAWKKITAARGLKPEEFTQVRVAVNCRARANPPAPPDF  284

Query  952   FGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLV  1131
             FGN+VLWAFP  + +D+L        + I DA+++V+ +YI+SF+DF  S   A  + L 
Sbjct  285   FGNMVLWAFPRLQARDVLGWTYRGVVEAIRDAIARVDADYIQSFVDF-GSLADANGEELA  343

Query  1132  PTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
              TA  +  + CP+LEVDS L F F  +D GTG P  F+    P EG+M  LPS    G +
Sbjct  344   ATAAANGTMFCPDLEVDSSLGFRFNQIDLGTGPPSAFVTPDLPNEGLMIFLPSCTASGGV  403

Query  1312  DAFIPLFQD-NLPTFKQICYSLD  1377
             D  + + +D +  TF    YSLD
Sbjct  404   DLIMAIPEDHDTATF----YSLD  422



>gb|EEC80004.1| hypothetical protein OsI_21657 [Oryza sativa Indica Group]
Length=430

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 157/425 (37%), Positives = 220/425 (52%), Gaps = 18/425 (4%)
 Frame = +1

Query  115   PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREWAGRLGNDEE  294
             PL    VPL+ FD+ ++D  + +++AYR P P +  ++ GLR A+  Y   AGRL  D  
Sbjct  11    PLAGEKVPLTAFDRAAFDVFVPLVFAYRAPAPSSEAVKEGLRVAVAAYPLAAGRLAVD--  68

Query  295   GNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLKGVVELVQVQVTRFTCGS  474
                 V ++ +G     +S      +                 +       VQ+TRF CG 
Sbjct  69    ----VAVDGQGAP-APSSCPARQRRGRAGPRCHRRGRPGRRARRQRRHRPVQLTRFRCGG  123

Query  475   LVVGFTAHHLVADGHSTSNFLVAWGKACRD--VMIQPLPLRDRTIF-IPRNPPRIEYDHV  645
             LVVG   HH V DGHS S F   W +A RD    I P P  DR I  +PR+PP   +DH 
Sbjct  124   LVVGLIGHHHVFDGHSMSTFCATWARAVRDGEAFIVPSPSLDRAITGVPRSPPAPVFDHR  183

Query  646   GAEYMPKQIKKNDHFLNSNDATF-LDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTF  822
               E+       +     +      ++ I    VHFT +F+A+LKA+      G R  STF
Sbjct  184   SIEFKVGNKSSDSSGAAAAAVDMPMEKITNIGVHFTAKFVAELKARV-----GGR-CSTF  237

Query  823   ESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDL  1002
             E ++AH W+ IT AR L   E T +R++V+ R R NP  P D FGN+VLWAFP  +V+ L
Sbjct  238   ECVLAHAWKKITAARGLKPEEFTRVRVAVNCRRRANPPAPADLFGNMVLWAFPRLQVRRL  297

Query  1003  LREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVD  1182
             L          I  AV++V+  YI+SF+D+  +     E+ L  TA      LCP+LEVD
Sbjct  298   LSSSYRDVVGAIRAAVARVDAEYIQSFVDYVEAADARGEE-LAATAPEPGETLCPDLEVD  356

Query  1183  SWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQI  1362
             SWL F F+++D GTG P   +    P EG+M L+P+  G G +D  + L  D+   F+QI
Sbjct  357   SWLGFRFHEMDLGTGPPAAVLSPNLPVEGLMILVPASGGGGGVDLLVALADDHAQAFEQI  416

Query  1363  CYSLD  1377
             CYSL+
Sbjct  417   CYSLE  421



>ref|XP_006853060.1| hypothetical protein AMTR_s00038p00068550 [Amborella trichopoda]
 gb|ERN14527.1| hypothetical protein AMTR_s00038p00068550 [Amborella trichopoda]
Length=292

 Score =   255 bits (652),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 130/294 (44%), Positives = 185/294 (63%), Gaps = 12/294 (4%)
 Frame = +1

Query  349   GDTTLDKVMPFKPSVSLLNLHPSLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTS  528
                TLD+  P K +  L +LHPS +G  EL+QVQ+TRF CGSLVVGFT++HL+ADG +T 
Sbjct  2     ASCTLDEASPLKLTPQLCDLHPSDEGTEELMQVQLTRFMCGSLVVGFTSNHLIADGKATG  61

Query  529   NFLVAWGKACRDVMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDA  708
              FL+A G+A   +   P+P+ DR +  P +P  IE+DH+G EYM K++ K   +      
Sbjct  62    TFLLACGQATCGLTDYPVPIHDRAVVKPHDPFSIEFDHLGKEYMEKRLVKEVPW-----E  116

Query  709   TFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFET  888
               +  + V K  F+ + LAKLKA A+      R YSTFESL+ HLW+ +T+A  +G  ET
Sbjct  117   EMVSQVRVEKTQFSPDVLAKLKAPATVRCPSGRDYSTFESLIFHLWQKVTQAHGMGEEET  176

Query  889   THIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNN  1068
             + + I ++ R  + P + + YFGN+VLW FP A V++LL +PL   A+++H A+++VN+ 
Sbjct  177   SQLCILINVRTHVVPPIAHGYFGNMVLWVFPRATVRELLSQPLDRVAEVVHAAIAQVNDR  236

Query  1069  YIRSFIDFANSKVVAEEDG----LVPTADMDKHILCPNLEVDSWLRFPFYDLDF  1218
             Y RSF+DF    V  E DG    LV T D+D  + CPNLE +S LR PF +  F
Sbjct  237   YARSFVDF---DVGVERDGRWSELVATGDLDSTVCCPNLEANSRLRIPFEENGF  287



>gb|EEE58457.1| hypothetical protein OsJ_09694 [Oryza sativa Japonica Group]
Length=411

 Score =   258 bits (658),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 159/442 (36%), Positives = 219/442 (50%), Gaps = 56/442 (13%)
 Frame = +1

Query  88    IKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRKALGVYREW  267
             + P Y    PL    V L+VFD+ ++D  +  + AYR P P N  I+ GL +A+  Y   
Sbjct  2     LAPVYGTPHPLAGAEVQLTVFDRAAFDLYVPSVLAYRAPAPSNEAIKEGLLRAVAAYPHL  61

Query  268   AGRLGNDEEGNPVVLLNDEGVKFVEASGDTT-LDKVMPFKP---SVSLLNLHPSL---KG  426
             AGRL  D  G   + +ND+GV  VEA+ D   LD V+       +  + +L+P+L     
Sbjct  62    AGRLAVDHHGRRFLHVNDQGVLVVEATVDGADLDDVLANSGRAMATDVADLYPALPEDNV  121

Query  427   VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR--DVMIQPLPLRDR-  597
                L+QV++ R+ CG LVVG   HH  ADGHS S F  AW  A R  +    P P  DR 
Sbjct  122   GAALLQVKLVRYRCGGLVVGSICHHHTADGHSMSAFFTAWATAVREGEGFTAPTPFLDRA  181

Query  598   TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKA  777
                +PR PP   +DH   E+   +        +S  A  LD I    VHFT EF+ +LKA
Sbjct  182   ATAVPRTPPVPAFDHRSIEFDGGEAAAAGGGRSSYAAVSLDKIKDLTVHFTAEFVGELKA  241

Query  778   KASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFG  957
             +A    GG                                        R NP VP D+FG
Sbjct  242   RA----GG----------------------------------------RANPPVPMDFFG  257

Query  958   NLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG--LV  1131
             N+VLWAFP  + ++LLR         I DAV++V+  YI+SF+DF  +       G  LV
Sbjct  258   NMVLWAFPRMRARELLRATYGAVVGAIRDAVARVDGEYIQSFVDFGGAAAAGGGGGGDLV  317

Query  1132  PTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSI  1311
              TA     +LCP+LEVDSWL F F+ +D GTG P  F+P   P EG+M  +PS    G +
Sbjct  318   ATAAAAGTMLCPDLEVDSWLGFRFHQMDLGTGSPAAFLPPDLPVEGLMVFVPSRAAKGGV  377

Query  1312  DAFIPLFQDNLPTFKQICYSLD  1377
             D F+ + + ++  F++I YSL+
Sbjct  378   DVFMAVAEHHVEAFERIIYSLE  399



>gb|EEE52439.1| hypothetical protein OsJ_34584 [Oryza sativa Japonica Group]
Length=435

 Score =   258 bits (659),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 165/453 (36%), Positives = 230/453 (51%), Gaps = 42/453 (9%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNP-PLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLR  240
             +++ S+  +KP+    P PL    VPL+ FD+ ++D  + +++AYR P P +  ++ GLR
Sbjct  1     MEITSSAMLKPAPTPTPHPLAGEKVPLTAFDRAAFDVFVPMVFAYRAPAPSSEAVKEGLR  60

Query  241   KALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDT------TLDKVMPFKPSVSLL  402
              A+  Y   AGRL  D   +             +  G            + P  P  S  
Sbjct  61    MAVAAYPLAAGRLAVDVAADGPGAPAPSSCPARQRRGRAGPRCHRRGRPLTPCSPPTSAT  120

Query  403   NLHPSLKG---VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRD--V  567
             +L+P+         ++QVQ+TRF C  LVVG   HH V DGHSTS F   W +A RD   
Sbjct  121   DLYPAPPEHSFGAAVLQVQLTRFRCSGLVVGLIVHHHVFDGHSTSAFCTTWARAVRDGEA  180

Query  568   MIQPLPLRDRTIF-IPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVH  744
                P P  DR I  +PR+PP    D  GA                  A  ++ I    V 
Sbjct  181   FSVPSPCLDRAITSVPRSPP-APVDSSGAA-----------------AAAVEKITNIGVR  222

Query  745   FTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRAR  924
             FT +F+A+LKA+      G R  STFE ++AH W+ +T AR L   E T +R++V+ R R
Sbjct  223   FTAKFVAELKARV-----GGR-CSTFECVLAHAWKKMTAARGLKPEEFTRVRVAVNCRRR  276

Query  925   LNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSK  1104
              NP  P D FGN+VLWAFP  +V+ LL          I  AV++V+  YI+SF+D+    
Sbjct  277   ANPPAPADLFGNMVLWAFPRLQVRRLLSASYRDVVGAIRAAVARVDGEYIQSFVDYVE--  334

Query  1105  VVAEEDG--LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMF  1278
              VA+  G  L  TA      LCP+LEVDSWL F F+++D GTG P   +    P EG+M 
Sbjct  335   -VADARGEELAATAAEPGETLCPDLEVDSWLGFRFHEMDLGTGPPAAVLSPDLPIEGLMI  393

Query  1279  LLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             L+P     G +D F+ L  D    F+QICYSL+
Sbjct  394   LVPVGGDGGGVDLFVALADDRAQVFEQICYSLE  426



>ref|XP_003561971.1| PREDICTED: agmatine coumaroyltransferase-1-like [Brachypodium 
distachyon]
Length=442

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 155/448 (35%), Positives = 242/448 (54%), Gaps = 22/448 (5%)
 Frame = +1

Query  64    VKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGLRK  243
             +++  +  +KP Y    PL    VPL+VFD+ + D  + ++ AY  P P N+ ++ GL +
Sbjct  1     MEITGSAMLKPVYTAPHPLAGEKVPLTVFDRAALDMFVPMVLAYPAPAPSNAALKEGLLR  60

Query  244   ALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTL-DKVMPFKPSVSLLNLHPSL  420
             A+      AGRL  D  G   + +NDEGV  +EA+    L D ++  + + S+ +L+P +
Sbjct  61    AVAPSPHLAGRLPVDSRGRRFIHVNDEGVLVIEATVAADLADVLVGGRMAGSVDDLYPKI  120

Query  421   KGV---VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP--  585
                     L+QV++ R+    LV+G + HH  ADG +   FL  W +A R+     +P  
Sbjct  121   PEENVGAALLQVKLNRYKYRGLVIGVSYHHHTADGVAMDAFLTTWARAVREGNGFTVPSF  180

Query  586   -LRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATF-LDDIVVHKVHFTLEF  759
              L      +PR+ P+  +DH   E+  ++   N     S DA   +  +    VHF  EF
Sbjct  181   FLGREATAVPRSTPKPAFDHRSIEFKAREDNSNSS--KSYDAVLSMYKMKNLAVHFPAEF  238

Query  760   LAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKV  939
             +A LKA+      G R  STF+ L+AH W+ +T AR L   E T ++++V+ R + +  V
Sbjct  239   IADLKARV-----GFR-CSTFQCLLAHAWKKLTVARGLKSEEFTQVKVAVNCRGKASSPV  292

Query  940   PNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEE  1119
             P ++FGN+VLWAFP  + +D+L          I DAV +V+  YI+SF+DF     VA+ 
Sbjct  293   PTEFFGNMVLWAFPRLQARDVLSWSYGRVVGAIRDAVGRVDEEYIQSFVDFG---AVADA  349

Query  1120  DG--LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSF  1293
             +G  L  TA     +LCP++EVDSWL F    LDFGTG   +F+P   P EG++  +PS 
Sbjct  350   NGEELQATAGAGT-MLCPDIEVDSWLGFKINRLDFGTGTNTVFLPPDLPIEGLLVFVPSC  408

Query  1294  IGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
                G++D  + + +D+   F+  CYSLD
Sbjct  409   TEMGAVDLVLAVAEDHAAAFENTCYSLD  436



>ref|NP_001064485.1| Os10g0380100 [Oryza sativa Japonica Group]
 dbj|BAF26399.1| Os10g0380100, partial [Oryza sativa Japonica Group]
Length=301

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 185/314 (59%), Gaps = 16/314 (5%)
 Frame = +1

Query  442   QVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV-MIQPLPLRDRT-IFIPR  615
             QVQ+TR+ CG LV+G   +H V+DG S S F VAW  A R      P P  DR  I +PR
Sbjct  2     QVQLTRYACGGLVIGTACNHQVSDGQSMSFFYVAWAAAVRSAGATLPTPFVDRAAIAVPR  61

Query  616   NPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKASAMN  795
              PP   +DH   E+     K    + +S  +  L+ I    VHF  EF+A LK+      
Sbjct  62    GPPAPAFDHRNIEF-----KGEHSWTHSYGSLPLERIRNLAVHFPDEFVAGLKSHV----  112

Query  796   GGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWA  975
              GAR  STF+ L+AH W+ IT AR+L   E T +R++V+ R R +P VP DYFGN+VLWA
Sbjct  113   -GAR-CSTFQCLLAHAWKKITAARDLSPEEYTQVRVAVNCRGRASPAVPMDYFGNMVLWA  170

Query  976   FPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKH  1155
             FP  +V+DLL    +    +I +AV++V+  YI+SF+DF     VA  D L PTA     
Sbjct  171   FPRMRVRDLLSSSYAAVVGVIRNAVARVDEQYIQSFVDFGE---VAAGDELTPTAAPPGT  227

Query  1156  ILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQ  1335
             + CP+LEVDSWL F F+DLDFG G P  F+P   P EG++  +PS    G ++ F+ L  
Sbjct  228   VFCPDLEVDSWLGFRFHDLDFGRGPPCAFLPPDVPVEGLLIFVPSCAAKGGVEMFMALDD  287

Query  1336  DNLPTFKQICYSLD  1377
              ++  F+QICYS+D
Sbjct  288   VHVEAFRQICYSMD  301



>ref|XP_002960602.1| BAHD family acyltransferase, clade IV [Selaginella moellendorffii]
 gb|EFJ38141.1| BAHD family acyltransferase, clade IV [Selaginella moellendorffii]
Length=482

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 162/459 (35%), Positives = 225/459 (49%), Gaps = 64/459 (14%)
 Frame = +1

Query  133   VPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIEL--GLRKALGVYREWAGRLGNDEEGNP-  303
             VPLS  D    +     IYA++ PT P    EL  GL +AL  Y EWAGRL  D   +  
Sbjct  42    VPLSTCDLAIPNVYAMAIYAFKAPTRPGVVEELERGLAEALDEYPEWAGRLCKDSSSSSS  101

Query  304   -------------------VVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLKG  426
                                V+ LND+GV  +EAS D  L  +MPF P   L  L P+ K 
Sbjct  102   SSSSSCSSGLSGSVGSSKVVIDLNDDGVALMEASMDCCLQDLMPFNPCPLLFQLVPATKS  161

Query  427   VVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDRTIF  606
             V EL+ VQVT F CG +V+G   HH +ADG +  +F+  W +  R   +   P RDR+  
Sbjct  162   VEELLLVQVTSFKCGGIVLGVAWHHRLADGQAFFSFMDNWSRLTRGAPLACSPFRDRSAL  221

Query  607   IPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDD----------IVVHKVHFTLE  756
                        + G    P Q   +D+ L S                  +   K HF+++
Sbjct  222   -----------NAGETAQPLQ---DDYLLLSPPQAPAPAPDPGAAKTPPLAARKFHFSMD  267

Query  757   FLAKLKAKASAMNGGARPYS-------TFESLVAHLWRAITKARNLGGFETTHIRISVDG  915
              L ++K +A   +    P S       TFESL AHLWR ITKAR + G   T I I ++G
Sbjct  268   LLQRIKRRAGGDSSTDEPASSTTRGVTTFESLTAHLWRCITKARGITGDTKTQIMIPMNG  327

Query  916   RARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRS---FI  1086
             R+RL P +P  YFGN         +  +L   PL YAA+L+H A+ K +++Y+RS    +
Sbjct  328   RSRLEPAIPESYFGNATFMPSSGTEAGELTSRPLCYAAQLVHGAIIKADSSYLRSALELM  387

Query  1087  DFANSKVVAEE--DGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFP  1260
             +  N  +  EE  + +VP +      + P++ V SW+RFP YD+DFG G P         
Sbjct  388   ELQNRMMKDEEVAEVVVPPS------MSPHVVVTSWVRFPLYDVDFGWGTPLYVGNVLDL  441

Query  1261  TEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
              EG+M LLPS   DGSIDA + LF+  + T +++CY  D
Sbjct  442   YEGIMILLPSHTQDGSIDAVVALFEPEIETLQELCYRDD  480



>ref|XP_002969244.1| BAHD family acyltransferase, clade IV [Selaginella moellendorffii]
 gb|EFJ29332.1| BAHD family acyltransferase, clade IV [Selaginella moellendorffii]
Length=482

 Score =   255 bits (651),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 160/460 (35%), Positives = 225/460 (49%), Gaps = 64/460 (14%)
 Frame = +1

Query  130   HVPLSVFDKVSYDAQIAVIYAYRPPTPPN--STIELGLRKALGVYREWAGRLGNDEEGNP  303
             +VPLS  D    +     IYA++ PT P     +E GL +AL  Y EWAGRL  D   + 
Sbjct  41    NVPLSTCDLAIPNVYAMAIYAFKAPTRPGVVEELERGLAEALDEYPEWAGRLCKDSSSSS  100

Query  304   --------------------VVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSLK  423
                                 V+ LND+GV  +EAS D  L  +MPF P   L  L P+ K
Sbjct  101   SSSSSSCSSGLSGSVGSSKVVIDLNDDGVALMEASMDCCLQDLMPFNPCPLLFQLVPATK  160

Query  424   GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLPLRDRTI  603
              V EL+ VQVT F CG +V+G   HH +ADG +  +F+  W +  R   +   P RDR+ 
Sbjct  161   SVEELLLVQVTSFKCGGIVLGVAWHHRLADGQAFFSFMDNWSRLTRGAPLACSPFRDRSA  220

Query  604   FIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDD----------IVVHKVHFTL  753
                         + G    P Q   +D+ L S                  +   K HF++
Sbjct  221   L-----------NAGETAQPLQ---DDYLLLSPPQVPAPAPDPGAAKTPPLAARKFHFSM  266

Query  754   EFLAKLKAKASAMNGGARPYS-------TFESLVAHLWRAITKARNLGGFETTHIRISVD  912
             + L ++K +A   +    P S       TFESL AHLWR ITKAR + G   T I I ++
Sbjct  267   DLLQRIKRRAGGDSSTDEPASSTTRGVTTFESLTAHLWRCITKARGITGDTKTQIMIPMN  326

Query  913   GRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRS---F  1083
             GR+RL P +P  YFGN         +  +L   PL YAA+L+H A+ K +++Y+RS    
Sbjct  327   GRSRLEPAIPESYFGNATFMPSSGTEAGELTSRPLCYAAQLVHGAIVKADSSYLRSALEL  386

Query  1084  IDFANSKVVAEE--DGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFF  1257
             ++  N  +  EE  + +VP +      + P++ V SW+RFP YD+DFG G P        
Sbjct  387   MELQNRMMKDEEVAEVVVPPS------MSPHVVVTSWVRFPLYDVDFGWGTPLYVGNVLD  440

Query  1258  PTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
               EG+M LLPS   DGSIDA + LF+  +   +++CY  D
Sbjct  441   LYEGIMILLPSHTQDGSIDAVVALFEPEIEKLQELCYRDD  480



>gb|EEE59703.1| hypothetical protein OsJ_12127 [Oryza sativa Japonica Group]
Length=285

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 147/192 (77%), Gaps = 2/192 (1%)
 Frame = +1

Query  802   ARPYSTFESLVAHLWRAITKARNLGGFETT-HIRISVDGRARLNPKVPNDYFGNLVLWAF  978
              R Y+TFESLVAHLWRA+T AR LG   TT  +RI+V+GRAR+ P VP DYFGNLVLWAF
Sbjct  94    GRGYTTFESLVAHLWRAVTAARGLGAAATTTRVRIAVNGRARMRPPVPRDYFGNLVLWAF  153

Query  979   PTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHI  1158
             P     +L+  P  +AA+LIH AV+ +++ Y RSF+DFA+S  V E +GLVPTAD  + +
Sbjct  154   PRCDAGELVARPSHHAAELIHRAVAGIDDAYFRSFVDFASSGAV-EAEGLVPTADAGEVV  212

Query  1159  LCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQD  1338
             +CP++EVDSWL   FYDLDFG GCP  FMP++   EG +FL+PSF+GDGSID ++PLF++
Sbjct  213   VCPDMEVDSWLGMSFYDLDFGGGCPLYFMPSYLAMEGTIFLVPSFLGDGSIDVYVPLFEN  272

Query  1339  NLPTFKQICYSL  1374
             +L  FK+ICY++
Sbjct  273   HLEEFKKICYNI  284


 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +1

Query  58   MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIELGL  237
            MKVKVES+R +KP Y+   P     +PLSV    +YD  IA+IYA+RPP PP++ +ELGL
Sbjct  1    MKVKVESSRIVKPLYDAAAP-APEWMPLSVSKTATYDESIAIIYAFRPPNPPSAAMELGL  59

Query  238  RKALGVYR  261
             + L VYR
Sbjct  60   ARTLAVYR  67



>dbj|BAJ88765.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=322

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/320 (42%), Positives = 186/320 (58%), Gaps = 18/320 (6%)
 Frame = +1

Query  436   LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRD---VMIQPLPLRDRTIF  606
             + Q Q+TR++CG LV+G   HH VADG S S F  AW  A R    V++ P   R  T+ 
Sbjct  15    IFQAQLTRYSCGGLVIGTACHHQVADGQSMSVFYTAWASAVRTDSAVLLSPFVDRSATV-  73

Query  607   IPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLAKLKAKAS  786
             +PR+PP   YDH   E+     K    + +S     ++ I    VHF  EF+A LKA+  
Sbjct  74    VPRSPPTPAYDHRNIEF-----KGERSWSHSYGVLPMERIKNLAVHFPDEFVADLKARV-  127

Query  787   AMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLV  966
                 G R  STF+ L+AH W+ IT AR+L   + T +R++V+ R R  P VP D+FGN+V
Sbjct  128   ----GTR-CSTFQCLLAHSWKKITAARDLAPDDFTQVRVAVNCRGRAKPPVPMDFFGNMV  182

Query  967   LWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG---LVPT  1137
             LWAFP  +V+DL+          I DAV+ V++ Y++SF+DF  ++    EDG   L  T
Sbjct  183   LWAFPRMQVRDLMSSSYPTVVGAIRDAVALVDDEYVQSFVDFGEAERGVIEDGGEELAST  242

Query  1138  ADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDA  1317
             A     + CP+LEVDSWL F F+DLDFG G P  F+P   P EG+M  +PS    G +D 
Sbjct  243   AATPGTMFCPDLEVDSWLGFRFHDLDFGCGPPCAFLPPDLPIEGIMIFVPSCDPKGGVDL  302

Query  1318  FIPLFQDNLPTFKQICYSLD  1377
             F+ L  +++  FKQICYS+D
Sbjct  303   FMALDDEHVQAFKQICYSMD  322



>gb|EMT10925.1| hypothetical protein F775_52506 [Aegilops tauschii]
Length=401

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 154/393 (39%), Positives = 213/393 (54%), Gaps = 24/393 (6%)
 Frame = +1

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             + GL  A+  +   AGR   D+ G     LND GV  +EA+ D  L   +       +  
Sbjct  24    QAGLVPAVARFPHLAGRFAADDHGRKCFHLNDAGVLVLEATADADLADALAHDVPAHINE  83

Query  406   LHPSL---KGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRD---V  567
             L+P     +    + Q Q+TR+ CG LV+G   HH VADG S S F  AW  A R    V
Sbjct  84    LYPKAEKERANEPIFQAQLTRYACGGLVIGTACHHQVADGQSMSVFYTAWASAVRTDSAV  143

Query  568   MIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHF  747
             ++ P   R  T+ +PR+PP   YD+   E+  +  + +     S     +D I    VHF
Sbjct  144   LMSPFVDRSATV-VPRSPPTPAYDYRNIEFKGELSRSH-----SYGVLPMDRIKNLAVHF  197

Query  748   TLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARL  927
               EF+A LKA+      G R  STF+ L+AH W+ IT AR+L   + T +R++V+ R R 
Sbjct  198   PDEFIADLKARV-----GTR-CSTFQCLLAHAWKKITAARDLALDDFTQVRVAVNCRGRA  251

Query  928   NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKV  1107
              P VP D+FGN+VLWAFP  + +  L       A  I DAV+ V++ YI+SFIDF  ++ 
Sbjct  252   KPPVPMDFFGNMVLWAFPRMQGRGHLP---PRVAPPIRDAVALVDDEYIQSFIDFGEAER  308

Query  1108  VAEEDG---LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMF  1278
                EDG   L  TA     + CP+LEVDSWL F F+DLDFG G P  F+P   P EG+M 
Sbjct  309   GVIEDGGEELASTAATPGTMFCPDLEVDSWLGFRFHDLDFGCGPPCAFLPPDLPIEGIMI  368

Query  1279  LLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
              +PS    G +D F+ L  +++ +FKQICYS+D
Sbjct  369   FVPSCDPKGGVDLFMALDDEHVQSFKQICYSMD  401



>ref|XP_006662273.1| PREDICTED: agmatine coumaroyltransferase-2-like [Oryza brachyantha]
Length=401

 Score =   247 bits (631),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 169/456 (37%), Positives = 222/456 (49%), Gaps = 71/456 (16%)
 Frame = +1

Query  58    MKVKVESTRT--IKPS-YEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYR----------  198
             M V VE T++  I+PS             PL+VFD+ + D  I  +YA+R          
Sbjct  1     MAVTVEITKSEVIRPSPASCGDAGGARSSPLTVFDRAAMDMYIPSVYAWRNAGGGAEAVA  60

Query  199   PPTPPNSTIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMP  378
                P N  I+LGL   L  +   AGR   D  G     LND GV   EA+   TL   + 
Sbjct  61    EAPPSNRAIKLGLAAVLPRFPHLAGRFDVDARGRRCFDLNDAGVFVFEAAASGTLADALA  120

Query  379   FKPSVSLLNLHP---SLKGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWG  549
                +  +  L+P   + +    LVQVQ+TR+TCG LV+G TAHH +ADG S S      G
Sbjct  121   HDVAAHVNELYPKADTERADEPLVQVQLTRYTCGGLVIGATAHHHIADGQSFSFSAERGG  180

Query  550   KACRDVMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIV  729
             +                                               NS     LD I 
Sbjct  181   R-----------------------------------------------NSRATLPLDRIQ  193

Query  730   VHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISV  909
                VHF  EF+A+LKA+      G R  STF  L+AH W+ IT AR L     T +R++V
Sbjct  194   NLAVHFPDEFVARLKAQV-----GVR-CSTFRCLLAHAWKKITAARGLPPEAFTQVRVAV  247

Query  910   DGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFID  1089
             D R R  P VP DYFGN+VLWAFP  +V  LL    +  A +I DAV++V+  YIRSF+D
Sbjct  248   DCRGRTTPPVPRDYFGNMVLWAFPRMQVGQLLSASYAAVAGVISDAVARVDERYIRSFVD  307

Query  1090  FANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEG  1269
             F  +    EE+ L  TA     +LCP+LEVDSWL F F++LDFG G P  F+    P EG
Sbjct  308   FGEA--TGEEEELAATAAEPGTVLCPDLEVDSWLGFRFHELDFGGGPPCAFLTPDVPIEG  365

Query  1270  MMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSLD  1377
             +   +PS  G G I+ F+ L   ++  F++ICYSLD
Sbjct  366   IFIFVPSCAGKGGIEMFVALQDTHVEAFREICYSLD  401



>gb|EMS61449.1| Agmatine coumaroyltransferase-1 [Triticum urartu]
Length=365

 Score =   242 bits (617),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 163/247 (66%), Gaps = 8/247 (3%)
 Frame = +1

Query  58   MKVKVESTRTIKPSYEG---NPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTIE  228
            MK+ V S++ +KP Y      P  T   VPL+V DK ++D  I+VIYA+  P PPN+ +E
Sbjct  1    MKITVHSSKAVKPDYGACGVAPACTNDVVPLTVLDKANFDTYISVIYAFHAPAPPNAVLE  60

Query  229  LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
             GL +AL  YREWAGRLG D  G   ++LND G +FVEA+ D  LD VMP KP+  +L+L
Sbjct  61   AGLARALVDYREWAGRLGVDPNGERAIMLNDAGARFVEATADVALDSVMPLKPTPEVLSL  120

Query  409  HPSL-KGVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQPLP  585
            HPS   G  EL+ +QVTRF+CGSLVVGFT  H+V+DG ST NF VAW +A R   + P+P
Sbjct  121  HPSGDDGPEELMLIQVTRFSCGSLVVGFTTQHIVSDGRSTGNFFVAWSQATRGAAVDPVP  180

Query  586  LRDR-TIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFL  762
            + DR + F PR P  +EY+H G E+ P +   +D      D    D++VV+KVHF+ EF+
Sbjct  181  VHDRASFFHPREPLHVEYEHRGVEFKPYEKVHDDVVRADGDD---DEVVVNKVHFSREFI  237

Query  763  AKLKAKA  783
            ++LKA+A
Sbjct  238  SRLKAQA  244


 Score =   156 bits (395),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +1

Query  1006  REPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDS  1185
             + PL +A +LI   V+++N+ Y +SFIDFANS  V E++ L  TAD  + +L PN+EVDS
Sbjct  243   QAPLKHAVELISREVARINDGYFKSFIDFANSGAV-EKERLAATADAAEMVLSPNIEVDS  301

Query  1186  WLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQIC  1365
             WLR PFYD+DFG G P+ FMP++ P EG++ LLPSF+GDGS+DA++PLF  ++ TFK+ C
Sbjct  302   WLRIPFYDMDFGGGRPFFFMPSYLPVEGLLILLPSFLGDGSVDAYVPLFSRDMNTFKKCC  361

Query  1366  YSLD  1377
             Y+LD
Sbjct  362   YTLD  365



>gb|ABO77956.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 155/446 (35%), Positives = 234/446 (52%), Gaps = 27/446 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK+ V+ T  ++P+     P  T  +  S  D +     I  +Y Y+P    N      +
Sbjct  1     MKITVKETAMVRPAQ----PTPTKRLWNSNLDLLVARIHILTVYFYKPNGSANFFDTRVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L   L  +   AGRL  DEEG   +  N EGV FVEA  D+++D    F PS+ L  
Sbjct  57    KEALSNVLVSFYPMAGRLARDEEGRIEIDCNGEGVLFVEAESDSSVDDFGDFAPSLELRR  116

Query  406   LHPSLKGVVE-----LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++    +     LV  QVTRF CG+  +G    H ++DG S+ +F+ AW    RD+ 
Sbjct  117   LIPTVDCSGDISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGVSSLHFINAWSDIARDLT  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             I   P  DRT+   R+PP   ++HV   Y P Q+K +                V K+  T
Sbjct  177   IAVPPFIDRTLIRARDPPVPVFEHV-EYYPPPQLKSDSRIQELKTGPRASTTAVLKI--T  233

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              E L++LKAKA+  N G    ST+E L AH+WR   KAR L   ++T + ++ DGR+RL 
Sbjct  234   PEQLSQLKAKAN--NEG----STYEILAAHIWRTACKARGLTNDQSTKLYVATDGRSRLI  287

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P +P  Y GN+V  A P A+  +L  EPL+ +AK IH+A+++++N+Y+RS +D+   ++ 
Sbjct  288   PPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDYLRSALDYL--EIQ  345

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV      +H   PNL ++SW R PF+D DFG G P    P     EG +++LPS
Sbjct  346   PDLSALVRGP---RHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYVLPS  402

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICY  1368
                D ++   + L  D++P F++  Y
Sbjct  403   PGKDRTLSLAVCLDADHMPLFQKFLY  428



>ref|XP_006662310.1| PREDICTED: agmatine coumaroyltransferase-1-like [Oryza brachyantha]
Length=395

 Score =   239 bits (611),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 159/446 (36%), Positives = 229/446 (51%), Gaps = 57/446 (13%)
 Frame = +1

Query  58    MKVKVESTRT--IKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPP-NSTIE  228
             M V VE TR+  ++PS   +        PL+VFD+ + D  I V +A+     P N  ++
Sbjct  1     MAVAVEITRSEVLRPS-RASAAGGGRRSPLTVFDRAATDWYIPVAFAWDAAAAPCNEDVK  59

Query  229   LGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNL  408
              GL   L  +   AGR   D        LND GV+ +EA+ D  L   +    +  +  L
Sbjct  60    EGLAAVLARFPRLAGRFDVDGCDRRCFNLNDAGVRVIEATADARLADALAHDVAAHVNEL  119

Query  409   HP--SLKGVVE-LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVMIQP  579
             +P  +++   E ++QVQ+TR+TCG LV+G  +HH V                        
Sbjct  120   YPKANMENADEPVLQVQLTRYTCGGLVIGAVSHHQV------------------------  155

Query  580   LPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEF  759
                          PP   +DH   E+  +Q + +     S  +  LD I    VHF  EF
Sbjct  156   -------------PPEPAFDHRNIEFKGEQSRSH-----SYGSLPLDRIKNLVVHFPDEF  197

Query  760   LAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKV  939
             +A LK+      GG R  STF+ L+AH W+ IT AR+L   E+T +R++V+ R R +P V
Sbjct  198   VAGLKSHV----GGVR-CSTFQCLLAHAWKKITAARDLPPEESTQVRVAVNCRGRASPAV  252

Query  940   PNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEE  1119
             P DYFGN+VLWAFP  +V+DLL    +    +I DAV+ V+  YI+SFIDF     VA  
Sbjct  253   PTDYFGNMVLWAFPRMQVRDLLSSSYATVVSVIRDAVASVDEQYIQSFIDFGE---VAAG  309

Query  1120  DGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIG  1299
             + L PTA     + CP+LEVDSWL F F+ LDFG G P  F+P   P EGM+  +PS   
Sbjct  310   EELTPTAAPPGTVFCPDLEVDSWLGFRFHGLDFGRGPPRAFLPPDLPVEGMLIFVPSCGE  369

Query  1300  DGSIDAFIPLFQDNLPTFKQICYSLD  1377
              G ++ ++ L   ++   +QICY++D
Sbjct  370   KGGVEMYMALDDHHVDALRQICYAMD  395



>emb|CDP02827.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   241 bits (614),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 156/463 (34%), Positives = 237/463 (51%), Gaps = 27/463 (6%)
 Frame = +1

Query  7     PKSSLIVFFVHFVEKKTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVI  186
             P++ LI   +  V  + MK+ V+ T  ++P+     P  T  +  S  D +     I  +
Sbjct  38    PRTKLISSCLISVGSEKMKITVKETAMVRPAQ----PTPTKRLWNSNLDLLVARIHILTV  93

Query  187   YAYRPPTPPN----STIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGD  354
             Y Y+P    N      ++  L   L  +   AGRL  DEEG   +  N EGV FVEA  D
Sbjct  94    YFYKPNGSANFFDTRVLKEALSNVLVSFYPMAGRLARDEEGRIEIDCNGEGVLFVEAESD  153

Query  355   TTLDKVMPFKPSVSLLNLHPSLK-----GVVELVQVQVTRFTCGSLVVGFTAHHLVADGH  519
             +++D    F PS+ L  L P++          LV  QVTRF CG+  +G    H ++DG 
Sbjct  154   SSVDDFGDFAPSLELRRLIPTVDCSGDISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGV  213

Query  520   STSNFLVAWGKACRDVMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNS  699
             S+ +F+  W    R + I   P  DRT+   R+PP   ++HV   Y P Q+K +      
Sbjct  214   SSLHFINTWSDIARGLTIAVPPFIDRTLIRARDPPVPVFEHV-EYYPPPQLKSDSRIQEL  272

Query  700   NDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGG  879
                       V K+  T E L++LKAKA+  N G    ST+E L AH+WR   KAR L  
Sbjct  273   KTGPRASTTAVLKI--TPEQLSQLKAKAN--NEG----STYEILAAHIWRTACKARGLTN  324

Query  880   FETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKV  1059
              ++T + ++ DGR+RL P +P  Y GN+V  A P A+  +L  EPL+ +AK IH+A++++
Sbjct  325   DQSTKLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARM  384

Query  1060  NNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYI  1239
             +N+Y+RS +D+     +  +  L       +H   PNL ++SW R PF+D DFG G P  
Sbjct  385   DNDYLRSALDY-----LEIQPDLSALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIH  439

Query  1240  FMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICY  1368
               P     EG +++LPS   D ++   + L  D++P F++  Y
Sbjct  440   IGPAIILYEGTVYVLPSPGKDRTLSLAVCLDADHMPLFQKFLY  482



>emb|CAT00081.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=430

 Score =   238 bits (608),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 155/446 (35%), Positives = 232/446 (52%), Gaps = 27/446 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK+ V+ T  ++P+     P  T  +  S  D +     I  IY Y+P    N      +
Sbjct  1     MKITVKETAMVRPAQ----PTPTKRLWNSNLDLLVARIHILTIYFYKPNGSANFFDTRVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L   L  +   AGRL  DEEG   +  N EGV FVEA  D+++D    F PS+ L  
Sbjct  57    KEALSNVLVSFYPMAGRLARDEEGRIEIDCNGEGVLFVEAESDSSVDDFGDFAPSLELRR  116

Query  406   LHPSLKGVVE-----LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++    +     LV  QVTRF CG+  +G    H ++DG S+ +F+  W    R + 
Sbjct  117   LIPTVDCSGDISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGVSSLHFINTWSDIARGLT  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             I   P  DRT+   R+PP   ++HV   Y P Q+K +                V K+  T
Sbjct  177   IAVPPFIDRTLIHARDPPVPVFEHV-EYYPPPQLKSDSRIQELKTGPRASTTAVLKI--T  233

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              E L++LKAKA+  N G    ST+E L AH+WR   KAR L   ++T + ++ DGR+RL 
Sbjct  234   PEQLSQLKAKAN--NEG----STYEILAAHIWRTACKARGLTNDQSTKLYVATDGRSRLI  287

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P +P  Y GN+V  A P A+  DL  EPL+ +AK IH+A+++++N+Y+RS +D+   ++ 
Sbjct  288   PPLPPGYLGNVVFTATPIAESSDLQSEPLTNSAKRIHNALARMDNDYLRSALDYL--EIQ  345

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV      +H   PNL ++SW R PF+D DFG G P    P     EG +++LPS
Sbjct  346   PDLSALVRGP---RHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYVLPS  402

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICY  1368
                D ++   + L  D++P F++  Y
Sbjct  403   PGKDRTLSLAVCLDADHMPLFQKFLY  428



>ref|XP_006654926.1| PREDICTED: agmatine coumaroyltransferase-1-like [Oryza brachyantha]
Length=322

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 138/187 (74%), Gaps = 1/187 (1%)
 Frame = +1

Query  811   YSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAK  990
             YSTFES+V HLWRA+T AR LG  E T +RISV+GR R+ P VP DYFGNLVLWAFP + 
Sbjct  136   YSTFESVVGHLWRAVTAARGLGAGEPTTLRISVNGRTRMRPPVPRDYFGNLVLWAFPRST  195

Query  991   VKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPN  1170
               +L+  P+ +AA+LIH AV++V++ Y RSF+DFA+S     E  L  TAD  + +LCP+
Sbjct  196   AGELVSGPVQHAAELIHRAVARVDDAYFRSFVDFASSGAGGAER-LAATADESQAVLCPD  254

Query  1171  LEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPT  1350
             +E DSWL   FYDLDFG G P  FMP++ P EG +FL+PSF+GDG IDA++ LF+ +L  
Sbjct  255   VEGDSWLGIDFYDLDFGGGGPAYFMPSYLPMEGTVFLVPSFLGDGGIDAYVSLFETHLDE  314

Query  1351  FKQICYS  1371
             FK+ICY+
Sbjct  315   FKKICYT  321


 Score =   131 bits (330),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 85/127 (67%), Gaps = 7/127 (6%)
 Frame = +1

Query  58   MKVKVESTRTIKPSYEGNPPLTT----THVPLSVFDKVSYDAQIAVIYAYRPPTPPNSTI  225
            M V+++S++ +KP Y+G     T      VPLSVFD V+YD  +AVIYA+RPP PPN+ +
Sbjct  1    MNVRIDSSKVVKPLYDGAAAPGTLAGGESVPLSVFDTVTYDVYMAVIYAFRPPNPPNAAL  60

Query  226  ELGLRKALGVYREWAGRL--GNDEEG-NPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVS  396
            E+GL KAL VYREWAG L  G+  EG  P VLLND G   VEA+    L  VMPFKPS  
Sbjct  61   EVGLAKALAVYREWAGELADGDGTEGRRPAVLLNDRGALLVEATVSAPLAAVMPFKPSPE  120

Query  397  LLNLHPS  417
            LL LHPS
Sbjct  121  LLRLHPS  127



>gb|AFP49814.1| caffeoyl-CoA quinic acid caffeoyl transferase 4 [Coffea arabica]
Length=430

 Score =   236 bits (602),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 152/446 (34%), Positives = 229/446 (51%), Gaps = 27/446 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK+ V+ T  ++P+     P  T  +  S  D +     I  +Y Y+P    N      +
Sbjct  1     MKITVKETAMVRPAQ----PTPTKRLWNSNLDLLVARIHILTVYFYKPNGSANFFDTRVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L   L  +   AGRL  DEEG   +  N EGV FVEA  D+++D    F PS+ L  
Sbjct  57    KEALSNVLVSFYPMAGRLARDEEGRIEIDCNGEGVLFVEAESDSSVDDFGDFAPSLELRR  116

Query  406   LHPSLK-----GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++          LV  QVTRF CG+  +G    H ++DG S+ +F+  W    R + 
Sbjct  117   LIPTVDCSGDISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGVSSLHFINTWSDIARGLT  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             I   P  DRT+   R+PP   ++HV   Y P Q+K +                V K+  T
Sbjct  177   IAVPPFIDRTLIHARDPPVPVFEHV-EYYPPPQLKSDSRIQELKTGPRASTTAVLKI--T  233

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              E L++LKAKA+  N G    ST+E L AH+WR   KAR L   ++T + ++ DGR+RL 
Sbjct  234   PEQLSQLKAKAN--NEG----STYEILAAHIWRTACKARGLTNDQSTKLYVATDGRSRLI  287

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P +P  Y GN+V  A P A+  +L  EPL+ +AK IH+A+++++N+Y+RS +D+     +
Sbjct  288   PPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDYLRSALDY-----L  342

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
               +  L       +H   PNL ++SW R PF+D DFG G P    P     EG +++LPS
Sbjct  343   EIQPDLSALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYVLPS  402

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICY  1368
                D ++   + L  D++P F++  Y
Sbjct  403   PGKDRTLSLAVCLDADHMPLFQKFLY  428



>gb|ABO77957.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   236 bits (602),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 153/446 (34%), Positives = 232/446 (52%), Gaps = 27/446 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK+ V+ T  ++P+     P  T  +  S  D +     I  +Y Y+P    N      +
Sbjct  1     MKITVKETAMVRPAQ----PTPTKRLWNSNLDLLVARIHILTVYFYKPNGSANFFDTRVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L   L  +   AGRL  DEEG   +  N EGV FVEA  D+++D    F PS+ L  
Sbjct  57    KEALSNVLVSFYPMAGRLARDEEGRIEIDCNGEGVLFVEAESDSSVDDFGDFAPSLELRR  116

Query  406   LHPSLKGVVE-----LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++    +     LV  QVTRF CG+  +G    H ++DG S+ +F+  W    R + 
Sbjct  117   LIPTVDCSGDISSYPLVIFQVTRFKCGAAALGAGVQHNLSDGVSSLHFINTWSDIARGLT  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             I   P  DRT+   R+PP   ++HV   Y P Q+K +                V K+  T
Sbjct  177   IAVPPFIDRTLIRARDPPVPVFEHV-EYYPPPQLKSDSRIQELKTGPRASTTAVLKI--T  233

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              E L++LKAKA+  N G    ST+E L AH+WR   KAR L   ++T + ++ DGR+RL 
Sbjct  234   PEQLSQLKAKAN--NEG----STYEILAAHIWRTACKARGLTNDQSTKLYVATDGRSRLI  287

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P +P  Y GN+V  A P A+  +L  EPL+ +AK IH+A+++++N+Y+RS +D+   ++ 
Sbjct  288   PPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDYLRSALDYL--EIQ  345

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV      +H   PNL ++SW R PF+D DFG G P    P     EG +++LPS
Sbjct  346   PDLSALVRGP---RHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYEGTVYVLPS  402

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICY  1368
                D ++   + L  D++P F++  Y
Sbjct  403   PGKDRTLSLAVCLDADHMPLFQRFLY  428



>gb|AHA14500.1| hydroxycinnamoyl-coenzyme A quinate transperase [Fagopyrum tataricum]
Length=435

 Score =   236 bits (602),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 150/451 (33%), Positives = 234/451 (52%), Gaps = 26/451 (6%)
 Frame = +1

Query  49    KKTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----  216
             +K M + V ++  +KP+ E  P  +  +   S  D V        +Y YRP    N    
Sbjct  2     EKKMIINVRNSTMVKPAKE-TPQRSLWN---SNVDLVVPRIHTPSVYFYRPNGSTNFFDP  57

Query  217   STIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVS  396
             + ++  L +AL  +   AGRL  DE+G   +  N EGV FVEA   + +D    F P++ 
Sbjct  58    NPVKEALSRALVYFYPMAGRLRRDEDGRIEIDCNGEGVLFVEAETTSVIDDFGDFAPTLE  117

Query  397   LLNLHPSL---KGV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR  561
             L  L P++   +G+    L+ +Q+T F CG + +G    H  ADG S  +F+  W    R
Sbjct  118   LRKLIPTVDYSQGISSYSLLVLQLTYFKCGGVSLGVGMQHHAADGFSGLHFINTWADMAR  177

Query  562   DVMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKV  741
              + +   P  DRT+   R+PP+ ++ HV  EY P    KN       + +  ++  V   
Sbjct  178   GLDLTIPPFIDRTLLRARDPPQPKFHHV--EYQPPPTLKN-----PTEPSTPEEATVAIF  230

Query  742   HFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRA  921
               + E ++ LKAK S  +G   PYS++E L  H+WR + +AR L   + T + I+ DGR+
Sbjct  231   KISREQISTLKAK-SKEDGNTIPYSSYEMLSGHVWRCVCQARGLENDQGTKLYIATDGRS  289

Query  922   RLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANS  1101
             RLNP +P  YFGN++    P A+  DL  +P  YAA  IHDA+++++N Y+RS +D+   
Sbjct  290   RLNPTLPPGYFGNVIFTTTPVAQAGDLASKPTWYAASRIHDALARMDNEYLRSALDYL--  347

Query  1102  KVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFL  1281
             ++  +   LV  A   +   CPNL + SW R P +D DFG G P    P   P EG+ ++
Sbjct  348   ELQPDLTALVRGAHTFR---CPNLGITSWTRLPIHDADFGWGRPIFMGPGGIPYEGLAYM  404

Query  1282  LPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             LPS + DGS+   I L  +++  F +  Y +
Sbjct  405   LPSPVNDGSLSLAIALQPEHMKLFSKYLYEI  435



>emb|CDG56249.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 2 
[Glechoma hederacea]
Length=430

 Score =   236 bits (601),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 155/451 (34%), Positives = 235/451 (52%), Gaps = 33/451 (7%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRP-------PTPPN  216
             MK++V  +  ++PS    P ++  +   S  D V  +     +Y YRP            
Sbjct  1     MKIEVRDSTLVRPS-AATPAVSLWN---SNVDLVVPNFHTPSVYFYRPDGGAAAADFFDT  56

Query  217   STIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVS  396
             + ++  L +AL  +   AGRL  DE+G   +  N EGV FVEA  D ++D    F P++ 
Sbjct  57    AVMKAALGRALVPFYPMAGRLKRDEDGRVEIDCNAEGVLFVEAESDGSVDDYGDFAPNLE  116

Query  397   LLNLHPSL---KGV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR  561
             L  L P++   +G+    L+ +QVT+F CG + +G    H VADG S  +F+  W    R
Sbjct  117   LRRLIPAVDYSQGISTYALLVLQVTKFKCGGVSLGVGMQHHVADGFSGLHFINTWSDMAR  176

Query  562   DVMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKV  741
              + I   P  DRT+ + R+PP+ ++ H+  EY P    K      + DAT   + VV   
Sbjct  177   GLDITLPPFIDRTLLLARDPPQPQFKHI--EYQPAPAMK------TYDAT---ETVVSIF  225

Query  742   HFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRA  921
               T E L  LKAK S  +G    YS++E L  H+WR    AR+L   + T + I+ DGRA
Sbjct  226   KLTREQLTTLKAK-SKEDGNTVTYSSYEMLAGHVWRCACLARSLPEDQDTKLYIATDGRA  284

Query  922   RLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANS  1101
             RL P +P  YFGN++    P A   DL  +P+ YAA  IHDA+++++N Y+RS +D+   
Sbjct  285   RLQPPLPQGYFGNVIFTTTPQAVAGDLDSKPVWYAASKIHDALAQMDNEYLRSALDYL--  342

Query  1102  KVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFL  1281
             ++  +   LV  A   +   CPNL + SW+R P +D DFG G P    P     EG+ F+
Sbjct  343   ELQPDLKALVRGAHTFR---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFV  399

Query  1282  LPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             LPS   DGS+   I L  +++  F+++ Y +
Sbjct  400   LPSPANDGSLSVAISLQAEHMKLFEKLLYDI  430



>ref|XP_010479240.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   235 bits (600),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 152/448 (34%), Positives = 225/448 (50%), Gaps = 26/448 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK+ +  +  ++P+ E      TT++  S  D +        +Y YRP    N      +
Sbjct  1     MKINILDSTIVRPAAE----TPTTNLWNSHVDLIIAKYHTPSVYFYRPTGASNFFDPQVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L KAL  +   AGRL  D +G   +  N  GV FV A   + +D +  F PS++L  
Sbjct  57    KDALSKALVPFYPMAGRLKKDNDGRIEIDCNGAGVLFVVADTPSVIDDLGEFAPSLTLRQ  116

Query  406   LHPSLK---GV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P +    GV  + L+ +QVT F CG   +G    H VADG S  +F+  W    R + 
Sbjct  117   LIPDVDYSVGVHTLPLLVLQVTFFKCGGASLGVGMQHHVADGFSGLHFINTWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   RNPP+  + HV  EY P    +       +    LDD  V     +
Sbjct  177   LTIPPFIDRTVLRARNPPQPAFHHV--EYQPSPTMRI-----PSSTQGLDDTTVSIFKIS  229

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              + L  LK K S  +G    YS++E L  H+WR++ KAR L   + T + +++DGR+RL 
Sbjct  230   RDMLVALKTK-SKQDGNTVSYSSYEVLAGHVWRSVCKARGLPDDQETKLYVAIDGRSRLR  288

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P++P  YFGN++  A P     DLL +P  YAA LIHD + ++++ Y+RS +D+   +  
Sbjct  289   PQLPPGYFGNVIFSATPLTFAGDLLSKPTWYAAVLIHDVIVRMDDKYLRSALDYLEMQ--  346

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW+R P YD DFG G P    P     EG+ FLLPS
Sbjct  347   PDLSALVRCASTYK---CPNLGITSWVRLPMYDADFGWGRPIFVGPGAIAYEGLSFLLPS  403

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  F++  Y +
Sbjct  404   PTNDGSLSLAISLQSEHMKLFEKFLYEI  431



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score =   235 bits (599),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 155/450 (34%), Positives = 232/450 (52%), Gaps = 29/450 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPL--SVFDKVSYDAQIAVIYAYRPPTPPN----S  219
             MK+ V+ +  ++P+        T  V L  S  D V  +     +Y YRP    N     
Sbjct  1     MKINVKDSTLVRPA------AATPMVSLWNSNIDLVVPNFHTPSVYFYRPTAADNFFDAG  54

Query  220   TIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSL  399
              ++  L +AL  +   AGRL  DE+G   +  N EGV FVEA  D  +D    F P++ L
Sbjct  55    VLKAALGRALVPFYPMAGRLKRDEDGRVEIDCNAEGVLFVEAESDGVVDDFGDFAPTLEL  114

Query  400   LNLHPSL---KGVVE--LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRD  564
               L P++   +G+    L+ +QVT F CG + +G    H VADG S  +F+  W    R 
Sbjct  115   RRLIPAVDYSQGISTYPLLVLQVTHFKCGGVSLGVGMQHHVADGFSGLHFINTWSDMARG  174

Query  565   VMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVH  744
             + +   P  DRT+   R+PP+ ++ H+  EY P    K    L S DA    +  V    
Sbjct  175   LDLTIPPFIDRTLLRARDPPQPQFKHI--EYQPAPAMKT---LASKDAE-APETAVSIFK  228

Query  745   FTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRAR  924
              T + L  LKAK S   G    YS++E L  H+WR++  AR L   + T + I+ DGR+R
Sbjct  229   LTRDQLNALKAK-SKEGGNTVTYSSYEMLAGHVWRSVCMARGLPEDQDTKLYIATDGRSR  287

Query  925   LNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSK  1104
             L P +P  YFGN++  A P A   DL  +P+ YAA  IHDA+++++N+Y+RS +D+   +
Sbjct  288   LQPPLPPGYFGNVIFTATPIAVSGDLTSKPVWYAASKIHDALARMDNDYLRSALDYL--E  345

Query  1105  VVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLL  1284
             +  +   LV  A   +   CPNL + SW+R P +D DFG G P    P     EG+ F+L
Sbjct  346   LQPDLKALVRGAHTFR---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVL  402

Query  1285  PSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             PS   DGS+   I L  +++  F+++ Y +
Sbjct  403   PSPTNDGSLSVAISLQAEHMKLFEKLLYDI  432



>emb|CBI83579.1| hydroxycinnamoyl transferase [Solenostemon scutellarioides]
Length=427

 Score =   234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 155/448 (35%), Positives = 230/448 (51%), Gaps = 30/448 (7%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK+ V  +  ++PS    P ++  +   S  D V  +     +Y YRP    N    + +
Sbjct  1     MKIHVRDSTLVRPS-AATPAVSLWN---SNVDLVVPNFHTPSVYFYRPSGADNFFDTAVM  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L +AL  +   AGRL  DE+G   +  N EGV FVEA  D T+D    F PS+ L  
Sbjct  57    KAALGRALVSFYPMAGRLKRDEDGRVEIDCNAEGVLFVEAESDGTVDDYGDFAPSLELRR  116

Query  406   LHPSL---KGVVE--LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++   +G+    L+ +QVT F CG + +G    H  ADG S  +F+  W    R + 
Sbjct  117   LIPAVDYSQGISAYPLLVLQVTFFKCGGVSLGVGMQHHAADGFSGLHFINTWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             I   P  DRT+   R+PP+ ++ HV  EY P    K      +         VV     T
Sbjct  177   ITLPPFIDRTLLSARDPPQPQFKHV--EYQPPPAMKTYEPAET---------VVSIFKLT  225

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              + L  LKAK S  +G    YS++E L  H+WR    AR L   + T + I+ DGR+RL 
Sbjct  226   KDQLTTLKAK-SKEDGNTTTYSSYEMLSGHVWRCTCLARGLPEEQETKLYIATDGRSRLQ  284

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P++P  YFGN++  A P A   DL  +P+ YAA  IHDA+++++N+Y+RS +DF   ++ 
Sbjct  285   PQLPPGYFGNVIFTATPLAVAGDLGSKPVWYAASKIHDALARMDNDYLRSALDFL--ELQ  342

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   +   CPNL + SW+R P +D DFG G P    P     EG+ F+LPS
Sbjct  343   PDLKALVRGAHTFR---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPS  399

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  F+++ Y +
Sbjct  400   PTNDGSLSVAISLQAEHMKLFEKLLYQI  427



>emb|CDO98242.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 152/448 (34%), Positives = 232/448 (52%), Gaps = 23/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK++V+ +  ++P+ E        ++  S  D V  +     +Y YRP    N      +
Sbjct  1     MKIEVKESTMVRPAQE----TPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L +AL  +   AGRL  DE+G   +  N EGV FVEA  D  +D    F P++ L  
Sbjct  57    KDALSRALVPFYPMAGRLKRDEDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRR  116

Query  406   LHPSL---KGVVE--LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++   +G+    L+ +QVT F CG + +G    H  ADG S  +F+ +W    R + 
Sbjct  117   LIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFINSWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R+PP+ ++ H+  EY P    K       +D+  + +  V     T
Sbjct  177   VTLPPFIDRTLLRARDPPQPQFQHI--EYQPPPALKVSPQTAKSDS--VPETAVSIFKLT  232

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              E ++ LKAK S  +G    YS++E L  H+WR   KAR L   + T + I+ DGRARL 
Sbjct  233   REQISALKAK-SKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLR  291

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P +P  YFGN++  A P A   DL  +P+ YAA  IHDA+++++N+Y+RS +D+   ++ 
Sbjct  292   PSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYL--ELQ  349

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW+R P +D DFG G P    P     EG+ F+LPS
Sbjct  350   PDLKALVRGAHTFK---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPS  406

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  F+   Y +
Sbjct  407   PTNDGSMSVAISLQGEHMKLFQSFLYDI  434



>gb|ABO47805.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   234 bits (597),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 152/448 (34%), Positives = 232/448 (52%), Gaps = 23/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK++V+ +  ++P+ E        ++  S  D V  +     +Y YRP    N      +
Sbjct  1     MKIEVKESTMVRPAQE----TPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L +AL  +   AGRL  DE+G   +  N EGV FVEA  D  +D    F P++ L  
Sbjct  57    KDALSRALVPFYPMAGRLKRDEDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRR  116

Query  406   LHPSL---KGVVE--LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++   +G+    L+ +QVT F CG + +G    H  ADG S  +F+ +W    R + 
Sbjct  117   LIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMRHHAADGFSGLHFINSWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R+PP+ ++ H+  EY P    K       +D+  + +  V     T
Sbjct  177   VTLPPFIDRTLLRARDPPQPQFQHI--EYQPPPALKVSPQTAKSDS--VPETAVSIFKLT  232

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              E ++ LKAK S  +G    YS++E L  H+WR   KAR L   + T + I+ DGRARL 
Sbjct  233   REQISALKAK-SKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLR  291

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P +P  YFGN++  A P A   DL  +P+ YAA  IHDA+++++N+Y+RS +D+   ++ 
Sbjct  292   PSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYL--ELQ  349

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW+R P +D DFG G P    P     EG+ F+LPS
Sbjct  350   PDLKALVRGAHTFK---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPS  406

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  F+   Y +
Sbjct  407   PTNDGSMSVAISLQGEHMKLFQSFLYDI  434



>ref|XP_004158793.1| PREDICTED: LOW QUALITY PROTEIN: shikimate O-hydroxycinnamoyltransferase-like 
[Cucumis sativus]
Length=430

 Score =   234 bits (597),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 160/443 (36%), Positives = 225/443 (51%), Gaps = 29/443 (7%)
 Frame = +1

Query  85    TIKPSYEGNPPLTTTHVPL--SVFDKVSYDAQIAVIYAYRPPTPPN----STIELGLRKA  246
             TIK S    P   T H  L  S  D V        +Y YRP    N      ++ GL KA
Sbjct  4     TIKDSTMVTPAEETPHRSLWNSNVDLVVPSMHTPSVYFYRPTGDSNFFDAEVLKEGLSKA  63

Query  247   LGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSL--  420
             L  +   AGRL  DE+G   +  N EGV  VEA     +D    F P++ L  L P++  
Sbjct  64    LVPFYPMAGRLRRDEDGRIEIYCNAEGVLLVEAETTAVIDDFGDFAPTLQLRQLIPAVDY  123

Query  421   KGVVE---LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR--DVMIQPLP  585
              G +E   L+ +QVT F CG + +G    H VADG+S  +F+  W    R  D+M+QP  
Sbjct  124   SGGIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGYSGLHFVNTWSDMSRGLDLMLQPY-  182

Query  586   LRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLA  765
               DRT+   R+PP+  + HV  EY P    KN    +    T      V    FT E L 
Sbjct  183   -IDRTLLRARDPPQPAFRHV--EYQPAPPMKNPVQADPEGTT------VSIFKFTREQLN  233

Query  766   KLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPN  945
              LKAK S  NG    YS++E L  H+WR+  KAR L   + T + I+ DGRARL P +PN
Sbjct  234   LLKAK-SKENGNTINYSSYEMLSGHVWRSTCKARELPEDQDTKVYIATDGRARLRPPLPN  292

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG  1125
              YFGN++    P A   +L+  P  +AA  IHDA+++++N+Y+RS +D+   ++      
Sbjct  293   GYFGNVIFTTTPLAVAGELMSNPTWFAASKIHDALTRMDNDYLRSALDYL--EIQPNISA  350

Query  1126  LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDG  1305
             LV  A   +   CPNL + SW+R P +D DFG G P    P     EG+ F++PS   DG
Sbjct  351   LVRGAHTFR---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSASDDG  407

Query  1306  SIDAFIPLFQDNLPTFKQICYSL  1374
             S+   I L   ++  F+++ + +
Sbjct  408   SLSVAISLQNRHMKVFEKLFFDI  430



>pdb|4G0B|A Chain A, Structure Of Native Hct From Coffea Canephora
 pdb|4G0B|B Chain B, Structure Of Native Hct From Coffea Canephora
Length=436

 Score =   234 bits (597),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 152/449 (34%), Positives = 232/449 (52%), Gaps = 23/449 (5%)
 Frame = +1

Query  55    TMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----ST  222
              MK++V+ +  ++P+ E        ++  S  D V  +     +Y YRP    N      
Sbjct  2     AMKIEVKESTMVRPAQE----TPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKV  57

Query  223   IELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLL  402
             ++  L +AL  +   AGRL  DE+G   +  N EGV FVEA  D  +D    F P++ L 
Sbjct  58    LKDALSRALVPFYPMAGRLKRDEDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELR  117

Query  403   NLHPSL---KGVVE--LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV  567
              L P++   +G+    L+ +QVT F CG + +G    H  ADG S  +F+ +W    R +
Sbjct  118   RLIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMRHHAADGFSGLHFINSWSDMARGL  177

Query  568   MIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHF  747
              +   P  DRT+   R+PP+ ++ H+  EY P    K       +D+  + +  V     
Sbjct  178   DVTLPPFIDRTLLRARDPPQPQFQHI--EYQPPPALKVSPQTAKSDS--VPETAVSIFKL  233

Query  748   TLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARL  927
             T E ++ LKAK S  +G    YS++E L  H+WR   KAR L   + T + I+ DGRARL
Sbjct  234   TREQISALKAK-SKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARL  292

Query  928   NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKV  1107
              P +P  YFGN++  A P A   DL  +P+ YAA  IHDA+++++N+Y+RS +D+   ++
Sbjct  293   RPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYL--EL  350

Query  1108  VAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLP  1287
               +   LV  A   K   CPNL + SW+R P +D DFG G P    P     EG+ F+LP
Sbjct  351   QPDLKALVRGAHTFK---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILP  407

Query  1288  SFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             S   DGS+   I L  +++  F+   Y +
Sbjct  408   SPTNDGSMSVAISLQGEHMKLFQSFLYDI  436



>ref|XP_004135880.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
 gb|KGN45212.1| hypothetical protein Csa_7G431440 [Cucumis sativus]
Length=430

 Score =   234 bits (596),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 160/443 (36%), Positives = 225/443 (51%), Gaps = 29/443 (7%)
 Frame = +1

Query  85    TIKPSYEGNPPLTTTHVPL--SVFDKVSYDAQIAVIYAYRPPTPPN----STIELGLRKA  246
             TIK S    P   T H  L  S  D V        +Y YRP    N      ++ GL KA
Sbjct  4     TIKDSTMVTPAEETPHRSLWNSNVDLVVPSMHTPSVYFYRPTGDSNFFDAEVLKEGLSKA  63

Query  247   LGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSL--  420
             L  +   AGRL  DE+G   +  N EGV  VEA     +D    F P++ L  L P++  
Sbjct  64    LVPFYPMAGRLRRDEDGRIEIYCNAEGVLLVEAETTAVIDDFGDFAPTLQLRQLIPAVDY  123

Query  421   KGVVE---LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR--DVMIQPLP  585
              G +E   L+ +QVT F CG + +G    H VADG+S  +F+  W    R  D+M+QP  
Sbjct  124   SGGIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGYSGLHFVNTWSDMSRGLDLMLQPY-  182

Query  586   LRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLA  765
               DRT+   R+PP+  + HV  EY P    KN    +    T      V    FT E L 
Sbjct  183   -IDRTLLRARDPPQPAFRHV--EYQPAPPMKNPVQADPEGTT------VSIFKFTREQLN  233

Query  766   KLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPN  945
              LKAK S  NG    YS++E L  H+WR+  KAR L   + T + I+ DGRARL P +PN
Sbjct  234   LLKAK-SKENGNTINYSSYEMLSGHVWRSTCKARELPEDQDTKLYIATDGRARLRPPLPN  292

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG  1125
              YFGN++    P A   +L+  P  +AA  IHDA+++++N+Y+RS +D+   ++      
Sbjct  293   GYFGNVIFTTTPLAVAGELMSNPTWFAASKIHDALTRMDNDYLRSALDYL--EIQPNISA  350

Query  1126  LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDG  1305
             LV  A   +   CPNL + SW+R P +D DFG G P    P     EG+ F++PS   DG
Sbjct  351   LVRGAHTFR---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSASDDG  407

Query  1306  SIDAFIPLFQDNLPTFKQICYSL  1374
             S+   I L   ++  F+++ + +
Sbjct  408   SLSVAISLQNRHMKVFEKLFFDI  430



>gb|AEM63675.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Platycodon grandiflorus]
Length=434

 Score =   234 bits (596),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 155/448 (35%), Positives = 224/448 (50%), Gaps = 23/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK++V  +  +KP+ E   P+ T     S  D V  +     +Y YRP    N      +
Sbjct  1     MKIEVRESTMVKPAEET--PIKTLWN--SNVDLVVPNFHTPSVYFYRPNGSANFFDAKVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L + L  +    GRL  DE+G   +  N EGV FVEA  D  +D    F P++ L  
Sbjct  57    KDALSQILVPFYPMGGRLKRDEDGRIEIDCNGEGVLFVEAETDGVVDDFGDFAPTLELRK  116

Query  406   LHPSLKGVVE-----LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L PS+   +E     L+ +QVT F CG + +G    H VADG S  +F+  W    R + 
Sbjct  117   LIPSVDYSLEISAIPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R+PP+  + H+  EY P    K    L   +A  + +  +     T
Sbjct  177   VTLPPFIDRTLLRARDPPQPAFPHI--EYQPAPTMKAP--LEPANAQSVPETEISIFKLT  232

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              E L  LKAK S  +G    YS++E L  H+WR + KAR L   + T + I+ DGR+RL 
Sbjct  233   REQLNALKAK-SKEDGNTVSYSSYEMLSGHVWRCVCKARGLPDDQDTKLYIATDGRSRLQ  291

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P +P  YFGN++    PTA   DL  +P  YAA  IHDA+ +++N Y+RS +D+   ++ 
Sbjct  292   PVLPPGYFGNVIFTTTPTAVAGDLTSKPTWYAASRIHDALGRMDNEYLRSALDYL--ELQ  349

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW R P +D DFG G P    P     EG+ F+LPS
Sbjct  350   PDLKALVRGAHTFK---CPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFVLPS  406

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  F +  Y +
Sbjct  407   TTNDGSLSIAISLQAEHMKLFSKFLYDI  434



>ref|XP_010479238.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=428

 Score =   233 bits (595),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 154/454 (34%), Positives = 227/454 (50%), Gaps = 41/454 (9%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLT---TTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----  216
             MK+ +  +  ++P+ E   P+T    +HV     D +        +Y YRP    N    
Sbjct  1     MKINIRDSTIVRPAAE--TPVTKLWNSHV-----DLIDAKYHTPTVYFYRPTGANNFFDP  53

Query  217   STIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVS  396
               ++  L KAL  +   AGRL  D++G   +  N  GV FV A   + +D +  F PS++
Sbjct  54    QVLKDALSKALVTFYPMAGRLKKDDDGRIEIDCNGAGVLFVVADTPSAIDDLGDFAPSLT  113

Query  397   LLNLHPSLK---GV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR  561
             L  L P++    GV  + L+ +QVT F CG   +G    H VADG S  +F+  W    R
Sbjct  114   LCQLIPNVDYSVGVQTLPLLVLQVTFFKCGGASLGVGMQHHVADGSSALHFINTWSDMAR  173

Query  562   DVMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPK---QIKKNDHFLNSNDATFLDDIVV  732
              + +   P  DRT+   R+PP++ + HV  EY P      K   H           D  V
Sbjct  174   GLDLTIPPFIDRTLLRARDPPQLAFHHV--EYQPSPDXSSKPGPH-----------DTTV  220

Query  733   HKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVD  912
                  + E L  LKAK S  +G    YS++E L  H+WRA+ KAR L   + T + I++D
Sbjct  221   SIFKISRELLLALKAK-SNQDGNTVSYSSYEVLAGHVWRAVGKARGLPDDQETKLYIAID  279

Query  913   GRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDF  1092
             GR+RL P++P  YFGN+V  A P     DL+ +P  YAA +IHD + ++++ Y+RS +D+
Sbjct  280   GRSRLRPQLPPGYFGNVVFTATPLTVAGDLVSKPTWYAAGMIHDVIVRMDDEYLRSALDY  339

Query  1093  ANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGM  1272
                +   +   LV  A   K   CPNL + SW + P YD DFG G P    P     EG+
Sbjct  340   LEMQ--PDLSALVRGAHTYK---CPNLGITSWAKLPIYDADFGWGRPLFMGPGAIAFEGL  394

Query  1273  MFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
              FLLPS   DGS+   I L  +++  F++  Y +
Sbjct  395   SFLLPSPTDDGSLSLAISLQSEHMKLFEKFLYEI  428



>emb|CAJ40778.1| hydroxycinnamoyl transferase [Coffea arabica]
Length=434

 Score =   233 bits (595),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 151/448 (34%), Positives = 231/448 (52%), Gaps = 23/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK++V+ +  ++P+ E        ++  S  D V  +     +Y YRP    N      +
Sbjct  1     MKIEVKESTMVRPAQE----TPRRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L +AL  +   AGRL  DE+G   +  N EGV FVEA  D  +D    F P++ L  
Sbjct  57    KDALSRALVPFYPMAGRLKRDEDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRR  116

Query  406   LHPSL---KGVVE--LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++   +G+    L+ +QVT F CG + +G    H  ADG S  +F+ +W    R + 
Sbjct  117   LIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFINSWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R+PP+ ++ H+  EY P    K       +D+  + +  V     T
Sbjct  177   VTLPPFIDRTLLRARDPPQPQFQHI--EYQPPPTLKVSPQTAKSDS--VPETAVSIFKLT  232

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              E ++ LKAK    +G    YS++E L  H+WR   KAR L   + T + I+ DGRARL 
Sbjct  233   REQISALKAKPKE-DGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLR  291

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P +P  YFGN++  A P A   DL  +P+ YAA  IHDA+++++N+Y+RS +D+   ++ 
Sbjct  292   PSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYL--ELQ  349

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW+R P +D DFG G P    P     EG+ F+LPS
Sbjct  350   PDLKALVRGAHTFK---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPS  406

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  F+   Y +
Sbjct  407   PTNDGSMSVAISLQGEHMKLFQSFLYDI  434



>gb|AEJ88365.1| hydroxycinnamoyltransferase [Cucumis sativus]
Length=430

 Score =   233 bits (595),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 159/443 (36%), Positives = 225/443 (51%), Gaps = 29/443 (7%)
 Frame = +1

Query  85    TIKPSYEGNPPLTTTHVPL--SVFDKVSYDAQIAVIYAYRPPTPPN----STIELGLRKA  246
             T+K S    P   T H  L  S  D V        +Y YRP    N      ++ GL KA
Sbjct  4     TVKDSTMVTPAEETPHKSLWNSNVDLVVPSMHTPSVYFYRPTGDSNFFDAEVLKEGLSKA  63

Query  247   LGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLNLHPSL--  420
             L  +   AGRL  DE+G   +  N EGV  VEA     +D    F P++ L  L P++  
Sbjct  64    LVPFYPMAGRLRRDEDGRIEIYCNAEGVLLVEAETTAVIDDFGDFAPTLQLRQLIPAVDY  123

Query  421   KGVVE---LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR--DVMIQPLP  585
              G +E   L+ +QVT F CG + +G    H VADG+S  +F+  W    R  D+M+QP  
Sbjct  124   SGGIESYPLLVLQVTYFKCGGVSLGVGMQHHVADGYSGLHFVNTWSDMSRGLDLMLQPY-  182

Query  586   LRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFTLEFLA  765
               DRT+   R+PP+  + HV  EY P    KN    +    T      V    FT E L 
Sbjct  183   -IDRTLLRARDPPQPAFRHV--EYQPAPPMKNPVQADPEGTT------VSIFKFTREQLN  233

Query  766   KLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLNPKVPN  945
              LKAK S  NG    YS++E L  H+WR+  KAR L   + T + I+ DGRARL P +PN
Sbjct  234   LLKAK-SKENGNTINYSSYEMLSGHVWRSTCKARELPEDQDTKLYIATDGRARLRPPLPN  292

Query  946   DYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVVAEEDG  1125
              YFGN++    P A   +L+  P  +AA  IHDA+++++N+Y+RS +D+   ++      
Sbjct  293   GYFGNVIFTTTPLAVAGELMSNPTWFAASKIHDALTRMDNDYLRSALDYL--EIQPNISA  350

Query  1126  LVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPSFIGDG  1305
             LV  A   +   CPNL + SW+R P +D DFG G P    P     EG+ F++PS   DG
Sbjct  351   LVRGAHTFR---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSASDDG  407

Query  1306  SIDAFIPLFQDNLPTFKQICYSL  1374
             S+   I L   ++  F+++ + +
Sbjct  408   SLSVAISLQNRHMKVFEKLFFDI  430



>ref|XP_007023475.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 ref|XP_007023476.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26097.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26098.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
Length=431

 Score =   233 bits (594),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 144/406 (35%), Positives = 209/406 (51%), Gaps = 22/406 (5%)
 Frame = +1

Query  184   IYAYRPPTPPN----STIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASG  351
             +Y YRP    N      ++  L KAL  +    GRL  DE+G   +  N EGV  VEA  
Sbjct  39    VYFYRPTGASNFFDPQVMKEALSKALVPFYPMGGRLKRDEDGRIEIDCNGEGVLLVEAET  98

Query  352   DTTLDKVMPFKPSVSLLNLHPSLK-----GVVELVQVQVTRFTCGSLVVGFTAHHLVADG  516
             ++ +D    F P++ L  L P++      G   L+ +QVT F CG   +G    H  ADG
Sbjct  99    NSVIDDFGDFAPTLELRQLIPTVDYSGGIGTYPLLVLQVTYFKCGGASLGVGMQHHAADG  158

Query  517   HSTSNFLVAWGKACRDVMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLN  696
              S  +F+  W    R + +   P  DRT+   R+PP+  + H+  EY P           
Sbjct  159   FSGLHFINTWSDMARGLDLTIPPFIDRTLLRARDPPQPVFHHI--EYQPPPAMNT-----  211

Query  697   SNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLG  876
                +T  +   V     T E L  LKAK S  +G    YS++E L  H+WR++ KAR L 
Sbjct  212   PPQSTGPESTAVSIFKLTREQLNALKAK-SKEDGNTVNYSSYEMLSGHVWRSVCKARGLA  270

Query  877   GFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSK  1056
             G + T + I+ DGRARL P +P  YFGN++  A P A   DLL +P  YAA  IHDA+++
Sbjct  271   GDQGTKLYIATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLSKPTWYAAGTIHDALAR  330

Query  1057  VNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPY  1236
             ++++Y+RS +D+   ++  +   LV  A   K   CPNL + SW R P +D DFG G P 
Sbjct  331   MDDDYLRSALDYL--ELQPDLSALVRGAHTFK---CPNLGITSWARLPIHDADFGWGRPI  385

Query  1237  IFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                P   P EG+ F+LPS   DGS+   I L  +++  F+++ Y +
Sbjct  386   FMGPGGIPYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLIYDI  431



>emb|CDG56248.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 1 
[Glechoma hederacea]
Length=434

 Score =   233 bits (594),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 153/451 (34%), Positives = 231/451 (51%), Gaps = 29/451 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRP-------PTPPN  216
             MK++V  +  ++PS    P ++  +   S  D V  +     +Y YRP            
Sbjct  1     MKIEVRDSTLVRPS-AATPAVSLWN---SNVDLVVPNFHTPSVYFYRPDGGAAAADFFDT  56

Query  217   STIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVS  396
             + ++  L  AL  +   AGRL  DE+G   +  N EGV FVEA  D ++D    F P++ 
Sbjct  57    AVMKAALGLALVPFYPMAGRLKRDEDGRVEIDCNAEGVLFVEAESDGSVDDYGDFAPNLE  116

Query  397   LLNLHPSL---KGV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACR  561
             L  L P++   +G+    L+ +QVT+F CG + +G    H VADG S  +F+  W    R
Sbjct  117   LRRLIPAVDYSQGISTYALLVLQVTKFKCGGVSLGVGMQHHVADGFSGLHFINTWSDMAR  176

Query  562   DVMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKV  741
              + I   P  DRT+   R+PP+ ++ H+  EY P    K           +  + VV   
Sbjct  177   GLDITLPPFIDRTLLRARDPPQPQFKHI--EYQPAPAMKT-----YGAGHYATETVVSIF  229

Query  742   HFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRA  921
               T E L  LKAK S  +G    YS++E L  H+WR    AR+L   + T + I+ DGRA
Sbjct  230   KLTREQLTTLKAK-SKEDGNTVTYSSYEMLAGHVWRCACLARSLPEDQDTKLYIATDGRA  288

Query  922   RLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANS  1101
             RL P +P  YFGN++  A P A   DL  +P+ YAA  IHDA+++++N Y+RS +D+   
Sbjct  289   RLQPPLPQGYFGNVIFTATPLAVAGDLESKPVWYAASKIHDALARMDNEYLRSALDYL--  346

Query  1102  KVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFL  1281
             ++  +   LV  A   +   CPNL + SW+R P +D DFG G P    P     EG+ F+
Sbjct  347   ELQPDLKALVRGAHTFR---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFV  403

Query  1282  LPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             LPS   DGS+   I L  +++  F+++ Y +
Sbjct  404   LPSPANDGSLSVAISLQAEHMKLFEKLLYDI  434



>ref|XP_010500344.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   233 bits (594),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 153/448 (34%), Positives = 226/448 (50%), Gaps = 26/448 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK+ +     ++P+ E       T++  S  D +        +Y YRP    N      +
Sbjct  1     MKINIRDFTIVRPAAE----TPVTNLWNSHVDLIIAKYHTPSVYFYRPTGASNFFDPQVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L KAL  +   AGRL  D++G   +  ND GV FV A   + +D +  F PS++L  
Sbjct  57    KDALSKALVPFYPMAGRLKKDDDGRIEIDCNDAGVLFVVADTLSVIDDLGDFAPSLTLRQ  116

Query  406   LHPSLK---GV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P +    GV  + L+ VQVT F CG   +G    H VADG S  +F+ AW    R + 
Sbjct  117   LIPDVDYSVGVHTLPLLVVQVTFFKCGGASLGVGMQHHVADGFSGLHFINAWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R+PP+  +DHV  EY P    +       +     DD  V     +
Sbjct  177   LTIPPFIDRTLLRARDPPQPAFDHV--EYQPSPSIRI-----PSSKPGPDDNTVSIFKIS  229

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              + L  LK K S  +G    YS++E L  H+WR++ KAR L   + T + +++DGR+RL 
Sbjct  230   RDLLLALKGK-SKQDGNTVSYSSYEVLAGHVWRSVCKARGLPDDQETKLYVAIDGRSRLC  288

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P++P  YFGN++  A P     DLL +P  YAA  IHD + ++++NY+RS +D+   +  
Sbjct  289   PQLPPGYFGNVIFSATPLTLAGDLLSKPTWYAAGKIHDVIVRMDDNYLRSALDYLEMQ--  346

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW+R P YD DFG G P    P     EG+ FLLPS
Sbjct  347   PDLSALVRCASTYK---CPNLGITSWVRLPMYDADFGWGRPIFVGPGAIAYEGLSFLLPS  403

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  F++  Y +
Sbjct  404   PTNDGSLSLAIALQSEHMKLFEKFLYDI  431



>ref|XP_010034043.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=492

 Score =   234 bits (598),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 153/449 (34%), Positives = 228/449 (51%), Gaps = 25/449 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPL-SVFDKVSYDAQIAVIYAYRPPTPPN----ST  222
             M V V  +  ++P+ E     T  H    S  D V        +Y YRP   P+      
Sbjct  59    MIVSVRESTMVRPAGE-----TRIHALWNSNVDLVVPSMHTPSVYFYRPNGSPDFFDPKV  113

Query  223   IELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLL  402
             ++ GL KAL  +   AGRL  DE+G   +  N EGV FVEA   + +D    F P++ L 
Sbjct  114   LKEGLSKALVPFYPMAGRLRRDEDGRIEIDCNAEGVLFVEAETSSAVDDFGDFAPTLELR  173

Query  403   NLHPSLK-----GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV  567
              L P++          L+ +QVT F CG + +G    H VADG S  +F+  W    R +
Sbjct  174   KLIPAVDYSAGLSTYPLLVLQVTYFKCGGVSLGVGMQHHVADGFSGLHFVNTWSDMARGL  233

Query  568   MIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHF  747
              +   P  DRT+   R+PP+ ++ H+  EY P    K    L+    +  +   V     
Sbjct  234   DLTTPPFIDRTLLRARDPPQPQFKHI--EYQPPPALKAP--LSQTTKSGAESTAVSIFKM  289

Query  748   TLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARL  927
             T E L KLK K S  +G    YS++E L  H+WR+  KAR+L   + + + I+ DGR+RL
Sbjct  290   TREQLNKLKGK-SKEDGNTVNYSSYEMLAGHVWRSACKARDLAVDQESKMYIATDGRSRL  348

Query  928   NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKV  1107
             +P +P  YFGN++  A P A   DL  +P  YAA  IHDA+ +++N+Y+RS +D+   ++
Sbjct  349   SPPLPPGYFGNVIFTATPLAVAGDLQSKPTWYAASRIHDALVRMDNDYLRSALDYL--EL  406

Query  1108  VAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLP  1287
               +   LV  A   +   CPNL + SW+R P +D DFG G P    P     EG+ F+LP
Sbjct  407   QPDLSALVRGAHTFR---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILP  463

Query  1288  SFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             S   DGS+   I L  +++  F+++ Y +
Sbjct  464   SPTNDGSMSVAISLQTEHMKVFEKLLYEI  492



>emb|CDY31956.1| BnaA07g00390D [Brassica napus]
Length=433

 Score =   233 bits (593),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 152/448 (34%), Positives = 228/448 (51%), Gaps = 24/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK+ +  +  ++P+ E      +T++  S  D V        +Y YRP    N      +
Sbjct  1     MKINIRDSTMVRPAGE----TPSTYLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPGVM  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L KAL  +   AGRL  D++G   +  N  GV FV A   + +D    F P++ L  
Sbjct  57    KEALAKALVPFYPMAGRLKRDDDGRIEIDCNAAGVLFVVADTPSLIDDFGDFAPTLDLRQ  116

Query  406   LHPSLK---GV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P +    G+    L+ +QVT F CG   +G    H  ADG S  +F+  W    R + 
Sbjct  117   LIPDVDHSPGIHSFPLLVLQVTYFKCGGASLGVGMQHHAADGFSGLHFINTWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R+PP+  +DHV  +  P      D   +S D+T      V     +
Sbjct  177   LTIPPFIDRTLLRARDPPQPAFDHVEYQPAPSMKIPLDPSKSSPDST-----TVSIFKLS  231

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              + L  LKAKA   +G    YS++E L  H+WR++ KAR L   + T + I+ DGR+RL 
Sbjct  232   RDQLVSLKAKAKE-DGNTVSYSSYEMLAGHVWRSVGKARGLPDDQETKLYIATDGRSRLR  290

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P++P  YFGN++  A P A   DLL +P  YAA LIHD ++++++NY+RS +D+   ++ 
Sbjct  291   PQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGLIHDVLARMDDNYLRSALDYL--EMQ  348

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW+R P YD DFG G P    P   P EG+ F+LPS
Sbjct  349   PDLSALVRGAHTYK---CPNLGITSWVRLPIYDADFGWGRPIFMGPGGIPYEGLSFVLPS  405

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  F++  Y +
Sbjct  406   PTNDGSLSVAIALQTEHMKLFEKYLYEI  433



>ref|XP_004507045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Cicer arietinum]
Length=449

 Score =   233 bits (595),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 154/453 (34%), Positives = 226/453 (50%), Gaps = 21/453 (5%)
 Frame = +1

Query  43    VEKKTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN--  216
             ++K  M + V  +  ++PS E    +T   V  S  D V  +     +Y YR  +  N  
Sbjct  9     LKKIEMIINVRDSTMVRPSDE----VTRRTVWNSNVDLVVPNFHTPSVYFYRTNSASNFF  64

Query  217   --STIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPS  390
                 I+  L K L  +   AGRL  DE+G   +  N +GV F+EA     +D    F P+
Sbjct  65    DAKIIKEALSKVLVPFYPMAGRLRRDEDGRVEIDCNGQGVLFIEADTGVVIDDFGDFAPT  124

Query  391   VSLLNLHPSL---KGV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKA  555
             + L  L P++   +G+    L+ +QVT F CG + +G    H VADG S  +F+  W   
Sbjct  125   LKLRQLIPAVDYSQGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDV  184

Query  556   CRDVMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVH  735
              R + +   P  DRT+   R+PPR  ++H+  EY P    K         A       V 
Sbjct  185   ARGLDVSIPPFIDRTLLRARDPPRPVFEHI--EYKPPPSMKTSPHNQPTKADSEATAAVS  242

Query  736   KVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDG  915
                 T E L  LKAK S   G    YS++E L  H+WR++ KAR+L   + T + I+ DG
Sbjct  243   IFKLTREQLVTLKAK-SKEAGNTINYSSYEMLAGHVWRSVCKARSLPDDQETKLYIATDG  301

Query  916   RARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFA  1095
             RARL P  P  YFGN++    P A   DL+ +P  YAA  IH+A+S+++N Y+RS +D+ 
Sbjct  302   RARLQPPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHNALSRMDNEYLRSALDYL  361

Query  1096  NSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMM  1275
               ++  +   LV  A   K   CPNL + SW R P +D DFG G P    P     EG+ 
Sbjct  362   --ELQPDLKALVRGAHTFK---CPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLS  416

Query  1276  FLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             F++PS   DGS+   I L  +++  FK++ Y +
Sbjct  417   FIIPSSTNDGSLSVAIALQHEHMKVFKELLYDI  449



>gb|KCW53914.1| hypothetical protein EUGRSUZ_J03126 [Eucalyptus grandis]
Length=497

 Score =   234 bits (598),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 153/449 (34%), Positives = 228/449 (51%), Gaps = 25/449 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPL-SVFDKVSYDAQIAVIYAYRPPTPPN----ST  222
             M V V  +  ++P+ E     T  H    S  D V        +Y YRP   P+      
Sbjct  64    MIVSVRESTMVRPAGE-----TRIHALWNSNVDLVVPSMHTPSVYFYRPNGSPDFFDPKV  118

Query  223   IELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLL  402
             ++ GL KAL  +   AGRL  DE+G   +  N EGV FVEA   + +D    F P++ L 
Sbjct  119   LKEGLSKALVPFYPMAGRLRRDEDGRIEIDCNAEGVLFVEAETSSAVDDFGDFAPTLELR  178

Query  403   NLHPSLK-----GVVELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDV  567
              L P++          L+ +QVT F CG + +G    H VADG S  +F+  W    R +
Sbjct  179   KLIPAVDYSAGLSTYPLLVLQVTYFKCGGVSLGVGMQHHVADGFSGLHFVNTWSDMARGL  238

Query  568   MIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHF  747
              +   P  DRT+   R+PP+ ++ H+  EY P    K    L+    +  +   V     
Sbjct  239   DLTTPPFIDRTLLRARDPPQPQFKHI--EYQPPPALKAP--LSQTTKSGAESTAVSIFKM  294

Query  748   TLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARL  927
             T E L KLK K S  +G    YS++E L  H+WR+  KAR+L   + + + I+ DGR+RL
Sbjct  295   TREQLNKLKGK-SKEDGNTVNYSSYEMLAGHVWRSACKARDLAVDQESKMYIATDGRSRL  353

Query  928   NPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKV  1107
             +P +P  YFGN++  A P A   DL  +P  YAA  IHDA+ +++N+Y+RS +D+   ++
Sbjct  354   SPPLPPGYFGNVIFTATPLAVAGDLQSKPTWYAASRIHDALVRMDNDYLRSALDYL--EL  411

Query  1108  VAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLP  1287
               +   LV  A   +   CPNL + SW+R P +D DFG G P    P     EG+ F+LP
Sbjct  412   QPDLSALVRGAHTFR---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILP  468

Query  1288  SFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
             S   DGS+   I L  +++  F+++ Y +
Sbjct  469   SPTNDGSMSVAISLQTEHMKVFEKLLYEI  497



>gb|ABO77955.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 151/448 (34%), Positives = 231/448 (52%), Gaps = 23/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK++V+ +  ++P+ E        ++  S  D V  +     +Y YRP    N      +
Sbjct  1     MKIEVKESTMVRPAQE----TPGRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L +AL  +   AGRL  DE+G   +  N EGV FVEA  D  +D    F P++    
Sbjct  57    KDALSRALVPFYPMAGRLKRDEDGQIEIECNGEGVLFVEAESDGVVDDFGDFAPTLEHRR  116

Query  406   LHPSL---KGVVE--LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++   +G+    L+ +QVT F CG + +G    H  ADG S  +F+ +W    R + 
Sbjct  117   LIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFINSWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R+PP+ ++ H+  EY P    K       +D+  + +  V     T
Sbjct  177   VTLPPFIDRTLLRARDPPQPQFQHI--EYQPPPALKVSPQTAKSDS--VPETAVSIFKLT  232

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              E ++ LKAK S  +G    YS++E L  H+WR   KAR L   + T + I+ DGRARL 
Sbjct  233   REQISALKAK-SKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLR  291

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P +P  YFGN++  A P A   DL  +P+ YAA  IHDA+++++N+Y+RS +D+   ++ 
Sbjct  292   PSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYL--ELQ  349

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW+R P +D DFG G P    P     EG+ F+LPS
Sbjct  350   PDLKALVRGAHTFK---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPS  406

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  F+   Y +
Sbjct  407   PTNDGSMSVAISLQGEHMKLFQSFLYDI  434



>ref|XP_004235891.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum lycopersicum]
Length=435

 Score =   232 bits (592),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 153/448 (34%), Positives = 231/448 (52%), Gaps = 22/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK++V+++  ++P+ E  P L   +   S  D V  +     +Y YRP   PN      +
Sbjct  1     MKIEVKNSTMVQPATE-TPQLRLWN---SNVDLVVPNFHTPSVYFYRPTGSPNFFDGKVV  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L KAL  +   AGRL  DE+G   +    +GV FVEA  D  +D    F P++ L  
Sbjct  57    KEALSKALVPFYPMAGRLCRDEDGRIEIDCKGQGVLFVEAESDGVVDDFGDFAPTLELRR  116

Query  406   LHPSL---KGV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++   +G+    L+ +Q+T+F CG + +G    H  ADG S  +F+  W    R + 
Sbjct  117   LIPAVDYSQGIESYALLVLQITQFKCGGVSLGVGMQHHAADGASGLHFINTWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R+PP+ ++ HV  EY P    K     N  +A  + +  V     T
Sbjct  177   LTIPPFIDRTLLRARDPPQPQFPHV--EYQPPPTLKTTE-ENVPNAETVPETSVSIFKLT  233

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              + +  LKAK S  +G    YS++E L  H+WR+   AR L   + T + I+ DGRARL 
Sbjct  234   RDQINTLKAK-SKEDGNTVNYSSYEMLAGHVWRSTCMARGLTQDQETKLYIATDGRARLR  292

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P +P  YFGN++  A P A   DL  +P+ YAA  IHD ++ ++N+Y+RS +D+   ++ 
Sbjct  293   PSLPPGYFGNVIFTATPVAVAGDLQSKPIWYAASKIHDQLAIMDNDYLRSALDYL--ELQ  350

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW R P +D DFG G P    P     EG+ F+LPS
Sbjct  351   PDLKALVRGAHTFK---CPNLGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPS  407

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
              I DGS    I L  +++  F++  Y +
Sbjct  408   PINDGSQSVAISLQAEHMKLFEKFLYDI  435



>gb|ABO40491.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=434

 Score =   232 bits (592),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 151/448 (34%), Positives = 232/448 (52%), Gaps = 23/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK++V+ +  ++P++E        ++  S  D V  +     +Y YRP    N      +
Sbjct  1     MKIEVKESTMVRPAHE----TPRRNLWNSNVDLVVPNFHTPSVYFYRPTGSSNFFDAKVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L +AL  +   AGRL  DE+G   +  N EGV FVEA  D  +D    F P++ L  
Sbjct  57    KDALSRALVPFYPMAGRLKRDEDGRIEIECNGEGVLFVEAESDGVVDDFGDFAPTLELRR  116

Query  406   LHPSL---KGVVE--LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++   +G+    L+ +QVT F CG + +G    H  ADG S  +F+ +W    R + 
Sbjct  117   LIPAVDYSQGISSYALLVLQVTYFKCGGVSLGVGMQHHAADGFSGLHFINSWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R+PP+ ++ H+  EY P    K       +D+  + +  V     T
Sbjct  177   VTLPPFIDRTLLRARDPPQPQFQHI--EYQPPPTLKVSPQTAKSDS--VPETAVSIFKLT  232

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              E ++ LKAK S  +G    YS++E L  H+WR   KAR L   + T + I+ DGRARL 
Sbjct  233   REQISALKAK-SKEDGNTISYSSYEMLAGHVWRCACKARGLEVDQGTKLYIATDGRARLR  291

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P +P  YFGN++  A   A   DL  +P+ YAA  IHDA+++++N+Y+RS +D+   ++ 
Sbjct  292   PSLPPGYFGNVIFTATLIAIAGDLEFKPVWYAASKIHDALARMDNDYLRSALDYL--ELQ  349

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW+R P +D DFG G P    P     EG+ F+LPS
Sbjct  350   PDLKALVRGAHTFK---CPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFILPS  406

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  F+   Y +
Sbjct  407   PTNDGSMSVAISLQGEHMKLFQSFLYDI  434



>ref|XP_004507046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Cicer arietinum]
Length=436

 Score =   232 bits (591),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 153/448 (34%), Positives = 223/448 (50%), Gaps = 21/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             M + V  +  ++PS E    +T   V  S  D V  +     +Y YR  +  N      I
Sbjct  1     MIINVRDSTMVRPSDE----VTRRTVWNSNVDLVVPNFHTPSVYFYRTNSASNFFDAKII  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L K L  +   AGRL  DE+G   +  N +GV F+EA     +D    F P++ L  
Sbjct  57    KEALSKVLVPFYPMAGRLRRDEDGRVEIDCNGQGVLFIEADTGVVIDDFGDFAPTLKLRQ  116

Query  406   LHPSL---KGV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++   +G+    L+ +QVT F CG + +G    H VADG S  +F+  W    R + 
Sbjct  117   LIPAVDYSQGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDVARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R+PPR  ++H+  EY P    K         A       V     T
Sbjct  177   VSIPPFIDRTLLRARDPPRPVFEHI--EYKPPPSMKTSPHNQPTKADSEATAAVSIFKLT  234

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              E L  LKAK S   G    YS++E L  H+WR++ KAR+L   + T + I+ DGRARL 
Sbjct  235   REQLVTLKAK-SKEAGNTINYSSYEMLAGHVWRSVCKARSLPDDQETKLYIATDGRARLQ  293

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P  P  YFGN++    P A   DL+ +P  YAA  IH+A+S+++N Y+RS +D+   ++ 
Sbjct  294   PPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHNALSRMDNEYLRSALDYL--ELQ  351

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW R P +D DFG G P    P     EG+ F++PS
Sbjct  352   PDLKALVRGAHTFK---CPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPS  408

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  FK++ Y +
Sbjct  409   STNDGSLSVAIALQHEHMKVFKELLYDI  436



>ref|XP_009102018.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
Length=433

 Score =   232 bits (591),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 151/448 (34%), Positives = 228/448 (51%), Gaps = 24/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK+ +  +  ++P+ E      +T++  S  D V        +Y YRP    N      +
Sbjct  1     MKINIRDSTMVRPAGE----TPSTYLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPGVM  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L KAL  +   AGRL  D++G   +  N  GV FV A   + +D    F P++ L  
Sbjct  57    KEALAKALVPFYPMAGRLKRDDDGRIEIDCNAAGVLFVVADTPSLIDDFGDFAPTLDLRQ  116

Query  406   LHPSLK---GV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P +    G+    L+ +QVT F CG   +G    H  ADG S  +F+  W    R + 
Sbjct  117   LIPDVDHSPGIHSFPLLVLQVTYFKCGGASLGVGMQHHAADGFSGLHFINTWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R+PP+  +DHV  +  P      D   +S D+T      V     +
Sbjct  177   LTIPPFIDRTLLRARDPPQPAFDHVEYQPAPSMKIPLDPSKSSPDST-----TVSIFKLS  231

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              + L  LKAKA   +G    YS++E L  H+WR++ KAR L   + T + I+ DGR+RL 
Sbjct  232   RDQLVSLKAKAKE-DGNTVSYSSYEMLAGHVWRSVGKARGLPDDQETKLYIATDGRSRLR  290

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P++P  YFGN++  A P A   DLL +P  YAA LIHD ++++++NY+RS +D+   ++ 
Sbjct  291   PQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGLIHDVLARMDDNYLRSALDYL--EMQ  348

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW+R P YD DFG G P    P   P EG+ F++PS
Sbjct  349   PDLSALVRGAHTYK---CPNLGITSWVRLPIYDADFGWGRPIFMGPGGIPYEGLSFVVPS  405

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  F++  Y +
Sbjct  406   PTNDGSLSVAIALQTEHMKLFEKYLYEI  433



>emb|CDY05770.1| BnaC07g00330D [Brassica napus]
Length=433

 Score =   231 bits (590),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 150/448 (33%), Positives = 228/448 (51%), Gaps = 24/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK+ +  +  ++P+ E      +T++  S  D V        +Y YRP    N      +
Sbjct  1     MKINIRDSTMVRPAAE----TPSTYLWNSNVDLVIPRFHTPSVYFYRPTGASNFFDPQVM  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L KAL  +   AGRL  D++G   +  N  GV FV A   + +D    F P++ L  
Sbjct  57    KEALAKALVPFYPMAGRLKRDDDGRIEIDCNAAGVLFVVADTPSVIDDFGDFAPTLELRQ  116

Query  406   LHPSLK---GV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P +    G+    L+ +QVT F CG   +G    H  ADG S  +F+  W    R + 
Sbjct  117   LIPEVDHSPGIHSFPLLVLQVTYFKCGGASLGVGMQHHAADGFSGLHFINTWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R+PP+  +DHV  +  P      D   +S D+T      V     +
Sbjct  177   LTIPPFIDRTLLRARDPPQPAFDHVEYQPAPSMKIPLDPSKSSPDST-----TVSIFKLS  231

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              + L  LKAKA   +G    YS++E L  H+WR++ K+R L   + T + I+ DGR+RL 
Sbjct  232   RDQLVSLKAKAKE-DGNTVSYSSYEMLAGHVWRSVGKSRGLPDDQETKLYIATDGRSRLR  290

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P++P  YFGN++  A P A   DLL +P  +AA LIHD ++++++NY+RS +D+   ++ 
Sbjct  291   PQLPPGYFGNVIFTATPLAVAGDLLSKPTWFAAGLIHDVLARMDDNYLRSALDYL--EMQ  348

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW+R P YD DFG G P    P   P EG+ F+LPS
Sbjct  349   PDLSALVRGAHTYK---CPNLGITSWVRLPIYDADFGWGRPIFMGPGGIPYEGLSFVLPS  405

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  F++  Y +
Sbjct  406   PTNDGSLSVAIALQTEHMKLFEKYLYEI  433



>gb|KDP41953.1| hypothetical protein JCGZ_26971 [Jatropha curcas]
Length=431

 Score =   231 bits (590),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 140/406 (34%), Positives = 213/406 (52%), Gaps = 22/406 (5%)
 Frame = +1

Query  184   IYAYRPPTPPN----STIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASG  351
             +Y YRP   P     + ++ GL KAL  +   AGRL  DE+G   +  N EGV FV A  
Sbjct  39    VYFYRPTGAPTFFDPNVVKEGLSKALVPFYPMAGRLRRDEDGRIEIDCNAEGVLFVVAET  98

Query  352   DTTLDKVMPFKPSVSLLNLHPSLK-----GVVELVQVQVTRFTCGSLVVGFTAHHLVADG  516
              + +D    F P++ L  L P++          L+ +Q+T F CG + +G    H VADG
Sbjct  99    SSVIDDFGDFAPTLELKKLIPTVDYSGGISTYPLLVLQLTYFKCGGVSLGVGMQHHVADG  158

Query  517   HSTSNFLVAWGKACRDVMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLN  696
              S  +F+  W    R + +   P  DRT+   R+PP+  + H+  EY P    K      
Sbjct  159   FSGLHFVNTWSDMTRGLDLTIPPFIDRTLLRARDPPQPAFHHI--EYQPPPAMKT-----  211

Query  697   SNDATFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLG  876
               D +  D   V     T + L  LK KA   +G    YS++E L  H+WR+ +KAR L 
Sbjct  212   PVDNSKPDSTTVSIFKLTRDQLNILKTKAKE-DGNTVSYSSYEMLAGHVWRSASKARGLV  270

Query  877   GFETTHIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSK  1056
             G + T + I+ DGR+RL P +P  YFGN++  A P A+  ++  +P  +AA+ IHDA+ +
Sbjct  271   GDQETKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAQAGEMQSKPTWFAARKIHDALVR  330

Query  1057  VNNNYIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPY  1236
             ++N+Y+RS +D+   ++  +   LV  A   +   CPNL + SW+R P +D DFG G P 
Sbjct  331   MDNDYLRSALDYL--ELQPDPSALVRGAHTFR---CPNLGITSWVRLPIHDADFGWGRPI  385

Query  1237  IFMPTFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                P   P EG+ F+LPS   DGS+   I L  +++  F+++ Y +
Sbjct  386   FMGPGGIPYEGLSFILPSATNDGSLSVAIALQTEHMKLFEKLIYEI  431



>gb|KEH28560.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=433

 Score =   231 bits (589),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 156/448 (35%), Positives = 224/448 (50%), Gaps = 24/448 (5%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             M + V  +  ++PS E    +T   V  S  D V  +     +Y YRP    N      +
Sbjct  1     MIINVRDSTMVRPSEE----VTQRTVWNSNVDLVVPNFHTPSVYFYRPNGASNFFDAKVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L K L  +   AGRL  DE+G   +  + +GV FVEA     +D    F P++ L  
Sbjct  57    KEALSKVLVPFYPMAGRLRRDEDGRVEIDCDGQGVLFVEADTGGVVDDFGDFAPTLELRQ  116

Query  406   LHPSL---KGV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++   +G+    L+ +QVT F CG + +G    H VADG S  +F+  W    R + 
Sbjct  117   LIPAVDYSRGIETYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINTWSDVARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R+PPR  +DH+  EY P    K  H   +   +  D   V     T
Sbjct  177   VSMPPFIDRTLLRARDPPRPVFDHI--EYKPPPSMKT-HQQPTKPGS--DGAAVSIFKLT  231

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              E L  LKAK S   G    YS++E L  H+WR++ KAR+L   + T + I+ DGRARL 
Sbjct  232   REQLNTLKAK-SKEAGNTIHYSSYEMLAGHVWRSVCKARSLPDDQETKLYIATDGRARLQ  290

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P  P  YFGN++    P A   DL+ +P  YAA  IH+A+S+++N Y+RS +DF   ++ 
Sbjct  291   PPPPPGYFGNVIFTTTPIAIAGDLMTKPTWYAASRIHNALSRMDNEYLRSALDFL--ELQ  348

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW R P +D DFG G P    P     EG+ F++PS
Sbjct  349   PDLKALVRGAHTFK---CPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPS  405

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  +++  FK   Y +
Sbjct  406   SANDGSLSVAIALQHEHMKVFKDFLYDI  433



>ref|XP_003531748.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
1 [Glycine max]
 ref|XP_003531749.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
2 [Glycine max]
Length=429

 Score =   231 bits (589),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 151/448 (34%), Positives = 225/448 (50%), Gaps = 28/448 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             M + V+ +  ++P+ E    +    V  S  D V  +     +Y YR    PN      +
Sbjct  1     MMINVKESTMVRPAEE----VARRVVWNSNVDLVVPNFHTPSVYFYRSNGAPNFFDGKVM  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L K L  +   AGRL  D++G   +  + +GV FVEA     +D    F P++ L  
Sbjct  57    KEALTKVLVPFYPMAGRLLRDDDGRVEIDCDGQGVLFVEADTGAVIDDFGDFAPTLELRQ  116

Query  406   LHPSL---KGVVE--LVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P++   +G+    L+ +QVT F CG + +G    H VADG S  +F+  W    R + 
Sbjct  117   LIPAVDYSQGIASYPLLVLQVTHFKCGGVSLGVGMQHHVADGASGLHFINTWSDVARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRTI   R+PPR  +DH+  EY P    K     N++ A       V     T
Sbjct  177   VSIPPFIDRTILRARDPPRPIFDHI--EYKPPPAMKTQQATNASAA-------VSIFRLT  227

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              + L  LKAK S  +G    YS++E L  H+WR+++KAR L   + T + I+ DGR+RL 
Sbjct  228   RDQLNTLKAK-SKEDGNTISYSSYEMLAGHVWRSVSKARALPDDQETKLYIATDGRSRLQ  286

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P  P  YFGN++    P A   DL+ +P  YAA  IH+A+ +++N+Y+RS +D+   ++ 
Sbjct  287   PPTPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNDYLRSALDYL--ELQ  344

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   LV  A   K   CPNL + SW R P +D DFG G P    P     EG+ F++PS
Sbjct  345   PDLKALVRGAHTFK---CPNLGITSWTRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPS  401

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+   I L  D++  FK   Y +
Sbjct  402   STNDGSLSVAIALQPDHMKLFKDFLYDI  429



>ref|XP_010500346.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=472

 Score =   232 bits (591),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 156/462 (34%), Positives = 229/462 (50%), Gaps = 26/462 (6%)
 Frame = +1

Query  16    SLIVFFVHFVEKKTMKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAY  195
             S+ +FF       TMK+ +  +  I+P+ E       T++  S  D +        +Y Y
Sbjct  28    SIKLFFACNNPYATMKINIRDSTIIRPAAE----TPVTNLWNSNVDLIIPRFHTPSVYFY  83

Query  196   RPPTPPN----STIELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTL  363
             RP    N      ++  L KAL  +   AGRL  D +G   +  N  GV FV A   + +
Sbjct  84    RPTGVSNFFDPQVLKDALSKALVPFYPIAGRLKRDNDGRIEIDCNGAGVLFVVADTPSVI  143

Query  364   DKVMPFKPSVSLLNLHPSL---KGV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTS  528
             D +  F PS++L  L P +    GV    L+ +QVT F CG   +G    H VADG S  
Sbjct  144   DDLGDFAPSLTLRQLIPDVDYSAGVHTFPLLVLQVTFFRCGGASLGVGLQHHVADGSSAL  203

Query  529   NFLVAWGKACRDVMIQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDA  708
             +F+  W    R + +   P  DRT+   R+PP+  +DHV  EY P    K       +  
Sbjct  204   HFINTWSDMARGLDLTVPPFIDRTLLRARDPPQPAFDHV--EYQPSPTMKI-----PSSK  256

Query  709   TFLDDIVVHKVHFTLEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFET  888
                DD  V     + + L  LKAK S  +G    YS++E L  H+WR++ KAR L   + 
Sbjct  257   PDPDDTTVSIFKISHDLLCALKAK-SKQDGNTMSYSSYEVLAGHVWRSVCKARGLQDDQE  315

Query  889   THIRISVDGRARLNPKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNN  1068
             T   I++DGR+RL P++P  Y GN++  A P     DLL +P  YAA +IHDA+ ++N+N
Sbjct  316   TKFYIAIDGRSRLRPQLPPGYLGNVIFTATPLTVAGDLLSKPTWYAAGMIHDAIVRMNDN  375

Query  1069  YIRSFIDFANSKVVAEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMP  1248
             Y+ S +D+   ++  +   LV  A   K   CPNL + SW + P YD DFG G P    P
Sbjct  376   YLWSALDYL--ELQPDLSSLVRGAHTYK---CPNLGITSWTKLPIYDADFGWGRPIYMGP  430

Query  1249  TFFPTEGMMFLLPSFIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                  EG+ F+LPS   DGS+   I L  +++  F++  Y +
Sbjct  431   GAIAYEGLSFVLPSPTNDGSLSLAIALQSEHMKLFQKFFYDI  472



>emb|CDY22880.1| BnaA01g18180D [Brassica napus]
Length=428

 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 148/448 (33%), Positives = 227/448 (51%), Gaps = 29/448 (6%)
 Frame = +1

Query  58    MKVKVESTRTIKPSYEGNPPLTTTHVPLSVFDKVSYDAQIAVIYAYRPPTPPN----STI  225
             MK+   +   ++P+ E      +T++  S  D +      + +Y YRP    N      +
Sbjct  1     MKINTRNATMVRPAAE----TPSTYLWNSNVDLIIARYHSSSVYFYRPNGASNFFDPHVL  56

Query  226   ELGLRKALGVYREWAGRLGNDEEGNPVVLLNDEGVKFVEASGDTTLDKVMPFKPSVSLLN  405
             +  L KAL  +  +AG L  DE G   +  N  G  F+ A   + +D +  F PSV+L  
Sbjct  57    KEALAKALVPFYPFAGSLRRDENGRIEIDCNAAGALFIVADTPSVIDDLGDFAPSVNLSK  116

Query  406   LHPSLK---GV--VELVQVQVTRFTCGSLVVGFTAHHLVADGHSTSNFLVAWGKACRDVM  570
             L P +    G+    L+ +QVT F CG + +G    H V+DG S+ +F+ +W    R + 
Sbjct  117   LVPHVDYSPGIHTFPLLVLQVTFFKCGGVSLGVGIQHHVSDGLSSIHFINSWSDMARGLD  176

Query  571   IQPLPLRDRTIFIPRNPPRIEYDHVGAEYMPKQIKKNDHFLNSNDATFLDDIVVHKVHFT  750
             +   P  DRT+   R PP   + HV  EY P    K             D+  V     +
Sbjct  177   LTLPPFIDRTLLRAREPPHPTFHHV--EYQPSPSMKT--------PLHPDNTTVSIFKLS  226

Query  751   LEFLAKLKAKASAMNGGARPYSTFESLVAHLWRAITKARNLGGFETTHIRISVDGRARLN  930
              + L  LKAKA   +G    YS++E+L AH+WR++TKAR     + T + I+ DGR+RL 
Sbjct  227   RDLLVALKAKAKE-DGNTVSYSSYETLAAHVWRSVTKARAFPDDQVTKLYIATDGRSRLR  285

Query  931   PKVPNDYFGNLVLWAFPTAKVKDLLREPLSYAAKLIHDAVSKVNNNYIRSFIDFANSKVV  1110
             P++P  Y GN+V  A P A   DLL +P SY A LIHD ++++++ Y+RS +D+   ++ 
Sbjct  286   PQLPPGYLGNVVFTATPLAAAGDLLSKPTSYVAGLIHDVLARMDDEYLRSALDYL--EMQ  343

Query  1111  AEEDGLVPTADMDKHILCPNLEVDSWLRFPFYDLDFGTGCPYIFMPTFFPTEGMMFLLPS  1290
              +   L+  A       CPNL + SW+R P YD DFG G P    P+    EG+ F+LPS
Sbjct  344   PDLSALIRGAQTYN---CPNLGITSWVRLPIYDADFGWGRPVFMGPSVIAFEGLSFVLPS  400

Query  1291  FIGDGSIDAFIPLFQDNLPTFKQICYSL  1374
                DGS+  FI L  +++  F++  Y +
Sbjct  401   PTNDGSLSLFIALRTEHMKLFEKYLYEI  428



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4377449940080