BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19172_g1_i1 len=2983 path=[3045:0-2063 @20@!:2064-2493
5537:2494-2671 5714:2672-2760 64:2761-2982]

Length=2983
                                                                      Score     E

ref|XP_009628339.1|  PREDICTED: uncharacterized protein LOC104118722    625   0.0      
ref|XP_009795670.1|  PREDICTED: uncharacterized protein LOC104242...    615   0.0      
ref|XP_006343981.1|  PREDICTED: mitochondrial aspartate-glutamate...    614   0.0      
ref|XP_010325670.1|  PREDICTED: uncharacterized protein LOC101257884    602   0.0      
ref|XP_010660679.1|  PREDICTED: uncharacterized protein LOC100853340    555   0.0      
emb|CBI34669.3|  unnamed protein product                                540   1e-176   
ref|XP_007040233.1|  Mitochondrial substrate carrier family prote...    542   3e-176   
ref|XP_007040231.1|  Mitochondrial substrate carrier family prote...    542   8e-176   
emb|CDP12025.1|  unnamed protein product                                535   1e-173   
gb|KDP25434.1|  hypothetical protein JCGZ_20590                         528   4e-171   
gb|EYU23473.1|  hypothetical protein MIMGU_mgv1a002748mg                526   6e-171   
ref|XP_006439547.1|  hypothetical protein CICLE_v10019111mg             522   2e-168   
ref|XP_006476567.1|  PREDICTED: uncharacterized protein LOC102608...    521   2e-168   
ref|XP_011080954.1|  PREDICTED: probable S-adenosylmethionine car...    520   2e-168   
gb|KDO76222.1|  hypothetical protein CISIN_1g005451mg                   521   4e-168   
ref|XP_004300791.1|  PREDICTED: uncharacterized protein LOC101309355    509   4e-164   
gb|KHG23174.1|  mcfF                                                    509   2e-163   
ref|XP_007208818.1|  hypothetical protein PRUPE_ppa025003mg             504   7e-162   
ref|XP_002509806.1|  mitochondrial carrier protein, putative            501   9e-161   Ricinus communis
ref|XP_010089103.1|  hypothetical protein L484_024277                   501   2e-160   
gb|KDO76221.1|  hypothetical protein CISIN_1g005451mg                   498   2e-159   
ref|XP_008238884.1|  PREDICTED: uncharacterized protein LOC103337495    492   4e-159   
ref|XP_011022691.1|  PREDICTED: uncharacterized protein LOC105124...    494   8e-159   
gb|KCW72152.1|  hypothetical protein EUGRSUZ_E00597                     486   7e-155   
ref|XP_010055636.1|  PREDICTED: uncharacterized protein LOC104443805    486   2e-154   
ref|XP_007040235.1|  Mitochondrial substrate carrier family prote...    483   5e-154   
ref|XP_010241914.1|  PREDICTED: adenine nucleotide transporter BT...    476   3e-151   
ref|XP_007040238.1|  Mitochondrial substrate carrier family prote...    460   4e-146   
ref|XP_003524460.1|  PREDICTED: uncharacterized protein LOC100778...    461   5e-146   
gb|KHN23643.1|  Mitochondrial substrate carrier family protein B        457   2e-144   
gb|KCW72151.1|  hypothetical protein EUGRSUZ_E00597                     458   2e-144   
ref|XP_010695140.1|  PREDICTED: uncharacterized protein LOC104907...    456   1e-143   
ref|XP_010695139.1|  PREDICTED: uncharacterized protein LOC104907...    457   1e-143   
ref|XP_009795672.1|  PREDICTED: uncharacterized protein LOC104242...    452   2e-143   
ref|XP_007040234.1|  Mitochondrial substrate carrier family prote...    451   3e-142   
ref|XP_002304496.1|  hypothetical protein POPTR_0003s12770g             450   8e-142   Populus trichocarpa [western balsam poplar]
ref|XP_007160064.1|  hypothetical protein PHAVU_002G289600g             444   3e-139   
ref|XP_004503716.1|  PREDICTED: calcium-binding mitochondrial car...    442   8e-139   
ref|XP_011022695.1|  PREDICTED: uncharacterized protein LOC105124...    438   7e-138   
ref|XP_003630504.1|  Mitochondrial substrate carrier family prote...    437   3e-137   
ref|XP_003532412.1|  PREDICTED: uncharacterized protein LOC100812...    436   5e-136   
gb|KHN16819.1|  Mitochondrial substrate carrier family protein B        435   1e-135   
ref|XP_006439548.1|  hypothetical protein CICLE_v10019111mg             429   2e-134   
gb|KDO76223.1|  hypothetical protein CISIN_1g005451mg                   429   3e-134   
ref|XP_008437278.1|  PREDICTED: uncharacterized protein LOC103482...    429   3e-133   
ref|XP_004143980.1|  PREDICTED: uncharacterized protein LOC101216245    426   4e-132   
ref|XP_006286373.1|  hypothetical protein CARUB_v10000438mg             421   1e-130   
ref|XP_010434930.1|  PREDICTED: probable S-adenosylmethionine car...    417   8e-129   
ref|XP_010529594.1|  PREDICTED: mitochondrial substrate carrier f...    416   3e-128   
ref|XP_010422099.1|  PREDICTED: uncharacterized protein LOC104707444    412   6e-127   
ref|XP_010455551.1|  PREDICTED: probable S-adenosylmethionine car...    411   7e-127   
ref|XP_008805793.1|  PREDICTED: uncharacterized protein LOC103718...    407   4e-125   
ref|XP_010918562.1|  PREDICTED: probable mitochondrial adenine nu...    406   1e-124   
gb|EPS66533.1|  hypothetical protein M569_08243                         390   1e-123   
ref|XP_011022693.1|  PREDICTED: uncharacterized protein LOC105124...    401   1e-123   
ref|NP_192883.2|  mitochondrial substrate carrier family protein        401   4e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396904.1|  hypothetical protein EUTSA_v10028506mg             401   5e-123   
emb|CDY25285.1|  BnaA02g21710D                                          394   2e-122   
ref|XP_009128671.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    393   4e-122   
emb|CDY37620.1|  BnaCnng08350D                                          394   1e-121   
ref|XP_007040240.1|  Mitochondrial substrate carrier family prote...    395   2e-121   
ref|XP_006827637.1|  hypothetical protein AMTR_s00009p00246820          394   2e-120   
ref|XP_002872587.1|  binding protein                                    392   8e-120   
gb|KCW72153.1|  hypothetical protein EUGRSUZ_E00597                     387   2e-118   
ref|XP_009387927.1|  PREDICTED: probable mitochondrial adenine nu...    385   7e-117   
ref|XP_009411517.1|  PREDICTED: uncharacterized protein LOC103993251    379   2e-114   
ref|XP_006580585.1|  PREDICTED: uncharacterized protein LOC100778...    371   1e-112   
ref|XP_006580584.1|  PREDICTED: uncharacterized protein LOC100778...    371   1e-112   
gb|KDO76225.1|  hypothetical protein CISIN_1g005451mg                   372   2e-112   
ref|XP_006580583.1|  PREDICTED: uncharacterized protein LOC100778...    371   2e-112   
ref|XP_008804022.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-bind...    365   4e-110   
ref|XP_007040236.1|  Mitochondrial substrate carrier family prote...    363   1e-109   
ref|XP_002972833.1|  hypothetical protein SELMODRAFT_413467             350   7e-107   
ref|XP_003570048.1|  PREDICTED: calcium-binding mitochondrial car...    355   2e-106   
gb|EEC73746.1|  hypothetical protein OsI_08383                          343   1e-105   Oryza sativa Indica Group [Indian rice]
ref|XP_004953385.1|  PREDICTED: uncharacterized protein LOC101766...    353   2e-105   
ref|XP_004953384.1|  PREDICTED: uncharacterized protein LOC101766...    353   3e-105   
ref|NP_001047664.1|  Os02g0665200                                       347   3e-103   Oryza sativa Japonica Group [Japonica rice]
gb|EMT08898.1|  Mitoferrin                                              347   4e-103   
ref|XP_006286372.1|  hypothetical protein CARUB_v10000438mg             343   4e-102   
ref|XP_008678912.1|  PREDICTED: calcium-binding mitochondrial car...    345   5e-102   
ref|XP_009387935.1|  PREDICTED: uncharacterized protein LOC103974...    336   5e-99    
ref|XP_006647649.1|  PREDICTED: adenine nucleotide transporter BT...    334   2e-98    
ref|XP_008805795.1|  PREDICTED: uncharacterized protein LOC103718...    323   1e-94    
ref|XP_010918563.1|  PREDICTED: uncharacterized protein LOC105042...    322   5e-94    
ref|XP_006580586.1|  PREDICTED: uncharacterized protein LOC100778...    315   5e-92    
emb|CAN65659.1|  hypothetical protein VITISV_000953                     332   9e-92    Vitis vinifera
ref|XP_008678915.1|  PREDICTED: calcium-binding mitochondrial car...    315   3e-91    
ref|XP_001752212.1|  predicted protein                                  310   7e-89    
ref|XP_001757436.1|  predicted protein                                  290   2e-86    
ref|XP_007040232.1|  Mitochondrial substrate carrier family prote...    296   4e-85    
ref|XP_008437279.1|  PREDICTED: uncharacterized protein LOC103482...    291   6e-83    
gb|KDO76226.1|  hypothetical protein CISIN_1g005451mg                   281   6e-80    
gb|EMS63704.1|  hypothetical protein TRIUR3_06650                       286   1e-79    
ref|XP_009364946.1|  PREDICTED: mitoferrin-like isoform X3              250   1e-73    
emb|CAB78187.1|  putative protein                                       260   3e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002503139.1|  mitochondrial carrier family                       247   5e-71    Micromonas commoda
ref|XP_003061154.1|  mitochondrial carrier family                       239   3e-66    
ref|XP_008678916.1|  PREDICTED: uncharacterized protein LOC103653...    235   1e-63    
ref|XP_008678914.1|  PREDICTED: uncharacterized protein LOC103653...    234   1e-62    
ref|XP_001757421.1|  predicted protein                                  221   3e-62    
ref|XP_008678919.1|  PREDICTED: uncharacterized protein LOC103653...    218   6e-58    
ref|XP_009364949.1|  PREDICTED: mitoferrin-like isoform X4              204   2e-57    
ref|XP_002984406.1|  hypothetical protein SELMODRAFT_120459             204   3e-55    
emb|CDX93731.1|  BnaA09g23310D                                          157   3e-38    
emb|CDX93733.1|  BnaA09g23330D                                          157   3e-38    
ref|XP_009114760.1|  PREDICTED: probable S-adenosylmethionine car...    157   6e-38    
emb|CDY15312.1|  BnaC06g07980D                                          154   2e-37    
gb|KDP35277.1|  hypothetical protein JCGZ_09436                         153   5e-37    
ref|XP_009792044.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    152   1e-36    
ref|XP_009792043.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    151   2e-36    
ref|XP_008678917.1|  PREDICTED: uncharacterized protein LOC103653...    155   2e-36    
ref|XP_003630125.1|  S-adenosylmethionine mitochondrial carrier p...    151   3e-36    
gb|ADE77358.1|  unknown                                                 151   3e-36    
ref|XP_008456740.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    150   3e-36    
ref|XP_002893808.1|  At1g34065                                          150   4e-36    
ref|XP_009595343.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    150   5e-36    
emb|CAF04055.2|  S-adenosylmethionine transporter                       150   5e-36    Nicotiana benthamiana
gb|AAY34159.1|  At1g34065                                               150   6e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009595342.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    149   9e-36    
ref|NP_564436.4|  S-adenosylmethionine carrier 2                        150   1e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140954.1|  PREDICTED: uncharacterized mitochondrial car...    148   3e-35    
ref|XP_004288103.1|  PREDICTED: S-adenosylmethionine mitochondria...    148   4e-35    
ref|XP_010499947.1|  PREDICTED: probable S-adenosylmethionine car...    147   5e-35    
emb|CAF25317.1|  S-adenosylmethionine transporter                       147   5e-35    Capsicum annuum
ref|XP_007048160.1|  S-adenosylmethionine carrier 1                     147   5e-35    
ref|XP_006367413.1|  PREDICTED: S-adenosylmethionine mitochondria...    147   5e-35    
ref|XP_004504005.1|  PREDICTED: uncharacterized mitochondrial car...    147   6e-35    
gb|AFK45388.1|  unknown                                                 147   7e-35    
gb|EYU31105.1|  hypothetical protein MIMGU_mgv1a010029mg                146   1e-34    
ref|XP_002969176.1|  hypothetical protein SELMODRAFT_146160             146   1e-34    
emb|CDP17607.1|  unnamed protein product                                146   1e-34    
gb|EAZ39471.1|  hypothetical protein OsJ_23900                          144   2e-34    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010319792.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    146   2e-34    
ref|XP_006654303.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    145   2e-34    
ref|NP_001059405.1|  Os07g0295000                                       144   2e-34    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004148454.1|  PREDICTED: uncharacterized mitochondrial car...    145   3e-34    
ref|XP_010268594.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    145   3e-34    
ref|XP_010268598.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    144   3e-34    
ref|XP_010461233.1|  PREDICTED: probable S-adenosylmethionine car...    145   3e-34    
ref|XP_010268593.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    145   3e-34    
gb|EAZ03558.1|  hypothetical protein OsI_25694                          144   4e-34    Oryza sativa Indica Group [Indian rice]
ref|XP_010268592.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    145   4e-34    
ref|XP_010478825.1|  PREDICTED: probable S-adenosylmethionine car...    145   4e-34    
ref|XP_010478826.1|  PREDICTED: probable S-adenosylmethionine car...    144   4e-34    
ref|XP_010526619.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    145   5e-34    
ref|XP_008457910.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    144   5e-34    
emb|CDP12870.1|  unnamed protein product                                145   5e-34    
ref|XP_006466113.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    144   6e-34    
gb|KGN62097.1|  hypothetical protein Csa_2G297210                       144   6e-34    
ref|XP_002530256.1|  mitochondrial carrier protein, putative            144   7e-34    Ricinus communis
ref|XP_010542975.1|  PREDICTED: probable S-adenosylmethionine car...    144   7e-34    
ref|XP_003532851.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    144   7e-34    
ref|NP_001130185.1|  uncharacterized protein LOC100191279               143   7e-34    Zea mays [maize]
gb|ACG42110.1|  mitochondrial carrier C12B10.09                         143   7e-34    Zea mays [maize]
ref|XP_002452854.1|  hypothetical protein SORBIDRAFT_04g033610          143   7e-34    Sorghum bicolor [broomcorn]
ref|XP_011021953.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    144   8e-34    
ref|XP_006585312.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    143   8e-34    
ref|XP_002279217.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    144   1e-33    Vitis vinifera
ref|XP_010261037.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    144   1e-33    
gb|ACG43941.1|  mitochondrial carrier C12B10.09                         142   1e-33    Zea mays [maize]
ref|XP_010261039.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    143   1e-33    
ref|XP_007019619.1|  S-adenosylmethionine carrier 2                     143   1e-33    
ref|XP_009119224.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    145   1e-33    
ref|XP_002452606.1|  hypothetical protein SORBIDRAFT_04g028930          142   2e-33    Sorghum bicolor [broomcorn]
ref|XP_004981046.1|  PREDICTED: S-adenosylmethionine mitochondria...    142   2e-33    
ref|XP_011100076.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    143   2e-33    
ref|XP_001785199.1|  predicted protein                                  144   2e-33    
ref|XP_010652872.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    143   2e-33    
ref|XP_006441382.1|  hypothetical protein CICLE_v10021207mg             142   2e-33    
ref|XP_010652871.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    143   2e-33    
ref|XP_001771578.1|  predicted protein                                  141   3e-33    
ref|XP_007143580.1|  hypothetical protein PHAVU_007G083700g             142   3e-33    
ref|XP_011044281.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    141   3e-33    
gb|EPS64138.1|  hypothetical protein M569_10643                         141   3e-33    
ref|NP_001055312.1|  Os05g0361900                                       141   3e-33    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006842198.1|  hypothetical protein AMTR_s00078p00165690          142   3e-33    
emb|CDX89771.1|  BnaA10g03110D                                          144   4e-33    
ref|XP_006473125.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    142   4e-33    
ref|XP_011044279.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    141   4e-33    
ref|XP_002524353.1|  mitochondrial carrier protein, putative            142   4e-33    Ricinus communis
emb|CBI21530.3|  unnamed protein product                                143   4e-33    
gb|EEC79066.1|  hypothetical protein OsI_19641                          140   5e-33    Oryza sativa Indica Group [Indian rice]
ref|XP_002973887.1|  hypothetical protein SELMODRAFT_100740             140   5e-33    
ref|XP_008232365.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    141   6e-33    
ref|XP_006580309.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    141   6e-33    
ref|XP_002306360.2|  mitochondrial substrate carrier family protein     141   6e-33    Populus trichocarpa [western balsam poplar]
emb|CDY18275.1|  BnaC05g02980D                                          143   7e-33    
ref|XP_006580311.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    140   9e-33    
ref|XP_007205556.1|  hypothetical protein PRUPE_ppa008636mg             140   1e-32    
ref|XP_006473127.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    139   1e-32    
ref|XP_006473126.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    140   2e-32    
gb|KHN17041.1|  Putative mitochondrial carrier C12B10.09                139   2e-32    
ref|XP_007159774.1|  hypothetical protein PHAVU_002G266200g             140   2e-32    
gb|ACU23159.1|  unknown                                                 139   2e-32    Glycine max [soybeans]
ref|XP_003558587.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    139   2e-32    
ref|XP_009119223.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    141   3e-32    
ref|XP_007159773.1|  hypothetical protein PHAVU_002G266200g             139   3e-32    
gb|KFK32946.1|  hypothetical protein AALP_AA6G309900                    140   3e-32    
ref|XP_006473124.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    139   3e-32    
ref|XP_002263642.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    141   3e-32    Vitis vinifera
gb|KDO83816.1|  hypothetical protein CISIN_1g020666mg                   139   3e-32    
ref|XP_005645456.1|  mitochondrial carrier                              139   3e-32    
ref|XP_010314471.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    139   4e-32    
ref|XP_004252565.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    139   4e-32    
ref|XP_010665074.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    139   5e-32    
ref|XP_008793473.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    139   5e-32    
ref|XP_007413762.1|  hypothetical protein MELLADRAFT_117468             137   5e-32    
ref|XP_010665072.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    138   6e-32    
ref|XP_008678918.1|  PREDICTED: uncharacterized protein LOC103653...    141   6e-32    
ref|XP_010665073.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    138   7e-32    
ref|XP_003562380.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    137   9e-32    
ref|XP_009109466.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    138   9e-32    
ref|XP_010665071.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    138   1e-31    
gb|EWM26453.1|  s-adenosylmethionine mitochondrial carrier protein      140   1e-31    
ref|XP_010665070.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    138   1e-31    
ref|XP_005854766.1|  s-adenosylmethionine mitochondrial carrier p...    140   1e-31    
ref|XP_010665068.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    138   1e-31    
ref|XP_007019441.1|  Mitochondrial carrier protein, putative            139   1e-31    
ref|XP_009419300.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    137   1e-31    
ref|XP_005709304.1|  mitochondrial carrier (BOU / S-adenosylmethi...    137   2e-31    
ref|XP_004998043.1|  hypothetical protein PTSG_02054                    136   2e-31    
ref|XP_008372045.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    137   2e-31    
ref|XP_009337443.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    137   2e-31    
gb|KDO45531.1|  hypothetical protein CISIN_1g046528mg                   136   2e-31    
gb|KHN34018.1|  Putative mitochondrial carrier C12B10.09                137   2e-31    
ref|XP_004290480.1|  PREDICTED: S-adenosylmethionine mitochondria...    136   2e-31    
ref|XP_007946282.1|  PREDICTED: S-adenosylmethionine mitochondria...    135   2e-31    
ref|XP_006657622.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    136   2e-31    
gb|EMT09770.1|  S-adenosylmethionine mitochondrial carrier protein      136   3e-31    
ref|XP_002307518.2|  hypothetical protein POPTR_0005s21910g             136   3e-31    Populus trichocarpa [western balsam poplar]
ref|XP_010259890.1|  PREDICTED: mitochondrial substrate carrier f...    137   3e-31    
ref|XP_010915071.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    136   3e-31    
ref|XP_010063818.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    136   3e-31    
ref|XP_002868906.1|  predicted protein                                  136   3e-31    
ref|XP_009363686.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    136   3e-31    
ref|XP_006361619.1|  PREDICTED: putative mitochondrial carrier pr...    136   3e-31    
ref|XP_006361621.1|  PREDICTED: putative mitochondrial carrier pr...    135   4e-31    
emb|CDP18274.1|  unnamed protein product                                138   4e-31    
ref|XP_009408931.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    135   4e-31    
ref|XP_006434531.1|  hypothetical protein CICLE_v10001842mg             136   4e-31    
dbj|BAJ88489.1|  predicted protein                                      135   5e-31    
ref|XP_010025529.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    135   5e-31    
ref|XP_002946492.1|  hypothetical protein VOLCADRAFT_86841              135   7e-31    
ref|XP_006285873.1|  hypothetical protein CARUB_v10007368mg             135   1e-30    
ref|XP_008441537.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    136   1e-30    
ref|XP_002964333.1|  hypothetical protein SELMODRAFT_166450             135   1e-30    
emb|CDY49847.1|  BnaC02g44060D                                          136   1e-30    
ref|XP_010681056.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    134   2e-30    
ref|XP_002967701.1|  hypothetical protein SELMODRAFT_169433             135   2e-30    
ref|XP_010063881.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    135   2e-30    
ref|XP_010663243.1|  PREDICTED: mitochondrial substrate carrier f...    134   2e-30    
ref|XP_004496430.1|  PREDICTED: S-adenosylmethionine mitochondria...    133   2e-30    
ref|XP_004344251.1|  solute carrier family 25                           132   2e-30    
ref|XP_010437066.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    134   2e-30    
ref|XP_008237469.1|  PREDICTED: probable S-adenosylmethionine car...    134   2e-30    
ref|XP_004971374.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    135   2e-30    
ref|XP_002306686.1|  mitochondrial substrate carrier family protein     135   3e-30    Populus trichocarpa [western balsam poplar]
emb|CDX90333.1|  BnaA08g16510D                                          134   3e-30    
gb|AES62271.2|  S-adenosylmethionine carrier protein                    133   3e-30    
gb|KFM25534.1|  Putative mitochondrial carrier protein PET8             134   3e-30    
ref|NP_568060.1|  S-adenosylmethionine carrier 1                        133   3e-30    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001167783.1|  hypothetical protein                               132   3e-30    Zea mays [maize]
ref|XP_004148809.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    134   3e-30    
gb|EFA81562.1|  mitochondrial substrate carrier family protein          132   4e-30    Polysphondylium pallidum PN500
ref|XP_010431917.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    133   4e-30    
ref|XP_009767596.1|  PREDICTED: probable S-adenosylmethionine car...    133   4e-30    
ref|XP_001916313.2|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    131   5e-30    Equus caballus [domestic horse]
gb|KFH62336.1|  hypothetical protein MVEG_11547                         133   5e-30    
ref|XP_004372827.1|  PREDICTED: S-adenosylmethionine mitochondria...    133   7e-30    
gb|KDD74418.1|  hypothetical protein H632_c1328p1                       131   7e-30    
ref|XP_010999801.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    134   8e-30    
ref|XP_005860857.1|  PREDICTED: S-adenosylmethionine mitochondria...    131   9e-30    
ref|XP_006411746.1|  hypothetical protein EUTSA_v10025614mg             132   9e-30    
gb|ELU02536.1|  hypothetical protein CAPTEDRAFT_109350                  130   9e-30    
gb|EMS68458.1|  Putative mitochondrial carrier protein PET8             131   9e-30    
ref|XP_008674492.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    133   1e-29    
ref|XP_010431916.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    132   1e-29    
ref|XP_010247259.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    133   1e-29    
gb|ABR16477.1|  unknown                                                 132   1e-29    
emb|CDS04845.1|  hypothetical protein LRAMOSA07375                      131   2e-29    
gb|EYU24344.1|  hypothetical protein MIMGU_mgv1a018556mg                131   2e-29    
gb|KDP43023.1|  hypothetical protein JCGZ_25209                         132   3e-29    
gb|ABR17121.1|  unknown                                                 132   3e-29    
ref|XP_005538381.1|  probable mitochondrial carrier proteins; Pet8p     130   3e-29    
ref|XP_004955986.1|  PREDICTED: S-adenosylmethionine mitochondria...    129   4e-29    
gb|KHN29126.1|  Putative mitochondrial carrier C12B10.09                130   4e-29    
emb|CDR46814.1|  CYFA0S26e00364g1_1                                     129   5e-29    
emb|CBI15123.3|  unnamed protein product                                130   5e-29    
gb|KFW82450.1|  S-adenosylmethionine mitochondrial carrier protein      128   5e-29    
gb|KFH72080.1|  hypothetical protein MVEG_02373                         130   6e-29    
ref|XP_006472952.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    131   7e-29    
gb|KDO83666.1|  hypothetical protein CISIN_1g016394mg                   130   7e-29    
ref|XP_010110800.1|  Mitochondrial RNA-splicing protein MRS3            129   7e-29    
ref|XP_006434429.1|  hypothetical protein CICLE_v10001437mg             130   7e-29    
ref|XP_009335146.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    129   8e-29    
ref|XP_004884614.1|  PREDICTED: S-adenosylmethionine mitochondria...    128   8e-29    
ref|XP_006854607.1|  hypothetical protein AMTR_s00030p00139060          129   9e-29    
tpg|DAA60299.1|  TPA: hypothetical protein ZEAMMB73_843839              127   1e-28    
ref|XP_005825099.1|  hypothetical protein GUITHDRAFT_77427              127   1e-28    
ref|XP_009066734.1|  hypothetical protein LOTGIDRAFT_169864             127   2e-28    
ref|XP_010099455.1|  Mitochondrial RNA-splicing protein MRS3            128   2e-28    
ref|XP_001695360.1|  mitochondrial substrate carrier protein            129   2e-28    
ref|XP_008386376.1|  PREDICTED: probable S-adenosylmethionine car...    128   2e-28    
ref|XP_007152073.1|  hypothetical protein PHAVU_004G099800g             129   2e-28    
ref|XP_010519383.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    130   2e-28    
ref|XP_006646723.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    128   2e-28    
ref|XP_007096401.1|  PREDICTED: S-adenosylmethionine mitochondria...    127   2e-28    
ref|XP_502002.1|  YALI0C19195p                                          127   2e-28    
ref|XP_002456996.1|  hypothetical protein SORBIDRAFT_03g046920          129   2e-28    
ref|XP_003561891.1|  PREDICTED: mitochondrial substrate carrier f...    128   3e-28    
ref|XP_007061549.1|  PREDICTED: S-adenosylmethionine mitochondria...    127   3e-28    
ref|XP_002526128.1|  mitochondrial carrier protein, putative            129   3e-28    
ref|XP_009769943.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    129   3e-28    
ref|XP_645993.1|  mitochondrial substrate carrier family protein        127   3e-28    
ref|XP_011003298.1|  PREDICTED: mitoferrin-like isoform X1              127   3e-28    
gb|EMG47404.1|  putative mitochondrial S-adenosylmethionine trans...    128   3e-28    
ref|XP_005707975.1|  mitochondrial carrier (BOU / S-adenosylmethi...    127   4e-28    
emb|CBN76736.1|  mitochondrial phosphate carrier protein                127   4e-28    
ref|XP_006362812.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    128   4e-28    
ref|XP_010320064.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    128   5e-28    
ref|XP_007037566.1|  Mitochondrial substrate carrier family prote...    128   5e-28    
gb|KDP45745.1|  hypothetical protein JCGZ_17352                         127   5e-28    
ref|XP_009364945.1|  PREDICTED: uncharacterized protein LOC103954...    123   6e-28    
ref|XP_003592020.1|  S-adenosylmethionine mitochondrial carrier p...    126   8e-28    
ref|XP_010606353.1|  PREDICTED: S-adenosylmethionine mitochondria...    125   8e-28    
ref|NP_001187730.1|  s-adenosylmethionine mitochondrial carrier p...    125   8e-28    
ref|XP_007320618.1|  hypothetical protein SERLADRAFT_472402             125   9e-28    
emb|CCX29783.1|  Similar to Uncharacterized mitochondrial carrier...    125   9e-28    
ref|XP_003341778.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...    126   1e-27    
ref|XP_006390882.1|  hypothetical protein EUTSA_v10018646mg             127   1e-27    
ref|XP_001699329.1|  hypothetical protein CHLREDRAFT_121489             125   1e-27    
ref|XP_003285802.1|  hypothetical protein DICPUDRAFT_76707              125   1e-27    
ref|XP_002500313.1|  mitochondrial carrier family                       125   1e-27    
ref|XP_011101381.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    127   1e-27    
ref|XP_004290547.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    126   1e-27    
ref|XP_001643188.1|  hypothetical protein Kpol_448p18                   125   1e-27    
ref|XP_009364944.1|  PREDICTED: uncharacterized protein LOC103954...    122   1e-27    
ref|XP_003698268.1|  PREDICTED: S-adenosylmethionine mitochondria...    124   2e-27    
gb|EYU17465.1|  hypothetical protein MIMGU_mgv1a007576mg                127   2e-27    
ref|XP_011044282.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    125   2e-27    
ref|XP_009629376.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    125   2e-27    
ref|XP_009620785.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    126   2e-27    
ref|XP_002459729.1|  hypothetical protein SORBIDRAFT_02g009480          124   2e-27    
gb|KDO67025.1|  hypothetical protein CISIN_1g020120mg                   125   2e-27    
ref|XP_003632130.1|  PREDICTED: mitoferrin                              125   2e-27    
ref|XP_004339227.1|  mitochondrial 2oxodicarboxylate carrier 1, p...    124   2e-27    
ref|NP_001025314.1|  S-adenosylmethionine mitochondrial carrier p...    124   2e-27    
ref|XP_006425155.1|  hypothetical protein CICLE_v10028816mg             125   2e-27    
ref|XP_003565138.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    125   2e-27    
ref|XP_009801377.1|  PREDICTED: mitoferrin-like isoform X1              125   2e-27    
ref|XP_010695210.1|  PREDICTED: mitochondrial substrate carrier f...    125   2e-27    
ref|XP_011044280.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    124   3e-27    
ref|XP_010102090.1|  Protein MITOFERRINLIKE 1                           125   3e-27    
ref|XP_002421279.1|  S-adenosylmethionine transporter of the mito...    123   3e-27    
gb|EAY77348.1|  hypothetical protein OsI_05330                          125   3e-27    
ref|NP_001045491.1|  Os01g0964900                                       125   3e-27    
dbj|BAD88246.1|  mitochondrial carrier protein-like                     125   3e-27    
ref|XP_003518609.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    125   3e-27    
ref|XP_006678882.1|  hypothetical protein BATDEDRAFT_11642              124   4e-27    
ref|XP_002516353.1|  mitochondrial carrier protein, putative            124   4e-27    
gb|ACE97986.1|  mitochondrial substrate carrier                         124   4e-27    
ref|XP_008453268.1|  PREDICTED: mitochondrial substrate carrier f...    125   4e-27    
ref|XP_010532386.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    129   4e-27    
ref|NP_172184.1|  mitochondrial substrate carrier family protein        124   4e-27    
ref|XP_003028459.1|  hypothetical protein SCHCODRAFT_83303              124   5e-27    
gb|EPS72945.1|  hypothetical protein M569_01807                         125   5e-27    
ref|XP_005704542.1|  mitochondrial carrier (BOU / S-adenosylmethi...    124   5e-27    
ref|XP_010045378.1|  PREDICTED: mitoferrin                              124   5e-27    
emb|CDP17012.1|  unnamed protein product                                124   5e-27    
ref|XP_008614571.1|  hypothetical protein SDRG_10363                    124   5e-27    
gb|ABK25762.1|  unknown                                                 124   5e-27    
ref|XP_009089548.1|  PREDICTED: S-adenosylmethionine mitochondria...    123   6e-27    
gb|KHJ49096.1|  hypothetical protein D918_00214                         124   6e-27    
ref|XP_007875324.1|  hypothetical protein PNEG_03257                    123   6e-27    
ref|XP_002313965.2|  mitochondrial substrate carrier family protein     124   7e-27    
ref|XP_009141046.1|  PREDICTED: mitoferrin-like                         123   7e-27    
gb|ACE97997.1|  mitochondrial substrate carrier                         123   7e-27    
ref|XP_009414840.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    124   7e-27    
ref|XP_006844804.1|  hypothetical protein AMTR_s00058p00026290          124   7e-27    
dbj|BAK04140.1|  predicted protein                                      124   8e-27    
ref|XP_002961990.1|  hypothetical protein SELMODRAFT_230023             122   8e-27    
ref|XP_002892375.1|  mitochondrial substrate carrier family protein     123   8e-27    
gb|ACE97985.1|  mitochondrial substrate carrier                         123   9e-27    
ref|XP_002952303.1|  hypothetical protein VOLCADRAFT_62264              122   9e-27    
gb|ACE97974.1|  mitochondrial substrate carrier                         123   9e-27    
gb|ACE97999.1|  mitochondrial substrate carrier                         123   9e-27    
ref|XP_005703208.1|  mitochondrial carrier (BOU / S-adenosylmethi...    122   9e-27    
gb|ACE97995.1|  mitochondrial substrate carrier                         123   9e-27    
ref|XP_004499853.1|  PREDICTED: mitochondrial substrate carrier f...    124   9e-27    
ref|NP_501552.1|  Protein D1046.3                                       122   1e-26    
ref|XP_004172350.1|  PREDICTED: uncharacterized mitochondrial car...    121   1e-26    
gb|ACE97994.1|  mitochondrial substrate carrier                         122   1e-26    
ref|XP_010910319.1|  PREDICTED: mitoferrin-like                         123   1e-26    
ref|XP_010539157.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    124   1e-26    
ref|XP_010257042.1|  PREDICTED: mitoferrin-like                         123   1e-26    
gb|KDO28743.1|  hypothetical protein SPRG_05697                         122   1e-26    
ref|XP_004068901.1|  PREDICTED: S-adenosylmethionine mitochondria...    122   1e-26    
gb|KFM78818.1|  S-adenosylmethionine mitochondrial carrier protein      121   1e-26    
ref|XP_008393228.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    123   1e-26    
gb|EXX72683.1|  Pet8p                                                   122   1e-26    
ref|XP_003598987.1|  Mitochondrial substrate carrier family prote...    123   1e-26    
ref|XP_008923949.1|  PREDICTED: S-adenosylmethionine mitochondria...    121   1e-26    
sp|Q75AH6.2|AGC1_ASHGO  RecName: Full=Mitochondrial aspartate-glu...    127   1e-26    
ref|NP_984047.1|  ADL049Wp                                              127   1e-26    
gb|KHG15442.1|  Mitoferrin                                              122   1e-26    
gb|AEE62351.1|  unknown                                                 122   2e-26    
ref|XP_006306138.1|  hypothetical protein CARUB_v10011609mg             122   2e-26    
ref|XP_002298505.1|  hypothetical protein POPTR_0001s28920g             122   2e-26    
ref|XP_001785843.1|  predicted protein                                  121   2e-26    
ref|XP_010557188.1|  PREDICTED: mitoferrin-like                         122   2e-26    
ref|XP_008240021.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    123   2e-26    
gb|KFB34829.1|  AGAP003536-PA-like protein                              122   2e-26    
ref|XP_008318575.1|  PREDICTED: S-adenosylmethionine mitochondria...    121   2e-26    
ref|XP_006893932.1|  PREDICTED: S-adenosylmethionine mitochondria...    121   2e-26    
ref|XP_007270796.1|  mitochondrial carrier                              121   2e-26    
emb|CEG69395.1|  hypothetical protein RMATCC62417_05480                 121   2e-26    
ref|XP_010880095.1|  PREDICTED: S-adenosylmethionine mitochondria...    121   2e-26    
gb|ACE97973.1|  mitochondrial substrate carrier                         122   2e-26    
gb|KFK43021.1|  hypothetical protein AALP_AA1G068700                    122   2e-26    
ref|XP_002961989.1|  hypothetical protein SELMODRAFT_76024              121   2e-26    
emb|CEI99572.1|  hypothetical protein RMCBS344292_13658                 121   2e-26    
ref|XP_007520687.1|  PREDICTED: S-adenosylmethionine mitochondria...    124   2e-26    
ref|XP_010482020.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    123   3e-26    
ref|XP_002683284.1|  predicted protein                                  122   3e-26    
emb|CDY29693.1|  BnaA04g17340D                                          122   3e-26    
dbj|GAA97023.1|  hypothetical protein E5Q_03698                         121   3e-26    
ref|XP_005707898.1|  mitochondrial carrier (BOU / S-adenosylmethi...    121   3e-26    
gb|KFH65577.1|  hypothetical protein MVEG_09053                         121   3e-26    
ref|XP_004138196.1|  PREDICTED: uncharacterized mitochondrial car...    122   3e-26    
ref|XP_002971097.1|  hypothetical protein SELMODRAFT_95032              120   4e-26    
emb|CAN77961.1|  hypothetical protein VITISV_022947                     122   4e-26    
ref|XP_007013412.1|  Mitochondrial substrate carrier family protein     122   4e-26    
ref|XP_007893386.1|  PREDICTED: S-adenosylmethionine mitochondria...    120   4e-26    
gb|KDP31344.1|  hypothetical protein JCGZ_11720                         122   4e-26    
ref|XP_006063612.1|  PREDICTED: S-adenosylmethionine mitochondria...    120   4e-26    
ref|XP_005538556.1|  probable mitochondrial iron transporter Mrs3       123   4e-26    
ref|XP_003330116.1|  MC family mitochondrial carrier protein            120   5e-26    
gb|KGN63725.1|  hypothetical protein Csa_1G013240                       122   5e-26    
ref|XP_002838085.1|  hypothetical protein                               120   6e-26    
gb|KFK21962.1|  hypothetical protein AALP_AAs48252U001200               121   6e-26    
ref|XP_009343300.1|  PREDICTED: mitoferrin                              120   6e-26    
ref|XP_007209309.1|  hypothetical protein PRUPE_ppa007881mg             121   6e-26    
gb|KEY72776.1|  hypothetical protein S7711_02558                        119   7e-26    
emb|CEJ03404.1|  hypothetical protein RMCBS344292_17389                 119   7e-26    
ref|XP_002111865.1|  hypothetical protein TRIADDRAFT_23540              119   7e-26    
ref|XP_003544903.1|  PREDICTED: mitoferrin-like                         120   7e-26    
ref|XP_009338302.1|  PREDICTED: S-adenosylmethionine carrier 1, c...    121   7e-26    
ref|XP_007865182.1|  mitochondrial carrier                              120   8e-26    
ref|XP_001835514.1|  S-adenosylmethionine transporter                   119   8e-26    
ref|XP_004299303.1|  PREDICTED: uncharacterized mitochondrial car...    121   8e-26    
ref|XP_010445928.1|  PREDICTED: uncharacterized protein LOC104728670    125   8e-26    
ref|XP_008339130.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    121   9e-26    
ref|XP_001763497.1|  predicted protein                                  122   9e-26    
ref|XP_006488588.1|  PREDICTED: mitoferrin-like                         120   1e-25    
ref|XP_005537186.1|  similar to mitochondrial carrier protein           120   1e-25    
ref|XP_011046815.1|  PREDICTED: mitoferrin-like                         120   1e-25    
emb|CDY10242.1|  BnaC05g04850D                                          120   1e-25    
ref|XP_008237623.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    121   1e-25    
ref|XP_010496077.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    121   1e-25    
ref|XP_010264541.1|  PREDICTED: mitoferrin-like isoform X1              120   1e-25    
ref|XP_004143170.1|  PREDICTED: mitoferrin-like                         120   1e-25    
ref|XP_008673069.1|  PREDICTED: uncharacterized protein LOC100381...    124   1e-25    
ref|NP_001247985.1|  S-adenosylmethionine mitochondrial carrier p...    119   1e-25    
gb|EHH51203.1|  hypothetical protein EGM_10539                          119   1e-25    
ref|XP_003957931.1|  hypothetical protein KAFR_0F01990                  119   1e-25    
ref|XP_006281574.1|  hypothetical protein CARUB_v10027681mg             121   1e-25    
gb|AAF82217.1|AC067971_25  Strong similarity to a mitochondrial c...    124   1e-25    
ref|XP_007770940.1|  mitochondrial carrier                              119   1e-25    
ref|XP_010297970.1|  PREDICTED: S-adenosylmethionine mitochondria...    118   1e-25    
ref|XP_002813601.1|  PREDICTED: S-adenosylmethionine mitochondria...    119   1e-25    
ref|XP_007983107.1|  PREDICTED: S-adenosylmethionine mitochondria...    119   1e-25    
gb|AGO11725.1|  AaceriADL049Wp                                          124   1e-25    
ref|XP_009772780.1|  PREDICTED: mitochondrial substrate carrier f...    120   1e-25    
gb|KGQ83512.1|  solute carrier family 25 (mitochondrial S-adenosy...    118   1e-25    
ref|XP_003329602.1|  hypothetical protein PGTG_11352                    119   2e-25    
ref|XP_009360766.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    120   2e-25    
gb|EXX64885.1|  Pet8p                                                   119   2e-25    
gb|KFO09513.1|  S-adenosylmethionine mitochondrial carrier protein      118   2e-25    
gb|KGQ87408.1|  solute carrier family 25 (mitochondrial S-adenosy...    118   2e-25    
ref|XP_007201085.1|  hypothetical protein PRUPE_ppa006970mg             120   2e-25    
ref|XP_007104209.1|  PREDICTED: S-adenosylmethionine mitochondria...    118   2e-25    
gb|EMS24111.1|  mitochondrial carrier protein, S-adenosylmethioni...    119   2e-25    
ref|XP_006160429.1|  PREDICTED: S-adenosylmethionine mitochondria...    118   2e-25    
ref|XP_004268046.1|  PREDICTED: S-adenosylmethionine mitochondria...    118   2e-25    
gb|KDR10210.1|  hypothetical protein L798_15708                         119   2e-25    
ref|XP_006853870.1|  hypothetical protein AMTR_s00036p00123720          119   2e-25    
ref|XP_008463838.1|  PREDICTED: mitoferrin-like                         120   2e-25    
ref|XP_011008422.1|  PREDICTED: mitoferrin-like isoform X2              119   2e-25    
ref|XP_011008421.1|  PREDICTED: mitoferrin-like isoform X1              119   2e-25    
ref|XP_010457865.1|  PREDICTED: mitoferrin-like isoform X1              119   2e-25    
ref|NP_080531.2|  S-adenosylmethionine mitochondrial carrier protein    118   2e-25    
gb|KFD57435.1|  hypothetical protein M513_01538                         124   2e-25    
ref|XP_006160428.1|  PREDICTED: S-adenosylmethionine mitochondria...    118   2e-25    
gb|KFO54136.1|  S-adenosylmethionine mitochondrial carrier protein      117   2e-25    
ref|XP_003668814.1|  hypothetical protein NDAI_0B05380                  118   2e-25    
gb|KFD66541.1|  hypothetical protein M514_01538                         124   2e-25    
ref|XP_008373321.1|  PREDICTED: protein MITOFERRINLIKE 1, chlorop...    120   2e-25    
ref|XP_008038196.1|  mitochondrial carrier                              118   3e-25    
gb|AAH19156.1|  Solute carrier family 25 (mitochondrial carrier, ...    118   3e-25    



>ref|XP_009628339.1| PREDICTED: uncharacterized protein LOC104118722 [Nicotiana tomentosiformis]
Length=663

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/688 (53%), Positives = 447/688 (65%), Gaps = 64/688 (9%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             MA G+QP + +K    YR NLLEGA FELAD DRE++A +SSENK +N K    E +  E
Sbjct  1     MAGGSQPRQSEKPSVNYRRNLLEGALFELADFDRESHAPVSSENK-ENPK--SSESRSSE  57

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSAD  2127
             IM+T ELISA+G IWNSAA PL+ I+S +SS   + D +EN+I      ++  S+  S  
Sbjct  58    IMSTSELISAIGTIWNSAARPLTRIVSKSSSRCYSADHRENNISGCSAADEISSAYFSTY  117

Query  2126  GKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKRDYLWRFLRNGLDVQHKSSKG  1947
               + PV++  D DSS L   N E L  N+ +S F        LW  LR G  +  ++ K 
Sbjct  118   DHSIPVNVDSDTDSSPLALANVECLTVNQKVSLFSPLLGNSPLWNLLRGGSTMHPETWKA  177

Query  1946  IGLSSLRISYNLENVYGWMNEIAFSKSK--LGSSSIQNHEFGDCSLGNINSSSTNGCDVR  1773
               L+      +L  +Y WM+EI+  + +  L S++   HE   C+  +   S ++   + 
Sbjct  178   KNLAD-----DLHTMYDWMHEISLLRLEHHLNSANTGIHESRKCAEEDTTKSPSSYSTIA  232

Query  1772  DATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSAL----------------  1641
             D           N DC TD + T+      +         ++++                
Sbjct  233   DIV---------NADCQTDREKTAGSLLGQIAKDHEIDMVSTSISCLRHYNEVSPDKNSN  283

Query  1640  -----CSKNGNVLF-HVLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLD  1479
                  CSKN +V+  + L PN     +S +H  ++E H T++    ++ + EN       
Sbjct  284   TLEAPCSKNNSVVHEYSLPPNC---PASVLHKINAEDH-TNDSTTNEKVELEN-------  332

Query  1478  DYGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTV  1299
                        E NSE +ISV AK+KP + LAKQEHAFAGAMAGI VSLCLHP+DTIKTV
Sbjct  333   -----------ELNSEVQISV-AKDKPRYTLAKQEHAFAGAMAGILVSLCLHPVDTIKTV  380

Query  1298  IQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFL  1119
             +QSCR DQKP YYIGRS ISERGV  LYRGIS+N+ASSAPISALYTFTYESVKG L+P  
Sbjct  381   VQSCRGDQKPLYYIGRSFISERGVTALYRGISTNLASSAPISALYTFTYESVKGTLIPLF  440

Query  1118  HTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLY  939
               EYQS AHC AGGCAS+ATSFIFTPSER+KQQMQV SHYKNCWNAL+ IIR GGLPSLY
Sbjct  441   PKEYQSFAHCFAGGCASIATSFIFTPSERIKQQMQVGSHYKNCWNALVEIIRSGGLPSLY  500

Query  938   AGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTP  759
             AGW AVLCRN+PHSIIKFYTYE LK++  SSVQ   QN+TLMTLVCGGLAGSTAALFTTP
Sbjct  501   AGWRAVLCRNIPHSIIKFYTYEILKEVRLSSVQLRNQNDTLMTLVCGGLAGSTAALFTTP  560

Query  758   FDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYE  579
             FDVVKTRLQTQ+PGS    GVL TLKEIGK EGLKGLYRGL+PRLVMYMTQGALFFASYE
Sbjct  561   FDVVKTRLQTQIPGSRIQLGVLDTLKEIGKREGLKGLYRGLSPRLVMYMTQGALFFASYE  620

Query  578   SFKRLFSLDLHQSSAQRTHHEPCFGDDS  495
             SFKRLF+L++ Q  A+R  +E    DDS
Sbjct  621   SFKRLFALEIPQPKAERVKYEQSLEDDS  648



>ref|XP_009795670.1| PREDICTED: uncharacterized protein LOC104242340 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009795671.1| PREDICTED: uncharacterized protein LOC104242340 isoform X1 [Nicotiana 
sylvestris]
Length=655

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/688 (54%), Positives = 445/688 (65%), Gaps = 64/688 (9%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             MA G+Q  + +K    YR NLLEGA FELAD DRE++A +SSENK +N K +E      E
Sbjct  1     MAGGSQSRQNEKPSVNYRRNLLEGALFELADFDRESHAPVSSENK-ENPKSSESGSS--E  57

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSAD  2127
             IM+T +LISA+G IWNS A PL+ I+S +SS   + D +EN+I      ++  S+  S  
Sbjct  58    IMSTSDLISAIGTIWNSTARPLTRIVSKSSSRCYSADHRENNISGCSAADEISSAYFSTY  117

Query  2126  GKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKRDYLWRFLRNGLDVQHKSSKG  1947
               + PV++  D DSS     N E L  N+ +SFF        LW  LR G  +  ++ K 
Sbjct  118   DHSIPVNVDSDTDSSPPALANVECLTVNQKVSFFGPLLGNSPLWNLLRGGSTMHPETWKA  177

Query  1946  IGLSSLRISYNLENVYGWMNEIAFSKSK--LGSSSIQNHEFGDCSLGNINSSSTNGCDVR  1773
               L+      +L  +Y WM+EI+  K K  L S++   HE   C+  +   S ++   V 
Sbjct  178   KNLAD-----DLHTMYDWMHEISLLKLKHHLNSANTGIHESRKCADEDTTKSPSSYSTVA  232

Query  1772  DATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSG-------------------ASN  1650
             D           N DC TD++ T+     ++                           SN
Sbjct  233   DIV---------NADCQTDMEKTAGSLLGHIVKAHEIDRVSTGISCLRHYNEVSPDKKSN  283

Query  1649  S--ALCSKNGNVLF-HVLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLD  1479
             +   LCSKN +V+  + L PN     +S ++   +E H+       D T  E      L+
Sbjct  284   TLETLCSKNNSVVHEYSLPPNC---PASVLNKIYAEDHTN------DSTTNEKVE---LE  331

Query  1478  DYGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTV  1299
             D          E NSE +IS+ AK+KP + LAKQEHAFAGAMAGIFVSLCLHP+DTIKTV
Sbjct  332   D----------ELNSEVQISM-AKDKPRYTLAKQEHAFAGAMAGIFVSLCLHPVDTIKTV  380

Query  1298  IQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFL  1119
             +QSCR DQKP YYIGRS ISERGV  LYRGIS+N+ASSAPIS LYTFTYESVKGAL+P  
Sbjct  381   VQSCRGDQKPLYYIGRSFISERGVTALYRGISTNLASSAPISGLYTFTYESVKGALIPLF  440

Query  1118  HTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLY  939
               EYQS AHC AGGCAS+ATSFIFTPSER+KQQMQV SHYKNCWNAL+ IIR GGLPSLY
Sbjct  441   PKEYQSFAHCFAGGCASIATSFIFTPSERIKQQMQVGSHYKNCWNALVEIIRSGGLPSLY  500

Query  938   AGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTP  759
             AGW AVLCRN+PHSIIKFYTYE LK+L  SSVQ   QN+TLMTLVCGGLAGSTAALFTTP
Sbjct  501   AGWRAVLCRNIPHSIIKFYTYERLKELRFSSVQLRNQNDTLMTLVCGGLAGSTAALFTTP  560

Query  758   FDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYE  579
             FDVVKTRLQTQ+PGS    GVL TLKEIG  EGLKGLYRGL+PRLVMYMTQGALFFASYE
Sbjct  561   FDVVKTRLQTQIPGSRIQLGVLDTLKEIGTREGLKGLYRGLSPRLVMYMTQGALFFASYE  620

Query  578   SFKRLFSLDLHQSSAQRTHHEPCFGDDS  495
             SFK+LFSL++ Q  A+R  +E    DDS
Sbjct  621   SFKKLFSLEIPQPKAERVAYEQSLEDDS  648



>ref|XP_006343981.1| PREDICTED: mitochondrial aspartate-glutamate transporter AGC1-like 
[Solanum tuberosum]
Length=652

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/674 (55%), Positives = 444/674 (66%), Gaps = 28/674 (4%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             MA G+QP + DK   +YRCNLL+GA FE+ D DR++ A ISS NK +N + ++ E    E
Sbjct  1     MAGGSQPRQSDKPSIRYRCNLLDGALFEITDLDRQSNAPISSGNK-ENPRNSDSESS--E  57

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMED---SCSSPP  2136
             IM+T ELISAVG+IW+SAA P++ ILS ASS   N D QEN+I  +   +     C SPP
Sbjct  58    IMSTSELISAVGSIWDSAARPVTRILSKASSRCNNTDHQENNIFGYSTADKISGVCFSPP  117

Query  2135  SADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKRDYLWRFLRNGLDVQHKS  1956
                  + PV++  D DSS L   N E L AN+ +SFF        L   L +   +  ++
Sbjct  118   D---HSIPVNVDSDTDSSPLQLANVEQLTANQKVSFFGPLLGSSSLQSVLHDRSTMHPET  174

Query  1955  SKGIGLSSLRISYNLENVYGWMNEIAFSKSK--LGSSSIQNHEFGDCSLGNINSSSTNGC  1782
              K        ++Y L+NVYGWM+E +  K K  L  +SI  HE   C++ +  +S  + C
Sbjct  175   RKAKDF----VNY-LQNVYGWMHEASLLKFKQQLNCASIGCHENRKCTIEDTTNSPLSCC  229

Query  1781  DVRDATSCSDNLSAGNTDCHTDIK-PTsslsshnlnlhksSGASNSALCSKNGNVLFHVL  1605
              V D           N DC TD + P  SL S      +    S      ++ N +FH  
Sbjct  230   SVVDTV---------NADCRTDREEPAGSLLSQIAKHDEIDRVSTGTSSLRHYNEVFHDK  280

Query  1604  EPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFGGIECNSESE  1425
             + N  ++S SE      E +S +  C+       N  D   D     +     E +SE +
Sbjct  281   KSNTLEISCSENKSVFHE-YSVTPTCSASVDDKVNAKDHIYDSAINEKVELEEELSSEVQ  339

Query  1424  ISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSV  1245
             ISV AKEKP +ALAKQEHAFAGAMAGIFVSLCLHP+DTIKTVIQSC  DQKP YYIGRS 
Sbjct  340   ISV-AKEKPRYALAKQEHAFAGAMAGIFVSLCLHPVDTIKTVIQSCPNDQKPLYYIGRSF  398

Query  1244  ISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASV  1065
             ISERGV  LYRGIS+N+ASSAPISALYTFTYESVKG LLP    E  S AHC+AGGCAS+
Sbjct  399   ISERGVTALYRGISTNLASSAPISALYTFTYESVKGTLLPLFPKECHSFAHCLAGGCASI  458

Query  1064  ATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKF  885
             ATSFIFTPSER+KQQMQV SHYKNCW+ALI IIR GGLPSLYAGW AVL RN+PHSIIKF
Sbjct  459   ATSFIFTPSERIKQQMQVGSHYKNCWDALIVIIRSGGLPSLYAGWKAVLWRNIPHSIIKF  518

Query  884   YTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQY  705
             YTYE LK+L  SSVQ   QN+TLMTL CGGLAGSTAALFTTPFDVVKTRLQTQ+PGS   
Sbjct  519   YTYERLKELRLSSVQLRNQNDTLMTLACGGLAGSTAALFTTPFDVVKTRLQTQIPGSTTQ  578

Query  704   DGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRT  525
              GV  TL+EI K EGLKGLYRGL+PRL+MYMTQGALFFASYESFK++FSLD+ Q   +  
Sbjct  579   FGVFGTLQEIAKREGLKGLYRGLSPRLIMYMTQGALFFASYESFKKIFSLDIPQPKTETV  638

Query  524   HHEPCFGDDSTLSS  483
              +E    D + L+S
Sbjct  639   PYEHKEDDPAMLTS  652



>ref|XP_010325670.1| PREDICTED: uncharacterized protein LOC101257884 [Solanum lycopersicum]
Length=1013

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/692 (53%), Positives = 451/692 (65%), Gaps = 34/692 (5%)
 Frame = -3

Query  2528  LLHFHSLPQLF--CDKMAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSEN  2355
             LL F+ L  +   CD MA G+QP + DK   +YRCNLL+GA FE+ D DR++ A ISS N
Sbjct  344   LLAFYILENILNHCDNMAGGSQPRQSDKPSIRYRCNLLDGALFEITDLDRQSNAPISSGN  403

Query  2354  KKQNNKIAERERKPPEIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDIL  2175
             K +N K ++ E    +IM+T ELISAVG+IW SAA P++ ILS  SS   N D QEN+I 
Sbjct  404   K-ENPKNSDSESS--KIMSTSELISAVGSIWCSAAGPVTRILSKGSSRCNNTDHQENNIF  460

Query  2174  YFPPMED---SCSSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKRD  2004
              +   +     C SPP     + PV+L  D DSS L+  N E L AN+ +SFF       
Sbjct  461   GYSTADKISGVCFSPPD---HSIPVNLDSDTDSSPLLLANVERLTANQKVSFFGPLLGSS  517

Query  2003  YLWRFL--RNGLDVQHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSK--LGSSSIQNH  1836
              L   L  R+ +  +++ +K        ++Y L+NVYGW++E +  K K  L  +S    
Sbjct  518   SLQSLLHDRSTMHPENRKAKDF------VNY-LQNVYGWIHEASLLKFKQQLNCASFGCP  570

Query  1835  EFGDCSLGNINSSSTNGCDVRDATSCSDNLSAGNTDCHTDIK-PTsslsshnlnlhksSG  1659
             E   C++ ++ ++  + C V D           NTDC TD + P  SL S      +   
Sbjct  571   ENRKCTIEDMTNNPLSCCSVVDTV---------NTDCQTDREEPDGSLLSQMAKHDEIDR  621

Query  1658  ASNSALCSKNGNVLFHVLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLD  1479
              S      ++ N +FH  + N   +S SE +     ++S +  C+       N  D  + 
Sbjct  622   VSTGTSSIRHYNEVFHDKKSNTLGISHSE-NNLVFHEYSVTPSCSASVHDKINAKDH-IY  679

Query  1478  DYGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTV  1299
             D   N++    E  S      VAKEKP +ALAKQEHAFAGAMAGIFVSLCLHP+DTIKTV
Sbjct  680   DSAINEKVELEEELSSEVQRSVAKEKPLYALAKQEHAFAGAMAGIFVSLCLHPVDTIKTV  739

Query  1298  IQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFL  1119
             IQSC  DQKP YYIGRS ISERGV  LYRGIS+N+ASSAPISALYTFTYESVKGALLP  
Sbjct  740   IQSCPNDQKPLYYIGRSFISERGVTALYRGISTNLASSAPISALYTFTYESVKGALLPLF  799

Query  1118  HTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLY  939
               E  S AHC+AGG AS+ATSFIFTPSER+KQQMQV SHYKNCW+ALI I R GGLPSLY
Sbjct  800   PKECHSFAHCLAGGSASIATSFIFTPSERIKQQMQVGSHYKNCWSALIVITRSGGLPSLY  859

Query  938   AGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTP  759
             AGW AVL RN+PHSIIKFYTYE LK+L  SSVQ   QN+TLMTL CGGLAGSTAALFTTP
Sbjct  860   AGWKAVLWRNIPHSIIKFYTYERLKELRLSSVQLRNQNDTLMTLACGGLAGSTAALFTTP  919

Query  758   FDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYE  579
             FDVVKTRLQTQ+PGS    GV  TL+EI K EGLKGLYRGL+PRL+MYMTQGALFFASYE
Sbjct  920   FDVVKTRLQTQIPGSMTQFGVFGTLQEIAKREGLKGLYRGLSPRLIMYMTQGALFFASYE  979

Query  578   SFKRLFSLDLHQSSAQRTHHEPCFGDDSTLSS  483
             SFK++FSLD+ Q   +   +E    D +TL S
Sbjct  980   SFKKIFSLDIPQPKTETVPYEHKEDDHATLPS  1011



>ref|XP_010660679.1| PREDICTED: uncharacterized protein LOC100853340 [Vitis vinifera]
 ref|XP_010660686.1| PREDICTED: uncharacterized protein LOC100853340 [Vitis vinifera]
 ref|XP_010660690.1| PREDICTED: uncharacterized protein LOC100853340 [Vitis vinifera]
Length=663

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/676 (48%), Positives = 432/676 (64%), Gaps = 28/676 (4%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             M + ++ PK D+  T YR   L+ A FE      E+Y     +N  +  K+ E   K  E
Sbjct  1     MGFCSKQPKRDQPSTNYRYKSLKQASFEFV---HEDYGGTLPDNDNRRAKVMES--KSCE  55

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSAD  2127
             I++T ELISAVG IW+ A+ PLS     A+S H + D  +  +L +   E     P SA+
Sbjct  56    ILSTAELISAVGQIWDCASRPLSIFQPKANSKHNDTDSNKEKVLCYLGGEGYVRVPTSAN  115

Query  2126  GKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFE---SRNKRDYLWRFLRNGLDVQHKS  1956
              K   + L      S +V  N E LN  + +S FE     N   +  R LR G ++ +++
Sbjct  116   SKYFCIDLKTASLFSPMVQPNIEHLNITQKMSLFEPGNGNNAHSFFLRCLRGGANMPNET  175

Query  1955  SKGIGLSSLRISYNLENVYGWMNEIAFS--KSKLGSSSIQNHEFGDCSLGNINSSSTNGC  1782
              K +GL+++ ISY+L N+Y WM++I     +S +  + I+N +  +C +   ++++T GC
Sbjct  176   WKEMGLTNVGISYDLGNIYRWMSKITLDTLRSPVDITQIENMKTKECCISK-DATNTAGC  234

Query  1781  DVR-DATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVL  1605
              +  D    +++ +  + DC+T +    +  +       + G S S+LC+      + + 
Sbjct  235   GINIDVAIPANHPATESADCYTGV----TEGNGANERVMNIGVSISSLCTD-----YFLG  285

Query  1604  EPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYE--NRSDSGLDDYGPNQRFGGIECNSE  1431
               +      S     SSE H+ S + +  +  +E       G+D     Q+    +   +
Sbjct  286   ADHGIAAGDSISRTPSSELHADSNFLSSTDFAFEECQHKTEGVD----RQKEFVTKDKLK  341

Query  1430  SEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGR  1251
              E     ++K  + LAKQEHAFAGA AG+FVSLCLHP+DTIKTVIQSC+ADQK  + +GR
Sbjct  342   METCPSKQDKHHYVLAKQEHAFAGAFAGVFVSLCLHPVDTIKTVIQSCQADQKSIFSVGR  401

Query  1250  SVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCA  1071
              +IS+RG+ G YRGI+SNIASSAPISA+YTFTYESVKGALLP    E  S+AHC+AGGCA
Sbjct  402   LIISQRGLAGFYRGITSNIASSAPISAVYTFTYESVKGALLPLFPKECHSIAHCMAGGCA  461

Query  1070  SVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSII  891
             S+ATSFIFTPSE +KQQMQ+ SHY+NCWNAL+GII++GGLPSLYAGWGAVLCRNVPHSII
Sbjct  462   SIATSFIFTPSEHIKQQMQIGSHYQNCWNALVGIIKKGGLPSLYAGWGAVLCRNVPHSII  521

Query  890   KFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-  714
             KFYTYESLKQLM  S+Q + + NTL TL CGGLAGSTAA FTTPFDVVKTRLQTQ+PGS 
Sbjct  522   KFYTYESLKQLMLPSLQPNAKPNTLQTLACGGLAGSTAAFFTTPFDVVKTRLQTQIPGSM  581

Query  713   NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSA  534
              QY+ V HTL+EI K EGL+GLYRGLTPRLVMY++QGALFFASYE FK LF L++ +  A
Sbjct  582   KQYNSVFHTLQEISKHEGLRGLYRGLTPRLVMYVSQGALFFASYEFFKSLFCLEMPKLHA  641

Query  533   QRTHHEPCFGDDSTLS  486
             Q   H+     DST S
Sbjct  642   QTIPHKQYMEGDSTSS  657



>emb|CBI34669.3| unnamed protein product [Vitis vinifera]
Length=615

 Score =   540 bits (1392),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 309/625 (49%), Positives = 409/625 (65%), Gaps = 29/625 (5%)
 Frame = -3

Query  2324  ERKPPEIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCS  2145
             E K  EI++T ELISAVG IW+ A+ PLS     A+S H + D  +  +L +   E    
Sbjct  2     ESKSCEILSTAELISAVGQIWDCASRPLSIFQPKANSKHNDTDSNKEKVLCYLGGEGYVR  61

Query  2144  SPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFE---SRNKRDYLWRFLRNGL  1974
              P SA+ K   + L      S +V  N E LN  + +S FE     N   +  R LR G 
Sbjct  62    VPTSANSKYFCIDLKTASLFSPMVQPNIEHLNITQKMSLFEPGNGNNAHSFFLRCLRGGA  121

Query  1973  DVQHKSSKGIGLSSLRISYNLENVYGWMNEIAFS--KSKLGSSSIQNHEFGDCSLGNINS  1800
             ++ +++ K +GL+++ ISY+L N+Y WM++I     +S +  + I+N +  +C +   ++
Sbjct  122   NMPNETWKEMGLTNVGISYDLGNIYRWMSKITLDTLRSPVDITQIENMKTKECCISK-DA  180

Query  1799  SSTNGCDVR-DATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGN  1623
             ++T GC +  D    +++ +  + DC+T +    +  +       + G S S+LC+    
Sbjct  181   TNTAGCGINIDVAIPANHPATESADCYTGV----TEGNGANERVMNIGVSISSLCTD---  233

Query  1622  VLFHVLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYE--NRSDSGLD---DYGPNQR  1458
               + +   +      S     SSE H+ S + +  +  +E       G+D   ++    +
Sbjct  234   --YFLGADHGIAAGDSISRTPSSELHADSNFLSSTDFAFEECQHKTEGVDRQKEFVTKDK  291

Query  1457  FGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRAD  1278
                  C S+       ++K  + LAKQEHAFAGA AG+FVSLCLHP+DTIKTVIQSC+AD
Sbjct  292   LKMETCPSK-------QDKHHYVLAKQEHAFAGAFAGVFVSLCLHPVDTIKTVIQSCQAD  344

Query  1277  QKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSV  1098
             QK  + +GR +IS+RG+ G YRGI+SNIASSAPISA+YTFTYESVKGALLP    E  S+
Sbjct  345   QKSIFSVGRLIISQRGLAGFYRGITSNIASSAPISAVYTFTYESVKGALLPLFPKECHSI  404

Query  1097  AHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVL  918
             AHC+AGGCAS+ATSFIFTPSE +KQQMQ+ SHY+NCWNAL+GII++GGLPSLYAGWGAVL
Sbjct  405   AHCMAGGCASIATSFIFTPSEHIKQQMQIGSHYQNCWNALVGIIKKGGLPSLYAGWGAVL  464

Query  917   CRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
             CRNVPHSIIKFYTYESLKQLM  S+Q + + NTL TL CGGLAGSTAA FTTPFDVVKTR
Sbjct  465   CRNVPHSIIKFYTYESLKQLMLPSLQPNAKPNTLQTLACGGLAGSTAAFFTTPFDVVKTR  524

Query  737   LQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLF  561
             LQTQ+PGS  QY+ V HTL+EI K EGL+GLYRGLTPRLVMY++QGALFFASYE FK LF
Sbjct  525   LQTQIPGSMKQYNSVFHTLQEISKHEGLRGLYRGLTPRLVMYVSQGALFFASYEFFKSLF  584

Query  560   SLDLHQSSAQRTHHEPCFGDDSTLS  486
              L++ +  AQ   H+     DST S
Sbjct  585   CLEMPKLHAQTIPHKQYMEGDSTSS  609



>ref|XP_007040233.1| Mitochondrial substrate carrier family protein, putative isoform 
3 [Theobroma cacao]
 gb|EOY24734.1| Mitochondrial substrate carrier family protein, putative isoform 
3 [Theobroma cacao]
Length=696

 Score =   542 bits (1397),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 333/668 (50%), Positives = 416/668 (62%), Gaps = 18/668 (3%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYA-TISSENKKQNNKIAERERKPP  2310
             M     P + D+   KYR    EGAFFE+     E YA ++  +N+K   K    E K P
Sbjct  1     MPASKNPCRSDQPSIKYRWRADEGAFFEVGKLVPEEYAPSLPDKNRKSRTK---SETKEP  57

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSA  2130
             EI++T ELIS++  IWN A+  L+     A+    +   Q+ DIL     E++ +   SA
Sbjct  58    EILSTAELISSLNQIWNCASR-LTIFQQQANLDRNHFVSQKEDILVNLGREENGTGSISA  116

Query  2129  DGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNGLDVQHK  1959
             D K   V L         +  N + +   + +S F+  NK     +    L  G D+ +K
Sbjct  117   DSKYFCVDLGTASQLPPAMKPNFKFVKITKKMSMFDFCNKNPKCSFYQGLLCCGTDLSNK  176

Query  1958  SSKGIGLSSLRISYNLENVYGWMNEIAFSKSKL-GSSSIQNHEFGD-CSLGNINSSSTNG  1785
             S K  GLS++  SY   NVY WM E+     K   +   +N + G  C +G   SS + G
Sbjct  177   SWKAKGLSAVGFSYEFGNVYKWMREMIPGGLKYYVNVQTENKKLGKYCDVGG-TSSDSGG  235

Query  1784  CDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVL  1605
             C   D T+ +DNL   N + ++    +   S  +           ++LCS     L  V 
Sbjct  236   CISADRTNPTDNLPTENAEPYSHCIKSIDSSILHDAKLVMDTRRTTSLCSDY--FLTSVQ  293

Query  1604  EPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFG----GIECN  1437
             E  A    S          +  +   +C  T  E +  S  ++   N+R        E +
Sbjct  294   ETKANCSVSRTPDSNLCADYHINVLASCSSTYKECQHLSDGNECLKNERKQPEPFSTEDD  353

Query  1436  SESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYI  1257
             S  E    A EKP  ALAKQEHAFAGA AGIFVSLCLHP+DT+KTVIQSCRA+QK   +I
Sbjct  354   SRMESHSTASEKPQFALAKQEHAFAGAFAGIFVSLCLHPVDTVKTVIQSCRAEQKSICFI  413

Query  1256  GRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGG  1077
             GRS+ISERG+ GLYRGI+SNIASSAPISALYTF+YESVKGALLP    EY S+AHC+AGG
Sbjct  414   GRSIISERGLTGLYRGIASNIASSAPISALYTFSYESVKGALLPLFPKEYHSLAHCMAGG  473

Query  1076  CASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHS  897
             CAS+ATSFIFTPSERVKQQMQV  HY+NCWNAL+GI+++GGLPSLY GWGAVLCRNVPHS
Sbjct  474   CASIATSFIFTPSERVKQQMQVGVHYQNCWNALVGIVKKGGLPSLYTGWGAVLCRNVPHS  533

Query  896   IIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPG  717
             IIKFYTYESLKQ+M +S+Q   Q NTL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ+PG
Sbjct  534   IIKFYTYESLKQVMLTSLQSSAQPNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQIPG  593

Query  716   -SNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQS  540
              S+QY+ V H L++I   EGLKGLYRGL PRLVMY++QGALFFASYE FK+LFSL++ Q 
Sbjct  594   SSSQYNSVYHALQDIRAQEGLKGLYRGLIPRLVMYVSQGALFFASYEFFKQLFSLEVPQF  653

Query  539   SAQRTHHE  516
               Q+ H E
Sbjct  654   IIQKQHME  661



>ref|XP_007040231.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24732.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma 
cacao]
Length=733

 Score =   542 bits (1397),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 333/668 (50%), Positives = 416/668 (62%), Gaps = 18/668 (3%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYA-TISSENKKQNNKIAERERKPP  2310
             M     P + D+   KYR    EGAFFE+     E YA ++  +N+K   K    E K P
Sbjct  1     MPASKNPCRSDQPSIKYRWRADEGAFFEVGKLVPEEYAPSLPDKNRKSRTK---SETKEP  57

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSA  2130
             EI++T ELIS++  IWN A+  L+     A+    +   Q+ DIL     E++ +   SA
Sbjct  58    EILSTAELISSLNQIWNCASR-LTIFQQQANLDRNHFVSQKEDILVNLGREENGTGSISA  116

Query  2129  DGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNGLDVQHK  1959
             D K   V L         +  N + +   + +S F+  NK     +    L  G D+ +K
Sbjct  117   DSKYFCVDLGTASQLPPAMKPNFKFVKITKKMSMFDFCNKNPKCSFYQGLLCCGTDLSNK  176

Query  1958  SSKGIGLSSLRISYNLENVYGWMNEIAFSKSKL-GSSSIQNHEFGD-CSLGNINSSSTNG  1785
             S K  GLS++  SY   NVY WM E+     K   +   +N + G  C +G   SS + G
Sbjct  177   SWKAKGLSAVGFSYEFGNVYKWMREMIPGGLKYYVNVQTENKKLGKYCDVGG-TSSDSGG  235

Query  1784  CDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVL  1605
             C   D T+ +DNL   N + ++    +   S  +           ++LCS     L  V 
Sbjct  236   CISADRTNPTDNLPTENAEPYSHCIKSIDSSILHDAKLVMDTRRTTSLCSDY--FLTSVQ  293

Query  1604  EPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFG----GIECN  1437
             E  A    S          +  +   +C  T  E +  S  ++   N+R        E +
Sbjct  294   ETKANCSVSRTPDSNLCADYHINVLASCSSTYKECQHLSDGNECLKNERKQPEPFSTEDD  353

Query  1436  SESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYI  1257
             S  E    A EKP  ALAKQEHAFAGA AGIFVSLCLHP+DT+KTVIQSCRA+QK   +I
Sbjct  354   SRMESHSTASEKPQFALAKQEHAFAGAFAGIFVSLCLHPVDTVKTVIQSCRAEQKSICFI  413

Query  1256  GRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGG  1077
             GRS+ISERG+ GLYRGI+SNIASSAPISALYTF+YESVKGALLP    EY S+AHC+AGG
Sbjct  414   GRSIISERGLTGLYRGIASNIASSAPISALYTFSYESVKGALLPLFPKEYHSLAHCMAGG  473

Query  1076  CASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHS  897
             CAS+ATSFIFTPSERVKQQMQV  HY+NCWNAL+GI+++GGLPSLY GWGAVLCRNVPHS
Sbjct  474   CASIATSFIFTPSERVKQQMQVGVHYQNCWNALVGIVKKGGLPSLYTGWGAVLCRNVPHS  533

Query  896   IIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPG  717
             IIKFYTYESLKQ+M +S+Q   Q NTL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ+PG
Sbjct  534   IIKFYTYESLKQVMLTSLQSSAQPNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQIPG  593

Query  716   -SNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQS  540
              S+QY+ V H L++I   EGLKGLYRGL PRLVMY++QGALFFASYE FK+LFSL++ Q 
Sbjct  594   SSSQYNSVYHALQDIRAQEGLKGLYRGLIPRLVMYVSQGALFFASYEFFKQLFSLEVPQF  653

Query  539   SAQRTHHE  516
               Q+ H E
Sbjct  654   IIQKQHME  661



>emb|CDP12025.1| unnamed protein product [Coffea canephora]
Length=679

 Score =   535 bits (1377),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 339/668 (51%), Positives = 420/668 (63%), Gaps = 13/668 (2%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             MA   QPP+ DK   KYRC+ L+GA FEL D   ++Y + SS    +N K    +    +
Sbjct  1     MAGAGQPPRRDKPSIKYRCSSLDGASFELVDFGGKDYVSASS---NKNKKSRTPDSTSSQ  57

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSAD  2127
             I++TRELISA+G+IWN A   LS ++S ++  + +   Q+  IL +P  E +C++   AD
Sbjct  58    ILSTRELISALGSIWNCANGILSSLVSKSTFRYDDDCLQKCTILCYPSGERACNACMVAD  117

Query  2126  GKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFE-SRNKRDYLWRFLRNGLDVQHKSSK  1950
              +N  V+     DS  +   N   L     ISF + S      L R L +   +  +S K
Sbjct  118   NQNDTVNPVRVGDSPPVFYANLRYLKVVDKISFVQPSSGTYLLLRRLLHSSYRMPQESWK  177

Query  1949  GIGLSSLRISYNLENVYGWMNEIAFS--KSKLGSSSIQNHEFGDCSLGNINSSSTNGCDV  1776
               G  +  +  +LE +Y WM EIA S  K +L  + ++  +  D   G+ N S    C V
Sbjct  178   EKGFPNSNLGCDLEKMYSWMTEIALSNPKCQLNFNPMEKQDTDDYHGGH-NRSDPTTCSV  236

Query  1775  RDATS-CSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVLEP  1599
                    + NL   N +  TD        S   N    S  +++ L +++  V    +  
Sbjct  237   SVIEPIVATNLITENGNSETDEIQLRGSLSVQNNDPAKSKRASATLWTEDRTV--RDVNA  294

Query  1598  NAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFGGIECNSESEIS  1419
                ++ SS     S      S  C  +E++   ++D    +    Q    I  NSE +I 
Sbjct  295   CTSELPSSNAPANSLGCLLLSGVCNTEESEISVQTDQQETEKHQQQELV-IGDNSEMQIC  353

Query  1418  VVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             +  KEK   A+AKQ HAFAGAMAG+FVSLCLHP+DTIKTV+QS RADQK  + I RS+IS
Sbjct  354   LPMKEKSHTAVAKQGHAFAGAMAGVFVSLCLHPVDTIKTVVQSGRADQKSLHDISRSIIS  413

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
             +RGV GLYRGIS+NIASSAPISA+YTFTYE VKG LLPF   EYQS+AHC+AGGCASVAT
Sbjct  414   QRGVTGLYRGISTNIASSAPISAVYTFTYEWVKGNLLPFFPKEYQSLAHCIAGGCASVAT  473

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             SFIFTPSER+KQQMQV S Y+NCWNAL+GII +GGLPSLYAGW AVLCRN+PHSIIKFYT
Sbjct  474   SFIFTPSERIKQQMQVGSRYQNCWNALVGIIEKGGLPSLYAGWAAVLCRNIPHSIIKFYT  533

Query  878   YESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYD  702
             YESLKQL  S VQ + Q NTL+TLV GGLAGSTAALFTTPFDVVKTRLQTQ PGS NQ  
Sbjct  534   YESLKQLF-SQVQLNGQTNTLVTLVSGGLAGSTAALFTTPFDVVKTRLQTQTPGSRNQCP  592

Query  701   GVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTH  522
             GV  TL+EI K EGLKGLY GLTPRL MYMTQGALFFASYESFK +FSLD  Q + Q   
Sbjct  593   GVFDTLREIAKKEGLKGLYGGLTPRLFMYMTQGALFFASYESFKTVFSLDSSQVNVQACR  652

Query  521   HEPCFGDD  498
             HE    DD
Sbjct  653   HEQVKEDD  660



>gb|KDP25434.1| hypothetical protein JCGZ_20590 [Jatropha curcas]
Length=676

 Score =   528 bits (1360),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 325/681 (48%), Positives = 430/681 (63%), Gaps = 27/681 (4%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             M+   +PP+ D+    YR N +EGA F+L +   E++A+  S+ K+Q++   E+  K  +
Sbjct  1     MSGSKRPPRSDQPSIAYRQNQVEGASFDLTNFVLEDHASSKSKKKQQSSIYTEQ--KSLQ  58

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMED-SCSSPPSA  2130
             +++T ELISAVG IWN  + PL+   S   S H     ++N IL    ++D   +     
Sbjct  59    MLSTTELISAVGQIWNLVS-PLASSESEVKSNHNGSGSEKNVILDGLVVKDVGAADLKDD  117

Query  2129  DGKNTPVHLSCDKDSSLLVSKNPESLNANR---NISFFESRNKRDYLWRFLRNGLDVQHK  1959
             D +   + +    +++ L+    E L   +   N+  +     R    +F++    + ++
Sbjct  118   DCRRFNIDVRTTSNTTALIQPKFEFLKVTQKMLNLEPYSENYMRPLFSQFMKGNNILTNE  177

Query  1958  SSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEF--GDCSLGNINSSSTNG  1785
               KG GL+S+ I Y  E++YGWM E   +  +  S +    E    DC+ GN   S  +G
Sbjct  178   FQKGKGLASVEILYEFESIYGWMKETIPANLRCHSVTRNKEEKTNKDCASGNA-FSHRDG  236

Query  1784  CDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVL  1605
             C   DAT   +N +  + DC++    +      +         + S+LCS       + L
Sbjct  237   CFSGDATHPGNNNALRSADCYSGSVKSKDEWLGDNMKVAMETETISSLCSD------YFL  290

Query  1604  EP---NAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDY--GPNQRFGGIEC  1440
             +P   N  + S S   G S       ++ A  +T         +DDY    + R      
Sbjct  291   QPPHDNNVRGSFSRALGSSLYLDHHIDFLATHKTS-SGTFQHNIDDYRIAESTRKPHQMV  349

Query  1439  NSESEISVVAK----EKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQK  1272
              SE +I +  +    ++PC+ALAKQEHA+AGA AGIFVS+CLHP+DTIKTV QSC A+QK
Sbjct  350   VSEDKILLDIRSPPCKQPCYALAKQEHAYAGAFAGIFVSVCLHPVDTIKTVTQSCHAEQK  409

Query  1271  PFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAH  1092
                 IGRS++SERG+ G YRGI+SNIASSAPISA+YTFTYESVKG+LLP    EY S+AH
Sbjct  410   SICNIGRSIVSERGLTGFYRGIASNIASSAPISAIYTFTYESVKGSLLPHFSKEYHSLAH  469

Query  1091  CVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCR  912
             C+AGG AS+ATSF+FTPSER+KQQMQ+ SHY NCWNALIGII +GGLPSLYAGWGAVLCR
Sbjct  470   CIAGGSASIATSFVFTPSERIKQQMQIGSHYHNCWNALIGIIGKGGLPSLYAGWGAVLCR  529

Query  911   NVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQ  732
             NVPHSIIKFYTYESLKQLM SS   D Q NTL TLVCGGLAGSTAALFTTPFDVVKTRLQ
Sbjct  530   NVPHSIIKFYTYESLKQLMLSSQNSDAQPNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQ  589

Query  731   TQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSL  555
              Q+PGS ++Y  V H LKEIGK+EGLKGLYRGL PRLV+Y++QGALFFASYE FKRLF+L
Sbjct  590   IQIPGSMSKYQSVFHALKEIGKNEGLKGLYRGLIPRLVIYLSQGALFFASYEFFKRLFTL  649

Query  554   DLHQSSAQRTHHEPCFGDDST  492
             ++ Q +A+ T ++    DDST
Sbjct  650   EVPQLNARGTQYKESMEDDST  670



>gb|EYU23473.1| hypothetical protein MIMGU_mgv1a002748mg [Erythranthe guttata]
Length=641

 Score =   526 bits (1356),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 333/679 (49%), Positives = 408/679 (60%), Gaps = 74/679 (11%)
 Frame = -3

Query  2465  PKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKP--PEIMTTR  2292
             P+ +K+   +R NL +GA FEL D D       +      N+K   R   P   E+++T 
Sbjct  8     PRNEKISVGHRNNLFKGAVFELKDFD------YTDSKPSGNDKCTLRNSDPQSSEVLSTS  61

Query  2291  ELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSADGKNTP  2112
             +LISAVG  W+ A  PLS +L   +SA +    +    L +   E +     SA+ +   
Sbjct  62    DLISAVGYAWDCAKKPLSVLLPKTNSASKTDVIEGGGRLQYITDEGTFREANSANDQPFS  121

Query  2111  VHLSCDKDSSLLVSKNPESLNANRNISFFESRNKRDYLWRFLRNGLDVQHKSSKGIGLSS  1932
             ++L+  ++S+ LV++N E      +  FF         WR +     V    S    LSS
Sbjct  122   IYLNSKENSAKLVNENRELSCRQPSYEFFS-------FWRIVLARSTVIEGCSVDNCLSS  174

Query  1931  LRISYNLENVYGWMNEIAFSKSKLGSSSIQ-------NHEFGDCSLGNINS----SSTNG  1785
               I  NL ++YG  +EIA +K K  +SS +       N    DCS    NS     S + 
Sbjct  175   TGILANLGSIYGCTSEIALAKRKNEASSAKIEIKKTSNCYIDDCSTSTCNSFTGVISASK  234

Query  1784  CDVRD------ATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGN  1623
              +V +       T CS+N          DI         +     S G+ NS   S+N  
Sbjct  235   SEVEEPLNRLSTTRCSEN----------DILHVPHTEDVSNLPLLSHGSENSVNESRNS-  283

Query  1622  VLFHVLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFGGIE  1443
              L    E    + S SEV    SEK                          P   F   E
Sbjct  284   -LHEHREGIKLEKSESEVKFSLSEKEK------------------------PQYAFAKQE  318

Query  1442  CNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
              ++E + S+  KEKP +A AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSC ADQK  +
Sbjct  319   -HAEVKFSLSEKEKPQYAFAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCPADQKALH  377

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
              IGRS+I+ERGV GLYRGISSNI SSAPISA+YTFTYESVK +LLP L  EY S+AHC A
Sbjct  378   TIGRSIITERGVSGLYRGISSNILSSAPISAVYTFTYESVKKSLLPMLPKEYHSLAHCAA  437

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             GGCAS+ATSFIFTPSER+KQQMQV SHY+NCWNALI +++ GGLPSLY GW AVLCRNVP
Sbjct  438   GGCASIATSFIFTPSERIKQQMQVGSHYRNCWNALIQVVKNGGLPSLYTGWAAVLCRNVP  497

Query  902   HSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV  723
             HSIIKFYTYE LKQ+M  S Q + + N + TLVCGGLAGSTA+LFTTPFDVVKTRLQTQ+
Sbjct  498   HSIIKFYTYERLKQMMLPSNQSNAEANIVQTLVCGGLAGSTASLFTTPFDVVKTRLQTQI  557

Query  722   PGSN-QYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLH  546
             PGS  QY+GV +TL EIGK EGLKGLYRGLTPRLVMYM QGALFFASYESFKRL SL++ 
Sbjct  558   PGSTAQYNGVYNTLTEIGKREGLKGLYRGLTPRLVMYMIQGALFFASYESFKRLLSLEVS  617

Query  545   QSSAQRTHHEPCFGDDSTL  489
             +S+    H E    D+ST+
Sbjct  618   KSTFHHVHKE----DNSTV  632



>ref|XP_006439547.1| hypothetical protein CICLE_v10019111mg [Citrus clementina]
 gb|ESR52787.1| hypothetical protein CICLE_v10019111mg [Citrus clementina]
Length=696

 Score =   522 bits (1344),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 325/687 (47%), Positives = 413/687 (60%), Gaps = 50/687 (7%)
 Frame = -3

Query  2480  WGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPEIM  2301
             +  Q    D+   K RCN +EGA FELAD   +  A   ++N KQ NK AE   K P I+
Sbjct  4     YKKQARTSDQSSIKCRCNPVEGASFELADFVSKEDALALADNSKQTNKKAEP--KSPMIL  61

Query  2300  TTRELISAVGNIWNSAA-----HPLSFILSSASSAH----RNVDPQENDILYFPPMEDSC  2148
             +T +LI+AVG +W+SA      HP   ++ S S       RN+D +EN  +         
Sbjct  62    STAQLIAAVGQLWDSANRLAIFHPKGNLIDSHSECKKEVLRNLDKEENAWV---------  112

Query  2147  SSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNG  1977
               P S D K   V +S     S +V  N E L   + +S F+S +K+      W FLR+G
Sbjct  113   --PLSTDSKYFCVDVSSAGQFSPMVQPNLEFLKVTQKMSVFDSCSKKFAHSTFWTFLRSG  170

Query  1976  LDVQHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSLGNINSS  1797
               + + +    GL+S  I Y L NV+ WM E  F      + SI + E           +
Sbjct  171   ASLSNDTCV-WGLASAGIPYQLGNVHRWMTE-KFPAGFTYADSIPDSE---------KRA  219

Query  1796  STNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVL  1617
             +   C + D T C+    +G+T        T   +  +L+  K   +  +A    +    
Sbjct  220   AGEQCILGDTTGCAGASISGDTLSPASKPATEDHNKSDLSKSKGQSSCFNAKLMMSTRTT  279

Query  1616  FHVLEPNAFQMSSSEVHGYSSEKHSTSEYCA-------------CDETKYENRSDSGLDD  1476
               +L     +  S         +   S  CA             C++ ++    D+ L++
Sbjct  280   KSLLSDYFLKDVSDMKEDCDVTRQPCSSLCADYCINSVASSNGTCEKCRHLMDDDALLEN  339

Query  1475  YGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVI  1296
                      +E  ++ E      EKP  +LAKQEHAFAGA+AG+FVSLCLHP+DT+KTVI
Sbjct  340   KRNQSDKNVVEDENKMEFHSPKAEKPHLSLAKQEHAFAGALAGVFVSLCLHPVDTVKTVI  399

Query  1295  QSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLH  1116
             QSC  +QK   YIGRS++SERG+ GLYRGI+SNIASSAPISA+Y FTYESVKGALLP L 
Sbjct  400   QSCHTEQKSIVYIGRSIVSERGLTGLYRGIASNIASSAPISAVYAFTYESVKGALLPHLP  459

Query  1115  TEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYA  936
              E+ S+AHC AGGCASVATSFIFTPSER+KQQMQV S Y NCWNAL+GII+ GGL SLYA
Sbjct  460   KEFHSLAHCTAGGCASVATSFIFTPSERIKQQMQVGSRYHNCWNALVGIIKNGGLHSLYA  519

Query  935   GWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPF  756
             GWGAVLCRNVPHSI+KFYTYESLKQ+M  S++   Q NT+ TL+CGG+AGSTAALFTTPF
Sbjct  520   GWGAVLCRNVPHSIVKFYTYESLKQMMLPSLKPGAQPNTIETLICGGVAGSTAALFTTPF  579

Query  755   DVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYE  579
             DVVKTRLQTQ+PGS +QY  V H L+EIGK EGLKGLYRGL PRLVMYM+QGALFFASYE
Sbjct  580   DVVKTRLQTQIPGSTSQYSSVYHALQEIGKREGLKGLYRGLIPRLVMYMSQGALFFASYE  639

Query  578   SFKRLFSLDLHQSSAQRTHHEPCFGDD  498
              FK +FSL++   S  R  H+    DD
Sbjct  640   FFKGVFSLEVPHLSTLRIQHKQTEEDD  666



>ref|XP_006476567.1| PREDICTED: uncharacterized protein LOC102608525 isoform X1 [Citrus 
sinensis]
 ref|XP_006476568.1| PREDICTED: uncharacterized protein LOC102608525 isoform X2 [Citrus 
sinensis]
Length=696

 Score =   521 bits (1343),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 325/688 (47%), Positives = 414/688 (60%), Gaps = 52/688 (8%)
 Frame = -3

Query  2480  WGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPEIM  2301
             +  Q    D+   K RCN +EGA FELAD   +  A   ++N KQ NK AE   K P I+
Sbjct  4     YKKQARTSDQSSIKCRCNPVEGASFELADFVSKEDALALADNSKQTNKKAEP--KSPMIL  61

Query  2300  TTRELISAVGNIWNSAA-----HPLSFILSSASSAH----RNVDPQENDILYFPPMEDSC  2148
             +T +LI+AVG +W+SA      HP   ++ + S       RN+D +EN  +         
Sbjct  62    STAQLIAAVGQVWDSANRLAIFHPKGNLIDNHSECKKEVLRNLDKEENAWV---------  112

Query  2147  SSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNG  1977
               P S D K   V +S     S +V  N E L   + +S F+S +K+      W FLR+G
Sbjct  113   --PLSTDSKYFCVDVSSAGQFSPMVQPNLEFLKVTQKMSVFDSCSKKFAHSTFWTFLRSG  170

Query  1976  LDVQHKSSKGI-GLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSLGNINS  1800
               + + +  G+ GL+S  I Y L NV+ WM E  F      + SI + E           
Sbjct  171   ASLSNDT--GVWGLASAGIPYQLGNVHRWMTE-KFPAGFTYADSIPDSE---------KR  218

Query  1799  SSTNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNV  1620
              +   C + D T C+    +G+T        T   +  +L+  K   +  +A    +   
Sbjct  219   EAGEQCILGDTTGCAGASISGDTLSPASKPATEDNNKSDLSKSKGQSSCFNAKLMMSTRT  278

Query  1619  LFHVLEPNAFQMSSSEVHGYSSEKHSTSEYCA-------------CDETKYENRSDSGLD  1479
                +L     +  S         +   S  CA             C++ ++    D+ L+
Sbjct  279   TKSLLSDYFLKDVSDMKEDCDVTRQPCSSLCADDCINSVASSNGTCEKCRHLMDDDALLE  338

Query  1478  DYGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTV  1299
             +         +E  ++ E      EKP  +LAKQEHAFAGA+AG+FVSLCLHP+DT+KTV
Sbjct  339   NKRNQSDKNVVEDENKMEFHSPKTEKPHLSLAKQEHAFAGALAGVFVSLCLHPVDTVKTV  398

Query  1298  IQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFL  1119
             IQSC  +QK   YIGRS++SERG+ GLYRGI+SNIASSAPISA+Y FTYESVKGALLP L
Sbjct  399   IQSCHTEQKSIVYIGRSIVSERGLTGLYRGIASNIASSAPISAVYAFTYESVKGALLPHL  458

Query  1118  HTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLY  939
               E+ S+AHC AGGCASVATSFIFTPSER+KQQMQV S Y NCWNAL+GII+ GGL SLY
Sbjct  459   PKEFHSLAHCTAGGCASVATSFIFTPSERIKQQMQVGSRYHNCWNALVGIIKNGGLHSLY  518

Query  938   AGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTP  759
             AGWGAVLCRNVPHSI+KFYTYESLKQ+M  S++   Q NT+ TL+CGG+AGSTAALFTTP
Sbjct  519   AGWGAVLCRNVPHSIVKFYTYESLKQMMLPSLKPGAQPNTIETLICGGVAGSTAALFTTP  578

Query  758   FDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASY  582
             FDVVKTRLQTQ+PGS +QY  V H L+EIGK EGLKGLYRGL PRLVMYM+QGALFFASY
Sbjct  579   FDVVKTRLQTQIPGSTSQYSSVYHALQEIGKREGLKGLYRGLIPRLVMYMSQGALFFASY  638

Query  581   ESFKRLFSLDLHQSSAQRTHHEPCFGDD  498
             E FK +FSL++   S  R  H+    DD
Sbjct  639   EFFKGVFSLEVPHLSTLRIQHKQTEEDD  666



>ref|XP_011080954.1| PREDICTED: probable S-adenosylmethionine carrier 2, chloroplastic 
[Sesamum indicum]
Length=644

 Score =   520 bits (1338),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 323/661 (49%), Positives = 417/661 (63%), Gaps = 37/661 (6%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKP--  2313
             MA  +  P+ +K+  K++ +  +G  FELAD +  + A        +N+K + R   P  
Sbjct  1     MAGDSVCPRNEKISVKHKNDPFKGPLFELADFEYTDIA------PSENDKCSCRHSDPQS  54

Query  2312  PEIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPS  2133
              E+++T +LISAVG+ W+ A  PLS +L   +S       QE  +L++   E +  +   
Sbjct  55    SEMLSTADLISAVGDAWSRAKKPLSVLLPKTNSTRETKVIQEGGVLHYSTDEGTFPASNL  114

Query  2132  ADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISF----FESRN-KRDYLWRFLRNGLDV  1968
             A     P +++  K +S  V +N E+L  N   S+    +E+   +R  L +  R G   
Sbjct  115   AYDHPCPGYMN-SKANSGKVQENVENLIVNWKTSWPPPCYENFPFQRTVLTKSTRIG---  170

Query  1967  QHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQ-------NHEFGDCSLGN  1809
                 S    L S  I+ N    YGWM+E+AF+K K   +SI+       N+   DCS   
Sbjct  171   --AYSIENCLWSTGIAPNFRRAYGWMSELAFAKQKNQVNSIKIEGKWTSNYFTCDCS---  225

Query  1808  INSSSTNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKN  1629
               ++S  GC   DATS S NL++G +  + +   T+                 +  CS+N
Sbjct  226   --TNSGAGCVPADATSKSSNLTSGISTSNPE---TAQPLDSFHEAANLDLKMATMTCSEN  280

Query  1628  GNVLFHVLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFGG  1449
               V    +E    ++ +S     S + +  S     D       S +GL ++        
Sbjct  281   DVVHGQYIEETDCKIFTSRCDADSQDTNIASS--TNDLENSIEASSNGLHEHHDQGMTFV  338

Query  1448  IECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKP  1269
             +   SE EIS+  KEKP + LAK EHA AGAMAGIFVSLCLHPMDT+KTVIQSCRADQKP
Sbjct  339   LADPSEVEISLSGKEKPVYRLAKHEHAVAGAMAGIFVSLCLHPMDTVKTVIQSCRADQKP  398

Query  1268  FYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHC  1089
              + IG+S+I+ERG+ GLYRGISSNI SSAPISA+YTFTYESVK +L+P L  EY S+AHC
Sbjct  399   LHSIGKSIIAERGMSGLYRGISSNILSSAPISAVYTFTYESVKKSLIPLLPREYHSLAHC  458

Query  1088  VAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRN  909
              AGGCAS+ATSFIFTPSER+KQQMQV SHY+NCW  +   +++GG  SLYAGWGAVLCRN
Sbjct  459   TAGGCASIATSFIFTPSERIKQQMQVGSHYRNCWYTIXXXVQKGGFLSLYAGWGAVLCRN  518

Query  908   VPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQT  729
             VPHS+IKFYTYESLK +MSSS+Q + Q NT +TLVCGGLAGS A+LFTTPFDVVKTRLQT
Sbjct  519   VPHSVIKFYTYESLKPIMSSSIQSNAQANTSVTLVCGGLAGSMASLFTTPFDVVKTRLQT  578

Query  728   QVPGSNQ-YDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLD  552
             Q+PGS   Y+GV +TLKEI K EGLKGLYRGLTPRLVMYM QGALFFASYESFKRLFSL+
Sbjct  579   QIPGSTMTYNGVFNTLKEIEKHEGLKGLYRGLTPRLVMYMVQGALFFASYESFKRLFSLE  638

Query  551   L  549
             +
Sbjct  639   V  639


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 83/189 (44%), Gaps = 8/189 (4%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQ-VRSHYKNCWNALIGIIRRGGLPSLYAGWGAVL  918
             H VAG  A +  S    P + VK  +Q  R+  K   +    II   G+  LY G  + +
Sbjct  364   HAVAGAMAGIFVSLCLHPMDTVKTVIQSCRADQKPLHSIGKSIIAERGMSGLYRGISSNI  423

Query  917   CRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
               + P S +  +TYES+K+ +   +  +   ++L     GG A    +   TP + +K +
Sbjct  424   LSSAPISAVYTFTYESVKKSLIPLLPREY--HSLAHCTAGGCASIATSFIFTPSERIKQQ  481

Query  737   LQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             +Q      + Y    +T+    +  G   LY G    L   +    + F +YES K + S
Sbjct  482   MQV----GSHYRNCWYTIXXXVQKGGFLSLYAGWGAVLCRNVPHSVIKFYTYESLKPIMS  537

Query  557   LDLHQSSAQ  531
               + QS+AQ
Sbjct  538   SSI-QSNAQ  545



>gb|KDO76222.1| hypothetical protein CISIN_1g005451mg [Citrus sinensis]
Length=696

 Score =   521 bits (1342),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 325/687 (47%), Positives = 412/687 (60%), Gaps = 50/687 (7%)
 Frame = -3

Query  2480  WGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPEIM  2301
             +  Q    D+   K RCN +EGA FELAD   +  A   ++N KQ NK AE   K P I+
Sbjct  4     YKKQARTSDQSSIKCRCNPVEGASFELADFVSKEDALALADNSKQTNKKAEP--KSPMIL  61

Query  2300  TTRELISAVGNIWNSAA-----HPLSFILSSASSAH----RNVDPQENDILYFPPMEDSC  2148
             +T +LI+AVG +W+SA      HP   ++ S S       RN+D +EN  +         
Sbjct  62    STAQLIAAVGQLWDSANRLAIFHPKGNLIDSHSECKKEVLRNLDKEENAWV---------  112

Query  2147  SSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNG  1977
               P S D K   V +S     S +V  N E L   + +S F+S +K+      W FLR+G
Sbjct  113   --PLSTDSKYFCVDVSSAGQFSPMVQPNLEFLKVTQKMSVFDSCSKKFAHSTFWTFLRSG  170

Query  1976  LDVQHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSLGNINSS  1797
               + + +    GL+S  I Y L NV+ WM E  F      + SI + E            
Sbjct  171   ASLSNDTCV-WGLASAGIPYQLGNVHRWMTE-KFPAGFTYADSIPDSE---------KRE  219

Query  1796  STNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVL  1617
             +   C + D T C+    +G+T        T   +  +L+  K   +  +A    +    
Sbjct  220   AGEQCILGDTTGCAGASISGDTLSPASKPATEDHNKSDLSKSKGQSSCFNAKLMMSTRTT  279

Query  1616  FHVLEPNAFQMSSSEVHGYSSEKHSTSEYCA-------------CDETKYENRSDSGLDD  1476
               +L     +  S         +   S  CA             C++ ++    D+ L++
Sbjct  280   KSLLSDYFLKDVSDMKEDCDVTRQPCSSLCADYCINSVASSNGTCEKCRHLMDDDALLEN  339

Query  1475  YGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVI  1296
                      +E  ++ E      EKP  +LAKQEHAFAGA+AG+FVSLCLHP+DT+KTVI
Sbjct  340   KRNQSDKNVVEDENKMEFHSPKTEKPHLSLAKQEHAFAGALAGVFVSLCLHPVDTVKTVI  399

Query  1295  QSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLH  1116
             QSC  +QK   YIGRS++SERG+ GLYRGI+SNIASSAPISA+Y FTYESVKGALLP L 
Sbjct  400   QSCHTEQKSIVYIGRSIVSERGLTGLYRGIASNIASSAPISAVYAFTYESVKGALLPHLP  459

Query  1115  TEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYA  936
              E+ S+AHC AGGCASVATSFIFTPSER+KQQMQV S Y NCWNAL+GII+ GGL SLYA
Sbjct  460   KEFHSLAHCTAGGCASVATSFIFTPSERIKQQMQVGSRYHNCWNALVGIIKNGGLHSLYA  519

Query  935   GWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPF  756
             GWGAVLCRNVPHSI+KFYTYESLKQ+M  S++   Q NT+ TL+CGG+AGSTAALFTTPF
Sbjct  520   GWGAVLCRNVPHSIVKFYTYESLKQMMLPSLKPGAQPNTIETLICGGVAGSTAALFTTPF  579

Query  755   DVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYE  579
             DVVKTRLQTQ+PGS +QY  V H L+EIGK EGLKGLYRGL PRLVMYM+QGALFFASYE
Sbjct  580   DVVKTRLQTQIPGSTSQYSSVYHALQEIGKREGLKGLYRGLIPRLVMYMSQGALFFASYE  639

Query  578   SFKRLFSLDLHQSSAQRTHHEPCFGDD  498
              FK +FSL++   S  R  H+    DD
Sbjct  640   FFKGVFSLEVPHLSTLRIQHKQTEEDD  666



>ref|XP_004300791.1| PREDICTED: uncharacterized protein LOC101309355 [Fragaria vesca 
subsp. vesca]
Length=669

 Score =   509 bits (1312),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 320/670 (48%), Positives = 420/670 (63%), Gaps = 30/670 (4%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAER-ERKPP  2310
             MA  N+P + D+   KYR     G    LA S      T+S   +K NN+ + + + K P
Sbjct  1     MARCNKPHENDQASIKYR-----GYKIGLASSPH----TVS---RKSNNQGSIKLQNKSP  48

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSA  2130
             EI++T ELISAVG IW+ A+ PL       +S       ++  IL     E       S 
Sbjct  49    EILSTTELISAVGQIWDYASRPLGLFQPKVNSEEIQSSRRKQIILSGLDGE-----ALSE  103

Query  2129  DGKNTPVHLSCDKDSSLLVSKNPESL-NANRNISFFESRNKRDY---LWRFLRNGLDVQH  1962
             D  N   +L  D D    +S+    L   ++N+S F   +K  Y    WR L  G DV  
Sbjct  104   DSGNLTFNLR-DSDKIPTISQPRIDLKQVSQNMSVFGHCSKSFYQASFWRLLYGGTDVPK  162

Query  1961  KSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSLGNINSSSTNGC  1782
              SSKG G +S  +SY L ++YGWMN++  S +       ++    D     +++++  G 
Sbjct  163   DSSKGNGTASFEVSYQLGSMYGWMNDVISSGANRPVKVSESENRTDQCCSPVDTNAVAGG  222

Query  1781  DVRDATS-CSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVL  1605
              +   TS   D+L+    +  ++  P  S +    +  KS  ++ ++LCS    V     
Sbjct  223   SITGETSRLVDDLA---RNAVSNPAPVKSSNLSKDDDEKSEISTRASLCSDYFLVAGEAD  279

Query  1604  EPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFGGIECNSESE  1425
             +  +    SS +  Y  +  STS     +E  ++      +D+         I    +++
Sbjct  280   DIISRAPCSSLLADYHIDS-STSCGNGLEECLHKIDDHDLVDNKKKQPENFVITDGCKAQ  338

Query  1424  ISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSV  1245
                +A +K  H LAKQEHAFAGA++G+FVS+CLHP+DTIKTVIQSCRA+QK  ++IG+S+
Sbjct  339   PCALAHDK-LHTLAKQEHAFAGALSGVFVSICLHPVDTIKTVIQSCRAEQKSIWFIGKSI  397

Query  1244  ISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASV  1065
             +S+RG+ GLYRGI++N+ASSAPIS++YTFTYESVKG+LLP    EY SVAHCVAGGCAS+
Sbjct  398   VSDRGLTGLYRGIATNVASSAPISSIYTFTYESVKGSLLPLFPKEYYSVAHCVAGGCASI  457

Query  1064  ATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKF  885
             ATSFIFTPSER+KQQMQV S Y NCWNAL+GII++GG  SLYAGWGAVLCRNVPHSI+KF
Sbjct  458   ATSFIFTPSERIKQQMQVGSKYHNCWNALVGIIQKGGFTSLYAGWGAVLCRNVPHSIVKF  517

Query  884   YTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQ  708
             YTYE LK+LMSSS +     +TL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ+PGS +Q
Sbjct  518   YTYERLKKLMSSSEESRNHPSTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQIPGSVSQ  577

Query  707   YDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQR  528
             Y+ V+H L+EI   EGLKGLYRGLTPRLVMYM+QGALFFASYE FK+ FSL   Q +AQR
Sbjct  578   YNSVIHALQEIENKEGLKGLYRGLTPRLVMYMSQGALFFASYEFFKKSFSLARQQPNAQR  637

Query  527   THHEPCFGDD  498
               +E    DD
Sbjct  638   IQYERNMEDD  647



>gb|KHG23174.1| mcfF [Gossypium arboreum]
 gb|KHG23175.1| mcfF [Gossypium arboreum]
Length=687

 Score =   509 bits (1310),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 318/657 (48%), Positives = 406/657 (62%), Gaps = 29/657 (4%)
 Frame = -3

Query  2441  KYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPEIMTTRELISAVGNIW  2262
             KYR +  EGAFFE+ +   E Y T S  +  +  +I + + K  +I++T ELIS++  IW
Sbjct  16    KYRLSAAEGAFFEIGELVPEEY-TPSPPDTNRKTRI-KADAKQTQILSTAELISSLNQIW  73

Query  2261  NSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSADGKNTPVHLSCDKDSS  2082
             N A+  ++      +     +  Q+ DIL     E++ S   SA  K   + L   +  S
Sbjct  74    NYAS-SIAIPQQQTNLEKARLVSQKEDILVNLGSEENGSGSISAGSKYFCIDL---RQLS  129

Query  2081  LLVSKNPESLNANRNISFFESRNKRD---YLWRFLRNGLDVQHKSSKGIGLSSLRISYNL  1911
              L   N + +   + +S FES N      +       G D  +   KG GL+++  SY  
Sbjct  130   SLRKPNFDIVKITKKMSMFESSNGNINPLFYQGLFCGGSDFSNADWKGKGLAAVGFSYEF  189

Query  1910  ENVYGWMNEI--AFSKSKLGSSSIQNHEFGDCSLGNINSSSTNGCDVRDATSCSDNLSAG  1737
              N+Y WM ++  A  +  +    I+N + G  S+    SS    C   D TS +DNL   
Sbjct  190   GNIYKWMRKMIPAGLQHFVKFPEIENKKIGKYSIAA--SSDIGNCISADRTSLTDNLPTE  247

Query  1736  NTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVLEPNA-FQMSSSEVHGY  1560
             N +C++    +  LS         +    ++LCS     L    E  A   +S +     
Sbjct  248   NAECYSHCIESKDLSISQDMKPVLNTGGTTSLCSDY--FLIDAQETKADCSVSRTPDSNL  305

Query  1559  SSEKHS---TSEYCACDETKYENRSDSGLDDYGPNQR-----FGGIECNSESEISVVAKE  1404
              ++ H     S Y A  E  ++  SD    +Y  NQR         +   ES ++ +A E
Sbjct  306   CADSHINSLASHYSAFKE--WQPLSDG--SEYHENQRKQLEVLSTNDGRMESHLTAIASE  361

Query  1403  KPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVL  1224
             KP + LAKQEHAFAGA AGIFVSLCLHP+DT+KTVIQSC A+QK  +YIGRS+ISERG  
Sbjct  362   KPQYTLAKQEHAFAGAFAGIFVSLCLHPIDTVKTVIQSCHAEQKSIFYIGRSIISERGFT  421

Query  1223  GLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFT  1044
             GLY GI+SNIASSAPISALYTF+YESVKGALLP L  EY S+AHC+AGGCASVATSFIFT
Sbjct  422   GLYSGIASNIASSAPISALYTFSYESVKGALLPLLPKEYHSLAHCMAGGCASVATSFIFT  481

Query  1043  PSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK  864
             PSER+KQQMQV +HY+NCWNAL+ IIR+GGLPSLY GWGAVLCRN+P+SIIKFYTYESLK
Sbjct  482   PSERIKQQMQVGAHYQNCWNALVEIIRKGGLPSLYTGWGAVLCRNIPNSIIKFYTYESLK  541

Query  863   QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHT  687
             Q+M +S+Q   Q NTL TLVCG L+GSTAA FTTPFDVVKTRLQTQ+PGS ++Y+ V H 
Sbjct  542   QVMLTSLQSPTQLNTLQTLVCGALSGSTAAFFTTPFDVVKTRLQTQIPGSLSRYNNVYHA  601

Query  686   LKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHE  516
             L++I   EGL GLYRGL PRLVMY TQGALFFASYESFK+L S +  Q  A     E
Sbjct  602   LQDIWMHEGLNGLYRGLIPRLVMYTTQGALFFASYESFKQLLSSERLQLIAHEQEKE  658



>ref|XP_007208818.1| hypothetical protein PRUPE_ppa025003mg [Prunus persica]
 gb|EMJ10017.1| hypothetical protein PRUPE_ppa025003mg [Prunus persica]
Length=682

 Score =   504 bits (1298),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 323/691 (47%), Positives = 411/691 (59%), Gaps = 72/691 (10%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSE--NKKQNNKIAERERKP  2313
             MA  N+  K D+   KYR   +  A   LAD   E Y    S+  NK+++ K    E K 
Sbjct  1     MAGCNKRHKNDQPSIKYRWYPVGQASSGLADFVHEKYPPFVSDKINKQRSRK---PEPKS  57

Query  2312  PEIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPS  2133
             P I++   LISAVG IW+ A+ PL F    A S H +   Q+  +L     E +  +P S
Sbjct  58    PAILSNAMLISAVGQIWDCASRPLGFFQPKAHSNHNDSGCQKEVVLADLGREGNDVAPIS  117

Query  2132  ADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNK---RDYLWRFLRNGLDVQH  1962
             A  K    +L+ D     L+  + + L  +  +S FE  +       LWRFL  G +V  
Sbjct  118   AKSK----YLTVD-----LMQPSLDFLQVSEKMSVFEPYSGSYCHSSLWRFLHGGGNVSQ  168

Query  1961  KSSKGIGLSSLRISYNLENVYGWMNEIAFS--KSKLGSSSIQNHEFGDCSL---GNINSS  1797
             +S KG GL+SL +SY L ++YGWM++   S  K  +  + I+N     C L    NI   
Sbjct  169   ESWKGKGLASLEVSYQLGSIYGWMSDTISSGLKCPVKVTEIENRTGQYCILEDTNNIAGG  228

Query  1796  STNGCDVRDATSCS--------DNLSAG--------NTDCHTDIKPTsslsshnlnlhks  1665
             S +G  V  A            DNL+          N     + + + +       +   
Sbjct  229   SISGDTVNIAGGSISGDSSSPVDNLTTNAYNLSLYENEKLEMNTRTSLTSDYFLRAVGSE  288

Query  1664  SGASNSALCSKNGNVLFHVLE----PNAFQMSSSEVHGY---SSEKHSTSEYCACDETKY  1506
                S S     N    +H+       + F+ S  ++  +    S+K  +  +   DE K 
Sbjct  289   VDGSISRTPCSNLYTDYHIDLLASCKDQFEESHHKIDDHEQLESKKKQSEIFIIQDECKT  348

Query  1505  ENRSDSGLDDYGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCL  1326
             E                G + C  E     +AK++  HA A       GA++GI VS+CL
Sbjct  349   E---------------IGALAC--EKPHYALAKQE--HAFA-------GALSGIVVSVCL  382

Query  1325  HPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYES  1146
             HP+DTIKTV+QSCRA+QK   YIG+S++S+RG+ GLYRGI++NIASSAPISA+YTFTYES
Sbjct  383   HPVDTIKTVVQSCRAEQKSLCYIGKSIVSDRGLTGLYRGIATNIASSAPISAVYTFTYES  442

Query  1145  VKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGII  966
             VKGALLP    EY S AHC+AGGCAS+ATSFIFTPSER+KQQMQV SHY NCWNAL+GI+
Sbjct  443   VKGALLPLFPKEYYSFAHCMAGGCASIATSFIFTPSERIKQQMQVGSHYNNCWNALVGIV  502

Query  965   RRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAG  786
             R GGLPSLYAGWGAVLCRNVPHSI+KFYTYESLKQ M S  +  +   TL TLVCGGLAG
Sbjct  503   RNGGLPSLYAGWGAVLCRNVPHSIVKFYTYESLKQFMLSPNEASVHPTTLQTLVCGGLAG  562

Query  785   STAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMT  609
             STAAL TTPFDVVKTRLQTQ+PGS +QY+ V+H L+EIGK+EGLKGLYRGLTPRLVMYM+
Sbjct  563   STAALLTTPFDVVKTRLQTQIPGSMSQYNSVIHALQEIGKNEGLKGLYRGLTPRLVMYMS  622

Query  608   QGALFFASYESFKRLFSLDLHQSSAQRTHHE  516
             QGALFFASYE FK LFSLD  Q+ A R  ++
Sbjct  623   QGALFFASYEFFKSLFSLDTPQTDAPRIQYQ  653



>ref|XP_002509806.1| mitochondrial carrier protein, putative [Ricinus communis]
 gb|EEF51193.1| mitochondrial carrier protein, putative [Ricinus communis]
Length=663

 Score =   501 bits (1289),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 320/684 (47%), Positives = 409/684 (60%), Gaps = 43/684 (6%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             M    +PP  D+    Y+ N +E     +AD + E +A+  S+ K Q+      E K PE
Sbjct  1     MCGSKKPPPIDRPSITYKWNKVEKGSSGVADFNIEEHASKHSQKKNQS-----AEPKNPE  55

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNV---DPQENDILYFPPMEDSCSSPP  2136
             +++T ELISAV +IW+           + S + +NV   D    D+      +D   S  
Sbjct  56    LLSTTELISAVEHIWDRVKEKPD---HNTSGSQKNVILGDLIAVDVDLGAFKDDDGGSCF  112

Query  2135  SADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR--DYLWRFLRNG-LDVQ  1965
             S D  N       D + +  V    E L+  + +S FE  +KR    L+    NG     
Sbjct  113   SVDVWN-------DSNITTSVQTKLEFLSVTQKMSTFEPCSKRCTRPLFSLFFNGRTKYL  165

Query  1964  HKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSS---IQNHEFGDCSLGNINSSS  1794
             +KS  G GL SL I+  +E +YGWM +I  ++S    S+   I++ +     +     S 
Sbjct  166   NKSWNGKGLPSLAITCGMERIYGWMMDIIPAESWYPVSTTKIIEDKKIDRICILTSTISH  225

Query  1793  TNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSK------  1632
               GC   DAT   +N ++ + D + D+      S  +         + ++LCS       
Sbjct  226   AEGCIPTDATHAGNNFASKSADFYCDLFKLKDASLDDNMKVAMKTGTFNSLCSNCILGAL  285

Query  1631  -NGNVLFHVLE-PNAFQMSSSEVHGYSSEK--HSTSEYCACDETKYENRSDSGLDDYGPN  1464
              + N +  V   P++       ++     +  + T ++ A D T  EN          P 
Sbjct  286   HDSNTIGSVSRGPSSSLYVDYHINVLVPHRSAYGTFQHIAGDNTMDENTRKK------PP  339

Query  1463  QRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCR  1284
             +     E     +I  +  E+P + LAKQEHA+AGA AG+FVSLCLHP+DTIKTV QS R
Sbjct  340   KFVA--EVKDSMDIRALPCERPHYGLAKQEHAYAGAFAGVFVSLCLHPVDTIKTVTQSYR  397

Query  1283  ADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQ  1104
              +QK    IGRS++SERGV GLYRGI+SNIASSAPISA+YTFTYESVKG+LLP    EY 
Sbjct  398   TEQKSICDIGRSIVSERGVTGLYRGIASNIASSAPISAIYTFTYESVKGSLLPLFSKEYH  457

Query  1103  SVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGA  924
             S+AHC+AGG ASVATSF+FTPSER+KQQMQ+ SHY NCW AL+GIIR GGLPSLY GWGA
Sbjct  458   SLAHCIAGGSASVATSFVFTPSERIKQQMQIGSHYHNCWKALVGIIRNGGLPSLYTGWGA  517

Query  923   VLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVK  744
             VLCRNVPHSIIKFYTYESLKQ M  S     Q  TL TLVCGGLAGSTAALFTTPFDVVK
Sbjct  518   VLCRNVPHSIIKFYTYESLKQFMWPSHNSTAQPITLQTLVCGGLAGSTAALFTTPFDVVK  577

Query  743   TRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKR  567
             TRLQ Q+PGS ++YD V H LKEIGK+EGLKGLYRGL PRLVMY++QGALFFASYESFK 
Sbjct  578   TRLQIQIPGSMSKYDSVFHALKEIGKNEGLKGLYRGLIPRLVMYVSQGALFFASYESFKG  637

Query  566   LFSLDLHQSSAQRTHHEPCFGDDS  495
              FSL++ Q  AQR  ++ C G DS
Sbjct  638   FFSLEVPQFGAQRNLNKECAGGDS  661



>ref|XP_010089103.1| hypothetical protein L484_024277 [Morus notabilis]
 gb|EXB37350.1| hypothetical protein L484_024277 [Morus notabilis]
Length=717

 Score =   501 bits (1291),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 336/726 (46%), Positives = 432/726 (60%), Gaps = 79/726 (11%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAER-ERKPP  2310
             MA  N   +GD+   KYR + +  +  EL     E   T  S N   + K  +R + K  
Sbjct  1     MAGRNNNLRGDQASIKYRWDPVVQSSSELGGFAHEECGTPLSNNF--DKKCGKRSDPKTH  58

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSA  2130
             EI++T ELISAVG +W+ A  PL+ + +  +S+H     + + IL     E +   P S+
Sbjct  59    EILSTAELISAVGQVWDYACRPLASLRNEVNSSHDGGGSKNDVILRNIVGESNDMVPHSS  118

Query  2129  DGKN-------TPVHLSCDKDSSLLVSKNPESLNANRNISF---FESRNKRDYLWRFLRN  1980
                N       T  H S  K        N + +   + IS    F  R +   +WR L+ 
Sbjct  119   PRTNYFCVDLRTAGHESPSK-----TQPNLDFMGVAQKISVSEPFGERYRHSSIWRLLQG  173

Query  1979  GLDVQHKSSKGIGLSSLRISYNLENVYGWMNEIAF--SKSKLGSSSIQNHEFGDCSLGNI  1806
             G  +  +  +  GL+S+ IS  L+N YGWM    F  SK ++  S ++N     C    +
Sbjct  174   GEKMIREPWRQQGLASVEISCELKNAYGWMKHTTFVGSKHQIKGSEVENRNSEYCI--PV  231

Query  1805  NSSSTNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNG  1626
             ++ S  G    D TS ++NL+A N   ++ IK  +  S  + NL  +   + S+LC+   
Sbjct  232   DTISIAG----DTTSPANNLAASN---YSLIKSVNLHSLSDANLEMN---TRSSLCTDY-  280

Query  1625  NVLFHVLEPNAFQMSSSEVHGYSSEKHSTSEYC-ACDETKYENRSDSGLDDYGPNQRFGG  1449
              +L    E ++    SS  + Y+    ++   C +  E  + +  D+ L D    Q    
Sbjct  281   -LLRASPEADSSISLSSFSNLYADYNMNSLVSCNSGPEECWHSTDDNQLRDTKSKQPEKW  339

Query  1448  IECNS--ESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQ  1275
             +  +S  E  +S  A  K    LAKQEHAFAGA AGIFV+LCLHP+DTIKTV+QSCRA+Q
Sbjct  340   VSEDSFKEEVVSSSASRKSHFTLAKQEHAFAGAFAGIFVTLCLHPVDTIKTVVQSCRAEQ  399

Query  1274  KPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVA  1095
             K  +YIGRS++S+RG+ GLYRGI++NIASSAPISA+YTFTYES+KGALLP    EY S A
Sbjct  400   KSLFYIGRSIVSDRGLTGLYRGITTNIASSAPISAIYTFTYESIKGALLPIFPKEYYSFA  459

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLC  915
             HCVAGGCASVATSF+FTPSE +KQQMQV SHY NCW AL+GIIR+GGL SLYAGWGAVLC
Sbjct  460   HCVAGGCASVATSFVFTPSEHIKQQMQVGSHYGNCWKALVGIIRKGGLRSLYAGWGAVLC  519

Query  914   RNVPHSIIK-----------------------------------FYTYESLKQLMSSSVQ  840
             RNVPHSIIK                                   FYTYESLKQLMSSS+ 
Sbjct  520   RNVPHSIIKVTYLYVLNDPVACFRSFNNRHMPIGCFIAVVVNPSFYTYESLKQLMSSSLP  579

Query  839   FDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQT------QVPGS-NQYDGVLHTLK  681
               IQ NTL TLVCGGLAGSTAALFTTPFDVVKTRLQT      Q+PGS +QY  V+H L 
Sbjct  580   SSIQPNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQKVDVLQIPGSTSQYSSVVHALC  639

Query  680   EIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHEPCFGD  501
             EIGK+EG+KGLYRGLTPRLVMY++QGALFFASYE+FKRL +L+  Q  A+R  H+    D
Sbjct  640   EIGKNEGVKGLYRGLTPRLVMYLSQGALFFASYETFKRLMALETPQPEAERIQHQDDTQD  699

Query  500   DSTLSS  483
             DS + S
Sbjct  700   DSLIPS  705



>gb|KDO76221.1| hypothetical protein CISIN_1g005451mg [Citrus sinensis]
Length=688

 Score =   498 bits (1283),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 317/687 (46%), Positives = 404/687 (59%), Gaps = 58/687 (8%)
 Frame = -3

Query  2480  WGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPEIM  2301
             +  Q    D+   K RCN +EGA FELAD   +  A   ++N KQ NK AE   K P I+
Sbjct  4     YKKQARTSDQSSIKCRCNPVEGASFELADFVSKEDALALADNSKQTNKKAEP--KSPMIL  61

Query  2300  TTRELISAVGNIWNSAA-----HPLSFILSSASSAH----RNVDPQENDILYFPPMEDSC  2148
             +T +LI+AVG +W+SA      HP   ++ S S       RN+D +EN  +         
Sbjct  62    STAQLIAAVGQLWDSANRLAIFHPKGNLIDSHSECKKEVLRNLDKEENAWV---------  112

Query  2147  SSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNG  1977
               P S D K   V +S     S +V  N E L   + +S F+S +K+      W FLR+G
Sbjct  113   --PLSTDSKYFCVDVSSAGQFSPMVQPNLEFLKVTQKMSVFDSCSKKFAHSTFWTFLRSG  170

Query  1976  LDVQHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSLGNINSS  1797
               + + +    GL+S  I Y L NV+ WM E  F      + SI + E            
Sbjct  171   ASLSNDTCV-WGLASAGIPYQLGNVHRWMTE-KFPAGFTYADSIPDSE---------KRE  219

Query  1796  STNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVL  1617
             +   C + D T C+    +G+T        T   +  +L+  K   +  +A    +    
Sbjct  220   AGEQCILGDTTGCAGASISGDTLSPASKPATEDHNKSDLSKSKGQSSCFNAKLMMSTRTT  279

Query  1616  FHVLEPNAFQMSSSEVHGYSSEKHSTSEYCA-------------CDETKYENRSDSGLDD  1476
               +L     +  S         +   S  CA             C++ ++    D+ L++
Sbjct  280   KSLLSDYFLKDVSDMKEDCDVTRQPCSSLCADYCINSVASSNGTCEKCRHLMDDDALLEN  339

Query  1475  YGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVI  1296
                      +E  ++ E      EKP  +LAKQEHAFAGA+AG+FVSLCLHP+DT+KTVI
Sbjct  340   KRNQSDKNVVEDENKMEFHSPKTEKPHLSLAKQEHAFAGALAGVFVSLCLHPVDTVKTVI  399

Query  1295  QSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLH  1116
             QSC  +QK   YIGRS++SERG+ GLYRGI+SNIASSAPISA+Y FTYESVKGALLP L 
Sbjct  400   QSCHTEQKSIVYIGRSIVSERGLTGLYRGIASNIASSAPISAVYAFTYESVKGALLPHLP  459

Query  1115  TEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYA  936
              E+ S+AHC AGGCASVATSFIFTPSER+KQQMQV S Y NCWNAL+GII+ GGL SLYA
Sbjct  460   KEFHSLAHCTAGGCASVATSFIFTPSERIKQQMQVGSRYHNCWNALVGIIKNGGLHSLYA  519

Query  935   GWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPF  756
             GWGAVLCRNVPHSI+KFYTYESLKQ+M  S++   Q NT+ TL+CGG+AGSTAALFTTPF
Sbjct  520   GWGAVLCRNVPHSIVKFYTYESLKQMMLPSLKPGAQPNTIETLICGGVAGSTAALFTTPF  579

Query  755   DVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYE  579
             DV        +PGS +QY  V H L+EIGK EGLKGLYRGL PRLVMYM+QGALFFASYE
Sbjct  580   DV--------IPGSTSQYSSVYHALQEIGKREGLKGLYRGLIPRLVMYMSQGALFFASYE  631

Query  578   SFKRLFSLDLHQSSAQRTHHEPCFGDD  498
              FK +FSL++   S  R  H+    DD
Sbjct  632   FFKGVFSLEVPHLSTLRIQHKQTEEDD  658



>ref|XP_008238884.1| PREDICTED: uncharacterized protein LOC103337495 [Prunus mume]
Length=542

 Score =   492 bits (1267),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 282/515 (55%), Positives = 353/515 (69%), Gaps = 35/515 (7%)
 Frame = -3

Query  2000  LWRFLRNGLDVQHKSSKGIGLSSLRISYNLENVYGWMNEIAFS--KSKLGSSSIQNHEFG  1827
             LWRFL  G ++  +S +G GL+SL +SY L ++YGWM++   S  K  +  + I+N    
Sbjct  16    LWRFLHGGGNISQESWRGKGLASLEVSYQLGSIYGWMSDTISSGLKCPVKVTEIENRTGQ  75

Query  1826  DCSLGNINSSSTNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNS  1647
              C L + N+ +  G    D  + +    +G+T    D   T++ +    +  K    + +
Sbjct  76    YCILEDTNNIA-GGSISGDTVNIAGGSISGDTSSPVDNLTTNAYNLLLYDNEKLETNTRT  134

Query  1646  ALCSKNGNVLFHVLEPNAFQMSSSEVHGYSSEKHSTSEYC-------ACDETKYENRSDS  1488
             +L S               +   SEV G  S    ++ Y        A  + ++E  S  
Sbjct  135   SLTSDY-----------FLRAVGSEVDGSISRTPCSNLYTDYHIDSLASCKDQFE-ESPH  182

Query  1487  GLDDYGPNQRFGGIECNSE---------SEISVVAKEKPCHALAKQEHAFAGAMAGIFVS  1335
              +DD+   ++ G  +  SE         +EI  +A EKP  ALAKQEHAFAGA++GIFVS
Sbjct  183   KIDDH---EQLGSKKKQSEIFIIQDECKTEIGALACEKPHCALAKQEHAFAGALSGIFVS  239

Query  1334  LCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFT  1155
             +CLHP+DTIKTV+QSCRA+QK   YIG+S++S+RG+ GLYRGI++NIASSAPISA+YTFT
Sbjct  240   VCLHPVDTIKTVVQSCRAEQKSICYIGKSIVSDRGLTGLYRGIATNIASSAPISAVYTFT  299

Query  1154  YESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALI  975
             YESVKGALLP    EY S AHCVAGGCAS+ATSFIFTPSER+KQQMQV SHY NCWNA +
Sbjct  300   YESVKGALLPLFPKEYYSFAHCVAGGCASIATSFIFTPSERIKQQMQVGSHYNNCWNASL  359

Query  974   GIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGG  795
             GIIR GGLPSLYAGWGAVLCRNVPHSI+KFYTYESLKQ M S  +  +   TL TLVCGG
Sbjct  360   GIIRNGGLPSLYAGWGAVLCRNVPHSIVKFYTYESLKQFMLSPNEASVHPTTLQTLVCGG  419

Query  794   LAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVM  618
             LAGSTAAL TTPFDVVKTRLQTQ+PGS +QY+ V+H L+EIGK+EGLKGLYRGLTPRLVM
Sbjct  420   LAGSTAALLTTPFDVVKTRLQTQIPGSMSQYNSVIHALQEIGKNEGLKGLYRGLTPRLVM  479

Query  617   YMTQGALFFASYESFKRLFSLDLHQSSAQRTHHEP  513
             YM+QGALFFASYE FK LFSL+  Q+ A R  ++P
Sbjct  480   YMSQGALFFASYEFFKSLFSLETPQTDAPRIQYQP  514



>ref|XP_011022691.1| PREDICTED: uncharacterized protein LOC105124380 isoform X1 [Populus 
euphratica]
 ref|XP_011022692.1| PREDICTED: uncharacterized protein LOC105124380 isoform X1 [Populus 
euphratica]
Length=630

 Score =   494 bits (1273),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 310/664 (47%), Positives = 408/664 (61%), Gaps = 47/664 (7%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPT-KYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPP  2310
             M  G +P +G++ P+  Y+ N      F+L D   + ++   SEN K N+   +     P
Sbjct  1     MYGGKRPGRGNQPPSITYKRNRNGVMPFDLTDFVHDGHSPSISENNKPND--IKSGTSSP  58

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSA  2130
             EI +T EL+SAVG +WN         L +  +     D Q+N IL +  +  + +   + 
Sbjct  59    EIFSTTELVSAVGQVWN---------LLNPCAVPETKD-QKNVILNY--LNGAGAGRAAI  106

Query  2129  DGKNTP---VHLSCDKDSSLLVSKNPESLNANRNISFFESRNK---RDYLWRFLRNGLDV  1968
                NT    V +      + +V    E L   + +  FE  ++   R   WRFL+ G  +
Sbjct  107   LDDNTKYFCVDIRNGSHVTQMVQPQFEFLKVTKKMLVFEPSSENYSRSLFWRFLKRGTSL  166

Query  1967  QHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSLGNINSSSTN  1788
             + +S +G GL++    Y L  +YGWM E+  + SK  +++                 ST 
Sbjct  167   RDESREGKGLATGGTGYELYKLYGWMKELIPACSKYPANN-----------------STE  209

Query  1787  GCDVRDA-TSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFH  1611
             GC  RD  T+ ++NL++   DC++D   +  +S  +     + G S+S     +   L  
Sbjct  210   GCMARDCPTNPANNLASRTADCYSDSVESKEVSLCDNARVVTIGKSSSV---SSDYFLGA  266

Query  1610  VLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFGGIECNSE  1431
             + + NA   +S  ++      +  +    C  T     +D G  D   N R       ++
Sbjct  267   LHDFNANSSASRALNYVLFADYHINCLAPCKSTYKHFENDIGDFDAPKNAREQPQNLVAQ  326

Query  1430  SE----ISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
                   I   A E+P +ALAKQEHAFAGA AGIFVSL LHP+DT+KT+IQSC A+QK   
Sbjct  327   GRTGIHIQSSACERPQYALAKQEHAFAGAFAGIFVSLSLHPIDTVKTIIQSCPAEQKSIS  386

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
             +IGRS++SERG+ GLYRGI SNIASSAPISA+YTFTYESVKG+LLP    E+ S AHC+A
Sbjct  387   FIGRSIVSERGMTGLYRGIGSNIASSAPISAIYTFTYESVKGSLLPQFPKEHHSFAHCLA  446

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             GGCAS+ATSF+FTPSER+KQQMQ+ SHY NCW+AL+GII +GG  SLYAGWGAVLCRN+P
Sbjct  447   GGCASIATSFVFTPSERIKQQMQIGSHYNNCWSALVGIIGKGGFHSLYAGWGAVLCRNIP  506

Query  902   HSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV  723
              S+IKFYTYESLKQL+ SS     Q NTL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ+
Sbjct  507   QSVIKFYTYESLKQLVLSSQNSSAQPNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQI  566

Query  722   PGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLH  546
             PGS + Y  V H L+EIGK+EGLKGLYRGLTPRLVMYM+QGA+FFASYE  KRLFSL++ 
Sbjct  567   PGSMSPYVNVFHALQEIGKNEGLKGLYRGLTPRLVMYMSQGAVFFASYEFLKRLFSLEMP  626

Query  545   QSSA  534
             Q SA
Sbjct  627   QFSA  630


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 85/191 (45%), Gaps = 12/191 (6%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQ-VRSHYKNCWNALIG--IIRRGGLPSLYAGWGA  924
             H  AG  A +  S    P + VK  +Q   +  K+   + IG  I+   G+  LY G G+
Sbjct  350   HAFAGAFAGIFVSLSLHPIDTVKTIIQSCPAEQKSI--SFIGRSIVSERGMTGLYRGIGS  407

Query  923   VLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVK  744
              +  + P S I  +TYES+K  +    QF  ++++    + GG A    +   TP + +K
Sbjct  408   NIASSAPISAIYTFTYESVKGSLLP--QFPKEHHSFAHCLAGGCASIATSFVFTPSERIK  465

Query  743   TRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRL  564
              ++Q      + Y+     L  I    G   LY G    L   + Q  + F +YES K+L
Sbjct  466   QQMQI----GSHYNNCWSALVGIIGKGGFHSLYAGWGAVLCRNIPQSVIKFYTYESLKQL  521

Query  563   FSLDLHQSSAQ  531
               L    SSAQ
Sbjct  522   V-LSSQNSSAQ  531



>gb|KCW72152.1| hypothetical protein EUGRSUZ_E00597 [Eucalyptus grandis]
Length=690

 Score =   486 bits (1252),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 304/670 (45%), Positives = 411/670 (61%), Gaps = 36/670 (5%)
 Frame = -3

Query  2474  NQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPEIMTT  2295
             ++ P+  +   +YRCN +E A FE AD   +      +E  +Q    A+ + K  EI++T
Sbjct  7     SKTPRRSQPSIQYRCNRVEQATFEFADFVHKEGVPAHAETFQQEK--ADCKSKSSEILST  64

Query  2294  RELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSADGKNT  2115
              ELISA G+ W+  +  L+ +L   ++    V  ++ DIL+   ++ +  +       ++
Sbjct  65    SELISAFGHAWDYTSRSLA-VLQQKTNLSYKVSGEKEDILHNVKLQQNGCTSTLPKCNHS  123

Query  2114  PVHLSCDKD---SSLLVSKNPESLNANRNISFFESRNKRDYLWR-FLRNGLDVQHKSSKG  1947
              ++L+  +      L ++     L  NR     ES  +     R F  +  ++ +    G
Sbjct  124   DINLTEMRQLYLDILRITNRTSVLKLNR-----ESTGQYQSPVRNFTGDMTNLLNGPRDG  178

Query  1946  IGLSSLRISYNLENVYGWMNEI--AFSKSKLGSSSIQNHEFGDCSLGNINSSSTNGCDVR  1773
              G+S L IS  L  +YGWMNE+  A +K    ++   + + G    G I +   +    R
Sbjct  179   KGISCLGISSGLGLIYGWMNELIPAEAKHPFKTAISDSEKAGKYFCGEIVTPPQDLMS-R  237

Query  1772  DATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVLEPNA  1593
             D    S  + +GN D +T    +  L   N     S    ++ L S     + ++   + 
Sbjct  238   DKGPKS-FIDSGNADSYTPSIQSKDLPVDNNAKLISDKKESTLLLSDYYLKVANIEADSC  296

Query  1592  F-QMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGL---------DDYGPNQRFGGIE  1443
               + +SS +H     K   SE   C   K +  S +G+         D++ P Q      
Sbjct  297   ISKAASSTLHADHHLKFVASEKGEC---KLDYESTNGIEFFPERKEEDNHRPAQE-----  348

Query  1442  CNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
                  +I  +  +KP  A+AK+EHAFAGA +GIFVSLCLHP+DTIKTVIQS RA+QK   
Sbjct  349   -EHTMKIHCLGHDKPQAAVAKEEHAFAGAFSGIFVSLCLHPVDTIKTVIQSYRAEQKSLC  407

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
             YIG+S++SERG+ GLYRGISS IASS PISA+YTFTYESVKGALLP    EY S+ HC+A
Sbjct  408   YIGKSIVSERGLTGLYRGISSKIASSGPISAIYTFTYESVKGALLPLFPKEYYSITHCIA  467

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             GGCAS+ATSF++TPSER+KQQMQV SHY NCWNAL+GII RGG+PSLYAGWGAVLCRN+P
Sbjct  468   GGCASIATSFVYTPSERIKQQMQVGSHYHNCWNALVGIITRGGMPSLYAGWGAVLCRNIP  527

Query  902   HSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV  723
             HS++KFY YE+LK    SS+    Q NTL TLVCGGLAGSTAALF+TPFDVVKTRLQTQ+
Sbjct  528   HSVVKFYVYENLKMWTLSSLPPGAQLNTLQTLVCGGLAGSTAALFSTPFDVVKTRLQTQI  587

Query  722   PGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLH  546
             PGS   Y+GV H ++EIG+ EGLKGLYRGLTPRL+MY++QGALFFASYESFKRLFSLD  
Sbjct  588   PGSIRPYNGVFHAVREIGRHEGLKGLYRGLTPRLIMYISQGALFFASYESFKRLFSLDKP  647

Query  545   QSSAQRTHHE  516
             + +AQ  H++
Sbjct  648   KETAQGHHYK  657



>ref|XP_010055636.1| PREDICTED: uncharacterized protein LOC104443805 [Eucalyptus grandis]
Length=716

 Score =   486 bits (1252),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 304/670 (45%), Positives = 411/670 (61%), Gaps = 36/670 (5%)
 Frame = -3

Query  2474  NQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPEIMTT  2295
             ++ P+  +   +YRCN +E A FE AD   +      +E  +Q    A+ + K  EI++T
Sbjct  33    SKTPRRSQPSIQYRCNRVEQATFEFADFVHKEGVPAHAETFQQEK--ADCKSKSSEILST  90

Query  2294  RELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSADGKNT  2115
              ELISA G+ W+  +  L+ +L   ++    V  ++ DIL+   ++ +  +       ++
Sbjct  91    SELISAFGHAWDYTSRSLA-VLQQKTNLSYKVSGEKEDILHNVKLQQNGCTSTLPKCNHS  149

Query  2114  PVHLSCDKD---SSLLVSKNPESLNANRNISFFESRNKRDYLWR-FLRNGLDVQHKSSKG  1947
              ++L+  +      L ++     L  NR     ES  +     R F  +  ++ +    G
Sbjct  150   DINLTEMRQLYLDILRITNRTSVLKLNR-----ESTGQYQSPVRNFTGDMTNLLNGPRDG  204

Query  1946  IGLSSLRISYNLENVYGWMNEI--AFSKSKLGSSSIQNHEFGDCSLGNINSSSTNGCDVR  1773
              G+S L IS  L  +YGWMNE+  A +K    ++   + + G    G I +   +    R
Sbjct  205   KGISCLGISSGLGLIYGWMNELIPAEAKHPFKTAISDSEKAGKYFCGEIVTPPQDLMS-R  263

Query  1772  DATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVLEPNA  1593
             D    S  + +GN D +T    +  L   N     S    ++ L S     + ++   + 
Sbjct  264   DKGPKS-FIDSGNADSYTPSIQSKDLPVDNNAKLISDKKESTLLLSDYYLKVANIEADSC  322

Query  1592  F-QMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGL---------DDYGPNQRFGGIE  1443
               + +SS +H     K   SE   C   K +  S +G+         D++ P Q      
Sbjct  323   ISKAASSTLHADHHLKFVASEKGEC---KLDYESTNGIEFFPERKEEDNHRPAQE-----  374

Query  1442  CNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
                  +I  +  +KP  A+AK+EHAFAGA +GIFVSLCLHP+DTIKTVIQS RA+QK   
Sbjct  375   -EHTMKIHCLGHDKPQAAVAKEEHAFAGAFSGIFVSLCLHPVDTIKTVIQSYRAEQKSLC  433

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
             YIG+S++SERG+ GLYRGISS IASS PISA+YTFTYESVKGALLP    EY S+ HC+A
Sbjct  434   YIGKSIVSERGLTGLYRGISSKIASSGPISAIYTFTYESVKGALLPLFPKEYYSITHCIA  493

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             GGCAS+ATSF++TPSER+KQQMQV SHY NCWNAL+GII RGG+PSLYAGWGAVLCRN+P
Sbjct  494   GGCASIATSFVYTPSERIKQQMQVGSHYHNCWNALVGIITRGGMPSLYAGWGAVLCRNIP  553

Query  902   HSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV  723
             HS++KFY YE+LK    SS+    Q NTL TLVCGGLAGSTAALF+TPFDVVKTRLQTQ+
Sbjct  554   HSVVKFYVYENLKMWTLSSLPPGAQLNTLQTLVCGGLAGSTAALFSTPFDVVKTRLQTQI  613

Query  722   PGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLH  546
             PGS   Y+GV H ++EIG+ EGLKGLYRGLTPRL+MY++QGALFFASYESFKRLFSLD  
Sbjct  614   PGSIRPYNGVFHAVREIGRHEGLKGLYRGLTPRLIMYISQGALFFASYESFKRLFSLDKP  673

Query  545   QSSAQRTHHE  516
             + +AQ  H++
Sbjct  674   KETAQGHHYK  683



>ref|XP_007040235.1| Mitochondrial substrate carrier family protein, putative isoform 
5 [Theobroma cacao]
 gb|EOY24736.1| Mitochondrial substrate carrier family protein, putative isoform 
5 [Theobroma cacao]
Length=644

 Score =   483 bits (1242),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 304/625 (49%), Positives = 381/625 (61%), Gaps = 18/625 (3%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYA-TISSENKKQNNKIAERERKPP  2310
             M     P + D+   KYR    EGAFFE+     E YA ++  +N+K   K    E K P
Sbjct  1     MPASKNPCRSDQPSIKYRWRADEGAFFEVGKLVPEEYAPSLPDKNRKSRTK---SETKEP  57

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSA  2130
             EI++T ELIS++  IWN A+  L+     A+    +   Q+ DIL     E++ +   SA
Sbjct  58    EILSTAELISSLNQIWNCASR-LTIFQQQANLDRNHFVSQKEDILVNLGREENGTGSISA  116

Query  2129  DGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNGLDVQHK  1959
             D K   V L         +  N + +   + +S F+  NK     +    L  G D+ +K
Sbjct  117   DSKYFCVDLGTASQLPPAMKPNFKFVKITKKMSMFDFCNKNPKCSFYQGLLCCGTDLSNK  176

Query  1958  SSKGIGLSSLRISYNLENVYGWMNEIAFSKSKL-GSSSIQNHEFGD-CSLGNINSSSTNG  1785
             S K  GLS++  SY   NVY WM E+     K   +   +N + G  C +G   SS + G
Sbjct  177   SWKAKGLSAVGFSYEFGNVYKWMREMIPGGLKYYVNVQTENKKLGKYCDVGG-TSSDSGG  235

Query  1784  CDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVL  1605
             C   D T+ +DNL   N + ++    +   S  +           ++LCS     L  V 
Sbjct  236   CISADRTNPTDNLPTENAEPYSHCIKSIDSSILHDAKLVMDTRRTTSLCSDY--FLTSVQ  293

Query  1604  EPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFG----GIECN  1437
             E  A    S          +  +   +C  T  E +  S  ++   N+R        E +
Sbjct  294   ETKANCSVSRTPDSNLCADYHINVLASCSSTYKECQHLSDGNECLKNERKQPEPFSTEDD  353

Query  1436  SESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYI  1257
             S  E    A EKP  ALAKQEHAFAGA AGIFVSLCLHP+DT+KTVIQSCRA+QK   +I
Sbjct  354   SRMESHSTASEKPQFALAKQEHAFAGAFAGIFVSLCLHPVDTVKTVIQSCRAEQKSICFI  413

Query  1256  GRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGG  1077
             GRS+ISERG+ GLYRGI+SNIASSAPISALYTF+YESVKGALLP    EY S+AHC+AGG
Sbjct  414   GRSIISERGLTGLYRGIASNIASSAPISALYTFSYESVKGALLPLFPKEYHSLAHCMAGG  473

Query  1076  CASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHS  897
             CAS+ATSFIFTPSERVKQQMQV  HY+NCWNAL+GI+++GGLPSLY GWGAVLCRNVPHS
Sbjct  474   CASIATSFIFTPSERVKQQMQVGVHYQNCWNALVGIVKKGGLPSLYTGWGAVLCRNVPHS  533

Query  896   IIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPG  717
             IIKFYTYESLKQ+M +S+Q   Q NTL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ+PG
Sbjct  534   IIKFYTYESLKQVMLTSLQSSAQPNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQIPG  593

Query  716   -SNQYDGVLHTLKEIGKSEGLKGLY  645
              S+QY+ V H L++I   EGLKGLY
Sbjct  594   SSSQYNSVYHALQDIRAQEGLKGLY  618


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 83/189 (44%), Gaps = 8/189 (4%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQ-VRSHYKNCWNALIGIIRRGGLPSLYAGWGAVL  918
             H  AG  A +  S    P + VK  +Q  R+  K+       II   GL  LY G  + +
Sbjct  375   HAFAGAFAGIFVSLCLHPVDTVKTVIQSCRAEQKSICFIGRSIISERGLTGLYRGIASNI  434

Query  917   CRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
               + P S +  ++YES+K  +     F  + ++L   + GG A    +   TP + VK +
Sbjct  435   ASSAPISALYTFSYESVKGALLP--LFPKEYHSLAHCMAGGCASIATSFIFTPSERVKQQ  492

Query  737   LQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             +Q  V     Y    + L  I K  GL  LY G    L   +    + F +YES K++  
Sbjct  493   MQVGV----HYQNCWNALVGIVKKGGLPSLYTGWGAVLCRNVPHSIIKFYTYESLKQVML  548

Query  557   LDLHQSSAQ  531
               L QSSAQ
Sbjct  549   TSL-QSSAQ  556



>ref|XP_010241914.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010241915.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010241916.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010241917.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010241918.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010241919.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010241920.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010241921.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010241923.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010241924.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010241925.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010241926.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010241927.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
 ref|XP_010241928.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/mitochondrial 
[Nelumbo nucifera]
Length=666

 Score =   476 bits (1225),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 311/675 (46%), Positives = 409/675 (61%), Gaps = 41/675 (6%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             MA  ++    D+   KY       A FEL+D D+E   +  S + +Q++K++E   K  E
Sbjct  1     MAACSRSSGSDQPSIKYMWTKPGAASFELSDFDQEGNVSKLSGSYRQHSKLSEP--KTSE  58

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSAD  2127
             I++T E +SAVG +WN A  PLS      ++ + +   Q+ ++L +   E +  +  SAD
Sbjct  59    ILSTAEFVSAVGRLWNWANRPLSVFQPKTNAKYTDYGYQKQNMLCYSGAEANGKASISAD  118

Query  2126  GKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRN-KRDYL--WRFLRNGLDVQH--  1962
              K     +  D     +V+   E L   + IS F+  N  R +L   R+L+   D Q   
Sbjct  119   TKCFCTDVMDDSYFPQVVNSEFECLKVTQKISLFDPCNGHRSHLSFGRYLQTS-DSQLPV  177

Query  1961  KSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQ---NHEFGDC-SLGNINSSS  1794
             +S KG GL S+ ISYNL  +YGW+ +I F   K   ++I    N E   C S G I    
Sbjct  178   ESWKGKGLISVGISYNLGEIYGWIRQIPFLGPKSSVNAIHSKNNKEDQGCISGGTITPVG  237

Query  1793  TNGCDVRDATSC----SDNLSAGNTDC-HTDIKPTsslsshnlnlhksSGASNSALCSKN  1629
                 +  D ++C     D+L   N    H    P                   ++L S  
Sbjct  238   IFTRESSDYSTCVTKREDSLLVENAASEHHAQMPV------------------NSLYSDY  279

Query  1628  GNVLFHVLEPNAF--QMSSSEVH-GYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQR  1458
                L   +E N+   + SSS ++  Y ++  S S  C  +E K+ +  +  L +     +
Sbjct  280   HFDLVSNIEANSVVPRTSSSNLYLDYHTDLPSLSN-CIFEECKHTSDDEEMLKNGKRQVK  338

Query  1457  FGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRAD  1278
                +E    +E+    + K   AL K+ HAFAGA+AG  VSLCLHP+DT+KTVIQS    
Sbjct  339   ELVLEHGHTTELRSSVQNKSGFALGKKRHAFAGALAGTCVSLCLHPVDTVKTVIQSRYMY  398

Query  1277  QKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSV  1098
             +K   +I RS+ISERGV G YRGI+SNIA SAPISA+YTFTYESVKGALLP L  EY S+
Sbjct  399   EKSIGHIVRSIISERGVTGFYRGIASNIACSAPISAVYTFTYESVKGALLPILSKEYYSI  458

Query  1097  AHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVL  918
             AHC AGGCAS+ATSFIFTPSER+KQQMQ+ SHY++CW+AL+GI+ RGGL SLYAGWGAVL
Sbjct  459   AHCTAGGCASIATSFIFTPSERIKQQMQIGSHYQSCWSALVGILERGGLRSLYAGWGAVL  518

Query  917   CRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
             CRN+PHSIIKFYTYESLKQL SSS   +    T  TL+CGGLAGSTAA FTTPFDVVKTR
Sbjct  519   CRNIPHSIIKFYTYESLKQLFSSS-DSNAHPTTFQTLICGGLAGSTAAFFTTPFDVVKTR  577

Query  737   LQTQVPGSN-QYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLF  561
             LQTQ+PGS+ QYDGV  TLKEI + EG +GLYRGLTPRLVMY++QGA+FFASYE FK + 
Sbjct  578   LQTQIPGSSRQYDGVFCTLKEIARHEGFRGLYRGLTPRLVMYISQGAIFFASYEFFKSIL  637

Query  560   SLDLHQSSAQRTHHE  516
             +L++ Q  A+   +E
Sbjct  638   TLEIRQLRAETIRNE  652



>ref|XP_007040238.1| Mitochondrial substrate carrier family protein, putative isoform 
8, partial [Theobroma cacao]
 gb|EOY24739.1| Mitochondrial substrate carrier family protein, putative isoform 
8, partial [Theobroma cacao]
Length=597

 Score =   460 bits (1184),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 291/602 (48%), Positives = 365/602 (61%), Gaps = 17/602 (3%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYA-TISSENKKQNNKIAERERKPP  2310
             M     P + D+   KYR    EGAFFE+     E YA ++  +N+K   K    E K P
Sbjct  1     MPASKNPCRSDQPSIKYRWRADEGAFFEVGKLVPEEYAPSLPDKNRKSRTK---SETKEP  57

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSA  2130
             EI++T ELIS++  IWN A+  L+     A+    +   Q+ DIL     E++ +   SA
Sbjct  58    EILSTAELISSLNQIWNCASR-LTIFQQQANLDRNHFVSQKEDILVNLGREENGTGSISA  116

Query  2129  DGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNGLDVQHK  1959
             D K   V L         +  N + +   + +S F+  NK     +    L  G D+ +K
Sbjct  117   DSKYFCVDLGTASQLPPAMKPNFKFVKITKKMSMFDFCNKNPKCSFYQGLLCCGTDLSNK  176

Query  1958  SSKGIGLSSLRISYNLENVYGWMNEIAFSKSKL-GSSSIQNHEFGD-CSLGNINSSSTNG  1785
             S K  GLS++  SY   NVY WM E+     K   +   +N + G  C +G   SS + G
Sbjct  177   SWKAKGLSAVGFSYEFGNVYKWMREMIPGGLKYYVNVQTENKKLGKYCDVGG-TSSDSGG  235

Query  1784  CDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVL  1605
             C   D T+ +DNL   N + ++    +   S  +           ++LCS     L  V 
Sbjct  236   CISADRTNPTDNLPTENAEPYSHCIKSIDSSILHDAKLVMDTRRTTSLCSDY--FLTSVQ  293

Query  1604  EPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFG----GIECN  1437
             E  A    S          +  +   +C  T  E +  S  ++   N+R        E +
Sbjct  294   ETKANCSVSRTPDSNLCADYHINVLASCSSTYKECQHLSDGNECLKNERKQPEPFSTEDD  353

Query  1436  SESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYI  1257
             S  E    A EKP  ALAKQEHAFAGA AGIFVSLCLHP+DT+KTVIQSCRA+QK   +I
Sbjct  354   SRMESHSTASEKPQFALAKQEHAFAGAFAGIFVSLCLHPVDTVKTVIQSCRAEQKSICFI  413

Query  1256  GRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGG  1077
             GRS+ISERG+ GLYRGI+SNIASSAPISALYTF+YESVKGALLP    EY S+AHC+AGG
Sbjct  414   GRSIISERGLTGLYRGIASNIASSAPISALYTFSYESVKGALLPLFPKEYHSLAHCMAGG  473

Query  1076  CASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHS  897
             CAS+ATSFIFTPSERVKQQMQV  HY+NCWNAL+GI+++GGLPSLY GWGAVLCRNVPHS
Sbjct  474   CASIATSFIFTPSERVKQQMQVGVHYQNCWNALVGIVKKGGLPSLYTGWGAVLCRNVPHS  533

Query  896   IIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPG  717
             IIKFYTYESLKQ+M +S+Q   Q NTL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ+PG
Sbjct  534   IIKFYTYESLKQVMLTSLQSSAQPNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQIPG  593

Query  716   SN  711
             S+
Sbjct  594   SS  595


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 83/189 (44%), Gaps = 8/189 (4%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQ-VRSHYKNCWNALIGIIRRGGLPSLYAGWGAVL  918
             H  AG  A +  S    P + VK  +Q  R+  K+       II   GL  LY G  + +
Sbjct  375   HAFAGAFAGIFVSLCLHPVDTVKTVIQSCRAEQKSICFIGRSIISERGLTGLYRGIASNI  434

Query  917   CRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
               + P S +  ++YES+K  +     F  + ++L   + GG A    +   TP + VK +
Sbjct  435   ASSAPISALYTFSYESVKGALLP--LFPKEYHSLAHCMAGGCASIATSFIFTPSERVKQQ  492

Query  737   LQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             +Q  V     Y    + L  I K  GL  LY G    L   +    + F +YES K++  
Sbjct  493   MQVGV----HYQNCWNALVGIVKKGGLPSLYTGWGAVLCRNVPHSIIKFYTYESLKQVML  548

Query  557   LDLHQSSAQ  531
               L QSSAQ
Sbjct  549   TSL-QSSAQ  556



>ref|XP_003524460.1| PREDICTED: uncharacterized protein LOC100778143 isoform X1 [Glycine 
max]
 ref|XP_006580581.1| PREDICTED: uncharacterized protein LOC100778143 isoform X2 [Glycine 
max]
 ref|XP_006580582.1| PREDICTED: uncharacterized protein LOC100778143 isoform X3 [Glycine 
max]
Length=643

 Score =   461 bits (1187),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 297/667 (45%), Positives = 396/667 (59%), Gaps = 64/667 (10%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             M+  N+ PK  +   KY      GA  E   S  +   ++S+   KQ       + K P+
Sbjct  1     MSGCNKSPKNGQQSFKYWRIQHGGASSEAVLSCVDYSPSLSTNENKQC--YGSSQPKSPQ  58

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRN-----------VDPQENDILYFPPM  2160
             I++T +LISA+G IW+SA+ PLS +LS  +    +           VD ++ND++Y    
Sbjct  59    ILSTSQLISAIGLIWDSASRPLSVLLSKETVNQDDKGFQKEKILDSVDERKNDLVY----  114

Query  2159  EDSCSSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNK-RDYLWRFLR  1983
                     S D K  PV     +  + +V    +     + IS  +S N+ +DY+    +
Sbjct  115   -------ASTDIKYYPV----TEGGAQIVQGKLDFPKVMQKISVLDSSNESQDYIDSLFK  163

Query  1982  NGLDVQHKSS----KGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSL  1815
               L    K++    K + L    +S    NVY W+     +K+      +   E  + + 
Sbjct  164   RCLLASDKTTNKDWKEMELRREEMSCKSGNVYWWVGR-NITKALNCQVDVAQPEIPESNA  222

Query  1814  ----GNINSSSTNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNS  1647
                 GNI+  ++       A +   ++S+ N+  H                  ++   N+
Sbjct  223   PVAGGNISVDTST-----PALAIESDVSSPNSITH------------ETQSLYNAATLNT  265

Query  1646  ALCSKNGNVLFHVLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGP  1467
              + S   +  F    P+  Q+ SS +          S   A ++ ++E   +  L+    
Sbjct  266   RIVSPLCSDYFLQAVPDTCQILSSSICADYHINSLASYNSASNQCQHEIDDNKSLEI--Q  323

Query  1466  NQRFGGIECNSESEISVVAKE-KPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQS  1290
              + F  I  + E ++   A   KPC+  AKQEH F+GA+AGI VSLCLHP+DTIKTVIQ+
Sbjct  324   RRHFLDI-ADDEPKVQTSATHLKPCNYQAKQEHVFSGALAGICVSLCLHPVDTIKTVIQA  382

Query  1289  CRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTE  1110
             CRA+ +  +YIG+S++S+RG+LGLYRGI++NIA SAPISA+YTF+YESVK ALLP L  E
Sbjct  383   CRAEHRSIFYIGKSIVSDRGLLGLYRGITTNIACSAPISAVYTFSYESVKAALLPHLPKE  442

Query  1109  YQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGW  930
             Y S AHC+ GGCAS+ATSFIFTPSER+KQQMQV SHY+NCW+ L+GIIR GG  SLYAGW
Sbjct  443   YYSFAHCMGGGCASIATSFIFTPSERIKQQMQVGSHYRNCWDVLVGIIRNGGFSSLYAGW  502

Query  929   GAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDV  750
              AVLCRNVPHSIIKFYTYESLKQ+M SS    IQ NT  TLVCGGLAGSTAALFTTPFDV
Sbjct  503   RAVLCRNVPHSIIKFYTYESLKQVMPSS----IQPNTFQTLVCGGLAGSTAALFTTPFDV  558

Query  749   VKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESF  573
             +KTRLQTQ+PGS NQYD VLH L +I KSEG KGLYRGL PRL+MYM+QG+LFFASYE F
Sbjct  559   IKTRLQTQIPGSANQYDSVLHALYKISKSEGFKGLYRGLIPRLIMYMSQGSLFFASYEFF  618

Query  572   KRLFSLD  552
             KR FSL+
Sbjct  619   KRTFSLE  625



>gb|KHN23643.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=643

 Score =   457 bits (1177),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 297/667 (45%), Positives = 395/667 (59%), Gaps = 64/667 (10%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             M+  N+ PK  +   KY      GA  E   S  +   ++S+   KQ       + K P+
Sbjct  1     MSGCNKSPKNGQQSFKYWRIQHGGASSEAVLSCVDYSPSLSTNENKQC--YGSSQPKSPQ  58

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRN-----------VDPQENDILYFPPM  2160
             I++T +LISA+G IW+SA+ PLS +LS  +    +           VD ++ND++Y    
Sbjct  59    ILSTSQLISAIGLIWDSASRPLSVLLSKETVNQDDKGFQKEKILDSVDERKNDLVY----  114

Query  2159  EDSCSSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNK-RDYLWRFLR  1983
                     S D K  PV     +  + +V    +     + IS  +S N+ +DY+    +
Sbjct  115   -------ASTDIKYYPV----TEGGAQIVQGKLDFPKVMQKISVLDSSNESQDYIDSLFK  163

Query  1982  NGLDVQHKSS----KGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSL  1815
               L    K++    K + L    +S    NVY W      +K+      +   E  + + 
Sbjct  164   RCLLASDKTTNKDWKEMELRREEMSCKSGNVY-WWVGRNITKALNCQVDVAQPEIPESNA  222

Query  1814  ----GNINSSSTNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNS  1647
                 GNI+  ++       A +   ++S+ N+  H                  ++   N+
Sbjct  223   PVAGGNISVDTST-----PALANESDVSSPNSITH------------ETQSLYNAATLNT  265

Query  1646  ALCSKNGNVLFHVLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGP  1467
              + S   +  F    P+  Q+ SS +          S   A ++ ++E   +  L+    
Sbjct  266   RIVSPLCSDYFLQAVPDTCQILSSSICADYHINSLASYNSASNQCQHEIDDNKSLEI--Q  323

Query  1466  NQRFGGIECNSESEISVVAKE-KPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQS  1290
              + F  I  + E ++   A   KPC+  AKQEH F+GA+AGI VSLCLHP+DTIKTVIQ+
Sbjct  324   RRHFLDI-ADDEPKVQTSATHLKPCNYQAKQEHVFSGALAGICVSLCLHPVDTIKTVIQA  382

Query  1289  CRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTE  1110
             CRA+ +  +YIG+S++S+RG+LGLYRGI++NIA SAPISA+YTF+YESVK ALLP L  E
Sbjct  383   CRAEHRSIFYIGKSIVSDRGLLGLYRGITTNIACSAPISAVYTFSYESVKAALLPHLPKE  442

Query  1109  YQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGW  930
             Y S AHC+ GGCAS+ATSFIFTPSER+KQQMQV SHY+NCW+ L+GIIR GG  SLYAGW
Sbjct  443   YYSFAHCMGGGCASIATSFIFTPSERIKQQMQVGSHYRNCWDVLVGIIRNGGFSSLYAGW  502

Query  929   GAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDV  750
              AVLCRNVPHSIIKFYTYESLKQ+M SS    IQ NT  TLVCGGLAGSTAALFTTPFDV
Sbjct  503   RAVLCRNVPHSIIKFYTYESLKQVMPSS----IQPNTFQTLVCGGLAGSTAALFTTPFDV  558

Query  749   VKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESF  573
             +KTRLQTQ+PGS NQYD VLH L +I KSEG KGLYRGL PRL+MYM+QG+LFFASYE F
Sbjct  559   IKTRLQTQIPGSANQYDSVLHALYKISKSEGFKGLYRGLIPRLIMYMSQGSLFFASYEFF  618

Query  572   KRLFSLD  552
             KR FSL+
Sbjct  619   KRTFSLE  625



>gb|KCW72151.1| hypothetical protein EUGRSUZ_E00597 [Eucalyptus grandis]
Length=680

 Score =   458 bits (1179),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 296/670 (44%), Positives = 403/670 (60%), Gaps = 46/670 (7%)
 Frame = -3

Query  2474  NQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPEIMTT  2295
             ++ P+  +   +YRCN +E A FE AD   +      +E  +Q    A+ + K  EI++T
Sbjct  7     SKTPRRSQPSIQYRCNRVEQATFEFADFVHKEGVPAHAETFQQEK--ADCKSKSSEILST  64

Query  2294  RELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSADGKNT  2115
              ELISA G+ W+  +  L+ +L   ++    V  ++ DIL+   ++ +  +       ++
Sbjct  65    SELISAFGHAWDYTSRSLA-VLQQKTNLSYKVSGEKEDILHNVKLQQNGCTSTLPKCNHS  123

Query  2114  PVHLSCDKD---SSLLVSKNPESLNANRNISFFESRNKRDYLWR-FLRNGLDVQHKSSKG  1947
              ++L+  +      L ++     L  NR     ES  +     R F  +  ++ +    G
Sbjct  124   DINLTEMRQLYLDILRITNRTSVLKLNR-----ESTGQYQSPVRNFTGDMTNLLNGPRDG  178

Query  1946  IGLSSLRISYNLENVYGWMNEI--AFSKSKLGSSSIQNHEFGDCSLGNINSSSTNGCDVR  1773
              G+S L IS  L  +YGWMNE+  A +K    ++   + + G    G I +   +    R
Sbjct  179   KGISCLGISSGLGLIYGWMNELIPAEAKHPFKTAISDSEKAGKYFCGEIVTPPQDLMS-R  237

Query  1772  DATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVLEPNA  1593
             D    S  + +GN D +T    +  L   N     S    ++ L S     + ++   + 
Sbjct  238   DKGPKS-FIDSGNADSYTPSIQSKDLPVDNNAKLISDKKESTLLLSDYYLKVANIEADSC  296

Query  1592  F-QMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGL---------DDYGPNQRFGGIE  1443
               + +SS +H     K   SE   C   K +  S +G+         D++ P Q      
Sbjct  297   ISKAASSTLHADHHLKFVASEKGEC---KLDYESTNGIEFFPERKEEDNHRPAQE-----  348

Query  1442  CNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
                  +I  +  +KP  A+AK+EHAFAGA +GIFVSLCLHP+DTIKTVIQS RA+QK   
Sbjct  349   -EHTMKIHCLGHDKPQAAVAKEEHAFAGAFSGIFVSLCLHPVDTIKTVIQSYRAEQKSLC  407

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
             YIG+S++SERG+ GLYRGISS IASS PISA+YTFTYESVKGALLP    EY S+ HC+A
Sbjct  408   YIGKSIVSERGLTGLYRGISSKIASSGPISAIYTFTYESVKGALLPLFPKEYYSITHCIA  467

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             GGCAS+ATSF++TPSER+KQQM          NAL+GII RGG+PSLYAGWGAVLCRN+P
Sbjct  468   GGCASIATSFVYTPSERIKQQM----------NALVGIITRGGMPSLYAGWGAVLCRNIP  517

Query  902   HSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV  723
             HS++KFY YE+LK    SS+    Q NTL TLVCGGLAGSTAALF+TPFDVVKTRLQTQ+
Sbjct  518   HSVVKFYVYENLKMWTLSSLPPGAQLNTLQTLVCGGLAGSTAALFSTPFDVVKTRLQTQI  577

Query  722   PGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLH  546
             PGS   Y+GV H ++EIG+ EGLKGLYRGLTPRL+MY++QGALFFASYESFKRLFSLD  
Sbjct  578   PGSIRPYNGVFHAVREIGRHEGLKGLYRGLTPRLIMYISQGALFFASYESFKRLFSLDKP  637

Query  545   QSSAQRTHHE  516
             + +AQ  H++
Sbjct  638   KETAQGHHYK  647



>ref|XP_010695140.1| PREDICTED: uncharacterized protein LOC104907835 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=670

 Score =   456 bits (1174),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 306/697 (44%), Positives = 405/697 (58%), Gaps = 76/697 (11%)
 Frame = -3

Query  2462  KGDKLPT------KYRCNLLEGAFFELAD-SDRENYATISSENKKQNNKIAERERKPPEI  2304
             K DK PT      K+R   L+G +FE+AD +D+ +    S++NK     +A +    PEI
Sbjct  3     KLDKSPTHSQQSVKFRVKPLKGPYFEIADFADQSDVHISSNDNKDGREHLASQS---PEI  59

Query  2303  MTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSADG  2124
             +T  ELISAVG+IW  A+  L+ +   A     +   Q+++ L +   +DS       D 
Sbjct  60    LTKTELISAVGHIWECASRSLARVQPKARFECSSTLRQKDNDLRYLVQDDSSGVITFIDS  119

Query  2123  KNTPVHLSCDKDSSLLVSKNPESLNANR-------NISFFESRNKRDYLWRFLRNGLDVQ  1965
                 V L      S ++ K+ + + A R       N  F E+  +R     F+++ + ++
Sbjct  120   GYFNVDLKSSGYFSCIMQKSLQFVRATRRMQYNPYNDHFIENLFERSGDDGFVKHDIWLK  179

Query  1964  HKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEF---------------  1830
              KS   +G     I Y L N YGWM++I+ S     S+S +  +                
Sbjct  180   EKSIANVG-----ILYRLMNRYGWMSQISVSPKPRMSASNEAKKIVEAFTSKAAVCYFCP  234

Query  1829  ---GDCSLGNINSSSTNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSG  1659
                 + S  N+ +   N CD  D T+  D +S G +D    ++                 
Sbjct  235   VSEDEVSSSNVGTGYLNTCD--DMTNLKDLISHGASDRVNMLR----------------K  276

Query  1658  ASNSALCSKNGNVLFHVLEPN--AFQMSSSEVHG-YSSEKHSTSEYCACDETKYENRSDS  1488
             AS S   S N   L H+++    A +MS++   G +  +K ST    A D T    + + 
Sbjct  277   ASISFPYSVN---LLHMVQNKHYATRMSTALSLGLHLDDKMST---LAPDCTHEPKQLNV  330

Query  1487  GLDDYGPNQRFGGIECNSESEI------SVVAKEKPCHALAKQEHAFAGAMAGIFVSLCL  1326
               DD   N+     + N + E+      SV  K  P   LAKQEHA +GA+AGIFVSLCL
Sbjct  331   EADDLLENEMRRCEKLNPQDELQIESCSSVTNKFHPL--LAKQEHAVSGAVAGIFVSLCL  388

Query  1325  HPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYES  1146
             HP+DT+KT+ QSC+  QK   YIG+SV+SERG+ GLYRGI+SNI +SAPISA+YTFTYES
Sbjct  389   HPIDTVKTIAQSCQPGQKSICYIGQSVLSERGLPGLYRGIASNITTSAPISAIYTFTYES  448

Query  1145  VKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGII  966
             +K  LLPFL  EY SVAHC AG CAS+ATSF+FTPSER+KQQMQV + Y+NCWNA+  II
Sbjct  449   MKELLLPFLAKEYHSVAHCTAGACASIATSFVFTPSERIKQQMQVNTKYQNCWNAVQKII  508

Query  965   RRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAG  786
               GGL SLYAGWGAVLCRN+PHSIIKFYTYESLKQ + SS   + Q NT  TL+CGGLAG
Sbjct  509   ETGGLTSLYAGWGAVLCRNIPHSIIKFYTYESLKQKLMSSEPPNKQPNTSQTLLCGGLAG  568

Query  785   STAALFTTPFDVVKTRLQTQVPGSN-QYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMT  609
             STAALF+TPFDVVKTRLQTQ+P S  +Y G+L  L++I   EG++GLYRGL PRL MYM+
Sbjct  569   STAALFSTPFDVVKTRLQTQMPESRGRYHGILSVLQDIRDHEGVRGLYRGLIPRLAMYMS  628

Query  608   QGALFFASYESFKRLFSLDLHQSSAQRTHHEPCFGDD  498
             QGALFFASYE  K   SL+L Q   +   H+    DD
Sbjct  629   QGALFFASYEFLKSFLSLELLQHKPEMLQHKQDIDDD  665



>ref|XP_010695139.1| PREDICTED: uncharacterized protein LOC104907835 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=681

 Score =   457 bits (1175),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 306/697 (44%), Positives = 405/697 (58%), Gaps = 76/697 (11%)
 Frame = -3

Query  2462  KGDKLPT------KYRCNLLEGAFFELAD-SDRENYATISSENKKQNNKIAERERKPPEI  2304
             K DK PT      K+R   L+G +FE+AD +D+ +    S++NK     +A +    PEI
Sbjct  14    KLDKSPTHSQQSVKFRVKPLKGPYFEIADFADQSDVHISSNDNKDGREHLASQS---PEI  70

Query  2303  MTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSADG  2124
             +T  ELISAVG+IW  A+  L+ +   A     +   Q+++ L +   +DS       D 
Sbjct  71    LTKTELISAVGHIWECASRSLARVQPKARFECSSTLRQKDNDLRYLVQDDSSGVITFIDS  130

Query  2123  KNTPVHLSCDKDSSLLVSKNPESLNANR-------NISFFESRNKRDYLWRFLRNGLDVQ  1965
                 V L      S ++ K+ + + A R       N  F E+  +R     F+++ + ++
Sbjct  131   GYFNVDLKSSGYFSCIMQKSLQFVRATRRMQYNPYNDHFIENLFERSGDDGFVKHDIWLK  190

Query  1964  HKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEF---------------  1830
              KS   +G     I Y L N YGWM++I+ S     S+S +  +                
Sbjct  191   EKSIANVG-----ILYRLMNRYGWMSQISVSPKPRMSASNEAKKIVEAFTSKAAVCYFCP  245

Query  1829  ---GDCSLGNINSSSTNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSG  1659
                 + S  N+ +   N CD  D T+  D +S G +D    ++                 
Sbjct  246   VSEDEVSSSNVGTGYLNTCD--DMTNLKDLISHGASDRVNMLR----------------K  287

Query  1658  ASNSALCSKNGNVLFHVLEPN--AFQMSSSEVHG-YSSEKHSTSEYCACDETKYENRSDS  1488
             AS S   S N   L H+++    A +MS++   G +  +K ST    A D T    + + 
Sbjct  288   ASISFPYSVN---LLHMVQNKHYATRMSTALSLGLHLDDKMST---LAPDCTHEPKQLNV  341

Query  1487  GLDDYGPNQRFGGIECNSESEI------SVVAKEKPCHALAKQEHAFAGAMAGIFVSLCL  1326
               DD   N+     + N + E+      SV  K  P   LAKQEHA +GA+AGIFVSLCL
Sbjct  342   EADDLLENEMRRCEKLNPQDELQIESCSSVTNKFHPL--LAKQEHAVSGAVAGIFVSLCL  399

Query  1325  HPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYES  1146
             HP+DT+KT+ QSC+  QK   YIG+SV+SERG+ GLYRGI+SNI +SAPISA+YTFTYES
Sbjct  400   HPIDTVKTIAQSCQPGQKSICYIGQSVLSERGLPGLYRGIASNITTSAPISAIYTFTYES  459

Query  1145  VKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGII  966
             +K  LLPFL  EY SVAHC AG CAS+ATSF+FTPSER+KQQMQV + Y+NCWNA+  II
Sbjct  460   MKELLLPFLAKEYHSVAHCTAGACASIATSFVFTPSERIKQQMQVNTKYQNCWNAVQKII  519

Query  965   RRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAG  786
               GGL SLYAGWGAVLCRN+PHSIIKFYTYESLKQ + SS   + Q NT  TL+CGGLAG
Sbjct  520   ETGGLTSLYAGWGAVLCRNIPHSIIKFYTYESLKQKLMSSEPPNKQPNTSQTLLCGGLAG  579

Query  785   STAALFTTPFDVVKTRLQTQVPGSN-QYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMT  609
             STAALF+TPFDVVKTRLQTQ+P S  +Y G+L  L++I   EG++GLYRGL PRL MYM+
Sbjct  580   STAALFSTPFDVVKTRLQTQMPESRGRYHGILSVLQDIRDHEGVRGLYRGLIPRLAMYMS  639

Query  608   QGALFFASYESFKRLFSLDLHQSSAQRTHHEPCFGDD  498
             QGALFFASYE  K   SL+L Q   +   H+    DD
Sbjct  640   QGALFFASYEFLKSFLSLELLQHKPEMLQHKQDIDDD  676



>ref|XP_009795672.1| PREDICTED: uncharacterized protein LOC104242340 isoform X2 [Nicotiana 
sylvestris]
Length=555

 Score =   452 bits (1162),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 290/591 (49%), Positives = 360/591 (61%), Gaps = 64/591 (11%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             MA G+Q  + +K    YR NLLEGA FELAD DRE++A +SSENK +N K +E      E
Sbjct  1     MAGGSQSRQNEKPSVNYRRNLLEGALFELADFDRESHAPVSSENK-ENPKSSESGSS--E  57

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSAD  2127
             IM+T +LISA+G IWNS A PL+ I+S +SS   + D +EN+I      ++  S+  S  
Sbjct  58    IMSTSDLISAIGTIWNSTARPLTRIVSKSSSRCYSADHRENNISGCSAADEISSAYFSTY  117

Query  2126  GKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKRDYLWRFLRNGLDVQHKSSKG  1947
               + PV++  D DSS     N E L  N+ +SFF        LW  LR G  +  ++ K 
Sbjct  118   DHSIPVNVDSDTDSSPPALANVECLTVNQKVSFFGPLLGNSPLWNLLRGGSTMHPETWKA  177

Query  1946  IGLSSLRISYNLENVYGWMNEIAFSKSK--LGSSSIQNHEFGDCSLGNINSSSTNGCDVR  1773
               L+      +L  +Y WM+EI+  K K  L S++   HE   C+  +   S ++   V 
Sbjct  178   KNLAD-----DLHTMYDWMHEISLLKLKHHLNSANTGIHESRKCADEDTTKSPSSYSTVA  232

Query  1772  DATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSG-------------------ASN  1650
             D           N DC TD++ T+     ++                           SN
Sbjct  233   DIV---------NADCQTDMEKTAGSLLGHIVKAHEIDRVSTGISCLRHYNEVSPDKKSN  283

Query  1649  S--ALCSKNGNVLF-HVLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLD  1479
             +   LCSKN +V+  + L PN     +S ++   +E H+       D T  E      L+
Sbjct  284   TLETLCSKNNSVVHEYSLPPNC---PASVLNKIYAEDHTN------DSTTNEKVE---LE  331

Query  1478  DYGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTV  1299
             D          E NSE +IS+ AK+KP + LAKQEHAFAGAMAGIFVSLCLHP+DTIKTV
Sbjct  332   D----------ELNSEVQISM-AKDKPRYTLAKQEHAFAGAMAGIFVSLCLHPVDTIKTV  380

Query  1298  IQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFL  1119
             +QSCR DQKP YYIGRS ISERGV  LYRGIS+N+ASSAPIS LYTFTYESVKGAL+P  
Sbjct  381   VQSCRGDQKPLYYIGRSFISERGVTALYRGISTNLASSAPISGLYTFTYESVKGALIPLF  440

Query  1118  HTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLY  939
               EYQS AHC AGGCAS+ATSFIFTPSER+KQQMQV SHYKNCWNAL+ IIR GGLPSLY
Sbjct  441   PKEYQSFAHCFAGGCASIATSFIFTPSERIKQQMQVGSHYKNCWNALVEIIRSGGLPSLY  500

Query  938   AGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAG  786
             AGW AVLCRN+PHSIIKFYTYE LK+L  SSVQ   QN+TLMTL    L+G
Sbjct  501   AGWRAVLCRNIPHSIIKFYTYERLKELRFSSVQLRNQNDTLMTLRQWDLSG  551


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 72/178 (40%), Gaps = 7/178 (4%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQ-VRSHYKNCWNALIGIIRRGGLPSLYAGWGAVL  918
             H  AG  A +  S    P + +K  +Q  R   K  +      I   G+ +LY G    L
Sbjct  356   HAFAGAMAGIFVSLCLHPVDTIKTVVQSCRGDQKPLYYIGRSFISERGVTALYRGISTNL  415

Query  917   CRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
               + P S +  +TYES+K  +     F  +  +      GG A    +   TP + +K +
Sbjct  416   ASSAPISGLYTFTYESVKGALIP--LFPKEYQSFAHCFAGGCASIATSFIFTPSERIKQQ  473

Query  737   LQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRL  564
             +Q      + Y    + L EI +S GL  LY G    L   +    + F +YE  K L
Sbjct  474   MQV----GSHYKNCWNALVEIIRSGGLPSLYAGWRAVLCRNIPHSIIKFYTYERLKEL  527



>ref|XP_007040234.1| Mitochondrial substrate carrier family protein, putative isoform 
4 [Theobroma cacao]
 gb|EOY24735.1| Mitochondrial substrate carrier family protein, putative isoform 
4 [Theobroma cacao]
Length=634

 Score =   451 bits (1161),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 288/597 (48%), Positives = 360/597 (60%), Gaps = 17/597 (3%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYA-TISSENKKQNNKIAERERKPP  2310
             M     P + D+   KYR    EGAFFE+     E YA ++  +N+K   K    E K P
Sbjct  1     MPASKNPCRSDQPSIKYRWRADEGAFFEVGKLVPEEYAPSLPDKNRKSRTK---SETKEP  57

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSA  2130
             EI++T ELIS++  IWN A+  L+     A+    +   Q+ DIL     E++ +   SA
Sbjct  58    EILSTAELISSLNQIWNCASR-LTIFQQQANLDRNHFVSQKEDILVNLGREENGTGSISA  116

Query  2129  DGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNGLDVQHK  1959
             D K   V L         +  N + +   + +S F+  NK     +    L  G D+ +K
Sbjct  117   DSKYFCVDLGTASQLPPAMKPNFKFVKITKKMSMFDFCNKNPKCSFYQGLLCCGTDLSNK  176

Query  1958  SSKGIGLSSLRISYNLENVYGWMNEIAFSKSKL-GSSSIQNHEFGD-CSLGNINSSSTNG  1785
             S K  GLS++  SY   NVY WM E+     K   +   +N + G  C +G   SS + G
Sbjct  177   SWKAKGLSAVGFSYEFGNVYKWMREMIPGGLKYYVNVQTENKKLGKYCDVGG-TSSDSGG  235

Query  1784  CDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVL  1605
             C   D T+ +DNL   N + ++    +   S  +           ++LCS     L  V 
Sbjct  236   CISADRTNPTDNLPTENAEPYSHCIKSIDSSILHDAKLVMDTRRTTSLCSDY--FLTSVQ  293

Query  1604  EPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFG----GIECN  1437
             E  A    S          +  +   +C  T  E +  S  ++   N+R        E +
Sbjct  294   ETKANCSVSRTPDSNLCADYHINVLASCSSTYKECQHLSDGNECLKNERKQPEPFSTEDD  353

Query  1436  SESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYI  1257
             S  E    A EKP  ALAKQEHAFAGA AGIFVSLCLHP+DT+KTVIQSCRA+QK   +I
Sbjct  354   SRMESHSTASEKPQFALAKQEHAFAGAFAGIFVSLCLHPVDTVKTVIQSCRAEQKSICFI  413

Query  1256  GRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGG  1077
             GRS+ISERG+ GLYRGI+SNIASSAPISALYTF+YESVKGALLP    EY S+AHC+AGG
Sbjct  414   GRSIISERGLTGLYRGIASNIASSAPISALYTFSYESVKGALLPLFPKEYHSLAHCMAGG  473

Query  1076  CASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHS  897
             CAS+ATSFIFTPSERVKQQMQV  HY+NCWNAL+GI+++GGLPSLY GWGAVLCRNVPHS
Sbjct  474   CASIATSFIFTPSERVKQQMQVGVHYQNCWNALVGIVKKGGLPSLYTGWGAVLCRNVPHS  533

Query  896   IIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ  726
             IIKFYTYESLKQ+M +S+Q   Q NTL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ
Sbjct  534   IIKFYTYESLKQVMLTSLQSSAQPNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQ  590


 Score = 64.7 bits (156),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 83/189 (44%), Gaps = 8/189 (4%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQ-VRSHYKNCWNALIGIIRRGGLPSLYAGWGAVL  918
             H  AG  A +  S    P + VK  +Q  R+  K+       II   GL  LY G  + +
Sbjct  375   HAFAGAFAGIFVSLCLHPVDTVKTVIQSCRAEQKSICFIGRSIISERGLTGLYRGIASNI  434

Query  917   CRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
               + P S +  ++YES+K  +     F  + ++L   + GG A    +   TP + VK +
Sbjct  435   ASSAPISALYTFSYESVKGALLP--LFPKEYHSLAHCMAGGCASIATSFIFTPSERVKQQ  492

Query  737   LQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             +Q  V     Y    + L  I K  GL  LY G    L   +    + F +YES K++  
Sbjct  493   MQVGV----HYQNCWNALVGIVKKGGLPSLYTGWGAVLCRNVPHSIIKFYTYESLKQVML  548

Query  557   LDLHQSSAQ  531
               L QSSAQ
Sbjct  549   TSL-QSSAQ  556



>ref|XP_002304496.1| hypothetical protein POPTR_0003s12770g [Populus trichocarpa]
 gb|EEE79475.1| hypothetical protein POPTR_0003s12770g [Populus trichocarpa]
Length=620

 Score =   450 bits (1157),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 293/680 (43%), Positives = 390/680 (57%), Gaps = 89/680 (13%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPT-KYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPP  2310
             M  G +P +G+  P+  Y+ N   G  F+LAD   + ++   SEN K ++   +     P
Sbjct  1     MYGGKRPGRGNHPPSITYKRNRNGGMPFDLADFVHDGHSPSISENNKPDD--IKSGTSSP  58

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNV---DPQENDILYFPPMEDSCSSP  2139
             EI +T EL+SAVG +WN     L+      +   +NV   D           ++D     
Sbjct  59    EIFSTTELVSAVGQVWNL----LNPCAVPETKEQKNVILNDLNGAGAGGAAILDD-----  109

Query  2138  PSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNK---RDYLWRFLRNGLDV  1968
                + K   V +      + +V    E L   + +  FE  ++   R   WRFL+ G   
Sbjct  110   ---NTKYFCVDIRNGSHVTQMVQPQFEFLKVTKKMLVFEPSSENYSRSLFWRFLKRGTSS  166

Query  1967  QHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSLGNINSSSTN  1788
             +++S +G GL+++   Y L+ +YGWM E+  + SK  +++                 ST 
Sbjct  167   RNESREGKGLATVGTGYELDKIYGWMKELIPAGSKYPANN-----------------STE  209

Query  1787  GCDVRD-ATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFH  1611
             GC  RD  T+ ++NL++   DC++D   +  +S  +     + G S+S     +   L  
Sbjct  210   GCIARDRPTNPANNLASKTADCYSDSVESKEVSLCDNARVVTIGKSSSV---SSDYFLGA  266

Query  1610  VLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFGGIECNSE  1431
             + + NA   +S  ++      +  +    C  T     +D G  D   N R       ++
Sbjct  267   LHDFNANSSASRALNYVLCADYHINCLAPCKSTYEHFENDIGDFDVPKNSREQPQNLVTQ  326

Query  1430  S----EISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
                  +I   A E+P +ALAKQEHAFAGA AGIFVSL LHP+DT+KT+IQSC A+QK   
Sbjct  327   GRTGIQIQSSACERPQYALAKQEHAFAGAFAGIFVSLSLHPIDTVKTIIQSCPAEQKSIS  386

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
             +IGRS++SERG+ GLYRGI SNIASSAPISA+YTFTYESVKG+LLP    E+ S AHC+A
Sbjct  387   FIGRSIVSERGMTGLYRGIGSNIASSAPISAIYTFTYESVKGSLLPHFPKEHHSFAHCIA  446

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             GGCAS+ATSF+FTPSER+KQQMQ+ SHY NCW+AL+GII +GG  SLYAGWGAVLCRN+P
Sbjct  447   GGCASIATSFVFTPSERIKQQMQIGSHYNNCWSALVGIIGKGGFHSLYAGWGAVLCRNIP  506

Query  902   HSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV  723
              S+IK                          LVCGGLAGSTAALFTTPFDVVKTRLQTQ+
Sbjct  507   QSVIK--------------------------LVCGGLAGSTAALFTTPFDVVKTRLQTQI  540

Query  722   PGS-NQYDGVLHTLKEIGKSEGLKGLY----------------RGLTPRLVMYMTQGALF  594
             PGS + Y  V H L+EIGK+EGLKGLY                RGLTPRLVMYM+QGALF
Sbjct  541   PGSMSPYGNVFHALQEIGKNEGLKGLYRYYQLCLTTILLVSMFRGLTPRLVMYMSQGALF  600

Query  593   FASYESFKRLFSLDLHQSSA  534
             FASYE  KRLFSL++ Q SA
Sbjct  601   FASYEFLKRLFSLEMPQFSA  620



>ref|XP_007160064.1| hypothetical protein PHAVU_002G289600g [Phaseolus vulgaris]
 ref|XP_007160065.1| hypothetical protein PHAVU_002G289600g [Phaseolus vulgaris]
 gb|ESW32058.1| hypothetical protein PHAVU_002G289600g [Phaseolus vulgaris]
 gb|ESW32059.1| hypothetical protein PHAVU_002G289600g [Phaseolus vulgaris]
Length=656

 Score =   444 bits (1142),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 217/288 (75%), Positives = 251/288 (87%), Gaps = 5/288 (2%)
 Frame = -3

Query  1403  KPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVL  1224
             KPC++ AKQEHAF+GA+AG+ VSLCLHP+DTIKTVIQSCRA+ +  +YIG+S++S+RG+ 
Sbjct  355   KPCNSKAKQEHAFSGALAGVCVSLCLHPVDTIKTVIQSCRAEHRSIFYIGKSIVSDRGLF  414

Query  1223  GLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFT  1044
             GLYRGI++N+ASSAPISA+YTF+YESVK ALLP+L  EY S AHC+ GGCAS+ATSFIFT
Sbjct  415   GLYRGIATNVASSAPISAVYTFSYESVKAALLPYLPKEYYSFAHCIGGGCASIATSFIFT  474

Query  1043  PSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK  864
             PSER+KQQMQVRS Y+NCW+ L+GIIR GG  SLYAGW AVLCRNVPHSIIKFYTYESLK
Sbjct  475   PSERIKQQMQVRSQYRNCWDVLVGIIRNGGFTSLYAGWRAVLCRNVPHSIIKFYTYESLK  534

Query  863   QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHT  687
             ++M SSV    Q NT  TLVCGGLAGSTAALFTTPFDV+KTRLQTQ+PGS NQYD VLH 
Sbjct  535   EVMPSSV----QPNTFQTLVCGGLAGSTAALFTTPFDVIKTRLQTQIPGSANQYDSVLHA  590

Query  686   LKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQ  543
             L +I K EGLKGLYRGL PRL+MYMTQG+LFFASYE FKR FSL+  Q
Sbjct  591   LYKISKGEGLKGLYRGLIPRLIMYMTQGSLFFASYEFFKRAFSLEASQ  638



>ref|XP_004503716.1| PREDICTED: calcium-binding mitochondrial carrier protein Aralar1-like 
isoform X1 [Cicer arietinum]
Length=625

 Score =   442 bits (1137),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 215/295 (73%), Positives = 253/295 (86%), Gaps = 4/295 (1%)
 Frame = -3

Query  1433  ESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIG  1254
             +++I     +KPCH+LAKQEHAF+GA+AGI VS CLHP+DTIKTVIQSCRA+Q+  +Y G
Sbjct  327   KAQIFSATHQKPCHSLAKQEHAFSGALAGICVSFCLHPVDTIKTVIQSCRAEQRSIFYTG  386

Query  1253  RSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGC  1074
             +S++S+RG  GLYRG+++NIA SAP SA+YTFTYESVK ALLP+L  EY S AHCV GGC
Sbjct  387   KSIVSDRGFPGLYRGLTTNIACSAPTSAVYTFTYESVKAALLPYLPKEYYSFAHCVGGGC  446

Query  1073  ASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSI  894
             AS+ATSFIFTPSER+KQQMQV SHY+NCW+ L+ IIR GGL SLYAGW AVLCRN+PHS+
Sbjct  447   ASIATSFIFTPSERIKQQMQVGSHYRNCWDVLVAIIRNGGLYSLYAGWRAVLCRNIPHSV  506

Query  893   IKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS  714
             IKFYTYESLKQ+M SS    IQ++T  TLVCGGLAGSTAALFTTPFDV+KTRLQTQ+PGS
Sbjct  507   IKFYTYESLKQVMPSS---SIQSHTFQTLVCGGLAGSTAALFTTPFDVIKTRLQTQIPGS  563

Query  713   -NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLD  552
              NQYD V H L +I K+EGLKGLYRGLTPRL+MY++QG+LFFASYE FK  FSLD
Sbjct  564   RNQYDSVFHALYKISKTEGLKGLYRGLTPRLIMYVSQGSLFFASYEFFKSAFSLD  618



>ref|XP_011022695.1| PREDICTED: uncharacterized protein LOC105124380 isoform X3 [Populus 
euphratica]
Length=589

 Score =   438 bits (1127),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 279/664 (42%), Positives = 373/664 (56%), Gaps = 88/664 (13%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPT-KYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPP  2310
             M  G +P +G++ P+  Y+ N      F+L D   + ++   SEN K N+   +     P
Sbjct  1     MYGGKRPGRGNQPPSITYKRNRNGVMPFDLTDFVHDGHSPSISENNKPND--IKSGTSSP  58

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSA  2130
             EI +T EL+SAVG +WN         L +  +     D Q+N IL +  +  + +   + 
Sbjct  59    EIFSTTELVSAVGQVWN---------LLNPCAVPETKD-QKNVILNY--LNGAGAGRAAI  106

Query  2129  DGKNTP---VHLSCDKDSSLLVSKNPESLNANRNISFFESRNK---RDYLWRFLRNGLDV  1968
                NT    V +      + +V    E L   + +  FE  ++   R   WRFL+ G  +
Sbjct  107   LDDNTKYFCVDIRNGSHVTQMVQPQFEFLKVTKKMLVFEPSSENYSRSLFWRFLKRGTSL  166

Query  1967  QHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSLGNINSSSTN  1788
             + +S +G GL++    Y L  +YGWM E+  + SK  +++                 ST 
Sbjct  167   RDESREGKGLATGGTGYELYKLYGWMKELIPACSKYPANN-----------------STE  209

Query  1787  GCDVRDA-TSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFH  1611
             GC  RD  T+ ++NL++   DC++D   +  +S  +     + G S+S     +   L  
Sbjct  210   GCMARDCPTNPANNLASRTADCYSDSVESKEVSLCDNARVVTIGKSSSV---SSDYFLGA  266

Query  1610  VLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFGGIECNSE  1431
             + + NA   +S  ++      +  +    C  T     +D G  D   N R       ++
Sbjct  267   LHDFNANSSASRALNYVLFADYHINCLAPCKSTYKHFENDIGDFDAPKNAREQPQNLVAQ  326

Query  1430  SE----ISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
                   I   A E+P +ALAKQEHAFAGA AGIFVSL LHP+DT+KT+IQSC A+QK   
Sbjct  327   GRTGIHIQSSACERPQYALAKQEHAFAGAFAGIFVSLSLHPIDTVKTIIQSCPAEQKSIS  386

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
             +IGRS++SERG+ GLYRG                                          
Sbjct  387   FIGRSIVSERGMTGLYRG-----------------------------------------I  405

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             GGCAS+ATSF+FTPSER+KQQMQ+ SHY NCW+AL+GII +GG  SLYAGWGAVLCRN+P
Sbjct  406   GGCASIATSFVFTPSERIKQQMQIGSHYNNCWSALVGIIGKGGFHSLYAGWGAVLCRNIP  465

Query  902   HSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV  723
              S+IKFYTYESLKQL+ SS     Q NTL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ+
Sbjct  466   QSVIKFYTYESLKQLVLSSQNSSAQPNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQI  525

Query  722   PGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLH  546
             PGS + Y  V H L+EIGK+EGLKGLYRGLTPRLVMYM+QGA+FFASYE  KRLFSL++ 
Sbjct  526   PGSMSPYVNVFHALQEIGKNEGLKGLYRGLTPRLVMYMSQGAVFFASYEFLKRLFSLEMP  585

Query  545   QSSA  534
             Q SA
Sbjct  586   QFSA  589



>ref|XP_003630504.1| Mitochondrial substrate carrier family protein P [Medicago truncatula]
 gb|AET04980.1| substrate carrier family protein [Medicago truncatula]
Length=597

 Score =   437 bits (1124),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 215/286 (75%), Positives = 250/286 (87%), Gaps = 4/286 (1%)
 Frame = -3

Query  1406  EKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGV  1227
             +KP H+LAKQEHAF+GA+AGI VS CLHP+DTIKTV QSCRA+QK  +YIG+S++S+RG 
Sbjct  308   KKPSHSLAKQEHAFSGALAGICVSCCLHPVDTIKTVTQSCRAEQKSIFYIGKSIVSDRGF  367

Query  1226  LGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIF  1047
              GLYRGI++NIA SAPISA+YT+TYESVK ALLP+L  EY S AHCV GGCAS+ATSFIF
Sbjct  368   PGLYRGITTNIACSAPISAVYTYTYESVKAALLPYLPKEYYSFAHCVGGGCASIATSFIF  427

Query  1046  TPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESL  867
             TPSER+KQQMQV SHY+NCW+ L+GIIR GGL SLYAGW AVLCRN+PHS+IKFYTYESL
Sbjct  428   TPSERIKQQMQVGSHYRNCWDVLVGIIRNGGLSSLYAGWIAVLCRNIPHSMIKFYTYESL  487

Query  866   KQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLH  690
             KQ M SS    IQ++T  TLVCGGLAG+TAALFTTPFDV+KTRLQTQ+PGS NQYD V H
Sbjct  488   KQAMPSS---SIQSHTFQTLVCGGLAGTTAALFTTPFDVIKTRLQTQIPGSRNQYDSVPH  544

Query  689   TLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLD  552
              L +I K+EGLKGLYRGLTPRL+MYM+QG+LFFASYE FK +FSL+
Sbjct  545   ALYKISKTEGLKGLYRGLTPRLIMYMSQGSLFFASYEFFKSVFSLE  590



>ref|XP_003532412.1| PREDICTED: uncharacterized protein LOC100812271 isoform X1 [Glycine 
max]
 ref|XP_006584720.1| PREDICTED: uncharacterized protein LOC100812271 isoform X2 [Glycine 
max]
Length=650

 Score =   436 bits (1120),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 215/285 (75%), Positives = 249/285 (87%), Gaps = 5/285 (2%)
 Frame = -3

Query  1403  KPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVL  1224
             KPC++ AKQEHAF+GA+AG+ VSLCLHP+DTIKTVIQ+CRA+ +  +YIG+S++S+RG+L
Sbjct  352   KPCNSQAKQEHAFSGALAGVCVSLCLHPVDTIKTVIQACRAEHRSIFYIGKSIVSDRGLL  411

Query  1223  GLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFT  1044
             GLYRGI++NIA SAPISA+YTF+YESVK ALLP L  EY S AHCV GGCAS+ATSFIFT
Sbjct  412   GLYRGITTNIACSAPISAVYTFSYESVKAALLPHLPKEYCSFAHCVGGGCASIATSFIFT  471

Query  1043  PSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK  864
             PSER+KQQMQV SHY+NCW+ L+GIIR GG  SLYAGW AVL RNVPHSIIKFYTYESLK
Sbjct  472   PSERIKQQMQVGSHYRNCWDVLVGIIRNGGFSSLYAGWRAVLFRNVPHSIIKFYTYESLK  531

Query  863   QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHT  687
             Q+M SS    IQ N+  T+VCGGLAGSTAALFTTPFDV+KTRLQTQ+PGS NQYD VLH 
Sbjct  532   QVMPSS----IQPNSFKTVVCGGLAGSTAALFTTPFDVIKTRLQTQIPGSANQYDSVLHA  587

Query  686   LKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLD  552
             L +I KSEGLKGLYRGL PRL+MYM+QG+LFFASYE FKR FSL+
Sbjct  588   LYKISKSEGLKGLYRGLIPRLIMYMSQGSLFFASYEFFKRTFSLE  632



>gb|KHN16819.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=650

 Score =   435 bits (1118),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 214/285 (75%), Positives = 249/285 (87%), Gaps = 5/285 (2%)
 Frame = -3

Query  1403  KPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVL  1224
             KPC++ AKQEHAF+GA+AG+ VSLCLHP+DTIKTVIQ+CRA+ +  +YIG+S++S+RG+L
Sbjct  352   KPCNSQAKQEHAFSGALAGVCVSLCLHPVDTIKTVIQACRAEHRSIFYIGKSIVSDRGLL  411

Query  1223  GLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFT  1044
             GLYRGI++NIA SAPISA+YTF+YESVK ALLP L  EY S AHC+ GGCAS+ATSFIFT
Sbjct  412   GLYRGITTNIACSAPISAVYTFSYESVKAALLPHLPKEYYSFAHCMGGGCASIATSFIFT  471

Query  1043  PSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK  864
             PSER+KQQMQV SHY+NCW+ L+GIIR GG  SLYAGW AVL RNVPHSIIKFYTYESLK
Sbjct  472   PSERIKQQMQVGSHYRNCWDVLVGIIRNGGFSSLYAGWRAVLFRNVPHSIIKFYTYESLK  531

Query  863   QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHT  687
             Q+M SS    IQ N+  T+VCGGLAGSTAALFTTPFDV+KTRLQTQ+PGS NQYD VLH 
Sbjct  532   QVMPSS----IQPNSFKTVVCGGLAGSTAALFTTPFDVIKTRLQTQIPGSANQYDSVLHA  587

Query  686   LKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLD  552
             L +I KSEGLKGLYRGL PRL+MYM+QG+LFFASYE FKR FSL+
Sbjct  588   LYKISKSEGLKGLYRGLIPRLIMYMSQGSLFFASYEFFKRTFSLE  632



>ref|XP_006439548.1| hypothetical protein CICLE_v10019111mg [Citrus clementina]
 gb|ESR52788.1| hypothetical protein CICLE_v10019111mg [Citrus clementina]
Length=591

 Score =   429 bits (1104),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 277/611 (45%), Positives = 357/611 (58%), Gaps = 49/611 (8%)
 Frame = -3

Query  2480  WGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPEIM  2301
             +  Q    D+   K RCN +EGA FELAD   +  A   ++N KQ NK AE   K P I+
Sbjct  4     YKKQARTSDQSSIKCRCNPVEGASFELADFVSKEDALALADNSKQTNKKAEP--KSPMIL  61

Query  2300  TTRELISAVGNIWNSAA-----HPLSFILSSASSAH----RNVDPQENDILYFPPMEDSC  2148
             +T +LI+AVG +W+SA      HP   ++ S S       RN+D +EN  +         
Sbjct  62    STAQLIAAVGQLWDSANRLAIFHPKGNLIDSHSECKKEVLRNLDKEENAWV---------  112

Query  2147  SSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNG  1977
               P S D K   V +S     S +V  N E L   + +S F+S +K+      W FLR+G
Sbjct  113   --PLSTDSKYFCVDVSSAGQFSPMVQPNLEFLKVTQKMSVFDSCSKKFAHSTFWTFLRSG  170

Query  1976  LDVQHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSLGNINSS  1797
               + + +    GL+S  I Y L NV+ WM E  F      + SI + E           +
Sbjct  171   ASLSNDTCVW-GLASAGIPYQLGNVHRWMTE-KFPAGFTYADSIPDSE---------KRA  219

Query  1796  STNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVL  1617
             +   C + D T C+    +G+T        T   +  +L+  K   +  +A    +    
Sbjct  220   AGEQCILGDTTGCAGASISGDTLSPASKPATEDHNKSDLSKSKGQSSCFNAKLMMSTRTT  279

Query  1616  FHVLEPNAFQMSSSEVHGYSSEKHSTSEYCA-------------CDETKYENRSDSGLDD  1476
               +L     +  S         +   S  CA             C++ ++    D+ L++
Sbjct  280   KSLLSDYFLKDVSDMKEDCDVTRQPCSSLCADYCINSVASSNGTCEKCRHLMDDDALLEN  339

Query  1475  YGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVI  1296
                      +E  ++ E      EKP  +LAKQEHAFAGA+AG+FVSLCLHP+DT+KTVI
Sbjct  340   KRNQSDKNVVEDENKMEFHSPKAEKPHLSLAKQEHAFAGALAGVFVSLCLHPVDTVKTVI  399

Query  1295  QSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLH  1116
             QSC  +QK   YIGRS++SERG+ GLYRGI+SNIASSAPISA+Y FTYESVKGALLP L 
Sbjct  400   QSCHTEQKSIVYIGRSIVSERGLTGLYRGIASNIASSAPISAVYAFTYESVKGALLPHLP  459

Query  1115  TEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYA  936
              E+ S+AHC AGGCASVATSFIFTPSER+KQQMQV S Y NCWNAL+GII+ GGL SLYA
Sbjct  460   KEFHSLAHCTAGGCASVATSFIFTPSERIKQQMQVGSRYHNCWNALVGIIKNGGLHSLYA  519

Query  935   GWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPF  756
             GWGAVLCRNVPHSI+KFYTYESLKQ+M  S++   Q NT+ TL+CGG+AGSTAALFTTPF
Sbjct  520   GWGAVLCRNVPHSIVKFYTYESLKQMMLPSLKPGAQPNTIETLICGGVAGSTAALFTTPF  579

Query  755   DVVKTRLQTQV  723
             DVVKTRLQTQV
Sbjct  580   DVVKTRLQTQV  590


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 79/188 (42%), Gaps = 9/188 (5%)
 Frame = -3

Query  1118  HTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIG--IIRRGGLPS  945
             H       H  AG  A V  S    P + VK  +Q   H +      IG  I+   GL  
Sbjct  366   HLSLAKQEHAFAGALAGVFVSLCLHPVDTVKTVIQ-SCHTEQKSIVYIGRSIVSERGLTG  424

Query  944   LYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFT  765
             LY G  + +  + P S +  +TYES+K  +   +  +   ++L     GG A    +   
Sbjct  425   LYRGIASNIASSAPISAVYAFTYESVKGALLPHLPKEF--HSLAHCTAGGCASVATSFIF  482

Query  764   TPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFAS  585
             TP + +K ++Q      ++Y    + L  I K+ GL  LY G    L   +    + F +
Sbjct  483   TPSERIKQQMQV----GSRYHNCWNALVGIIKNGGLHSLYAGWGAVLCRNVPHSIVKFYT  538

Query  584   YESFKRLF  561
             YES K++ 
Sbjct  539   YESLKQMM  546



>gb|KDO76223.1| hypothetical protein CISIN_1g005451mg [Citrus sinensis]
 gb|KDO76224.1| hypothetical protein CISIN_1g005451mg [Citrus sinensis]
Length=591

 Score =   429 bits (1102),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 277/611 (45%), Positives = 356/611 (58%), Gaps = 49/611 (8%)
 Frame = -3

Query  2480  WGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPEIM  2301
             +  Q    D+   K RCN +EGA FELAD   +  A   ++N KQ NK AE   K P I+
Sbjct  4     YKKQARTSDQSSIKCRCNPVEGASFELADFVSKEDALALADNSKQTNKKAEP--KSPMIL  61

Query  2300  TTRELISAVGNIWNSAA-----HPLSFILSSASSAH----RNVDPQENDILYFPPMEDSC  2148
             +T +LI+AVG +W+SA      HP   ++ S S       RN+D +EN  +         
Sbjct  62    STAQLIAAVGQLWDSANRLAIFHPKGNLIDSHSECKKEVLRNLDKEENAWV---------  112

Query  2147  SSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNG  1977
               P S D K   V +S     S +V  N E L   + +S F+S +K+      W FLR+G
Sbjct  113   --PLSTDSKYFCVDVSSAGQFSPMVQPNLEFLKVTQKMSVFDSCSKKFAHSTFWTFLRSG  170

Query  1976  LDVQHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSLGNINSS  1797
               + + +    GL+S  I Y L NV+ WM E  F      + SI + E            
Sbjct  171   ASLSNDTCVW-GLASAGIPYQLGNVHRWMTE-KFPAGFTYADSIPDSE---------KRE  219

Query  1796  STNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVL  1617
             +   C + D T C+    +G+T        T   +  +L+  K   +  +A    +    
Sbjct  220   AGEQCILGDTTGCAGASISGDTLSPASKPATEDHNKSDLSKSKGQSSCFNAKLMMSTRTT  279

Query  1616  FHVLEPNAFQMSSSEVHGYSSEKHSTSEYCA-------------CDETKYENRSDSGLDD  1476
               +L     +  S         +   S  CA             C++ ++    D+ L++
Sbjct  280   KSLLSDYFLKDVSDMKEDCDVTRQPCSSLCADYCINSVASSNGTCEKCRHLMDDDALLEN  339

Query  1475  YGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVI  1296
                      +E  ++ E      EKP  +LAKQEHAFAGA+AG+FVSLCLHP+DT+KTVI
Sbjct  340   KRNQSDKNVVEDENKMEFHSPKTEKPHLSLAKQEHAFAGALAGVFVSLCLHPVDTVKTVI  399

Query  1295  QSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLH  1116
             QSC  +QK   YIGRS++SERG+ GLYRGI+SNIASSAPISA+Y FTYESVKGALLP L 
Sbjct  400   QSCHTEQKSIVYIGRSIVSERGLTGLYRGIASNIASSAPISAVYAFTYESVKGALLPHLP  459

Query  1115  TEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYA  936
              E+ S+AHC AGGCASVATSFIFTPSER+KQQMQV S Y NCWNAL+GII+ GGL SLYA
Sbjct  460   KEFHSLAHCTAGGCASVATSFIFTPSERIKQQMQVGSRYHNCWNALVGIIKNGGLHSLYA  519

Query  935   GWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPF  756
             GWGAVLCRNVPHSI+KFYTYESLKQ+M  S++   Q NT+ TL+CGG+AGSTAALFTTPF
Sbjct  520   GWGAVLCRNVPHSIVKFYTYESLKQMMLPSLKPGAQPNTIETLICGGVAGSTAALFTTPF  579

Query  755   DVVKTRLQTQV  723
             DVVKTRLQTQV
Sbjct  580   DVVKTRLQTQV  590


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 79/188 (42%), Gaps = 9/188 (5%)
 Frame = -3

Query  1118  HTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIG--IIRRGGLPS  945
             H       H  AG  A V  S    P + VK  +Q   H +      IG  I+   GL  
Sbjct  366   HLSLAKQEHAFAGALAGVFVSLCLHPVDTVKTVIQ-SCHTEQKSIVYIGRSIVSERGLTG  424

Query  944   LYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFT  765
             LY G  + +  + P S +  +TYES+K  +   +  +   ++L     GG A    +   
Sbjct  425   LYRGIASNIASSAPISAVYAFTYESVKGALLPHLPKEF--HSLAHCTAGGCASVATSFIF  482

Query  764   TPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFAS  585
             TP + +K ++Q      ++Y    + L  I K+ GL  LY G    L   +    + F +
Sbjct  483   TPSERIKQQMQV----GSRYHNCWNALVGIIKNGGLHSLYAGWGAVLCRNVPHSIVKFYT  538

Query  584   YESFKRLF  561
             YES K++ 
Sbjct  539   YESLKQMM  546



>ref|XP_008437278.1| PREDICTED: uncharacterized protein LOC103482750 isoform X1 [Cucumis 
melo]
Length=676

 Score =   429 bits (1104),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 213/311 (68%), Positives = 253/311 (81%), Gaps = 5/311 (2%)
 Frame = -3

Query  1448  IECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKP  1269
             +E     E S + +E+ C+ + KQEHAFAGA+AG+FVSLCLHP+DTIKTV QS  A+QK 
Sbjct  362   VENEYNREDSSLTRERSCYNIGKQEHAFAGALAGVFVSLCLHPVDTIKTVFQSYHAEQKS  421

Query  1268  FYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHC  1089
               YIG+S++++RG+ GLYRGIS+NIASSAPISA+YTFTYESVKGALLP L  EY+S+ HC
Sbjct  422   LSYIGKSIVTDRGLSGLYRGISTNIASSAPISAVYTFTYESVKGALLPILQEEYRSIVHC  481

Query  1088  VAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRN  909
             VAGGCAS+ATSF+FTPSER+KQQMQV +HY NCWNA +G++ +GGL  LY GWGAVLCRN
Sbjct  482   VAGGCASIATSFLFTPSERIKQQMQVSAHYHNCWNAFVGVVAKGGLRGLYTGWGAVLCRN  541

Query  908   VPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQT  729
             VPHSIIKFYTYESLK LM S    + Q  T  TLVCGG+AGSTAALFTTPFDVVKTRLQT
Sbjct  542   VPHSIIKFYTYESLKGLMKS----NAQQTTSQTLVCGGVAGSTAALFTTPFDVVKTRLQT  597

Query  728   QVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLD  552
             Q+PGS + Y  V+  L EIGK EGL+GLYRGLTPRL+MYM+QGA+FF SYE  KRLFSL+
Sbjct  598   QIPGSLSPYKSVIQALYEIGKKEGLQGLYRGLTPRLIMYMSQGAIFFTSYEFLKRLFSLE  657

Query  551   LHQSSAQRTHH  519
             + +    R  H
Sbjct  658   VARHGTARVQH  668


 Score = 65.1 bits (157),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 68/254 (27%), Positives = 113/254 (44%), Gaps = 30/254 (12%)
 Frame = -3

Query  2492  DKMAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKP  2313
             +KM   N+P   ++    YR    EG   ELAD   EN  + +   K   +     + K 
Sbjct  10    EKMNKQNKPCVSNQPSIYYRWRPDEGISSELADFVLENGTSNTCYAKHSKDGRTINKPKS  69

Query  2312  PEIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQEND----ILYFPPMEDSCS  2145
               I++T ++IS  G + N A+ P +F   +       V  QEND    + +   +E    
Sbjct  70    SGILSTTQVISIFGQVLNLASRPFTFFRPN------RVLNQENDDFVEVTFNSVVEVDGK  123

Query  2144  SPPSADGKNTPVHLSCDKDSSLLV--SKNPESLNANRNISFFESRN--KRDYLWRFLRNG  1977
             +  S + K+  V    D   S LV  +     L   + IS  E  N       W  L  G
Sbjct  124   TVTSPEIKDFCVDSRTDGRCSPLVQPTLGLNCLTVTQKISLLEPCNFHSMSSFWSLLNGG  183

Query  1976  LDVQHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKS------KLGSS-SIQNHEF----  1830
              D+   S KG GL+S+RI +++  +YGWMN ++ +++      K+ ++ +++ +EF    
Sbjct  184   SDMPANSWKGKGLTSVRILHDMGKIYGWMNCVSHTEACYPYPMKVANTGNMEANEFQARG  243

Query  1829  -----GDCSLGNIN  1803
                  GDC+ G+ N
Sbjct  244   GLNEAGDCASGDSN  257



>ref|XP_004143980.1| PREDICTED: uncharacterized protein LOC101216245 [Cucumis sativus]
 ref|XP_004172743.1| PREDICTED: uncharacterized LOC101216245 [Cucumis sativus]
 gb|KGN50096.1| hypothetical protein Csa_5G153110 [Cucumis sativus]
Length=676

 Score =   426 bits (1095),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 212/311 (68%), Positives = 252/311 (81%), Gaps = 5/311 (2%)
 Frame = -3

Query  1448  IECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKP  1269
             +E     E S + +E+ C+ + KQEHAFAGA+AG+FVSLCLHP+DTIKTV+QS  A+ K 
Sbjct  362   VENEYNREDSSLTRERSCYNIGKQEHAFAGALAGVFVSLCLHPVDTIKTVVQSYHAEHKS  421

Query  1268  FYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHC  1089
               YIG+S++++RG+ GLYRGIS+NIASSAPISA+YTFTYESVKGALLP L  EY+S+ HC
Sbjct  422   LSYIGKSIVTDRGLSGLYRGISTNIASSAPISAVYTFTYESVKGALLPILQEEYRSIVHC  481

Query  1088  VAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRN  909
             VAGGCAS+ATSF+FTPSER+KQQMQV +HY NCWNA +G++ +GGL  LY GWGAVLCRN
Sbjct  482   VAGGCASIATSFLFTPSERIKQQMQVSAHYHNCWNAFVGVVAKGGLRGLYTGWGAVLCRN  541

Query  908   VPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQT  729
             VPHSIIKFYTYESLK LM S    + Q  T  TLVCGG+AGSTAALFTTPFDVVKTRLQT
Sbjct  542   VPHSIIKFYTYESLKGLMKS----NAQQTTSQTLVCGGVAGSTAALFTTPFDVVKTRLQT  597

Query  728   QVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLD  552
             Q+PGS + Y  V+  L EIGK EGL+GLYRGLTPRLVMYM+QGA+FF SYE  KRLFSL+
Sbjct  598   QIPGSLSPYKSVIQALYEIGKKEGLQGLYRGLTPRLVMYMSQGAIFFTSYEFLKRLFSLE  657

Query  551   LHQSSAQRTHH  519
             + +       H
Sbjct  658   VPRHDTAIVQH  668


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 93/213 (44%), Gaps = 6/213 (3%)
 Frame = -3

Query  2492  DKMAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKP  2313
             +KM   N+P   ++    Y     EG   ELAD   EN  + +   K+  + I   + K 
Sbjct  10    EKMDKQNKPCVSNQPSIYYWWRPDEGISSELADFVLENGTSNTCYAKQSKDGITVNKPKS  69

Query  2312  PEIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPS  2133
              EI++T ++IS  G + N A+ P +F          N D  E  + +   +E    +  S
Sbjct  70    SEILSTNQVISIFGQVLNLASRPFTFFQPKRVLNRDNDDSVE--VTFNSVVEIDGKTVTS  127

Query  2132  ADGKNTPVHLSCDKDSSLLV--SKNPESLNANRNISFFESRNKRDY--LWRFLRNGLDVQ  1965
              + K+  V L  D   S +V  +     L   + IS  E  N       W  L  G  + 
Sbjct  128   PEIKDFCVDLRTDGQCSPMVQPTLGLNCLTVTQKISLLEPCNYHSMSSFWNLLNGGSGMP  187

Query  1964  HKSSKGIGLSSLRISYNLENVYGWMNEIAFSKS  1866
               S  G GL+S+RI +++  +YGWM  ++ +++
Sbjct  188   ANSWTGKGLTSVRILHDMGKIYGWMKRVSHTET  220



>ref|XP_006286373.1| hypothetical protein CARUB_v10000438mg [Capsella rubella]
 gb|EOA19271.1| hypothetical protein CARUB_v10000438mg [Capsella rubella]
Length=641

 Score =   421 bits (1083),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 282/635 (44%), Positives = 374/635 (59%), Gaps = 43/635 (7%)
 Frame = -3

Query  2408  FELADSDR------ENYATISSENKKQNNKIAERERKPPEIMTTRELISAVGNIWNSAAH  2247
             + LA++ R      +++A +  E+  Q +     E K  +I++   LISAV  +W+ +  
Sbjct  20    WNLAEAKRKLSKINDHHAHVEYEHAFQRDNSKRGETKLSQILSRDSLISAVDLMWDRSVF  79

Query  2246  PLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSADGKNTPVHLSCDKDSSLLVSK  2067
                 ++SS     RN+D  + +I  F  + DS   P  AD K      S      + + +
Sbjct  80    VSGDLISSLK--ERNLD--DVNISEFKVLADSAQLP--ADQK-VMSQSSTTTQPRVKLLR  132

Query  2066  NPESLNANRNISFFESRNKRDYLWRFLRNGLDVQHKSSKGIGLSSLRISYNLENVYGWMN  1887
               E +  +   SFF   N+        ++G      S K    S L   +  E +Y    
Sbjct  133   VAEKMCISDPSSFFSRFNQ--------KSGAMSTSGSCKEYS-SPLNARWEREKLYSCRQ  183

Query  1886  EI-AFSKSKLGSSSIQNHEFGDCSLGNINSSSTNGCDVRDATSC-SDNLSAGNTDCHTDI  1713
              +  F++   G++ I+  +  DC       SS   C  R+A SC S  ++ G     T +
Sbjct  184   VVPTFTRYHRGAAEIEKRKDEDCI-----PSSEAECASRNAKSCDSIFVTTGAEGLTTLV  238

Query  1712  KPTsslsshnlnlhksSGASNSALCSKNGNVLFHVLEPNAFQMSSSEVHGYSSEKHSTSE  1533
             +P SSL +            ++  C  N    F +L  +  + ++ ++   +S K ST  
Sbjct  239   EPRSSLIASVAESLV-----DTRTCRSNDVNYFLLLYKD--RCANKKIVNRTSSKCSTDG  291

Query  1532  YCACDETKYENRSD-SGLDDYGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGA  1356
                   +   N SD   L      Q       + E+E+   + E P +A AKQ HAFAGA
Sbjct  292   DTEISSSG--NNSDIHSLSIVENQQLLERDRKDQETEVCSSSPETPTYAFAKQRHAFAGA  349

Query  1355  MAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapi  1176
             +AGI VSLCLHP+DT+KT+IQSCR ++K   Y GRS+ISERGV GLYRGI+SNIASSAP+
Sbjct  350   LAGISVSLCLHPLDTVKTMIQSCRLEEKSLCYTGRSIISERGVSGLYRGIASNIASSAPV  409

Query  1175  sALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYK  996
             SALYTFTYESVKG LLP    EY S+ HCVAGG AS+ATSFIFTPSER+KQQMQV SHY+
Sbjct  410   SALYTFTYESVKGTLLPLFPKEYCSLTHCVAGGSASIATSFIFTPSERIKQQMQVSSHYR  469

Query  995   NCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSS---VQFDIQN  825
             NCW AL+GII++GGL SLYAGW AVLCRN+PHSIIKFY YE++KQ++  S   +    Q 
Sbjct  470   NCWTALVGIIQKGGLLSLYAGWTAVLCRNIPHSIIKFYVYENMKQMVLPSLGPLGQSAQP  529

Query  824   NTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGL  648
              TL TL+CGGLAGS AA FTTPFDVVKTRLQTQ+PGS NQ+  V  TL+ I K EGL+GL
Sbjct  530   TTLQTLICGGLAGSAAAFFTTPFDVVKTRLQTQIPGSRNQHPSVYQTLQSIRKQEGLRGL  589

Query  647   YRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQ  543
             YRGL PRLVMYM+QGA+FFASYE +K + SL+  Q
Sbjct  590   YRGLIPRLVMYMSQGAIFFASYEFYKSVLSLEAAQ  624



>ref|XP_010434930.1| PREDICTED: probable S-adenosylmethionine carrier 2, chloroplastic 
[Camelina sativa]
Length=654

 Score =   417 bits (1071),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 212/305 (70%), Positives = 247/305 (81%), Gaps = 4/305 (1%)
 Frame = -3

Query  1445  ECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPF  1266
             E N E+ +   + E P +A AKQ HAFAGA+AGI VSLCLHP+DT+KT+IQSCR ++K  
Sbjct  322   EKNQETGVCSSSAETPTYAFAKQRHAFAGALAGISVSLCLHPLDTVKTMIQSCRLEEKSL  381

Query  1265  YYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCV  1086
              Y GRS+ISERGV GLYRGI+SNIASSAPISALYTFTYESVKGALLP    EY S+ HCV
Sbjct  382   CYTGRSIISERGVSGLYRGIASNIASSAPISALYTFTYESVKGALLPLFPKEYCSLTHCV  441

Query  1085  AGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNV  906
             AGG AS+ATSFIFTPSER+KQQMQV SHY+NCW AL+GII++GGL SLYAGW AVLCRN+
Sbjct  442   AGGSASIATSFIFTPSERIKQQMQVSSHYRNCWTALVGIIQKGGLLSLYAGWTAVLCRNI  501

Query  905   PHSIIKFYTYESLKQLMSSSVQF---DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRL  735
             PHSIIKFY YE++KQ++  S+       Q  TL TL+CGGLAGS AA FTTPFDVVKTRL
Sbjct  502   PHSIIKFYVYENMKQMVLPSLGPLGQSAQPTTLQTLICGGLAGSAAAFFTTPFDVVKTRL  561

Query  734   QTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             QTQ+PGS NQ+  V  TL+ I K EGL+GLYRGL PRLVMYM+QGA+FFASYE +K + S
Sbjct  562   QTQIPGSRNQHPSVYQTLQSIRKQEGLRGLYRGLIPRLVMYMSQGAIFFASYEFYKSVLS  621

Query  557   LDLHQ  543
             L+  Q
Sbjct  622   LEAAQ  626



>ref|XP_010529594.1| PREDICTED: mitochondrial substrate carrier family protein Y [Tarenaya 
hassleriana]
 ref|XP_010529596.1| PREDICTED: mitochondrial substrate carrier family protein Y [Tarenaya 
hassleriana]
 ref|XP_010529597.1| PREDICTED: mitochondrial substrate carrier family protein Y [Tarenaya 
hassleriana]
Length=666

 Score =   416 bits (1069),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 279/624 (45%), Positives = 367/624 (59%), Gaps = 51/624 (8%)
 Frame = -3

Query  2348  QNNKIAERERKPPEIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYF  2169
             + N     E K  +I++   LISAV  +W+ +     F+      +  +V P + D+L  
Sbjct  44    KKNTSKREETKLSQILSKNALISAVDLMWDRS----DFV------SGNSVGPLKEDVLDD  93

Query  2168  PPMEDSCSSPPSADGKNTPVHLSCDKDSSLLVSKNPES--LNANRNISFFESRNKRDYL-  1998
                ++  +   SA+ +    H      +  L +  P+   L     +S F+  ++  Y+ 
Sbjct  94    LDRDNVSNFQVSAESEMLH-HADLKAKAHSLPTSQPKLKLLKVTEKMSIFDVHSQ-SYVR  151

Query  1997  ----WRFLRNGLDVQHKSSKGIGLSSLRISYNLENVYGWMNE---IAFSKSKLGSSSIQN  1839
                 W    N     + S KG G   ++I   +  +Y WM E   I+      G+   + 
Sbjct  152   SLSRWLMQANEAKSLNGSCKGNGFE-IKIKGEMGKLYSWMKEVNSISLRHHLQGAVPEKK  210

Query  1838  HEFGDCSLGNINSSSTNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSG  1659
               F DC   +++ S+   C  ++  SCS N     TD   +  P  S     LN      
Sbjct  211   TIFEDCV--HLSGSTQAACASKNG-SCSAN-DFFTTDAVRNSTPAESKGPLLLNGTLVFT  266

Query  1658  ASNSALCSKNGNVLFHVLEPNAF------QMSS---SEVHGYSSEKHSTSEYCACDETKY  1506
              +  A  S +G+ LF +   N        +MSS   +  H   S   + ++ C       
Sbjct  267   DTRMA-TSTDGDYLFALYRDNCTDNDGMNKMSSGLGTNHHTEVSFSRNNAQVCC------  319

Query  1505  ENRSDSGLDDYGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCL  1326
              N +DS  ++   N+R      + + E+   + E P +A+A+++HAFAG +AGI VSLCL
Sbjct  320   RNMTDS--EELLENKRK-----DPKMEVHPSSTEIPTYAVAEKKHAFAGGLAGISVSLCL  372

Query  1325  HPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYES  1146
             HP+DT+KT+ QSC  ++K    +GRSVISERG  GLYRGI+SNIASSAPISALYTFTYES
Sbjct  373   HPLDTVKTITQSCLLEKKSPISVGRSVISERGFSGLYRGIASNIASSAPISALYTFTYES  432

Query  1145  VKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGII  966
             VKGALLP    EY  + HCVAGGCASVATSFIFTPSER+KQQMQV SHY+NCW AL+GII
Sbjct  433   VKGALLPLSPKEYCPLIHCVAGGCASVATSFIFTPSERIKQQMQVSSHYRNCWGALVGII  492

Query  965   RRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAG  786
             ++GGL SLYAGW AVLCRN+PHSIIKFY YESLKQLM  S+    Q NT  TL+CGGLAG
Sbjct  493   QKGGLLSLYAGWSAVLCRNIPHSIIKFYVYESLKQLMLPSLDPYAQPNTSRTLICGGLAG  552

Query  785   STAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMT  609
             S AA FTTPFDVVKTRLQTQ+PGS N Y  V   L+ IGK EGL+GLYRGL PRLVMYM+
Sbjct  553   SAAAFFTTPFDVVKTRLQTQIPGSKNGYHNVFQALRAIGKQEGLRGLYRGLIPRLVMYMS  612

Query  608   QGALFFASYESFKRLFSLDLHQSS  537
             QGA+FFASYE +K + SL+  Q+S
Sbjct  613   QGAIFFASYEFYKSILSLETPQTS  636



>ref|XP_010422099.1| PREDICTED: uncharacterized protein LOC104707444 [Camelina sativa]
Length=652

 Score =   412 bits (1058),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 213/312 (68%), Positives = 249/312 (80%), Gaps = 13/312 (4%)
 Frame = -3

Query  1466  NQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSC  1287
             +Q  GG  C+S +E S        +A AKQ HAFAGA+AGI VSLCLHP+DT+KT+IQSC
Sbjct  322   DQETGG--CSSSAETST-------YAFAKQRHAFAGALAGISVSLCLHPLDTVKTMIQSC  372

Query  1286  RADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEY  1107
             R ++K   Y GRS+ISERGV GLY GI+SNIASSAPISALYTFTYES+KGALLP    EY
Sbjct  373   RLEEKSLCYTGRSIISERGVSGLYWGIASNIASSAPISALYTFTYESIKGALLPLFPKEY  432

Query  1106  QSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWG  927
              S+ HCVAGG AS+ATSFIFTPSER+KQQMQV SHY+NCWNAL+GII++GGL SLYAGW 
Sbjct  433   CSLTHCVAGGSASIATSFIFTPSERIKQQMQVSSHYRNCWNALVGIIQKGGLLSLYAGWT  492

Query  926   AVLCRNVPHSIIKFYTYESLKQLMSSS---VQFDIQNNTLMTLVCGGLAGSTAALFTTPF  756
             AVLCRN+PHSIIKFY YE++KQ++  S   +    Q  TL TL+CGGLAGS AA FTTPF
Sbjct  493   AVLCRNIPHSIIKFYVYENMKQMVLPSLGPLSQSAQPTTLQTLICGGLAGSAAAFFTTPF  552

Query  755   DVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYE  579
             DVVKTRLQTQ+PGS NQ+  V  TL+ I K EGL+GLYRGL PRLVMYM+QGA+FFASYE
Sbjct  553   DVVKTRLQTQIPGSRNQHPSVYQTLQSIRKQEGLRGLYRGLIPRLVMYMSQGAIFFASYE  612

Query  578   SFKRLFSLDLHQ  543
              +K + SL+  Q
Sbjct  613   FYKSVLSLEAAQ  624



>ref|XP_010455551.1| PREDICTED: probable S-adenosylmethionine carrier 2, chloroplastic 
[Camelina sativa]
 ref|XP_010455552.1| PREDICTED: probable S-adenosylmethionine carrier 2, chloroplastic 
[Camelina sativa]
Length=632

 Score =   411 bits (1056),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 213/324 (66%), Positives = 249/324 (77%), Gaps = 4/324 (1%)
 Frame = -3

Query  1502  NRSDSGLDDYGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLH  1323
             N  +  L   G  Q       + E+ +   + E P    AKQ HAFAGA+AGI VSLCLH
Sbjct  281   NSDEDSLSIVGNKQLLERDRKDQETGVCSSSAETPTCTFAKQRHAFAGALAGISVSLCLH  340

Query  1322  PMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESV  1143
             P+DT+KT+IQSCR ++K   Y GRS++SERGV GLYRGI+SNIASSAPISALYTFTYESV
Sbjct  341   PLDTVKTMIQSCRLEEKSLCYTGRSILSERGVSGLYRGIASNIASSAPISALYTFTYESV  400

Query  1142  KGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIR  963
             KGALLP    EY S+ HCVAGG AS+ATSFIFTPSER+KQQMQV SHY+NCW AL+GII+
Sbjct  401   KGALLPLFPKEYCSLTHCVAGGSASIATSFIFTPSERIKQQMQVGSHYRNCWTALVGIIQ  460

Query  962   RGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF---DIQNNTLMTLVCGGL  792
             +GGL SLYAGW AVLCRN+PHSIIKFY YE++KQ++  S+       Q  TL TLVCGGL
Sbjct  461   KGGLLSLYAGWTAVLCRNIPHSIIKFYVYENMKQMVLPSLGPLGQSTQPTTLQTLVCGGL  520

Query  791   AGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMY  615
             AGS AA FTTPFDVVKTRLQTQ+PGS NQ+  V  TL+ I K EGL+GLYRGL PRLVMY
Sbjct  521   AGSAAAFFTTPFDVVKTRLQTQIPGSRNQHPSVYQTLQSIRKQEGLRGLYRGLIPRLVMY  580

Query  614   MTQGALFFASYESFKRLFSLDLHQ  543
             M+QGA+FFASYE +K + SL+  Q
Sbjct  581   MSQGAIFFASYEFYKSVLSLEAAQ  604



>ref|XP_008805793.1| PREDICTED: uncharacterized protein LOC103718653 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008805794.1| PREDICTED: uncharacterized protein LOC103718653 isoform X1 [Phoenix 
dactylifera]
Length=661

 Score =   407 bits (1046),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 202/290 (70%), Positives = 242/290 (83%), Gaps = 1/290 (0%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A +K  HA AGA+AG  VSLCLHP+DT+KT+IQ+    QK  Y I R +ISE+G+LGLYR
Sbjct  353   AFSKNRHAMAGALAGTLVSLCLHPVDTVKTIIQANGMGQKSSYLIVRRIISEKGMLGLYR  412

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             GI+SNIASSAPISA+YTFTYESVKG LLP L  EY S+AHC+AGGC+S+ATSF+FTPSER
Sbjct  413   GIASNIASSAPISAIYTFTYESVKGDLLPLLPKEYHSLAHCIAGGCSSIATSFVFTPSER  472

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMS  852
             +KQQMQV   Y+NCWNA+IG + +GG+ SLYAGWGAVLCRN+PHSIIKFYTYESLKQL+ 
Sbjct  473   IKQQMQVGLQYQNCWNAMIGCLEKGGVSSLYAGWGAVLCRNIPHSIIKFYTYESLKQLVL  532

Query  851   SSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEI  675
              S + D   NTL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ PG+  +Y+GVLH L+EI
Sbjct  533   GSAKPDASLNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQAPGTLGRYNGVLHALQEI  592

Query  674   GKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRT  525
              + EGL+GLY+GLTPRL MY++QGA+FFASYE  K +F+L++ Q  +Q T
Sbjct  593   AREEGLQGLYKGLTPRLAMYVSQGAIFFASYEFLKAVFALEVPQPPSQVT  642



>ref|XP_010918562.1| PREDICTED: probable mitochondrial adenine nucleotide transporter 
BTL3 isoform X1 [Elaeis guineensis]
Length=674

 Score =   406 bits (1044),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 203/299 (68%), Positives = 246/299 (82%), Gaps = 1/299 (0%)
 Frame = -3

Query  1409  KEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERG  1230
             ++K  +A +K  HA AGA+AG  VSLCLHP+DT+KT+IQ+    Q   Y I R +ISE+G
Sbjct  360   QDKIQNAFSKNRHAIAGALAGTLVSLCLHPVDTVKTIIQANGMGQISSYLIVRRIISEKG  419

Query  1229  VLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFI  1050
             +LGLYRGI+SNIASSAPISA+YTFTYESVKGALLP L  EY S+AHC+AGGC+S+ATSF+
Sbjct  420   ILGLYRGIASNIASSAPISAIYTFTYESVKGALLPHLPKEYHSLAHCIAGGCSSIATSFV  479

Query  1049  FTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYES  870
             FTPSER+KQQMQV   Y+NCWNA+IG + +GG+ SLYAGW AVLCRN+PHSIIKFYTYES
Sbjct  480   FTPSERIKQQMQVGLQYQNCWNAMIGCLEKGGMSSLYAGWSAVLCRNIPHSIIKFYTYES  539

Query  869   LKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVL  693
             LKQL+ +S + D   NTL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ PG+  +Y+GVL
Sbjct  540   LKQLLLASAKPDASLNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQAPGTLGRYNGVL  599

Query  692   HTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHE  516
             H L+EI + EGL+GLYRGLTPRL MY++QGA+FFASYE  K +F+L + Q   Q T ++
Sbjct  600   HALQEIAREEGLQGLYRGLTPRLAMYVSQGAIFFASYEFLKAVFALQVPQPPPQVTENK  658



>gb|EPS66533.1| hypothetical protein M569_08243, partial [Genlisea aurea]
Length=285

 Score =   390 bits (1001),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/290 (69%), Positives = 235/290 (81%), Gaps = 15/290 (5%)
 Frame = -3

Query  1388  LAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRG  1209
             +A+QEHAFAGAM+G+FVSLCLHP+DTIKTVIQSCRAD KPF+ I R++I+E+G+ GLYRG
Sbjct  1     IARQEHAFAGAMSGVFVSLCLHPIDTIKTVIQSCRADMKPFHSIVRTIITEKGLFGLYRG  60

Query  1208  issniassapisALYTFTYESVKGALLPFLH--------TEYQSVAHCVAGGCASVATSF  1053
             ISSNI  SAPISA+YTFTYESVK ++LP           TE Q       GG AS+ATSF
Sbjct  61    ISSNILCSAPISAVYTFTYESVKKSMLPLFPKAGLFLSLTEIQC-----TGGFASIATSF  115

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             IFTPSER+KQQMQV +HY NCWNALI I++ GGLPSLY GWGA+LCRN+PHS+IKFYTYE
Sbjct  116   IFTPSERIKQQMQVGTHYPNCWNALIQILKNGGLPSLYTGWGALLCRNIPHSVIKFYTYE  175

Query  872   SLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSN--QYDG  699
             +LK+ +  S + D + NT  TLVCGGLAGS+A+LFTTPFDVVKTRLQ Q+PGSN  QY G
Sbjct  176   NLKRFILPSFESDPRANTAATLVCGGLAGSSASLFTTPFDVVKTRLQAQIPGSNTTQYSG  235

Query  698   VLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDL  549
             V  TL +I + +GL+GLYRGLTPR+VMYM QGALFF SYE+ KR FSL L
Sbjct  236   VFTTLTKIWRQDGLRGLYRGLTPRVVMYMIQGALFFTSYETLKRAFSLKL  285



>ref|XP_011022693.1| PREDICTED: uncharacterized protein LOC105124380 isoform X2 [Populus 
euphratica]
Length=590

 Score =   401 bits (1030),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 263/599 (44%), Positives = 353/599 (59%), Gaps = 46/599 (8%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPT-KYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPP  2310
             M  G +P +G++ P+  Y+ N      F+L D   + ++   SEN K N+   +     P
Sbjct  1     MYGGKRPGRGNQPPSITYKRNRNGVMPFDLTDFVHDGHSPSISENNKPND--IKSGTSSP  58

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSA  2130
             EI +T EL+SAVG +WN         L +  +     D Q+N IL +  +  + +   + 
Sbjct  59    EIFSTTELVSAVGQVWN---------LLNPCAVPETKD-QKNVILNY--LNGAGAGRAAI  106

Query  2129  DGKNTP---VHLSCDKDSSLLVSKNPESLNANRNISFFESRNK---RDYLWRFLRNGLDV  1968
                NT    V +      + +V    E L   + +  FE  ++   R   WRFL+ G  +
Sbjct  107   LDDNTKYFCVDIRNGSHVTQMVQPQFEFLKVTKKMLVFEPSSENYSRSLFWRFLKRGTSL  166

Query  1967  QHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSLGNINSSSTN  1788
             + +S +G GL++    Y L  +YGWM E+  + SK  +++                 ST 
Sbjct  167   RDESREGKGLATGGTGYELYKLYGWMKELIPACSKYPANN-----------------STE  209

Query  1787  GCDVRDA-TSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFH  1611
             GC  RD  T+ ++NL++   DC++D   +  +S  +     + G S+S     +   L  
Sbjct  210   GCMARDCPTNPANNLASRTADCYSDSVESKEVSLCDNARVVTIGKSSSV---SSDYFLGA  266

Query  1610  VLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFGGIECNSE  1431
             + + NA   +S  ++      +  +    C  T     +D G  D   N R       ++
Sbjct  267   LHDFNANSSASRALNYVLFADYHINCLAPCKSTYKHFENDIGDFDAPKNAREQPQNLVAQ  326

Query  1430  SE----ISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
                   I   A E+P +ALAKQEHAFAGA AGIFVSL LHP+DT+KT+IQSC A+QK   
Sbjct  327   GRTGIHIQSSACERPQYALAKQEHAFAGAFAGIFVSLSLHPIDTVKTIIQSCPAEQKSIS  386

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
             +IGRS++SERG+ GLYRGI SNIASSAPISA+YTFTYESVKG+LLP    E+ S AHC+A
Sbjct  387   FIGRSIVSERGMTGLYRGIGSNIASSAPISAIYTFTYESVKGSLLPQFPKEHHSFAHCLA  446

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             GGCAS+ATSF+FTPSER+KQQMQ+ SHY NCW+AL+GII +GG  SLYAGWGAVLCRN+P
Sbjct  447   GGCASIATSFVFTPSERIKQQMQIGSHYNNCWSALVGIIGKGGFHSLYAGWGAVLCRNIP  506

Query  902   HSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ  726
              S+IKFYTYESLKQL+ SS     Q NTL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ
Sbjct  507   QSVIKFYTYESLKQLVLSSQNSSAQPNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQ  565


 Score = 61.2 bits (147),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 85/191 (45%), Gaps = 12/191 (6%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQ-VRSHYKNCWNALIG--IIRRGGLPSLYAGWGA  924
             H  AG  A +  S    P + VK  +Q   +  K+   + IG  I+   G+  LY G G+
Sbjct  350   HAFAGAFAGIFVSLSLHPIDTVKTIIQSCPAEQKSI--SFIGRSIVSERGMTGLYRGIGS  407

Query  923   VLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVK  744
              +  + P S I  +TYES+K  +    QF  ++++    + GG A    +   TP + +K
Sbjct  408   NIASSAPISAIYTFTYESVKGSLLP--QFPKEHHSFAHCLAGGCASIATSFVFTPSERIK  465

Query  743   TRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRL  564
              ++Q      + Y+     L  I    G   LY G    L   + Q  + F +YES K+L
Sbjct  466   QQMQI----GSHYNNCWSALVGIIGKGGFHSLYAGWGAVLCRNIPQSVIKFYTYESLKQL  521

Query  563   FSLDLHQSSAQ  531
               L    SSAQ
Sbjct  522   V-LSSQNSSAQ  531



>ref|NP_192883.2| mitochondrial substrate carrier family protein [Arabidopsis thaliana]
 gb|AEE83012.1| mitochondrial substrate carrier family protein [Arabidopsis thaliana]
Length=628

 Score =   401 bits (1030),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 205/303 (68%), Positives = 242/303 (80%), Gaps = 4/303 (1%)
 Frame = -3

Query  1439  NSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYY  1260
             + E+E+ + + E   +A AKQ HAFAGA+AGI VSLCLHP+DT+KT+IQSCR ++K    
Sbjct  307   DKETEVCLSSPETTTYAFAKQRHAFAGALAGISVSLCLHPLDTVKTMIQSCRLEEKSLCN  366

Query  1259  IGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAG  1080
              GRS+ISERG  GLYRGI+SNIASSAPISALYTFTYE+VKG LLP    EY S+AHC+AG
Sbjct  367   TGRSIISERGFSGLYRGIASNIASSAPISALYTFTYETVKGTLLPLFPKEYCSLAHCLAG  426

Query  1079  GCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPH  900
             G AS+ATSFIFTPSER+KQQMQV SHY+NCW AL+GII++GGL SLYAGW AVLCRN+PH
Sbjct  427   GSASIATSFIFTPSERIKQQMQVSSHYRNCWTALVGIIQKGGLLSLYAGWTAVLCRNIPH  486

Query  899   SIIKFYTYESLKQLMSSS---VQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQT  729
             SIIKFY YE++KQ++  S        Q  TL TL CGGLAGS AA FTTPFDVVKTRLQT
Sbjct  487   SIIKFYVYENMKQMVLPSPGPCGEMAQPTTLQTLTCGGLAGSAAAFFTTPFDVVKTRLQT  546

Query  728   QVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLD  552
             Q+PGS NQ+  V  TL+ I + EGL+GLYRGL PRLVMYM+QGA+FFASYE +K + SL 
Sbjct  547   QIPGSRNQHPSVYQTLQSIRRQEGLRGLYRGLIPRLVMYMSQGAIFFASYEFYKSVLSLA  606

Query  551   LHQ  543
               Q
Sbjct  607   AAQ  609



>ref|XP_006396904.1| hypothetical protein EUTSA_v10028506mg [Eutrema salsugineum]
 gb|ESQ38357.1| hypothetical protein EUTSA_v10028506mg [Eutrema salsugineum]
Length=645

 Score =   401 bits (1030),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 205/318 (64%), Positives = 246/318 (77%), Gaps = 4/318 (1%)
 Frame = -3

Query  1439  NSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYY  1260
             + E+E    + E P +A AKQ HAFAGA+AG+ VSLCLHP+DT+KT+IQSC  ++K   +
Sbjct  324   DQETEFCSSSTETPTYAFAKQRHAFAGALAGVSVSLCLHPLDTVKTMIQSCHLEEKSLCH  383

Query  1259  IGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAG  1080
              GRS++SERG  GLYRGI+SNIASSAPISALYT TYESVKGALLP    EY S+ HC+AG
Sbjct  384   TGRSIVSERGFSGLYRGIASNIASSAPISALYTLTYESVKGALLPLFPKEYCSLTHCIAG  443

Query  1079  GCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPH  900
             G ASVATSFIFTPSER+KQQMQV SHY+NCW AL GII++GGL SLYAGW AVLCRN+PH
Sbjct  444   GSASVATSFIFTPSERIKQQMQVSSHYRNCWTALFGIIQKGGLLSLYAGWSAVLCRNIPH  503

Query  899   SIIKFYTYESLKQLMSSSVQF---DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQT  729
             SIIKFY YE++K+++  S+       Q  T+ TL+CGGLAGS AA FTTPFDVVKTR QT
Sbjct  504   SIIKFYVYENMKRMVLPSLGPCGQTAQPTTIQTLICGGLAGSAAAFFTTPFDVVKTRFQT  563

Query  728   QVPG-SNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLD  552
             Q+PG SNQ+  V  TL+ IGK EG++GLYRGL PRLVMYM+QGA+FFASYE +K + SL 
Sbjct  564   QIPGSSNQHISVYQTLQSIGKQEGVRGLYRGLIPRLVMYMSQGAIFFASYEFYKSVLSLQ  623

Query  551   LHQSSAQRTHHEPCFGDD  498
               Q       H+   GD+
Sbjct  624   AAQPDLSALWHKTKDGDN  641



>emb|CDY25285.1| BnaA02g21710D [Brassica napus]
Length=481

 Score =   394 bits (1012),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 203/286 (71%), Positives = 233/286 (81%), Gaps = 4/286 (1%)
 Frame = -3

Query  1397  CHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGL  1218
             C + AK  HAFAGA+AG+ VSLCLHP+DT+KT+IQSCR   K   Y GRS+ISERGV GL
Sbjct  178   CSSFAKHGHAFAGALAGVSVSLCLHPLDTVKTMIQSCRFQDKSLCYTGRSIISERGVSGL  237

Query  1217  YRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPS  1038
             YRGI+SNIASSAPISALYTFTYESVKGALLP    EY S+AHCVAGG ASVATSFIFTPS
Sbjct  238   YRGIASNIASSAPISALYTFTYESVKGALLPVFPKEYCSLAHCVAGGSASVATSFIFTPS  297

Query  1037  ERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQL  858
             ER+KQQMQV SHY+NCW AL+GII++GGL SLYAGW AVLCRN+PHSIIKFY YE++K++
Sbjct  298   ERIKQQMQVSSHYRNCWTALVGIIQKGGLLSLYAGWSAVLCRNIPHSIIKFYVYENMKRM  357

Query  857   MSSSVQF---DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSN-QYDGVLH  690
             +  S+       Q  TL TLVCGGLAGS AA FTTPFDVVKTRLQTQ+PGS  Q+  V  
Sbjct  358   VLPSIGPCGQAAQPTTLQTLVCGGLAGSAAAFFTTPFDVVKTRLQTQIPGSKTQHPSVYQ  417

Query  689   TLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLD  552
              L+ I K EG +GLYRGL PRLVMYM+QGA+FFASYE +K + SL+
Sbjct  418   ALQSIRKREGPRGLYRGLIPRLVMYMSQGAIFFASYEFYKSILSLE  463



>ref|XP_009128671.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine mitochondrial 
carrier protein [Brassica rapa]
Length=489

 Score =   393 bits (1010),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 232/285 (81%), Gaps = 4/285 (1%)
 Frame = -3

Query  1397  CHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGL  1218
             C + AK  HAFAGA+AG+ VSLCLHP+DT+KT+IQSCR   K   Y GRS+ISERGV GL
Sbjct  178   CSSFAKHGHAFAGALAGVSVSLCLHPLDTVKTMIQSCRFQDKSLCYTGRSIISERGVSGL  237

Query  1217  YRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPS  1038
             YRGI+SNIASSAPISALYTFTYESVKGALLP    EY S+AHCVAGG ASVATSFIFTPS
Sbjct  238   YRGIASNIASSAPISALYTFTYESVKGALLPVFPKEYCSLAHCVAGGSASVATSFIFTPS  297

Query  1037  ERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQL  858
             ER+KQQMQV SHY+NCW AL+GII++GGL SLYAGW AVLCRN+PHSIIKFY YE++K++
Sbjct  298   ERIKQQMQVSSHYRNCWTALVGIIQKGGLLSLYAGWSAVLCRNIPHSIIKFYVYENMKRM  357

Query  857   MSSSVQF---DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSN-QYDGVLH  690
             +  S+       Q  TL TLVCGGLAGS AA FTTPFDVVKTRLQTQ+PGS  Q+  V  
Sbjct  358   VLPSIGPCGQAAQPTTLQTLVCGGLAGSAAAFFTTPFDVVKTRLQTQIPGSKTQHPSVYQ  417

Query  689   TLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSL  555
              L+ I K EG +GLYRGL PRLVMYM+QGA+FFASYE +K + SL
Sbjct  418   ALQSIRKREGPRGLYRGLIPRLVMYMSQGAIFFASYEFYKSILSL  462



>emb|CDY37620.1| BnaCnng08350D [Brassica napus]
Length=528

 Score =   394 bits (1011),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 233/285 (82%), Gaps = 4/285 (1%)
 Frame = -3

Query  1394  HALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLY  1215
             +A AK  HAFAGA+AG+ VSLCLHP+DT+KT+IQSCR   K   Y GRS+ISERGV GLY
Sbjct  226   YAFAKHRHAFAGALAGVSVSLCLHPLDTVKTMIQSCRFQDKSLCYTGRSIISERGVSGLY  285

Query  1214  RGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSE  1035
             RGI+SNIASSAPISALYTFTYESVKGALLP    EY S+AHCVAGG ASVATSFIFTPSE
Sbjct  286   RGIASNIASSAPISALYTFTYESVKGALLPVFPKEYCSLAHCVAGGSASVATSFIFTPSE  345

Query  1034  RVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLM  855
             R+KQQMQV SHY+NCW AL+GII++GGL SLYAGW AVLCRN+PHSIIKFY YE++K+++
Sbjct  346   RIKQQMQVSSHYRNCWTALVGIIQKGGLLSLYAGWSAVLCRNIPHSIIKFYVYENMKRMV  405

Query  854   SSSVQF---DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSN-QYDGVLHT  687
               S+       Q  TL TLVCGGLAGS AA FTTPFDVVKTRLQTQ+PGS  Q+  V   
Sbjct  406   LPSIGPCGQAAQPTTLQTLVCGGLAGSAAAFFTTPFDVVKTRLQTQIPGSKTQHPSVYQA  465

Query  686   LKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLD  552
             L+ I K EG +GLYRGL PRLVMYM+QGA+FFASYE ++ + SL+
Sbjct  466   LQSIRKREGPRGLYRGLIPRLVMYMSQGAIFFASYEFYRSILSLE  510



>ref|XP_007040240.1| Mitochondrial substrate carrier family protein, putative isoform 
10 [Theobroma cacao]
 ref|XP_007040241.1| Mitochondrial substrate carrier family protein, putative isoform 
10 [Theobroma cacao]
 gb|EOY24741.1| Mitochondrial substrate carrier family protein, putative isoform 
10 [Theobroma cacao]
 gb|EOY24742.1| Mitochondrial substrate carrier family protein, putative isoform 
10 [Theobroma cacao]
Length=597

 Score =   395 bits (1016),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 261/574 (45%), Positives = 334/574 (58%), Gaps = 17/574 (3%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYA-TISSENKKQNNKIAERERKPP  2310
             M     P + D+   KYR    EGAFFE+     E YA ++  +N+K   K    E K P
Sbjct  1     MPASKNPCRSDQPSIKYRWRADEGAFFEVGKLVPEEYAPSLPDKNRKSRTK---SETKEP  57

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSA  2130
             EI++T ELIS++  IWN A+  L+     A+    +   Q+ DIL     E++ +   SA
Sbjct  58    EILSTAELISSLNQIWNCASR-LTIFQQQANLDRNHFVSQKEDILVNLGREENGTGSISA  116

Query  2129  DGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNGLDVQHK  1959
             D K   V L         +  N + +   + +S F+  NK     +    L  G D+ +K
Sbjct  117   DSKYFCVDLGTASQLPPAMKPNFKFVKITKKMSMFDFCNKNPKCSFYQGLLCCGTDLSNK  176

Query  1958  SSKGIGLSSLRISYNLENVYGWMNEIAFSKSKL-GSSSIQNHEFGD-CSLGNINSSSTNG  1785
             S K  GLS++  SY   NVY WM E+     K   +   +N + G  C +G   SS + G
Sbjct  177   SWKAKGLSAVGFSYEFGNVYKWMREMIPGGLKYYVNVQTENKKLGKYCDVGG-TSSDSGG  235

Query  1784  CDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVL  1605
             C   D T+ +DNL   N + ++    +   S  +           ++LCS     L  V 
Sbjct  236   CISADRTNPTDNLPTENAEPYSHCIKSIDSSILHDAKLVMDTRRTTSLCSDY--FLTSVQ  293

Query  1604  EPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFG----GIECN  1437
             E  A    S          +  +   +C  T  E +  S  ++   N+R        E +
Sbjct  294   ETKANCSVSRTPDSNLCADYHINVLASCSSTYKECQHLSDGNECLKNERKQPEPFSTEDD  353

Query  1436  SESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYI  1257
             S  E    A EKP  ALAKQEHAFAGA AGIFVSLCLHP+DT+KTVIQSCRA+QK   +I
Sbjct  354   SRMESHSTASEKPQFALAKQEHAFAGAFAGIFVSLCLHPVDTVKTVIQSCRAEQKSICFI  413

Query  1256  GRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGG  1077
             GRS+ISERG+ GLYRGI+SNIASSAPISALYTF+YESVKGALLP    EY S+AHC+AGG
Sbjct  414   GRSIISERGLTGLYRGIASNIASSAPISALYTFSYESVKGALLPLFPKEYHSLAHCMAGG  473

Query  1076  CASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHS  897
             CAS+ATSFIFTPSERVKQQMQV  HY+NCWNAL+GI+++GGLPSLY GWGAVLCRNVPHS
Sbjct  474   CASIATSFIFTPSERVKQQMQVGVHYQNCWNALVGIVKKGGLPSLYTGWGAVLCRNVPHS  533

Query  896   IIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGG  795
             IIKFYTYESLKQ+M +S+Q   Q NTL T+   G
Sbjct  534   IIKFYTYESLKQVMLTSLQSSAQPNTLQTVCLLG  567


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 83/189 (44%), Gaps = 8/189 (4%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQ-VRSHYKNCWNALIGIIRRGGLPSLYAGWGAVL  918
             H  AG  A +  S    P + VK  +Q  R+  K+       II   GL  LY G  + +
Sbjct  375   HAFAGAFAGIFVSLCLHPVDTVKTVIQSCRAEQKSICFIGRSIISERGLTGLYRGIASNI  434

Query  917   CRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
               + P S +  ++YES+K  +     F  + ++L   + GG A    +   TP + VK +
Sbjct  435   ASSAPISALYTFSYESVKGALLP--LFPKEYHSLAHCMAGGCASIATSFIFTPSERVKQQ  492

Query  737   LQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             +Q  V     Y    + L  I K  GL  LY G    L   +    + F +YES K++  
Sbjct  493   MQVGV----HYQNCWNALVGIVKKGGLPSLYTGWGAVLCRNVPHSIIKFYTYESLKQVML  548

Query  557   LDLHQSSAQ  531
               L QSSAQ
Sbjct  549   TSL-QSSAQ  556



>ref|XP_006827637.1| hypothetical protein AMTR_s00009p00246820 [Amborella trichopoda]
 gb|ERM95053.1| hypothetical protein AMTR_s00009p00246820 [Amborella trichopoda]
Length=648

 Score =   394 bits (1012),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 202/287 (70%), Positives = 235/287 (82%), Gaps = 1/287 (0%)
 Frame = -3

Query  1406  EKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGV  1227
             E+   A  +Q HA AGA+AG+FVSL LHP+DT+KTVIQS R +QK   +I  S++SERGV
Sbjct  338   ERANTAHVQQVHAIAGALAGVFVSLWLHPVDTLKTVIQSGRVEQKSIGHILGSIVSERGV  397

Query  1226  LGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIF  1047
              GLYRGI SN+ASSAPISA+YTFTYE++K  LLP L   Y S+AHCVAGG AS+ATSFIF
Sbjct  398   TGLYRGIGSNLASSAPISAVYTFTYETIKEHLLPLLPKGYHSLAHCVAGGSASIATSFIF  457

Query  1046  TPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESL  867
             TPSER+KQQMQ+ SHY  CW A IGI+ +GG+ SLYAGWGAVLCRN+PHSIIKFYTYESL
Sbjct  458   TPSERIKQQMQIGSHYHTCWKAFIGILEKGGVSSLYAGWGAVLCRNIPHSIIKFYTYESL  517

Query  866   KQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLH  690
             KQ   S  +   Q NTL TLV GGLAGSTAALFTTPFDV+KTRLQTQ+PGS + Y GV H
Sbjct  518   KQWALSRQETGGQLNTLQTLVFGGLAGSTAALFTTPFDVIKTRLQTQIPGSLDHYGGVFH  577

Query  689   TLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDL  549
               ++I K EGL+GLYRGLTPRLVMY++QGALFFASYE FKRLFSL++
Sbjct  578   AFQQIAKIEGLRGLYRGLTPRLVMYVSQGALFFASYEFFKRLFSLEV  624



>ref|XP_002872587.1| binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48846.1| binding protein [Arabidopsis lyrata subsp. lyrata]
Length=616

 Score =   392 bits (1006),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 203/295 (69%), Positives = 236/295 (80%), Gaps = 5/295 (2%)
 Frame = -3

Query  1433  ESEISVVAKEKPCHA-LAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYI  1257
             E+E+   + E P +A +AKQ HAFAGA+AGI VSLCLHP+DT+KT+IQSCR  +K     
Sbjct  322   ETEVCSSSVETPTYAFVAKQRHAFAGALAGISVSLCLHPLDTVKTMIQSCRFGEKSLCNT  381

Query  1256  GRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGG  1077
             GRS+ISERG  GLYRGI+SNIASSAPISALYTFTYE+VKG LLP    EY S+ HC+AGG
Sbjct  382   GRSIISERGFSGLYRGIASNIASSAPISALYTFTYETVKGTLLPLFPKEYCSLTHCLAGG  441

Query  1076  CASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHS  897
              AS+ATSFIFTPSER+KQQMQV SHY+NCW AL+GII++GGL SLYAGW AVLCRN+PHS
Sbjct  442   SASIATSFIFTPSERIKQQMQVSSHYRNCWTALVGIIQKGGLLSLYAGWTAVLCRNIPHS  501

Query  896   IIKFYTYESLKQLMSSSV---QFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ  726
             IIKFY YE++KQ++  S+       Q  TL TL CGGLAGS AA FTTPFDVVKTRLQTQ
Sbjct  502   IIKFYVYENMKQVVLPSIGPRGEPAQPTTLQTLTCGGLAGSAAAFFTTPFDVVKTRLQTQ  561

Query  725   VPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRL  564
             +PGS NQ   V  T + I K EGL+GLYRGL PRLVMYM+QGA+FFASYE +K L
Sbjct  562   IPGSRNQQPNVYQTFQSIRKQEGLRGLYRGLIPRLVMYMSQGAIFFASYEFYKSL  616



>gb|KCW72153.1| hypothetical protein EUGRSUZ_E00597 [Eucalyptus grandis]
Length=611

 Score =   387 bits (995),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 257/600 (43%), Positives = 352/600 (59%), Gaps = 35/600 (6%)
 Frame = -3

Query  2474  NQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPEIMTT  2295
             ++ P+  +   +YRCN +E A FE AD   +      +E  +Q    A+ + K  EI++T
Sbjct  7     SKTPRRSQPSIQYRCNRVEQATFEFADFVHKEGVPAHAETFQQEK--ADCKSKSSEILST  64

Query  2294  RELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSADGKNT  2115
              ELISA G+ W+  +  L+ +L   ++    V  ++ DIL+   ++ +  +       ++
Sbjct  65    SELISAFGHAWDYTSRSLA-VLQQKTNLSYKVSGEKEDILHNVKLQQNGCTSTLPKCNHS  123

Query  2114  PVHLSCDKD---SSLLVSKNPESLNANRNISFFESRNKRDYLWR-FLRNGLDVQHKSSKG  1947
              ++L+  +      L ++     L  NR     ES  +     R F  +  ++ +    G
Sbjct  124   DINLTEMRQLYLDILRITNRTSVLKLNR-----ESTGQYQSPVRNFTGDMTNLLNGPRDG  178

Query  1946  IGLSSLRISYNLENVYGWMNEI--AFSKSKLGSSSIQNHEFGDCSLGNINSSSTNGCDVR  1773
              G+S L IS  L  +YGWMNE+  A +K    ++   + + G    G I +   +    R
Sbjct  179   KGISCLGISSGLGLIYGWMNELIPAEAKHPFKTAISDSEKAGKYFCGEIVTPPQDLMS-R  237

Query  1772  DATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVLEPNA  1593
             D    S  + +GN D +T    +  L   N     S    ++ L S     + ++   + 
Sbjct  238   DKGPKS-FIDSGNADSYTPSIQSKDLPVDNNAKLISDKKESTLLLSDYYLKVANIEADSC  296

Query  1592  F-QMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGL---------DDYGPNQRFGGIE  1443
               + +SS +H     K   SE   C   K +  S +G+         D++ P Q      
Sbjct  297   ISKAASSTLHADHHLKFVASEKGEC---KLDYESTNGIEFFPERKEEDNHRPAQE-----  348

Query  1442  CNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
                  +I  +  +KP  A+AK+EHAFAGA +GIFVSLCLHP+DTIKTVIQS RA+QK   
Sbjct  349   -EHTMKIHCLGHDKPQAAVAKEEHAFAGAFSGIFVSLCLHPVDTIKTVIQSYRAEQKSLC  407

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
             YIG+S++SERG+ GLYRGISS IASS PISA+YTFTYESVKGALLP    EY S+ HC+A
Sbjct  408   YIGKSIVSERGLTGLYRGISSKIASSGPISAIYTFTYESVKGALLPLFPKEYYSITHCIA  467

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             GGCAS+ATSF++TPSER+KQQMQV SHY NCWNAL+GII RGG+PSLYAGWGAVLCRN+P
Sbjct  468   GGCASIATSFVYTPSERIKQQMQVGSHYHNCWNALVGIITRGGMPSLYAGWGAVLCRNIP  527

Query  902   HSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV  723
             HS++KFY YE+LK    SS+    Q NTL TLVCGGLAGSTAALF+TPFDVVKTRLQTQV
Sbjct  528   HSVVKFYVYENLKMWTLSSLPPGAQLNTLQTLVCGGLAGSTAALFSTPFDVVKTRLQTQV  587



>ref|XP_009387927.1| PREDICTED: probable mitochondrial adenine nucleotide transporter 
BTL3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=656

 Score =   385 bits (989),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 198/300 (66%), Positives = 240/300 (80%), Gaps = 4/300 (1%)
 Frame = -3

Query  1418  VVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             +  ++K     AK  HA AGA+AGI VSLCLHP+DT+KT+IQ+    QK  Y   + +IS
Sbjct  351   ITVQDKLKKVFAKNRHAIAGALAGIMVSLCLHPVDTVKTIIQADGMVQKSAYCTLKRIIS  410

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
             E+G+ GLYRGI++NIASSAPISA+YTFTYESVKG LLP L  EY S AHC+AGGC+S+AT
Sbjct  411   EKGLSGLYRGIAANIASSAPISAIYTFTYESVKGTLLPILPKEYHSFAHCIAGGCSSIAT  470

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             SF+FTPSER+KQQMQV S Y+NCWNA +G + +GGLPSLYAGW AVLCRN+PHSIIKFYT
Sbjct  471   SFVFTPSERIKQQMQVGSQYQNCWNAFVGCLEKGGLPSLYAGWRAVLCRNIPHSIIKFYT  530

Query  878   YESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYD  702
             YESLKQL SS  +  +  +T  TL+CGGLAGSTAALFTTPFDVVKT+LQTQ PG+  +Y+
Sbjct  531   YESLKQL-SSKPEGGL--STSQTLLCGGLAGSTAALFTTPFDVVKTKLQTQAPGTLRKYN  587

Query  701   GVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTH  522
             GV H L+EI + EGL+GLYRGLTPRL MY++QGA+FFASYE  K +F+L+  Q  AQ  H
Sbjct  588   GVGHALQEIARQEGLQGLYRGLTPRLAMYVSQGAIFFASYEFLKAVFALEAPQLPAQVIH  647



>ref|XP_009411517.1| PREDICTED: uncharacterized protein LOC103993251 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411518.1| PREDICTED: uncharacterized protein LOC103993251 [Musa acuminata 
subsp. malaccensis]
Length=671

 Score =   379 bits (973),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 192/292 (66%), Positives = 232/292 (79%), Gaps = 1/292 (0%)
 Frame = -3

Query  1388  LAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRG  1209
             L K  HA AGA+AG  VSLCLHP+DTIKT+IQ+    QK  Y   R++IS++G+ GLY G
Sbjct  357   LTKNRHAIAGALAGTIVSLCLHPIDTIKTIIQADGIGQKSVYCTLRTLISQKGIAGLYCG  416

Query  1208  issniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERV  1029
             I++NIASSA ISA+YTFTYESVKGA+LP L  EY SVAHC AGGC+S+ATS IFTPSER+
Sbjct  417   ITTNIASSALISAIYTFTYESVKGAVLPVLPKEYHSVAHCFAGGCSSIATSLIFTPSERI  476

Query  1028  KQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSS  849
             KQQMQV S Y++CWNA IG   +GGLPSLY GW AVLCRN+PHSIIKFYTYE+LK L   
Sbjct  477   KQQMQVGSQYQDCWNAFIGCFEKGGLPSLYTGWKAVLCRNIPHSIIKFYTYENLKLLCLV  536

Query  848   SVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIG  672
             S + +   +TL TL+CGG+AGSTAALFTTPFDVVKT+LQTQ PG+  +Y GVLH L+EI 
Sbjct  537   SAKPNSGLSTLQTLLCGGIAGSTAALFTTPFDVVKTKLQTQAPGTIGKYRGVLHALQEIA  596

Query  671   KSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHE  516
             + EG +GLYRG+TPRL MY++QGALFFASYE  K +F+L + QS  Q  H++
Sbjct  597   RHEGFQGLYRGVTPRLAMYISQGALFFASYEFLKVVFALQVPQSHVQVIHNQ  648



>ref|XP_006580585.1| PREDICTED: uncharacterized protein LOC100778143 isoform X6 [Glycine 
max]
Length=566

 Score =   371 bits (952),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 253/608 (42%), Positives = 346/608 (57%), Gaps = 63/608 (10%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             M+  N+ PK  +   KY      GA  E   S  +   ++S+   KQ       + K P+
Sbjct  1     MSGCNKSPKNGQQSFKYWRIQHGGASSEAVLSCVDYSPSLSTNENKQC--YGSSQPKSPQ  58

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRN-----------VDPQENDILYFPPM  2160
             I++T +LISA+G IW+SA+ PLS +LS  +    +           VD ++ND++Y    
Sbjct  59    ILSTSQLISAIGLIWDSASRPLSVLLSKETVNQDDKGFQKEKILDSVDERKNDLVY----  114

Query  2159  EDSCSSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNK-RDYLWRFLR  1983
                     S D K  PV     +  + +V    +     + IS  +S N+ +DY+    +
Sbjct  115   -------ASTDIKYYPV----TEGGAQIVQGKLDFPKVMQKISVLDSSNESQDYIDSLFK  163

Query  1982  NGLDVQHKSS----KGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSL  1815
               L    K++    K + L    +S    NVY W+     +K+      +   E  + + 
Sbjct  164   RCLLASDKTTNKDWKEMELRREEMSCKSGNVYWWVGR-NITKALNCQVDVAQPEIPESNA  222

Query  1814  ----GNINSSSTNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNS  1647
                 GNI+  ++       A +   ++S+ N+  H                  ++   N+
Sbjct  223   PVAGGNISVDTST-----PALAIESDVSSPNSITH------------ETQSLYNAATLNT  265

Query  1646  ALCSKNGNVLFHVLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGP  1467
              + S   +  F    P+  Q+ SS +          S   A ++ ++E   +  L+    
Sbjct  266   RIVSPLCSDYFLQAVPDTCQILSSSICADYHINSLASYNSASNQCQHEIDDNKSLEIQ--  323

Query  1466  NQRFGGIECNSESEISVVAKE-KPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQS  1290
              + F  I  + E ++   A   KPC+  AKQEH F+GA+AGI VSLCLHP+DTIKTVIQ+
Sbjct  324   RRHFLDIA-DDEPKVQTSATHLKPCNYQAKQEHVFSGALAGICVSLCLHPVDTIKTVIQA  382

Query  1289  CRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTE  1110
             CRA+ +  +YIG+S++S+RG+LGLYRGI++NIA SAPISA+YTF+YESVK ALLP L  E
Sbjct  383   CRAEHRSIFYIGKSIVSDRGLLGLYRGITTNIACSAPISAVYTFSYESVKAALLPHLPKE  442

Query  1109  YQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGW  930
             Y S AHC+ GGCAS+ATSFIFTPSER+KQQMQV SHY+NCW+ L+GIIR GG  SLYAGW
Sbjct  443   YYSFAHCMGGGCASIATSFIFTPSERIKQQMQVGSHYRNCWDVLVGIIRNGGFSSLYAGW  502

Query  929   GAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDV  750
              AVLCRNVPHSIIKFYTYESLKQ+M SS    IQ NT  TLVCGGLAGSTAALFTTPFDV
Sbjct  503   RAVLCRNVPHSIIKFYTYESLKQVMPSS----IQPNTFQTLVCGGLAGSTAALFTTPFDV  558

Query  749   VKTRLQTQ  726
             +KTRLQTQ
Sbjct  559   IKTRLQTQ  566



>ref|XP_006580584.1| PREDICTED: uncharacterized protein LOC100778143 isoform X5 [Glycine 
max]
Length=567

 Score =   371 bits (952),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 253/608 (42%), Positives = 346/608 (57%), Gaps = 63/608 (10%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             M+  N+ PK  +   KY      GA  E   S  +   ++S+   KQ       + K P+
Sbjct  1     MSGCNKSPKNGQQSFKYWRIQHGGASSEAVLSCVDYSPSLSTNENKQC--YGSSQPKSPQ  58

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRN-----------VDPQENDILYFPPM  2160
             I++T +LISA+G IW+SA+ PLS +LS  +    +           VD ++ND++Y    
Sbjct  59    ILSTSQLISAIGLIWDSASRPLSVLLSKETVNQDDKGFQKEKILDSVDERKNDLVY----  114

Query  2159  EDSCSSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNK-RDYLWRFLR  1983
                     S D K  PV     +  + +V    +     + IS  +S N+ +DY+    +
Sbjct  115   -------ASTDIKYYPV----TEGGAQIVQGKLDFPKVMQKISVLDSSNESQDYIDSLFK  163

Query  1982  NGLDVQHKSS----KGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSL  1815
               L    K++    K + L    +S    NVY W+     +K+      +   E  + + 
Sbjct  164   RCLLASDKTTNKDWKEMELRREEMSCKSGNVYWWVGR-NITKALNCQVDVAQPEIPESNA  222

Query  1814  ----GNINSSSTNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNS  1647
                 GNI+  ++       A +   ++S+ N+  H                  ++   N+
Sbjct  223   PVAGGNISVDTST-----PALAIESDVSSPNSITH------------ETQSLYNAATLNT  265

Query  1646  ALCSKNGNVLFHVLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGP  1467
              + S   +  F    P+  Q+ SS +          S   A ++ ++E   +  L+    
Sbjct  266   RIVSPLCSDYFLQAVPDTCQILSSSICADYHINSLASYNSASNQCQHEIDDNKSLEIQ--  323

Query  1466  NQRFGGIECNSESEISVVAKE-KPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQS  1290
              + F  I  + E ++   A   KPC+  AKQEH F+GA+AGI VSLCLHP+DTIKTVIQ+
Sbjct  324   RRHFLDIA-DDEPKVQTSATHLKPCNYQAKQEHVFSGALAGICVSLCLHPVDTIKTVIQA  382

Query  1289  CRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTE  1110
             CRA+ +  +YIG+S++S+RG+LGLYRGI++NIA SAPISA+YTF+YESVK ALLP L  E
Sbjct  383   CRAEHRSIFYIGKSIVSDRGLLGLYRGITTNIACSAPISAVYTFSYESVKAALLPHLPKE  442

Query  1109  YQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGW  930
             Y S AHC+ GGCAS+ATSFIFTPSER+KQQMQV SHY+NCW+ L+GIIR GG  SLYAGW
Sbjct  443   YYSFAHCMGGGCASIATSFIFTPSERIKQQMQVGSHYRNCWDVLVGIIRNGGFSSLYAGW  502

Query  929   GAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDV  750
              AVLCRNVPHSIIKFYTYESLKQ+M SS    IQ NT  TLVCGGLAGSTAALFTTPFDV
Sbjct  503   RAVLCRNVPHSIIKFYTYESLKQVMPSS----IQPNTFQTLVCGGLAGSTAALFTTPFDV  558

Query  749   VKTRLQTQ  726
             +KTRLQTQ
Sbjct  559   IKTRLQTQ  566



>gb|KDO76225.1| hypothetical protein CISIN_1g005451mg [Citrus sinensis]
Length=604

 Score =   372 bits (955),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 250/583 (43%), Positives = 328/583 (56%), Gaps = 49/583 (8%)
 Frame = -3

Query  2480  WGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPEIM  2301
             +  Q    D+   K RCN +EGA FELAD   +  A   ++N KQ NK AE   K P I+
Sbjct  4     YKKQARTSDQSSIKCRCNPVEGASFELADFVSKEDALALADNSKQTNKKAEP--KSPMIL  61

Query  2300  TTRELISAVGNIWNSAA-----HPLSFILSSASSAH----RNVDPQENDILYFPPMEDSC  2148
             +T +LI+AVG +W+SA      HP   ++ S S       RN+D +EN  +         
Sbjct  62    STAQLIAAVGQLWDSANRLAIFHPKGNLIDSHSECKKEVLRNLDKEENAWV---------  112

Query  2147  SSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNG  1977
               P S D K   V +S     S +V  N E L   + +S F+S +K+      W FLR+G
Sbjct  113   --PLSTDSKYFCVDVSSAGQFSPMVQPNLEFLKVTQKMSVFDSCSKKFAHSTFWTFLRSG  170

Query  1976  LDVQHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSLGNINSS  1797
               + + +    GL+S  I Y L NV+ WM E  F      + SI + E            
Sbjct  171   ASLSNDTCVW-GLASAGIPYQLGNVHRWMTE-KFPAGFTYADSIPDSE---------KRE  219

Query  1796  STNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVL  1617
             +   C + D T C+    +G+T        T   +  +L+  K   +  +A    +    
Sbjct  220   AGEQCILGDTTGCAGASISGDTLSPASKPATEDHNKSDLSKSKGQSSCFNAKLMMSTRTT  279

Query  1616  FHVLEPNAFQMSSSEVHGYSSEKHSTSEYCA-------------CDETKYENRSDSGLDD  1476
               +L     +  S         +   S  CA             C++ ++    D+ L++
Sbjct  280   KSLLSDYFLKDVSDMKEDCDVTRQPCSSLCADYCINSVASSNGTCEKCRHLMDDDALLEN  339

Query  1475  YGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVI  1296
                      +E  ++ E      EKP  +LAKQEHAFAGA+AG+FVSLCLHP+DT+KTVI
Sbjct  340   KRNQSDKNVVEDENKMEFHSPKTEKPHLSLAKQEHAFAGALAGVFVSLCLHPVDTVKTVI  399

Query  1295  QSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLH  1116
             QSC  +QK   YIGRS++SERG+ GLYRGI+SNIASSAPISA+Y FTYESVKGALLP L 
Sbjct  400   QSCHTEQKSIVYIGRSIVSERGLTGLYRGIASNIASSAPISAVYAFTYESVKGALLPHLP  459

Query  1115  TEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYA  936
              E+ S+AHC AGGCASVATSFIFTPSER+KQQMQV S Y NCWNAL+GII+ GGL SLYA
Sbjct  460   KEFHSLAHCTAGGCASVATSFIFTPSERIKQQMQVGSRYHNCWNALVGIIKNGGLHSLYA  519

Query  935   GWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTL  807
             GWGAVLCRNVPHSI+KFYTYESLKQ+M  S++   Q NT+ T+
Sbjct  520   GWGAVLCRNVPHSIVKFYTYESLKQMMLPSLKPGAQPNTIETV  562


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 79/188 (42%), Gaps = 9/188 (5%)
 Frame = -3

Query  1118  HTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIG--IIRRGGLPS  945
             H       H  AG  A V  S    P + VK  +Q   H +      IG  I+   GL  
Sbjct  366   HLSLAKQEHAFAGALAGVFVSLCLHPVDTVKTVIQ-SCHTEQKSIVYIGRSIVSERGLTG  424

Query  944   LYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFT  765
             LY G  + +  + P S +  +TYES+K  +   +  +   ++L     GG A    +   
Sbjct  425   LYRGIASNIASSAPISAVYAFTYESVKGALLPHLPKEF--HSLAHCTAGGCASVATSFIF  482

Query  764   TPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFAS  585
             TP + +K ++Q      ++Y    + L  I K+ GL  LY G    L   +    + F +
Sbjct  483   TPSERIKQQMQV----GSRYHNCWNALVGIIKNGGLHSLYAGWGAVLCRNVPHSIVKFYT  538

Query  584   YESFKRLF  561
             YES K++ 
Sbjct  539   YESLKQMM  546



>ref|XP_006580583.1| PREDICTED: uncharacterized protein LOC100778143 isoform X4 [Glycine 
max]
Length=586

 Score =   371 bits (953),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 253/608 (42%), Positives = 346/608 (57%), Gaps = 63/608 (10%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             M+  N+ PK  +   KY      GA  E   S  +   ++S+   KQ       + K P+
Sbjct  1     MSGCNKSPKNGQQSFKYWRIQHGGASSEAVLSCVDYSPSLSTNENKQC--YGSSQPKSPQ  58

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRN-----------VDPQENDILYFPPM  2160
             I++T +LISA+G IW+SA+ PLS +LS  +    +           VD ++ND++Y    
Sbjct  59    ILSTSQLISAIGLIWDSASRPLSVLLSKETVNQDDKGFQKEKILDSVDERKNDLVY----  114

Query  2159  EDSCSSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNK-RDYLWRFLR  1983
                     S D K  PV     +  + +V    +     + IS  +S N+ +DY+    +
Sbjct  115   -------ASTDIKYYPV----TEGGAQIVQGKLDFPKVMQKISVLDSSNESQDYIDSLFK  163

Query  1982  NGLDVQHKSS----KGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSL  1815
               L    K++    K + L    +S    NVY W+     +K+      +   E  + + 
Sbjct  164   RCLLASDKTTNKDWKEMELRREEMSCKSGNVYWWVGR-NITKALNCQVDVAQPEIPESNA  222

Query  1814  ----GNINSSSTNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNS  1647
                 GNI+  ++       A +   ++S+ N+  H                  ++   N+
Sbjct  223   PVAGGNISVDTST-----PALAIESDVSSPNSITH------------ETQSLYNAATLNT  265

Query  1646  ALCSKNGNVLFHVLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGP  1467
              + S   +  F    P+  Q+ SS +          S   A ++ ++E   +  L+    
Sbjct  266   RIVSPLCSDYFLQAVPDTCQILSSSICADYHINSLASYNSASNQCQHEIDDNKSLEI--Q  323

Query  1466  NQRFGGIECNSESEISVVAKE-KPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQS  1290
              + F  I  + E ++   A   KPC+  AKQEH F+GA+AGI VSLCLHP+DTIKTVIQ+
Sbjct  324   RRHFLDIA-DDEPKVQTSATHLKPCNYQAKQEHVFSGALAGICVSLCLHPVDTIKTVIQA  382

Query  1289  CRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTE  1110
             CRA+ +  +YIG+S++S+RG+LGLYRGI++NIA SAPISA+YTF+YESVK ALLP L  E
Sbjct  383   CRAEHRSIFYIGKSIVSDRGLLGLYRGITTNIACSAPISAVYTFSYESVKAALLPHLPKE  442

Query  1109  YQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGW  930
             Y S AHC+ GGCAS+ATSFIFTPSER+KQQMQV SHY+NCW+ L+GIIR GG  SLYAGW
Sbjct  443   YYSFAHCMGGGCASIATSFIFTPSERIKQQMQVGSHYRNCWDVLVGIIRNGGFSSLYAGW  502

Query  929   GAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDV  750
              AVLCRNVPHSIIKFYTYESLKQ+M SS    IQ NT  TLVCGGLAGSTAALFTTPFDV
Sbjct  503   RAVLCRNVPHSIIKFYTYESLKQVMPSS----IQPNTFQTLVCGGLAGSTAALFTTPFDV  558

Query  749   VKTRLQTQ  726
             +KTRLQTQ
Sbjct  559   IKTRLQTQ  566



>ref|XP_008804022.1| PREDICTED: LOW QUALITY PROTEIN: calcium-binding mitochondrial 
carrier protein-like [Phoenix dactylifera]
Length=611

 Score =   365 bits (938),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 185/273 (68%), Positives = 222/273 (81%), Gaps = 1/273 (0%)
 Frame = -3

Query  1340  VSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYT  1161
             VSLCLHP+DT+KT+IQ+    QK  Y I R +ISE+G LGLY GI+SNIASSAPISA+YT
Sbjct  320   VSLCLHPVDTVKTIIQANGMGQKSTYLIVRRIISEKGTLGLYCGIASNIASSAPISAIYT  379

Query  1160  FTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNA  981
             FTYESVKGALLP L  EY S+AHC+ GGC+S+ATSF+ TPSER+KQQMQ    Y+NCWNA
Sbjct  380   FTYESVKGALLPLLPKEYHSLAHCITGGCSSIATSFVSTPSERIKQQMQXGLQYQNCWNA  439

Query  980   LIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVC  801
             +IG + +GG+ SLYAGW AVLCRN+PHSIIKFYTYESLKQ + +S + D   NTL TLVC
Sbjct  440   MIGCVEKGGVSSLYAGWSAVLCRNIPHSIIKFYTYESLKQFLLASAKPDASLNTLQTLVC  499

Query  800   GGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRL  624
             GGLAGS+AALFTTPFDVVKTRLQTQ PG+  +Y+GVLH L+EI + EGL+GLYRGL  RL
Sbjct  500   GGLAGSSAALFTTPFDVVKTRLQTQAPGTLGRYNGVLHALQEIAREEGLQGLYRGLALRL  559

Query  623   VMYMTQGALFFASYESFKRLFSLDLHQSSAQRT  525
              MY++QGA+ FASYE  K +F+L++ Q   Q T
Sbjct  560   AMYVSQGAIIFASYEFLKAVFALEVPQPPCQVT  592



>ref|XP_007040236.1| Mitochondrial substrate carrier family protein, putative isoform 
6 [Theobroma cacao]
 ref|XP_007040239.1| Mitochondrial substrate carrier family protein, putative isoform 
6 [Theobroma cacao]
 gb|EOY24737.1| Mitochondrial substrate carrier family protein, putative isoform 
6 [Theobroma cacao]
 gb|EOY24740.1| Mitochondrial substrate carrier family protein, putative isoform 
6 [Theobroma cacao]
Length=551

 Score =   363 bits (931),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 243/543 (45%), Positives = 312/543 (57%), Gaps = 17/543 (3%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYA-TISSENKKQNNKIAERERKPP  2310
             M     P + D+   KYR    EGAFFE+     E YA ++  +N+K   K    E K P
Sbjct  1     MPASKNPCRSDQPSIKYRWRADEGAFFEVGKLVPEEYAPSLPDKNRKSRTK---SETKEP  57

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSA  2130
             EI++T ELIS++  IWN A+  L+     A+    +   Q+ DIL     E++ +   SA
Sbjct  58    EILSTAELISSLNQIWNCASR-LTIFQQQANLDRNHFVSQKEDILVNLGREENGTGSISA  116

Query  2129  DGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNGLDVQHK  1959
             D K   V L         +  N + +   + +S F+  NK     +    L  G D+ +K
Sbjct  117   DSKYFCVDLGTASQLPPAMKPNFKFVKITKKMSMFDFCNKNPKCSFYQGLLCCGTDLSNK  176

Query  1958  SSKGIGLSSLRISYNLENVYGWMNEIAFSKSKL-GSSSIQNHEFGD-CSLGNINSSSTNG  1785
             S K  GLS++  SY   NVY WM E+     K   +   +N + G  C +G   SS + G
Sbjct  177   SWKAKGLSAVGFSYEFGNVYKWMREMIPGGLKYYVNVQTENKKLGKYCDVGG-TSSDSGG  235

Query  1784  CDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVL  1605
             C   D T+ +DNL   N + ++    +   S  +           ++LCS     L  V 
Sbjct  236   CISADRTNPTDNLPTENAEPYSHCIKSIDSSILHDAKLVMDTRRTTSLCSDY--FLTSVQ  293

Query  1604  EPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFG----GIECN  1437
             E  A    S          +  +   +C  T  E +  S  ++   N+R        E +
Sbjct  294   ETKANCSVSRTPDSNLCADYHINVLASCSSTYKECQHLSDGNECLKNERKQPEPFSTEDD  353

Query  1436  SESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYI  1257
             S  E    A EKP  ALAKQEHAFAGA AGIFVSLCLHP+DT+KTVIQSCRA+QK   +I
Sbjct  354   SRMESHSTASEKPQFALAKQEHAFAGAFAGIFVSLCLHPVDTVKTVIQSCRAEQKSICFI  413

Query  1256  GRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGG  1077
             GRS+ISERG+ GLYRGI+SNIASSAPISALYTF+YESVKGALLP    EY S+AHC+AGG
Sbjct  414   GRSIISERGLTGLYRGIASNIASSAPISALYTFSYESVKGALLPLFPKEYHSLAHCMAGG  473

Query  1076  CASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHS  897
             CAS+ATSFIFTPSERVKQQMQV  HY+NCWNAL+GI+++GGLPSLY GWGAVLCRNVPHS
Sbjct  474   CASIATSFIFTPSERVKQQMQVGVHYQNCWNALVGIVKKGGLPSLYTGWGAVLCRNVPHS  533

Query  896   IIK  888
             IIK
Sbjct  534   IIK  536



>ref|XP_002972833.1| hypothetical protein SELMODRAFT_413467 [Selaginella moellendorffii]
 gb|EFJ26054.1| hypothetical protein SELMODRAFT_413467 [Selaginella moellendorffii]
Length=395

 Score =   350 bits (897),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 181/299 (61%), Positives = 226/299 (76%), Gaps = 10/299 (3%)
 Frame = -3

Query  1418  VVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             +VA+EK  +A   + HA AGA+AG+FVSLCLHP+DT+KTVIQS    ++    I  S++S
Sbjct  69    LVAEEKRKNASCGKNHAVAGALAGVFVSLCLHPLDTVKTVIQSKNTGKQAILPIVASIVS  128

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
              RGV GLYRG+ SN+ASSAPISA+YTFTYE++K ALLP L  EY S+AHC AGGCAS+AT
Sbjct  129   TRGVSGLYRGLGSNLASSAPISAIYTFTYETMKAALLPRLPEEYHSLAHCAAGGCASIAT  188

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             S ++TPSERVKQQMQ+ + Y+N W A +GI++RGG P+LYAGW AVLCRNVP S+IKF+T
Sbjct  189   SLVYTPSERVKQQMQIGAVYRNSWLAFVGILQRGGFPALYAGWEAVLCRNVPQSVIKFFT  248

Query  878   YESLKQLMSSSVQFDIQNNTLMTLV---------CGGLAGSTAALFTTPFDVVKTRLQTQ  726
             YE+LK  +      D     L T+V         CGGLAGSTAALFTTPFDVVKTRLQTQ
Sbjct  249   YEALKHRVLRDSPPDTHLTNLQTIVWVWKNLQLACGGLAGSTAALFTTPFDVVKTRLQTQ  308

Query  725   VPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLD  552
               GS +QY  VL+ L+ I + EG++ LYRGL PRL +Y++QGALFFASYE FKR  +++
Sbjct  309   TIGSQHQYSSVLNALQMITRDEGIRSLYRGLIPRLAIYVSQGALFFASYEFFKRALAME  367



>ref|XP_003570048.1| PREDICTED: calcium-binding mitochondrial carrier protein [Brachypodium 
distachyon]
Length=604

 Score =   355 bits (912),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 176/283 (62%), Positives = 224/283 (79%), Gaps = 2/283 (1%)
 Frame = -3

Query  1403  KPCH-ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGV  1227
             + CH A+   +HA AGA+AG  VS+ LHP+DT+KT+IQ+  + Q  FY+I R  + ERGV
Sbjct  311   RRCHDAVNVNKHAVAGAIAGTVVSISLHPVDTVKTIIQANSSGQSSFYHILRRALVERGV  370

Query  1226  LGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIF  1047
             LGLY G++S +A SAPISA+YT TYE VKGALLP L  +Y S+AHC AGGC+S+ATSF+F
Sbjct  371   LGLYGGLASKVACSAPISAIYTLTYEIVKGALLPTLPKDYHSIAHCAAGGCSSIATSFVF  430

Query  1046  TPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESL  867
             TPSE +KQQMQ+ S Y+NCW AL+G ++RGG+ SLYAGWGAVLCRN+PHS++KFY YESL
Sbjct  431   TPSEYIKQQMQMGSQYQNCWKALVGCLQRGGIASLYAGWGAVLCRNIPHSVVKFYAYESL  490

Query  866   KQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ-VPGSNQYDGVLH  690
             KQ + ++   D + ++  TL+CGG AGSTAALFTTPFDVVKTR+Q Q +    +Y+GVLH
Sbjct  491   KQFLLNASPADAKLDSGQTLLCGGFAGSTAALFTTPFDVVKTRVQLQALSPVRKYEGVLH  550

Query  689   TLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLF  561
              LK+I + EGL+GLYRGLTPRLVMY++QGALFF SYE  K + 
Sbjct  551   ALKQIFEQEGLRGLYRGLTPRLVMYVSQGALFFTSYEFLKTIM  593



>gb|EEC73746.1| hypothetical protein OsI_08383 [Oryza sativa Indica Group]
 gb|EEE57530.1| hypothetical protein OsJ_07846 [Oryza sativa Japonica Group]
Length=313

 Score =   343 bits (881),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 175/278 (63%), Positives = 215/278 (77%), Gaps = 1/278 (0%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A+    HA AGA+AG  VS+ LHP+DT+KT+IQ   + +  FY+  R  + ERGVLGLY 
Sbjct  25    AVNLNRHAVAGALAGTVVSVSLHPIDTVKTIIQVNSSRRSSFYHTLRRALVERGVLGLYG  84

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G++S IA SAPISA+YT TYE VKG+LLP L  EY S+AHC AGGC+S+ATSF+FTPSE 
Sbjct  85    GLASKIACSAPISAIYTLTYEIVKGSLLPILPKEYHSIAHCTAGGCSSIATSFVFTPSEC  144

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMS  852
             +KQQMQV S Y+NCW+AL+G +R+GG+ SLYAGWGAVLCRN+PHS+IKFYTYESLKQ M 
Sbjct  145   IKQQMQVGSQYQNCWDALLGCLRKGGITSLYAGWGAVLCRNIPHSVIKFYTYESLKQFML  204

Query  851   SSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ-VPGSNQYDGVLHTLKEI  675
              S   +   ++  TL CGG AGSTAAL TTPFDVVKTR+Q Q +   ++YDGVLH LKEI
Sbjct  205   KSAPANANLDSGQTLFCGGFAGSTAALCTTPFDVVKTRVQLQALSPISKYDGVLHALKEI  264

Query  674   GKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLF  561
              + EGL+GLYRGL PRL MY++QGA+FF SYE  K + 
Sbjct  265   FQHEGLQGLYRGLAPRLAMYISQGAIFFTSYEFLKTIM  302



>ref|XP_004953385.1| PREDICTED: uncharacterized protein LOC101766138 isoform X2 [Setaria 
italica]
Length=610

 Score =   353 bits (907),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 178/288 (62%), Positives = 224/288 (78%), Gaps = 3/288 (1%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A+    HA AGA+AG  VS+ LHP+DT+KT+IQ+  + Q  FY+  R  + ERGVLGLY 
Sbjct  322   AVTINRHAVAGALAGTAVSVSLHPVDTVKTIIQANSSGQSSFYHTLRRTLVERGVLGLYG  381

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G++S +A SAPISA+YT TYE VKGALLP L  E+ S+AHC AGGC+S+ATSF+FTPSE 
Sbjct  382   GLTSKLACSAPISAIYTLTYEIVKGALLPVLPEEHHSIAHCAAGGCSSIATSFLFTPSEC  441

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMS  852
             +KQQMQV S Y+NCWNAL+G ++RGG+ SLYAGWGAVLCRN+PHSI+KFY YESLKQ + 
Sbjct  442   IKQQMQVGSQYQNCWNALVGCLKRGGIASLYAGWGAVLCRNIPHSIVKFYAYESLKQSIL  501

Query  851   SSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ-VPGSNQYDGVLHTLKEI  675
              S   +++ ++  TL+CGG AGSTAALFTTPFDVVKTR+Q Q +   ++YDGVLH LKEI
Sbjct  502   KSAPENVKLSSGETLICGGFAGSTAALFTTPFDVVKTRVQLQALSPVSKYDGVLHALKEI  561

Query  674   GKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLF--SLDLHQSS  537
                EGL+GLYRGLTPRL +Y++QGA+FF SYE  K +     ++H SS
Sbjct  562   FLQEGLRGLYRGLTPRLAIYISQGAIFFTSYEFLKTIMFPEQEVHASS  609



>ref|XP_004953384.1| PREDICTED: uncharacterized protein LOC101766138 isoform X1 [Setaria 
italica]
Length=637

 Score =   353 bits (907),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 178/288 (62%), Positives = 224/288 (78%), Gaps = 3/288 (1%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A+    HA AGA+AG  VS+ LHP+DT+KT+IQ+  + Q  FY+  R  + ERGVLGLY 
Sbjct  349   AVTINRHAVAGALAGTAVSVSLHPVDTVKTIIQANSSGQSSFYHTLRRTLVERGVLGLYG  408

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G++S +A SAPISA+YT TYE VKGALLP L  E+ S+AHC AGGC+S+ATSF+FTPSE 
Sbjct  409   GLTSKLACSAPISAIYTLTYEIVKGALLPVLPEEHHSIAHCAAGGCSSIATSFLFTPSEC  468

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMS  852
             +KQQMQV S Y+NCWNAL+G ++RGG+ SLYAGWGAVLCRN+PHSI+KFY YESLKQ + 
Sbjct  469   IKQQMQVGSQYQNCWNALVGCLKRGGIASLYAGWGAVLCRNIPHSIVKFYAYESLKQSIL  528

Query  851   SSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ-VPGSNQYDGVLHTLKEI  675
              S   +++ ++  TL+CGG AGSTAALFTTPFDVVKTR+Q Q +   ++YDGVLH LKEI
Sbjct  529   KSAPENVKLSSGETLICGGFAGSTAALFTTPFDVVKTRVQLQALSPVSKYDGVLHALKEI  588

Query  674   GKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLF--SLDLHQSS  537
                EGL+GLYRGLTPRL +Y++QGA+FF SYE  K +     ++H SS
Sbjct  589   FLQEGLRGLYRGLTPRLAIYISQGAIFFTSYEFLKTIMFPEQEVHASS  636



>ref|NP_001047664.1| Os02g0665200 [Oryza sativa Japonica Group]
 dbj|BAD28391.1| mitochondrial substrate carrier protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD27768.1| mitochondrial substrate carrier protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF09578.1| Os02g0665200 [Oryza sativa Japonica Group]
Length=618

 Score =   347 bits (891),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 175/278 (63%), Positives = 215/278 (77%), Gaps = 1/278 (0%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A+    HA AGA+AG  VS+ LHP+DT+KT+IQ   + +  FY+  R  + ERGVLGLY 
Sbjct  330   AVNLNRHAVAGALAGTVVSVSLHPIDTVKTIIQVNSSRRSSFYHTLRRALVERGVLGLYG  389

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G++S IA SAPISA+YT TYE VKG+LLP L  EY S+AHC AGGC+S+ATSF+FTPSE 
Sbjct  390   GLASKIACSAPISAIYTLTYEIVKGSLLPILPKEYHSIAHCTAGGCSSIATSFVFTPSEC  449

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMS  852
             +KQQMQV S Y+NCW+AL+G +R+GG+ SLYAGWGAVLCRN+PHS+IKFYTYESLKQ M 
Sbjct  450   IKQQMQVGSQYQNCWDALLGCLRKGGITSLYAGWGAVLCRNIPHSVIKFYTYESLKQFML  509

Query  851   SSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ-VPGSNQYDGVLHTLKEI  675
              S   +   ++  TL CGG AGSTAAL TTPFDVVKTR+Q Q +   ++YDGVLH LKEI
Sbjct  510   KSAPANANLDSGQTLFCGGFAGSTAALCTTPFDVVKTRVQLQALSPISKYDGVLHALKEI  569

Query  674   GKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLF  561
              + EGL+GLYRGL PRL MY++QGA+FF SYE  K + 
Sbjct  570   FQHEGLQGLYRGLAPRLAMYISQGAIFFTSYEFLKTIM  607



>gb|EMT08898.1| Mitoferrin [Aegilops tauschii]
Length=620

 Score =   347 bits (891),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 173/278 (62%), Positives = 217/278 (78%), Gaps = 1/278 (0%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A+   +HA AGA+AG  VS+ LHP+DT+KT+IQ+  + Q  FY+I R  + ERGVLGLY 
Sbjct  332   AVGANKHAAAGAIAGTVVSISLHPVDTVKTIIQANSSGQSSFYHILRRTLVERGVLGLYG  391

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G++S IA SAPISA+YT TYE VKG+LLP L  +Y S+AHC AGGC+S+ATSFIFTPSE 
Sbjct  392   GLASKIACSAPISAIYTLTYEIVKGSLLPTLPKDYHSIAHCAAGGCSSIATSFIFTPSEC  451

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMS  852
             +KQQMQV S Y+NCW AL+G ++RGG+ SLYAGWGAVLCRN+PHSI+KFY YESLKQ + 
Sbjct  452   IKQQMQVGSQYQNCWKALVGCLQRGGIASLYAGWGAVLCRNIPHSIVKFYAYESLKQFLL  511

Query  851   SSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEI  675
             ++   + + N+  TL+CGG AGSTAALFT PFDVVKTR+Q Q      +Y+GVLH L  I
Sbjct  512   NASPANAKLNSGQTLICGGFAGSTAALFTNPFDVVKTRVQLQALNPVRKYEGVLHALTHI  571

Query  674   GKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLF  561
              + EGL+GLYRGL+PRL+MY++QGALFF SYE  K + 
Sbjct  572   FEQEGLRGLYRGLSPRLLMYVSQGALFFTSYEFLKTIM  609



>ref|XP_006286372.1| hypothetical protein CARUB_v10000438mg [Capsella rubella]
 gb|EOA19270.1| hypothetical protein CARUB_v10000438mg [Capsella rubella]
Length=574

 Score =   343 bits (880),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 244/574 (43%), Positives = 327/574 (57%), Gaps = 42/574 (7%)
 Frame = -3

Query  2408  FELADSDR------ENYATISSENKKQNNKIAERERKPPEIMTTRELISAVGNIWNSAAH  2247
             + LA++ R      +++A +  E+  Q +     E K  +I++   LISAV  +W+ +  
Sbjct  20    WNLAEAKRKLSKINDHHAHVEYEHAFQRDNSKRGETKLSQILSRDSLISAVDLMWDRSVF  79

Query  2246  PLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSADGKNTPVHLSCDKDSSLLVSK  2067
                 ++SS     RN+D  + +I  F  + DS   P  AD K      S      + + +
Sbjct  80    VSGDLISSLK--ERNLD--DVNISEFKVLADSAQLP--ADQK-VMSQSSTTTQPRVKLLR  132

Query  2066  NPESLNANRNISFFESRNKRDYLWRFLRNGLDVQHKSSKGIGLSSLRISYNLENVYGWMN  1887
               E +  +   SFF   N+        ++G      S K    S L   +  E +Y    
Sbjct  133   VAEKMCISDPSSFFSRFNQ--------KSGAMSTSGSCKEYS-SPLNARWEREKLYSCRQ  183

Query  1886  EI-AFSKSKLGSSSIQNHEFGDCSLGNINSSSTNGCDVRDATSC-SDNLSAGNTDCHTDI  1713
              +  F++   G++ I+  +  DC       SS   C  R+A SC S  ++ G     T +
Sbjct  184   VVPTFTRYHRGAAEIEKRKDEDCI-----PSSEAECASRNAKSCDSIFVTTGAEGLTTLV  238

Query  1712  KPTsslsshnlnlhksSGASNSALCSKNGNVLFHVLEPNAFQMSSSEVHGYSSEKHSTSE  1533
             +P SSL +            ++  C  N    F +L  +  + ++ ++   +S K ST  
Sbjct  239   EPRSSLIASVAESLV-----DTRTCRSNDVNYFLLLYKD--RCANKKIVNRTSSKCSTDG  291

Query  1532  YCACDETKYENRSD-SGLDDYGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGA  1356
                   +   N SD   L      Q       + E+E+   + E P +A AKQ HAFAGA
Sbjct  292   DTEISSSG--NNSDIHSLSIVENQQLLERDRKDQETEVCSSSPETPTYAFAKQRHAFAGA  349

Query  1355  MAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapi  1176
             +AGI VSLCLHP+DT+KT+IQSCR ++K   Y GRS+ISERGV GLYRGI+SNIASSAP+
Sbjct  350   LAGISVSLCLHPLDTVKTMIQSCRLEEKSLCYTGRSIISERGVSGLYRGIASNIASSAPV  409

Query  1175  sALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYK  996
             SALYTFTYESVKG LLP    EY S+ HCVAGG AS+ATSFIFTPSER+KQQMQV SHY+
Sbjct  410   SALYTFTYESVKGTLLPLFPKEYCSLTHCVAGGSASIATSFIFTPSERIKQQMQVSSHYR  469

Query  995   NCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSS---VQFDIQN  825
             NCW AL+GII++GGL SLYAGW AVLCRN+PHSIIKFY YE++KQ++  S   +    Q 
Sbjct  470   NCWTALVGIIQKGGLLSLYAGWTAVLCRNIPHSIIKFYVYENMKQMVLPSLGPLGQSAQP  529

Query  824   NTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV  723
              TL TL+CGGLAGS AA FTTPFDVVKTRLQTQV
Sbjct  530   TTLQTLICGGLAGSAAAFFTTPFDVVKTRLQTQV  563


 Score = 57.4 bits (137),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 76/178 (43%), Gaps = 7/178 (4%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQ-VRSHYKNCWNALIGIIRRGGLPSLYAGWGAVL  918
             H  AG  A ++ S    P + VK  +Q  R   K+       II   G+  LY G  + +
Sbjct  344   HAFAGALAGISVSLCLHPLDTVKTMIQSCRLEEKSLCYTGRSIISERGVSGLYRGIASNI  403

Query  917   CRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
               + P S +  +TYES+K  +     F  +  +L   V GG A    +   TP + +K +
Sbjct  404   ASSAPVSALYTFTYESVKGTLLP--LFPKEYCSLTHCVAGGSASIATSFIFTPSERIKQQ  461

Query  737   LQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRL  564
             +Q     S+ Y      L  I +  GL  LY G T  L   +    + F  YE+ K++
Sbjct  462   MQV----SSHYRNCWTALVGIIQKGGLLSLYAGWTAVLCRNIPHSIIKFYVYENMKQM  515



>ref|XP_008678912.1| PREDICTED: calcium-binding mitochondrial carrier protein Aralar2 
isoform X1 [Zea mays]
 ref|XP_008678913.1| PREDICTED: calcium-binding mitochondrial carrier protein Aralar2 
isoform X1 [Zea mays]
 gb|AFW63305.1| hypothetical protein ZEAMMB73_570589 [Zea mays]
Length=640

 Score =   345 bits (885),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 175/290 (60%), Positives = 216/290 (74%), Gaps = 1/290 (0%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A+    HA AGA+AG  VS+ LHP+DT+KT+IQ+    Q   Y+  R  + ERGVLGLY 
Sbjct  350   AVTINRHAVAGALAGTAVSVSLHPIDTVKTIIQANSYGQSSVYHTLRRTLIERGVLGLYG  409

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G++S +A SAPISA+YT TYE+VKGALLP    EY S+AHC AGGC+S+ATSF+FTPSE 
Sbjct  410   GLASKLACSAPISAIYTLTYETVKGALLPVFPKEYHSIAHCAAGGCSSIATSFVFTPSEC  469

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMS  852
             +KQQMQV SHY+NCWNAL+G +++GG+ SLY GWGAVLCRN+PHSI+KFY YESLKQ + 
Sbjct  470   IKQQMQVGSHYQNCWNALVGCLKKGGIASLYTGWGAVLCRNIPHSIVKFYAYESLKQSLL  529

Query  851   SSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ-VPGSNQYDGVLHTLKEI  675
              S     + N+  TL+CGG AGSTAAL TTPFDV+KTR+Q Q +    +YDGV+H LKEI
Sbjct  530   KSAPDRAKLNSGQTLLCGGFAGSTAALCTTPFDVIKTRVQLQALSPVCKYDGVVHALKEI  589

Query  674   GKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRT  525
              + EGL GLYRGLTPRL MYM+QGA+FF SYE    L   +  Q    R+
Sbjct  590   FRHEGLCGLYRGLTPRLAMYMSQGAIFFTSYEFLSTLMFPEPEQEVHARS  639



>ref|XP_009387935.1| PREDICTED: uncharacterized protein LOC103974761 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=623

 Score =   336 bits (862),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 177/263 (67%), Positives = 213/263 (81%), Gaps = 5/263 (2%)
 Frame = -3

Query  1277  QKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSV  1098
             QK  Y   + +ISE+G+ GLYRGI++NIASSAPISA+YTFTYESVKG LLP L  EY S 
Sbjct  365   QKSAYCTLKRIISEKGLSGLYRGIAANIASSAPISAIYTFTYESVKGTLLPILPKEYHSF  424

Query  1097  AHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVL  918
             AHC+AGGC+S+ATSF+FTPSER+KQQMQV S Y+NCWNA +G + +GGLPSLYAGW AVL
Sbjct  425   AHCIAGGCSSIATSFVFTPSERIKQQMQVGSQYQNCWNAFVGCLEKGGLPSLYAGWRAVL  484

Query  917   CRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
             CRN+PHSIIKFYTYESLKQL SS  +  +  +T  TL+CGGLAGSTAALFTTPFDVVKT+
Sbjct  485   CRNIPHSIIKFYTYESLKQL-SSKPEGGL--STSQTLLCGGLAGSTAALFTTPFDVVKTK  541

Query  737   LQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLF  561
             LQTQ PG+  +Y+GV H L+EI + EGL+GLYRGLTPRL MY++QGA+FFASYE  K +F
Sbjct  542   LQTQAPGTLRKYNGVGHALQEIARQEGLQGLYRGLTPRLAMYVSQGAIFFASYEFLKAVF  601

Query  560   SLDLHQSSAQRTHHEPCFGDDST  492
             +L+  Q  AQ  H +    D+ST
Sbjct  602   ALEAPQLPAQVIHDKQ-RADNST  623



>ref|XP_006647649.1| PREDICTED: adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial-like 
[Oryza brachyantha]
Length=616

 Score =   334 bits (857),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 177/278 (64%), Positives = 215/278 (77%), Gaps = 1/278 (0%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A+    HA AGA+AG  VS+ LHP+DT+KT+IQ   + +  FY+  R  + ERGVLGLY 
Sbjct  328   AVTLNRHAVAGALAGTVVSVSLHPIDTVKTIIQVNSSGRSSFYHTLRHTLVERGVLGLYG  387

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G+ S IA SAPISA+YT TYE VKGALLP L  EY SVAHC AGGC+S+ATSF+FTPSE 
Sbjct  388   GLGSKIACSAPISAIYTLTYEIVKGALLPILPKEYYSVAHCAAGGCSSIATSFVFTPSEC  447

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMS  852
             +KQQMQV S Y+NCW+AL+G +RRGG+ SLYAGWGAVLCRN+PHSI+KFYTYE+LKQ M 
Sbjct  448   IKQQMQVGSKYQNCWDALLGSLRRGGITSLYAGWGAVLCRNIPHSIVKFYTYENLKQFML  507

Query  851   SSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ-VPGSNQYDGVLHTLKEI  675
              S   +   ++  TL+CGG AGSTAALFTTPFDVVKTR+Q Q +   ++Y GVLH LKEI
Sbjct  508   KSAPPNANLDSGQTLLCGGFAGSTAALFTTPFDVVKTRVQLQALSPVSKYKGVLHALKEI  567

Query  674   GKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLF  561
              + EGL+GLYRGL PRL MY++QGA+FF SYE  K + 
Sbjct  568   SQREGLQGLYRGLAPRLAMYVSQGAIFFTSYEFLKTIM  605



>ref|XP_008805795.1| PREDICTED: uncharacterized protein LOC103718653 isoform X2 [Phoenix 
dactylifera]
Length=594

 Score =   323 bits (829),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 188/222 (85%), Gaps = 0/222 (0%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A +K  HA AGA+AG  VSLCLHP+DT+KT+IQ+    QK  Y I R +ISE+G+LGLYR
Sbjct  353   AFSKNRHAMAGALAGTLVSLCLHPVDTVKTIIQANGMGQKSSYLIVRRIISEKGMLGLYR  412

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             GI+SNIASSAPISA+YTFTYESVKG LLP L  EY S+AHC+AGGC+S+ATSF+FTPSER
Sbjct  413   GIASNIASSAPISAIYTFTYESVKGDLLPLLPKEYHSLAHCIAGGCSSIATSFVFTPSER  472

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMS  852
             +KQQMQV   Y+NCWNA+IG + +GG+ SLYAGWGAVLCRN+PHSIIKFYTYESLKQL+ 
Sbjct  473   IKQQMQVGLQYQNCWNAMIGCLEKGGVSSLYAGWGAVLCRNIPHSIIKFYTYESLKQLVL  532

Query  851   SSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ  726
              S + D   NTL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ
Sbjct  533   GSAKPDASLNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQ  574



>ref|XP_010918563.1| PREDICTED: uncharacterized protein LOC105042899 isoform X2 [Elaeis 
guineensis]
Length=607

 Score =   322 bits (826),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 192/228 (84%), Gaps = 0/228 (0%)
 Frame = -3

Query  1409  KEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERG  1230
             ++K  +A +K  HA AGA+AG  VSLCLHP+DT+KT+IQ+    Q   Y I R +ISE+G
Sbjct  360   QDKIQNAFSKNRHAIAGALAGTLVSLCLHPVDTVKTIIQANGMGQISSYLIVRRIISEKG  419

Query  1229  VLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFI  1050
             +LGLYRGI+SNIASSAPISA+YTFTYESVKGALLP L  EY S+AHC+AGGC+S+ATSF+
Sbjct  420   ILGLYRGIASNIASSAPISAIYTFTYESVKGALLPHLPKEYHSLAHCIAGGCSSIATSFV  479

Query  1049  FTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYES  870
             FTPSER+KQQMQV   Y+NCWNA+IG + +GG+ SLYAGW AVLCRN+PHSIIKFYTYES
Sbjct  480   FTPSERIKQQMQVGLQYQNCWNAMIGCLEKGGMSSLYAGWSAVLCRNIPHSIIKFYTYES  539

Query  869   LKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ  726
             LKQL+ +S + D   NTL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ
Sbjct  540   LKQLLLASAKPDASLNTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQ  587


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 80/179 (45%), Gaps = 7/179 (4%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQVRSHYK-NCWNALIGIIRRGGLPSLYAGWGAVL  918
             H +AG  A    S    P + VK  +Q     + + +  +  II   G+  LY G  + +
Sbjct  372   HAIAGALAGTLVSLCLHPVDTVKTIIQANGMGQISSYLIVRRIISEKGILGLYRGIASNI  431

Query  917   CRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
               + P S I  +TYES+K  +        + ++L   + GG +    +   TP + +K +
Sbjct  432   ASSAPISAIYTFTYESVKGALLP--HLPKEYHSLAHCIAGGCSSIATSFVFTPSERIKQQ  489

Query  737   LQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLF  561
             +Q  +   N ++ ++  L++     G+  LY G +  L   +    + F +YES K+L 
Sbjct  490   MQVGLQYQNCWNAMIGCLEK----GGMSSLYAGWSAVLCRNIPHSIIKFYTYESLKQLL  544



>ref|XP_006580586.1| PREDICTED: uncharacterized protein LOC100778143 isoform X7 [Glycine 
max]
Length=540

 Score =   315 bits (807),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 226/581 (39%), Positives = 319/581 (55%), Gaps = 63/581 (11%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPE  2307
             M+  N+ PK  +   KY      GA  E   S  +   ++S+   KQ       + K P+
Sbjct  1     MSGCNKSPKNGQQSFKYWRIQHGGASSEAVLSCVDYSPSLSTNENKQC--YGSSQPKSPQ  58

Query  2306  IMTTRELISAVGNIWNSAAHPLSFILSSASSAHRN-----------VDPQENDILYFPPM  2160
             I++T +LISA+G IW+SA+ PLS +LS  +    +           VD ++ND++Y    
Sbjct  59    ILSTSQLISAIGLIWDSASRPLSVLLSKETVNQDDKGFQKEKILDSVDERKNDLVY----  114

Query  2159  EDSCSSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNK-RDYLWRFLR  1983
                     S D K  PV     +  + +V    +     + IS  +S N+ +DY+    +
Sbjct  115   -------ASTDIKYYPV----TEGGAQIVQGKLDFPKVMQKISVLDSSNESQDYIDSLFK  163

Query  1982  NGLDVQHKSS----KGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSL  1815
               L    K++    K + L    +S    NVY W+     +K+      +   E  + + 
Sbjct  164   RCLLASDKTTNKDWKEMELRREEMSCKSGNVYWWVGR-NITKALNCQVDVAQPEIPESNA  222

Query  1814  ----GNINSSSTNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNS  1647
                 GNI+  ++       A +   ++S+ N+  H                  ++   N+
Sbjct  223   PVAGGNISVDTST-----PALAIESDVSSPNSITH------------ETQSLYNAATLNT  265

Query  1646  ALCSKNGNVLFHVLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGP  1467
              + S   +  F    P+  Q+ SS +          S   A ++ ++E   +  L+    
Sbjct  266   RIVSPLCSDYFLQAVPDTCQILSSSICADYHINSLASYNSASNQCQHEIDDNKSLEI--Q  323

Query  1466  NQRFGGIECNSESEISVVAKE-KPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQS  1290
              + F  I  + E ++   A   KPC+  AKQEH F+GA+AGI VSLCLHP+DTIKTVIQ+
Sbjct  324   RRHFLDIA-DDEPKVQTSATHLKPCNYQAKQEHVFSGALAGICVSLCLHPVDTIKTVIQA  382

Query  1289  CRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTE  1110
             CRA+ +  +YIG+S++S+RG+LGLYRGI++NIA SAPISA+YTF+YESVK ALLP L  E
Sbjct  383   CRAEHRSIFYIGKSIVSDRGLLGLYRGITTNIACSAPISAVYTFSYESVKAALLPHLPKE  442

Query  1109  YQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGW  930
             Y S AHC+ GGCAS+ATSFIFTPSER+KQQMQV SHY+NCW+ L+GIIR GG  SLYAGW
Sbjct  443   YYSFAHCMGGGCASIATSFIFTPSERIKQQMQVGSHYRNCWDVLVGIIRNGGFSSLYAGW  502

Query  929   GAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTL  807
              AVLCRNVPHSIIKFYTYESLKQ+M SS    IQ NT  T+
Sbjct  503   RAVLCRNVPHSIIKFYTYESLKQVMPSS----IQPNTFQTV  539



>emb|CAN65659.1| hypothetical protein VITISV_000953 [Vitis vinifera]
Length=1742

 Score =   332 bits (852),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 241/657 (37%), Positives = 342/657 (52%), Gaps = 106/657 (16%)
 Frame = -3

Query  2492  DKMAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKP  2313
             +KM + ++ PK D+  T YR   L+ A FE      E+Y     +N  +  K+ E   K 
Sbjct  1108  EKMGFCSKQPKRDQPSTNYRYKSLKQASFEFV---HEDYGGTLPDNDNRRAKVXES--KS  1162

Query  2312  PEIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPS  2133
              EI++T ELISAVG IW+ A+ PLS     A+S H + D  +  +L +   E     P S
Sbjct  1163  CEILSTAELISAVGQIWDXASRPLSIFQPKANSKHNDTDSNKEKVLCYLGGEGYVRVPTS  1222

Query  2132  ADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFE---SRNKRDYLWRFLRNGLDVQH  1962
             A+ K   + L      S +V  N E LN  + +S FE     N   +  R L  G ++ +
Sbjct  1223  ANSKYFCIDLKTASLFSPMVQPNIEHLNITQKMSLFEPGNGNNAHSFFLRCLXGGANMPN  1282

Query  1961  KSSKGIGLSSLRISYNLENVYGWMNEIAFS--KSKLGSSSIQNHEFGDCSLGNINSSSTN  1788
             ++ K +GL+++ ISY+L N+Y WM++I     +S +  + I+N +  +C +   ++++T 
Sbjct  1283  ETWKEMGLTNVGISYDLGNIYRWMSKITLDTLRSPVDITQIENMKXKECCISK-DATNTA  1341

Query  1787  GCDVR-DATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFH  1611
             GC +  D    +++ +  + DC+T +    +  +       + G S S+LC+      + 
Sbjct  1342  GCGINIDVAIPANHPATESADCYTGV----TEGNGANERVMNIGVSISSLCTD-----YF  1392

Query  1610  VLEPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYE--NRSDSGLD---DYGPNQRFGGI  1446
             +   +      S     SSE H+ S + +  +  +E       G+D   ++    +    
Sbjct  1393  LGADHGIAAGDSISRTPSSELHADSNFLSSTDFAFEECQHKTEGVDRQKEFVTXDKLKME  1452

Query  1445  ECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPF  1266
              C S+       ++K  + LAKQEHAFAGA AG+FVSLCLHP+DTIKTVIQSC+ADQK  
Sbjct  1453  TCPSK-------QDKHHYVLAKQEHAFAGAFAGVFVSLCLHPVDTIKTVIQSCQADQKSI  1505

Query  1265  YYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCV  1086
             + +GR +IS+RG+ G YRGI+SNIASSAPISA+YTFTYESVKGALLP    E  S+AHC+
Sbjct  1506  FSVGRLIISQRGLAGFYRGITSNIASSAPISAVYTFTYESVKGALLPLFPKECHSIAHCM  1565

Query  1085  AGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGW--------  930
                       F F                    NAL+GII++GGLPSLYAGW        
Sbjct  1566  GRWLCKHCYFFHFYSQ-----------------NALVGIIKKGGLPSLYAGWGAVLCRNV  1608

Query  929   ------------------------GAVLCRN-----VPHSII------------------  891
                                     G+VL ++      P  I+                  
Sbjct  1609  PHSIIKVRVILDACDLSSIETTVFGSVLSQSDIFSACPFPILPSPASDICGYYIKDFADH  1668

Query  890   -KFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV  723
              +FYTYESLKQLM  S+Q + + NTL TL CGGLAGSTAA FTTPFDVVKTRLQTQV
Sbjct  1669  AQFYTYESLKQLMLPSLQPNAKPNTLQTLACGGLAGSTAAFFTTPFDVVKTRLQTQV  1725



>ref|XP_008678915.1| PREDICTED: calcium-binding mitochondrial carrier protein Aralar2 
isoform X3 [Zea mays]
Length=614

 Score =   315 bits (807),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 164/290 (57%), Positives = 202/290 (70%), Gaps = 27/290 (9%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A+    HA AGA+AG  VS+ LHP+DT+KT+IQ+    Q   Y+  R  + ERGVLGLY 
Sbjct  350   AVTINRHAVAGALAGTAVSVSLHPIDTVKTIIQANSYGQSSVYHTLRRTLIERGVLGLYG  409

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G++S +A SAPISA+YT TYE+VKGALLP    EY S+AHC AGGC+S+ATSF+FTPSE 
Sbjct  410   GLASKLACSAPISAIYTLTYETVKGALLPVFPKEYHSIAHCAAGGCSSIATSFVFTPSEC  469

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMS  852
             +KQQMQV SHY+NCWNAL+G +++GG+ SLY GWGAVLCRN+PHSI+K            
Sbjct  470   IKQQMQVGSHYQNCWNALVGCLKKGGIASLYTGWGAVLCRNIPHSIVK------------  517

Query  851   SSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ-VPGSNQYDGVLHTLKEI  675
                           L+CGG AGSTAAL TTPFDV+KTR+Q Q +    +YDGV+H LKEI
Sbjct  518   --------------LLCGGFAGSTAALCTTPFDVIKTRVQLQALSPVCKYDGVVHALKEI  563

Query  674   GKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRT  525
              + EGL GLYRGLTPRL MYM+QGA+FF SYE    L   +  Q    R+
Sbjct  564   FRHEGLCGLYRGLTPRLAMYMSQGAIFFTSYEFLSTLMFPEPEQEVHARS  613



>ref|XP_001752212.1| predicted protein [Physcomitrella patens]
 gb|EDQ82945.1| predicted protein [Physcomitrella patens]
Length=690

 Score =   310 bits (795),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 194/264 (73%), Gaps = 1/264 (0%)
 Frame = -3

Query  1340  VSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYT  1161
             VSLCLHP+DT+KT+IQ+     +    I  SVIS RG+ GLYRG+ SN+ASSAPISA+YT
Sbjct  401   VSLCLHPIDTVKTIIQAQTGSNRNLLPILSSVISTRGLKGLYRGLGSNLASSAPISAIYT  460

Query  1160  FTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNA  981
              TYE+VK  LL  +  +  ++AHC AGGCASVATS ++TPSE VKQQMQV   Y+N W A
Sbjct  461   LTYEAVKAGLLRHIPEDMSALAHCAAGGCASVATSIVYTPSECVKQQMQVNGLYRNSWQA  520

Query  980   LIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVC  801
                I+++GGLP LY GWGAVL RNVP S+IKFYTYE LK  +    + D    TL  L  
Sbjct  521   FTSILKQGGLPLLYKGWGAVLFRNVPQSVIKFYTYEGLKHWVQGGPRRDTPLTTLQALAI  580

Query  800   GGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRL  624
             GG AGSTAA FTTPFDVVKTRLQTQ+PGS  QY GV+H  + I  +EG+ GLYRGL PRL
Sbjct  581   GGAAGSTAAFFTTPFDVVKTRLQTQIPGSVQQYSGVVHAFQCIATTEGIAGLYRGLVPRL  640

Query  623   VMYMTQGALFFASYESFKRLFSLD  552
             V+Y+TQGALFFASYE  K + +L+
Sbjct  641   VIYVTQGALFFASYEFIKHILTLE  664



>ref|XP_001757436.1| predicted protein [Physcomitrella patens]
 gb|EDQ77921.1| predicted protein [Physcomitrella patens]
Length=270

 Score =   290 bits (743),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 156/277 (56%), Positives = 200/277 (72%), Gaps = 15/277 (5%)
 Frame = -3

Query  1364  AGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniass  1185
             AGAMAG  VSLCLHP+DT+KT++Q+     +    I  +VISERG   LYRG+ SN+ +S
Sbjct  1     AGAMAGGVVSLCLHPVDTLKTLVQARAGGNRKLLPIMSAVISERG---LYRGLGSNLIAS  57

Query  1184  apisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRS  1005
             APISA+YT TYE+VK  LL  +  +  ++AHCVAGGCASVATSF++TPS+ VKQ+MQV  
Sbjct  58    APISAIYTLTYETVKAGLLRHIPEDMSALAHCVAGGCASVATSFVYTPSDFVKQRMQVHG  117

Query  1004  HYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQN  825
              Y N W AL  I+++GGLP+LY GWGAVLCRNVP S++K   Y     L+  +V  D++ 
Sbjct  118   LYTNSWQALTSIVQQGGLPTLYKGWGAVLCRNVPQSVVKVCNY----LLVECNVGHDVRT  173

Query  824   -------NTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGK  669
                       + LV GG AGSTAALF+TPFDVVKTRLQTQ+PG+  QY GV+H  + I  
Sbjct  174   CLSCSDPLIFVQLVVGGAAGSTAALFSTPFDVVKTRLQTQIPGTAQQYTGVIHAFQSIVT  233

Query  668   SEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             +EG+ GLYRGL PR+++Y+TQGALFFASYE  KR+ +
Sbjct  234   TEGVAGLYRGLVPRILIYITQGALFFASYEFIKRVLA  270



>ref|XP_007040232.1| Mitochondrial substrate carrier family protein, putative isoform 
2 [Theobroma cacao]
 ref|XP_007040237.1| Mitochondrial substrate carrier family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY24733.1| Mitochondrial substrate carrier family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY24738.1| Mitochondrial substrate carrier family protein, putative isoform 
2 [Theobroma cacao]
Length=546

 Score =   296 bits (758),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 215/510 (42%), Positives = 280/510 (55%), Gaps = 17/510 (3%)
 Frame = -3

Query  2486  MAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYA-TISSENKKQNNKIAERERKPP  2310
             M     P + D+   KYR    EGAFFE+     E YA ++  +N+K   K    E K P
Sbjct  1     MPASKNPCRSDQPSIKYRWRADEGAFFEVGKLVPEEYAPSLPDKNRKSRTK---SETKEP  57

Query  2309  EIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQENDILYFPPMEDSCSSPPSA  2130
             EI++T ELIS++  IWN A+  L+     A+    +   Q+ DIL     E++ +   SA
Sbjct  58    EILSTAELISSLNQIWNCASR-LTIFQQQANLDRNHFVSQKEDILVNLGREENGTGSISA  116

Query  2129  DGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNGLDVQHK  1959
             D K   V L         +  N + +   + +S F+  NK     +    L  G D+ +K
Sbjct  117   DSKYFCVDLGTASQLPPAMKPNFKFVKITKKMSMFDFCNKNPKCSFYQGLLCCGTDLSNK  176

Query  1958  SSKGIGLSSLRISYNLENVYGWMNEIAFSKSKL-GSSSIQNHEFGD-CSLGNINSSSTNG  1785
             S K  GLS++  SY   NVY WM E+     K   +   +N + G  C +G   SS + G
Sbjct  177   SWKAKGLSAVGFSYEFGNVYKWMREMIPGGLKYYVNVQTENKKLGKYCDVGG-TSSDSGG  235

Query  1784  CDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVLFHVL  1605
             C   D T+ +DNL   N + ++    +   S  +           ++LCS     L  V 
Sbjct  236   CISADRTNPTDNLPTENAEPYSHCIKSIDSSILHDAKLVMDTRRTTSLCSDY--FLTSVQ  293

Query  1604  EPNAFQMSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFG----GIECN  1437
             E  A    S          +  +   +C  T  E +  S  ++   N+R        E +
Sbjct  294   ETKANCSVSRTPDSNLCADYHINVLASCSSTYKECQHLSDGNECLKNERKQPEPFSTEDD  353

Query  1436  SESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYI  1257
             S  E    A EKP  ALAKQEHAFAGA AGIFVSLCLHP+DT+KTVIQSCRA+QK   +I
Sbjct  354   SRMESHSTASEKPQFALAKQEHAFAGAFAGIFVSLCLHPVDTVKTVIQSCRAEQKSICFI  413

Query  1256  GRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGG  1077
             GRS+ISERG+ GLYRGI+SNIASSAPISALYTF+YESVKGALLP    EY S+AHC+AGG
Sbjct  414   GRSIISERGLTGLYRGIASNIASSAPISALYTFSYESVKGALLPLFPKEYHSLAHCMAGG  473

Query  1076  CASVATSFIFTPSERVKQQMQVRSHYKNCW  987
             CAS+ATSFIFTPSERVKQQMQV  HY+NCW
Sbjct  474   CASIATSFIFTPSERVKQQMQVGVHYQNCW  503



>ref|XP_008437279.1| PREDICTED: uncharacterized protein LOC103482750 isoform X2 [Cucumis 
melo]
Length=574

 Score =   291 bits (744),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = -3

Query  1448  IECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKP  1269
             +E     E S + +E+ C+ + KQEHAFAGA+AG+FVSLCLHP+DTIKTV QS  A+QK 
Sbjct  362   VENEYNREDSSLTRERSCYNIGKQEHAFAGALAGVFVSLCLHPVDTIKTVFQSYHAEQKS  421

Query  1268  FYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHC  1089
               YIG+S++++RG+ GLYRGIS+NIASSAPISA+YTFTYESVKGALLP L  EY+S+ HC
Sbjct  422   LSYIGKSIVTDRGLSGLYRGISTNIASSAPISAVYTFTYESVKGALLPILQEEYRSIVHC  481

Query  1088  VAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRN  909
             VAGGCAS+ATSF+FTPSER+KQQMQV +HY NCWNA +G++ +GGL  LY GWGAVLCRN
Sbjct  482   VAGGCASIATSFLFTPSERIKQQMQVSAHYHNCWNAFVGVVAKGGLRGLYTGWGAVLCRN  541

Query  908   VPHSIIKFYTYESLKQLMSSSVQ  840
             VPHSIIKFYTYESLK LM S+ Q
Sbjct  542   VPHSIIKFYTYESLKGLMKSNAQ  564


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 68/254 (27%), Positives = 113/254 (44%), Gaps = 30/254 (12%)
 Frame = -3

Query  2492  DKMAWGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKP  2313
             +KM   N+P   ++    YR    EG   ELAD   EN  + +   K   +     + K 
Sbjct  10    EKMNKQNKPCVSNQPSIYYRWRPDEGISSELADFVLENGTSNTCYAKHSKDGRTINKPKS  69

Query  2312  PEIMTTRELISAVGNIWNSAAHPLSFILSSASSAHRNVDPQEND----ILYFPPMEDSCS  2145
               I++T ++IS  G + N A+ P +F   +       V  QEND    + +   +E    
Sbjct  70    SGILSTTQVISIFGQVLNLASRPFTFFRPN------RVLNQENDDFVEVTFNSVVEVDGK  123

Query  2144  SPPSADGKNTPVHLSCDKDSSLLV--SKNPESLNANRNISFFESRN--KRDYLWRFLRNG  1977
             +  S + K+  V    D   S LV  +     L   + IS  E  N       W  L  G
Sbjct  124   TVTSPEIKDFCVDSRTDGRCSPLVQPTLGLNCLTVTQKISLLEPCNFHSMSSFWSLLNGG  183

Query  1976  LDVQHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKS------KLGSS-SIQNHEF----  1830
              D+   S KG GL+S+RI +++  +YGWMN ++ +++      K+ ++ +++ +EF    
Sbjct  184   SDMPANSWKGKGLTSVRILHDMGKIYGWMNCVSHTEACYPYPMKVANTGNMEANEFQARG  243

Query  1829  -----GDCSLGNIN  1803
                  GDC+ G+ N
Sbjct  244   GLNEAGDCASGDSN  257


 Score = 63.5 bits (153),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/190 (27%), Positives = 83/190 (44%), Gaps = 9/190 (5%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIG--IIRRGGLPSLYAGWGAV  921
             H  AG  A V  S    P + +K   Q   H +    + IG  I+   GL  LY G    
Sbjct  387   HAFAGALAGVFVSLCLHPVDTIKTVFQ-SYHAEQKSLSYIGKSIVTDRGLSGLYRGISTN  445

Query  920   LCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKT  741
             +  + P S +  +TYES+K  +   +Q + +  +++  V GG A    +   TP + +K 
Sbjct  446   IASSAPISAVYTFTYESVKGALLPILQEEYR--SIVHCVAGGCASIATSFLFTPSERIKQ  503

Query  740   RLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLF  561
             ++Q     S  Y    +    +    GL+GLY G    L   +    + F +YES K L 
Sbjct  504   QMQV----SAHYHNCWNAFVGVVAKGGLRGLYTGWGAVLCRNVPHSIIKFYTYESLKGLM  559

Query  560   SLDLHQSSAQ  531
               +  Q+++Q
Sbjct  560   KSNAQQTTSQ  569



>gb|KDO76226.1| hypothetical protein CISIN_1g005451mg [Citrus sinensis]
Length=514

 Score =   281 bits (718),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 207/527 (39%), Positives = 278/527 (53%), Gaps = 49/527 (9%)
 Frame = -3

Query  2480  WGNQPPKGDKLPTKYRCNLLEGAFFELADSDRENYATISSENKKQNNKIAERERKPPEIM  2301
             +  Q    D+   K RCN +EGA FELAD   +  A   ++N KQ NK AE   K P I+
Sbjct  4     YKKQARTSDQSSIKCRCNPVEGASFELADFVSKEDALALADNSKQTNKKAEP--KSPMIL  61

Query  2300  TTRELISAVGNIWNSAA-----HPLSFILSSASSAH----RNVDPQENDILYFPPMEDSC  2148
             +T +LI+AVG +W+SA      HP   ++ S S       RN+D +EN  +         
Sbjct  62    STAQLIAAVGQLWDSANRLAIFHPKGNLIDSHSECKKEVLRNLDKEENAWV---------  112

Query  2147  SSPPSADGKNTPVHLSCDKDSSLLVSKNPESLNANRNISFFESRNKR---DYLWRFLRNG  1977
               P S D K   V +S     S +V  N E L   + +S F+S +K+      W FLR+G
Sbjct  113   --PLSTDSKYFCVDVSSAGQFSPMVQPNLEFLKVTQKMSVFDSCSKKFAHSTFWTFLRSG  170

Query  1976  LDVQHKSSKGIGLSSLRISYNLENVYGWMNEIAFSKSKLGSSSIQNHEFGDCSLGNINSS  1797
               + + +    GL+S  I Y L NV+ WM E  F      + SI + E            
Sbjct  171   ASLSNDTCVW-GLASAGIPYQLGNVHRWMTE-KFPAGFTYADSIPDSE---------KRE  219

Query  1796  STNGCDVRDATSCSDNLSAGNTDCHTDIKPTsslsshnlnlhksSGASNSALCSKNGNVL  1617
             +   C + D T C+    +G+T        T   +  +L+  K   +  +A    +    
Sbjct  220   AGEQCILGDTTGCAGASISGDTLSPASKPATEDHNKSDLSKSKGQSSCFNAKLMMSTRTT  279

Query  1616  FHVLEPNAFQMSSSEVHGYSSEKHSTSEYCA-------------CDETKYENRSDSGLDD  1476
               +L     +  S         +   S  CA             C++ ++    D+ L++
Sbjct  280   KSLLSDYFLKDVSDMKEDCDVTRQPCSSLCADYCINSVASSNGTCEKCRHLMDDDALLEN  339

Query  1475  YGPNQRFGGIECNSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVI  1296
                      +E  ++ E      EKP  +LAKQEHAFAGA+AG+FVSLCLHP+DT+KTVI
Sbjct  340   KRNQSDKNVVEDENKMEFHSPKTEKPHLSLAKQEHAFAGALAGVFVSLCLHPVDTVKTVI  399

Query  1295  QSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLH  1116
             QSC  +QK   YIGRS++SERG+ GLYRGI+SNIASSAPISA+Y FTYESVKGALLP L 
Sbjct  400   QSCHTEQKSIVYIGRSIVSERGLTGLYRGIASNIASSAPISAVYAFTYESVKGALLPHLP  459

Query  1115  TEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALI  975
              E+ S+AHC AGGCASVATSFIFTPSER+KQQMQV S Y NCW   +
Sbjct  460   KEFHSLAHCTAGGCASVATSFIFTPSERIKQQMQVGSRYHNCWYTFL  506



>gb|EMS63704.1| hypothetical protein TRIUR3_06650 [Triticum urartu]
Length=761

 Score =   286 bits (733),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 156/284 (55%), Positives = 199/284 (70%), Gaps = 17/284 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             +HA AGA+AG  VS+ LHP+DT+KT+IQ+  + Q  FY+I R  + ERGVLGLY G++S 
Sbjct  337   KHAAAGALAGTVVSISLHPVDTVKTIIQANSSGQSSFYHILRRTLVERGVLGLYGGLASK  396

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             IA SAPISA+YT TYE VKG+LLP L  +Y S+AHC AGGC+S+ATSFIFTPSE +KQQM
Sbjct  397   IACSAPISAIYTLTYEIVKGSLLPTLPKDYHSIAHCAAGGCSSIATSFIFTPSECIKQQM  456

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             QV S Y+NCW AL+G ++RGG+ SLYAGWGAVLCRN+PHSI+KFY YESLKQ + ++   
Sbjct  457   QVGSQYQNCWKALVGCLQRGGIASLYAGWGAVLCRNIPHSIVKFYAYESLKQFLLNASPA  516

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHT----------  687
             + + N+  TL+CGG AGSTAALFT PFDVVKTR+Q Q+    Q    + T          
Sbjct  517   NAKLNSGQTLICGGFAGSTAALFTNPFDVVKTRVQLQIILQEQARPKIQTTSVQASLTRQ  576

Query  686   --LKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASY---ESFK  570
               LK+  ++E  +G+  G+  R     T  AL   S+   E FK
Sbjct  577   KSLKD--QAETRQGISPGMQARPQTKQTLNALRAKSFLEGEEFK  618



>ref|XP_009364946.1| PREDICTED: mitoferrin-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009364947.1| PREDICTED: mitoferrin-like isoform X3 [Pyrus x bretschneideri]
Length=161

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = -3

Query  1019  MQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQ  840
             MQV  HY NCWNAL+GIIR+GGLPS+YAGWGAVLCRNVPHSI+KFYTYESLKQ MSS  +
Sbjct  1     MQVGLHYNNCWNALVGIIRKGGLPSMYAGWGAVLCRNVPHSIVKFYTYESLKQFMSSPKE  60

Query  839   FDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSE  663
               +Q  TL TLVCGGLAGSTAALFTTPFDVVKTRLQTQ+PGS +QY+GV+H L+EIGK+E
Sbjct  61    AGVQPTTLQTLVCGGLAGSTAALFTTPFDVVKTRLQTQIPGSMSQYNGVIHGLQEIGKNE  120

Query  662   GLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSA  534
             GL+GLYRGLT RLVM ++Q  + FASYE FKR FSL+  +S++
Sbjct  121   GLQGLYRGLTLRLVMCVSQ--VIFASYEFFKRFFSLEFGESTS  161



>emb|CAB78187.1| putative protein [Arabidopsis thaliana]
 emb|CAB82149.1| putative protein [Arabidopsis thaliana]
Length=550

 Score =   260 bits (665),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 161/201 (80%), Gaps = 0/201 (0%)
 Frame = -3

Query  1439  NSESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYY  1260
             + E+E+ + + E   +A AKQ HAFAGA+AGI VSLCLHP+DT+KT+IQSCR ++K    
Sbjct  307   DKETEVCLSSPETTTYAFAKQRHAFAGALAGISVSLCLHPLDTVKTMIQSCRLEEKSLCN  366

Query  1259  IGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAG  1080
              GRS+ISERG  GLYRGI+SNIASSAPISALYTFTYE+VKG LLP    EY S+AHC+AG
Sbjct  367   TGRSIISERGFSGLYRGIASNIASSAPISALYTFTYETVKGTLLPLFPKEYCSLAHCLAG  426

Query  1079  GCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPH  900
             G AS+ATSFIFTPSER+KQQMQV SHY+NCW AL+GII++GGL SLYAGW AVLCRN+PH
Sbjct  427   GSASIATSFIFTPSERIKQQMQVSSHYRNCWTALVGIIQKGGLLSLYAGWTAVLCRNIPH  486

Query  899   SIIKFYTYESLKQLMSSSVQF  837
             SIIK     ++  L+   V +
Sbjct  487   SIIKVRFAHTIIGLIPRLVMY  507


 Score = 79.7 bits (195),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 90/209 (43%), Gaps = 31/209 (15%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQ-VRSHYKNCWNALIGIIRRGGLPSLYAGWGAVL  918
             H  AG  A ++ S    P + VK  +Q  R   K+  N    II   G   LY G  + +
Sbjct  329   HAFAGALAGISVSLCLHPLDTVKTMIQSCRLEEKSLCNTGRSIISERGFSGLYRGIASNI  388

Query  917   CRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
               + P S +  +TYE++K  +     F  +  +L   + GG A    +   TP + +K +
Sbjct  389   ASSAPISALYTFTYETVKGTLLP--LFPKEYCSLAHCLAGGSASIATSFIFTPSERIKQQ  446

Query  737   LQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRG------------------------LTP  630
             +Q     S+ Y      L  I +  GL  LY G                        L P
Sbjct  447   MQV----SSHYRNCWTALVGIIQKGGLLSLYAGWTAVLCRNIPHSIIKVRFAHTIIGLIP  502

Query  629   RLVMYMTQGALFFASYESFKRLFSLDLHQ  543
             RLVMYM+QGA+FFASYE +K + SL   Q
Sbjct  503   RLVMYMSQGAIFFASYEFYKSVLSLAAAQ  531



>ref|XP_002503139.1| mitochondrial carrier family, partial [Micromonas sp. RCC299]
 gb|ACO64397.1| mitochondrial carrier family, partial [Micromonas sp. RCC299]
Length=266

 Score =   247 bits (631),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 187/266 (70%), Gaps = 5/266 (2%)
 Frame = -3

Query  1364  AGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniass  1185
             AGA+AG  VS+ LHP+DTIK  IQ+ R  ++P   +   +I +RGV GLY G+S+++ASS
Sbjct  2     AGAIAGTLVSIVLHPVDTIKVTIQADRKVREPIAMVVSRIIRQRGVFGLYSGLSTSLASS  61

Query  1184  apisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRS  1005
             APISA+YT +YE VKG LLP L  E + +AHC+AGGCASVATSF++TPSE +KQ+ QV +
Sbjct  62    APISAIYTASYELVKGRLLPGLPEEKRWIAHCIAGGCASVATSFVYTPSECIKQRCQV-T  120

Query  1004  HYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESL-KQLMSSSVQFDIQ  828
                + + A   ++R  G+  LY GW AVLCRN+P S IKF+ +E L +    +       
Sbjct  121   GATSAFAAAKSVVRADGVLGLYKGWSAVLCRNIPQSAIKFFVFEQLMRAAGGALASGGGS  180

Query  827   NNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV---PGSNQYDGVLHTLKEIGKSEGL  657
             + TL  L  GG+AGSTAA+FTTPFD +KTR+QT      G +   G+L T+++I  +EG+
Sbjct  181   SGTLPALAIGGVAGSTAAMFTTPFDTIKTRMQTAGVVNQGGSTMRGLLPTMRDIVVNEGV  240

Query  656   KGLYRGLTPRLVMYMTQGALFFASYE  579
              GLYRG+ PRL++Y+TQGA+FF+SYE
Sbjct  241   GGLYRGVIPRLLIYVTQGAVFFSSYE  266



>ref|XP_003061154.1| mitochondrial carrier family [Micromonas pusilla CCMP1545]
 gb|EEH54804.1| mitochondrial carrier family [Micromonas pusilla CCMP1545]
Length=427

 Score =   239 bits (611),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 141/273 (52%), Positives = 177/273 (65%), Gaps = 15/273 (5%)
 Frame = -3

Query  1343  FVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALY  1164
              VS+ LHP+DTIK  +Q+ RA ++P   + R ++S RGV  LY G+S+++ASSAPISA+Y
Sbjct  135   LVSVVLHPVDTIKVAVQADRAAREPLTKVVRKMLSARGVSRLYSGLSASLASSAPISAIY  194

Query  1163  TFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWN  984
             T  YE+VK  LLP    E   VAHCVAGGCASVATSF++TPSE VKQ+ QV S     W 
Sbjct  195   TAAYEAVKAKLLPMFPEERSWVAHCVAGGCASVATSFVYTPSECVKQRCQV-SGTSTAWG  253

Query  983   ALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNT-----  819
             A   I+R  G+  LY GW AVLCRN+P S IKF+ +E L +  S S              
Sbjct  254   ATRAIVRAEGVCGLYKGWTAVLCRNIPQSAIKFFVFEQLMRAASRSASGGGGGGGGGGGG  313

Query  818   ---------LMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKS  666
                      L  LV GG+AGSTAA+FTTPFD +KTRLQT   G     GVL T+++I  S
Sbjct  314   GGGGGGGGPLPALVAGGVAGSTAAVFTTPFDTIKTRLQTGGGGRGAVAGVLPTMRDIVVS  373

Query  665   EGLKGLYRGLTPRLVMYMTQGALFFASYESFKR  567
             EG+ GLYRG+ PRL +Y+TQGA+FF SYE  +R
Sbjct  374   EGVGGLYRGVIPRLFIYVTQGAVFFTSYEVARR  406



>ref|XP_008678916.1| PREDICTED: uncharacterized protein LOC103653882 isoform X4 [Zea 
mays]
Length=551

 Score =   235 bits (600),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A+    HA AGA+AG  VS+ LHP+DT+KT+IQ+    Q   Y+  R  + ERGVLGLY 
Sbjct  350   AVTINRHAVAGALAGTAVSVSLHPIDTVKTIIQANSYGQSSVYHTLRRTLIERGVLGLYG  409

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G++S +A SAPISA+YT TYE+VKGALLP    EY S+AHC AGGC+S+ATSF+FTPSE 
Sbjct  410   GLASKLACSAPISAIYTLTYETVKGALLPVFPKEYHSIAHCAAGGCSSIATSFVFTPSEC  469

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQ  861
             +KQQMQV SHY+NCWNAL+G +++GG+ SLY GWGAVLCRN+PHSI+KFY YESLKQ
Sbjct  470   IKQQMQVGSHYQNCWNALVGCLKKGGIASLYTGWGAVLCRNIPHSIVKFYAYESLKQ  526



>ref|XP_008678914.1| PREDICTED: uncharacterized protein LOC103653882 isoform X2 [Zea 
mays]
Length=620

 Score =   234 bits (598),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A+    HA AGA+AG  VS+ LHP+DT+KT+IQ+    Q   Y+  R  + ERGVLGLY 
Sbjct  350   AVTINRHAVAGALAGTAVSVSLHPIDTVKTIIQANSYGQSSVYHTLRRTLIERGVLGLYG  409

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G++S +A SAPISA+YT TYE+VKGALLP    EY S+AHC AGGC+S+ATSF+FTPSE 
Sbjct  410   GLASKLACSAPISAIYTLTYETVKGALLPVFPKEYHSIAHCAAGGCSSIATSFVFTPSEC  469

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQ  861
             +KQQMQV SHY+NCWNAL+G +++GG+ SLY GWGAVLCRN+PHSI+KFY YESLKQ
Sbjct  470   IKQQMQVGSHYQNCWNALVGCLKKGGIASLYTGWGAVLCRNIPHSIVKFYAYESLKQ  526



>ref|XP_001757421.1| predicted protein [Physcomitrella patens]
 gb|EDQ77906.1| predicted protein [Physcomitrella patens]
Length=239

 Score =   221 bits (564),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 162/235 (69%), Gaps = 12/235 (5%)
 Frame = -3

Query  1340  VSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYT  1161
             VSLCLHP+DT+KT++Q+ RA         R+++    ++GLYRG+ SN+  SAPISA+YT
Sbjct  15    VSLCLHPVDTLKTLVQA-RAGGN------RNLLP---IIGLYRGLGSNLTVSAPISAIYT  64

Query  1160  FTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNA  981
              TYE+VK  LL  +  +  ++AHCVAGGCASVATSF++TPS+ VKQ+MQV   Y+N W A
Sbjct  65    LTYETVKAGLLRHIPEDMSALAHCVAGGCASVATSFVYTPSDCVKQRMQVHGLYENSWEA  124

Query  980   LIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESL-KQLMSSSVQFDIQNNTLMTLV  804
                I++  GLP+LY GWGAVLCRNVP S++K   ++   K    S             LV
Sbjct  125   FTSILKEEGLPTLYKGWGAVLCRNVPQSVVKVCIFQVFCKNETGSGKAVGRDWVDASNLV  184

Query  803   CGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYR  642
              GG AGSTAALF+TPFDVVKTRLQTQ+PG+  QY GV+H  + I  +EG+ GLYR
Sbjct  185   IGGAAGSTAALFSTPFDVVKTRLQTQIPGTAQQYTGVIHVFQSIVTTEGVAGLYR  239



>ref|XP_008678919.1| PREDICTED: uncharacterized protein LOC103653882 isoform X7 [Zea 
mays]
Length=525

 Score =   218 bits (556),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 133/168 (79%), Gaps = 0/168 (0%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A+    HA AGA+AG  VS+ LHP+DT+KT+IQ+    Q   Y+  R  + ERGVLGLY 
Sbjct  350   AVTINRHAVAGALAGTAVSVSLHPIDTVKTIIQANSYGQSSVYHTLRRTLIERGVLGLYG  409

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G++S +A SAPISA+YT TYE+VKGALLP    EY S+AHC AGGC+S+ATSF+FTPSE 
Sbjct  410   GLASKLACSAPISAIYTLTYETVKGALLPVFPKEYHSIAHCAAGGCSSIATSFVFTPSEC  469

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIK  888
             +KQQMQV SHY+NCWNAL+G +++GG+ SLY GWGAVLCRN+PHSI+K
Sbjct  470   IKQQMQVGSHYQNCWNALVGCLKKGGIASLYTGWGAVLCRNIPHSIVK  517



>ref|XP_009364949.1| PREDICTED: mitoferrin-like isoform X4 [Pyrus x bretschneideri]
Length=136

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 119/138 (86%), Gaps = 3/138 (2%)
 Frame = -3

Query  944  LYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFT  765
            +YAGWGAVLCRNVPHSI+KFYTYESLKQ MSS  +  +Q  TL TLVCGGLAGSTAALFT
Sbjct  1    MYAGWGAVLCRNVPHSIVKFYTYESLKQFMSSPKEAGVQPTTLQTLVCGGLAGSTAALFT  60

Query  764  TPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFA  588
            TPFDVVKTRLQTQ+PGS +QY+GV+H L+EIGK+EGL+GLYRGLT RLVM ++Q  + FA
Sbjct  61   TPFDVVKTRLQTQIPGSMSQYNGVIHGLQEIGKNEGLQGLYRGLTLRLVMCVSQ--VIFA  118

Query  587  SYESFKRLFSLDLHQSSA  534
            SYE FKR FSL+  +S++
Sbjct  119  SYEFFKRFFSLEFGESTS  136



>ref|XP_002984406.1| hypothetical protein SELMODRAFT_120459 [Selaginella moellendorffii]
 gb|EFJ14456.1| hypothetical protein SELMODRAFT_120459 [Selaginella moellendorffii]
Length=313

 Score =   204 bits (520),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 138/295 (47%), Positives = 172/295 (58%), Gaps = 53/295 (18%)
 Frame = -3

Query  1418  VVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             +VA+EK   A   + HA AGA+AG+FVSLCLHP+DT+KTVIQ           +   + S
Sbjct  36    LVAEEKRKSASCGKNHAVAGALAGVFVSLCLHPLDTVKTVIQ----------LVIILLFS  85

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
               GV GLYRG+ SN+ASSAPISA+YTFTYE++K ALLP L  EY S+AHC AGGCAS+AT
Sbjct  86    FAGVSGLYRGLGSNLASSAPISAIYTFTYETMKAALLPRLPEEYHSLAHCAAGGCASIAT  145

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGI----IRRGGLPSLYAGWGAVLC----RNVP  903
             S ++TPSERVKQQMQ+ + Y+N W A   +    IR         GW A  C    +  P
Sbjct  146   SLVYTPSERVKQQMQIGAVYRNSWWAFSILCCSRIRN-------HGWQAGFCWHSTKRRP  198

Query  902   HSIIKFYTYESLKQLMSSSVQFDIQNNTLM-------TLVCGGLAGSTAALFTTPFDVVK  744
                +       L Q  +   Q ++    L+       TL CGGLAGSTAALFTTPFDVVK
Sbjct  199   SGAVCRMGSRPLPQCSTIGYQSELHCLGLLSFPQRFETLACGGLAGSTAALFTTPFDVVK  258

Query  743   TRLQTQVP---------------------GSNQYDGVLHTLKEIGKSEGLKGLYR  642
             TRLQTQV                        +QY  VL+ L+ I + EG++ LYR
Sbjct  259   TRLQTQVSLTAQFLSFTLTWAISFFQTIGSQHQYSSVLNALQMITRDEGIRSLYR  313



>emb|CDX93731.1| BnaA09g23310D [Brassica napus]
Length=323

 Score =   157 bits (396),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 112/351 (32%), Positives = 170/351 (48%), Gaps = 32/351 (9%)
 Frame = -3

Query  1568  HGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFGGIECNSESEISVVAKEKPCHA  1389
              G +S     S+  + D   ++N  +       P ++    + N    I V   + PCH 
Sbjct  3     RGIASSSRDGSQTASPDALAFKNIKN-------PIKK----QINGCGTICVKQDDDPCHF  51

Query  1388  L-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             L    E   AG +AG+ V   L+P+DTIKT +Q  R   K  +             GLY 
Sbjct  52    LRLLYESLIAGGLAGLVVEAALYPIDTIKTRVQVARDGGKIIWK------------GLYS  99

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G+  N+A   P SAL+   YE  K  LL  L   + +VAH  AG      +S +  P+E 
Sbjct  100   GLGGNLAGVLPASALFFGVYEPTKQKLLKVLPENFSAVAHLAAGALGGAVSSIVRVPTEV  159

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMS  852
             VKQ+MQ    + +  +A+  II + G   +YAG+G+ L R++P   ++F  YE L+    
Sbjct  160   VKQRMQT-GQFASAPDAVRLIIAKEGFGGMYAGFGSFLLRDLPFDALQFCVYEQLRIGYK  218

Query  851   SSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIG  672
              + + D+  N     + G +AG+   + TTP DV+KTRL  Q  G NQY GV   LK I 
Sbjct  219   LAARRDL--NDPENAMLGAVAGAVTRVLTTPLDVIKTRLMVQGAG-NQYKGVSDCLKTIL  275

Query  671   KSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHH  519
             + EG   L++G+ PR++     G++FF   E  K++ S      S+Q+ H 
Sbjct  276   REEGSSALWKGMGPRVLWIGIGGSIFFGVLEKTKQILS----DQSSQKIHK  322



>emb|CDX93733.1| BnaA09g23330D [Brassica napus]
Length=323

 Score =   157 bits (396),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 111/351 (32%), Positives = 170/351 (48%), Gaps = 32/351 (9%)
 Frame = -3

Query  1568  HGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFGGIECNSESEISVVAKEKPCHA  1389
              G +S     S+  + D   ++N  +       P ++    + N    I V   + PCH 
Sbjct  3     RGIASSSRDGSQTASPDALAFKNIKN-------PIKK----QINGCGTICVKQDDDPCHF  51

Query  1388  L-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             L    E   AG +AG+ V   L+P+DTIKT +Q  R   K  +             GLY 
Sbjct  52    LRLLYESLIAGGLAGLVVEAALYPIDTIKTRVQVARDGGKIIWK------------GLYS  99

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G+  N+A   P SAL+   YE  K  LL  L   + +VAH  AG      +S +  P+E 
Sbjct  100   GLGGNLAGVLPASALFFGVYEPTKQKLLKVLPENFSAVAHLAAGALGGAVSSIVRVPTEV  159

Query  1031  VKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMS  852
             VKQ+MQ    + +  +A+  II + G   +YAG+G+ L R++P   ++F  YE L+    
Sbjct  160   VKQRMQT-GQFASAPDAVRLIIAKEGFGGMYAGFGSFLLRDLPFDALQFCVYEQLRIGYK  218

Query  851   SSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIG  672
              + + D+  N     + G +AG+   + TTP DV+KTRL  Q  G NQY GV   +K I 
Sbjct  219   LAARRDL--NDPENAMLGAVAGAVTGILTTPLDVIKTRLMVQGAG-NQYKGVSDCVKTIL  275

Query  671   KSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHH  519
             + EG   L++G+ PR++     G++FF   E  K++ S      S+Q+ H 
Sbjct  276   REEGSSALWKGMGPRVLWIGIGGSIFFGVLEKTKQILS----DQSSQKIHK  322



>ref|XP_009114760.1| PREDICTED: probable S-adenosylmethionine carrier 2, chloroplastic 
[Brassica rapa]
Length=363

 Score =   157 bits (396),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 106/310 (34%), Positives = 157/310 (51%), Gaps = 21/310 (7%)
 Frame = -3

Query  1445  ECNSESEISVVAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKP  1269
             + NS   I V   + PCH L    E   AG +AG+ V   L+P+DTIKT +Q  R   K 
Sbjct  73    QINSCGTICVKQDDDPCHLLRLLYESLIAGGLAGLVVEAALYPIDTIKTRVQVARDGGKI  132

Query  1268  FYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHC  1089
              +             GLY G+  N+A   P SAL+   YE  K  LL  L   + +VAH 
Sbjct  133   IWK------------GLYSGLGGNLAGVLPASALFFGVYEPTKQKLLKVLPENFSAVAHL  180

Query  1088  VAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRN  909
              AG      +S +  P+E VKQ+MQ    + +  +A+  II + G   +YAG+G+ L R+
Sbjct  181   AAGALGGAVSSIVRVPTEVVKQRMQT-GQFASAPDAVRLIIAKEGFGGMYAGFGSFLLRD  239

Query  908   VPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQT  729
             +P   ++F  YE L+     + + D+  N     + G +AG+   + TTP DV+KTRL  
Sbjct  240   LPFDALQFCVYEQLRIGYKLAARRDL--NDPENAMLGAVAGAVTGILTTPLDVIKTRLMV  297

Query  728   QVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDL  549
             Q  G NQY GV   +K I + EG   L++G+ PR++     G++FF   E  K++ S   
Sbjct  298   QGAG-NQYKGVSDCVKTILREEGSSALWKGMGPRVLWIGIGGSIFFGVLEKTKQILS---  353

Query  548   HQSSAQRTHH  519
                S+Q+ H 
Sbjct  354   -DQSSQKIHK  362



>emb|CDY15312.1| BnaC06g07980D [Brassica napus]
Length=318

 Score =   154 bits (389),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/303 (35%), Positives = 155/303 (51%), Gaps = 21/303 (7%)
 Frame = -3

Query  1424  ISVVAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRS  1248
             I V   + PCH L    E   AG +AG+ V   L+P+DTIKT +Q  R   K  +     
Sbjct  35    ICVKQDDDPCHFLRLLYECLVAGGLAGLVVEAALYPIDTIKTRVQVARDGGKIIWK----  90

Query  1247  VISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCAS  1068
                     GLY G+  N+A   P SAL+   YE  K  LL  L  ++ +VAH  AG    
Sbjct  91    --------GLYSGLGGNLAGVLPASALFFGVYEPTKQKLLKVLPEKFSAVAHLAAGALGG  142

Query  1067  VATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIK  888
               +S +  P+E VKQ+MQ    + +  +A+  II + G   +YAG+G+ L R++P   ++
Sbjct  143   AVSSIVRVPTEVVKQRMQT-GQFASAPDAVRLIIAKEGFGGMYAGFGSFLLRDLPFDALQ  201

Query  887   FYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQ  708
             F  YE L+     + + D+  N     + G +AG+   + TTP DV+KTRL  Q  G NQ
Sbjct  202   FCVYEQLRIGYKLAARRDL--NDPENAMLGAVAGAVTRVLTTPLDVIKTRLMVQGAG-NQ  258

Query  707   YDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQR  528
             Y GV   LK I + EG   L++G+ PR++     G++FF   E  K++ S      S+Q+
Sbjct  259   YKGVSDCLKTILREEGSSALWKGMGPRVLWIGIGGSIFFGVLEKTKQILS----DQSSQK  314

Query  527   THH  519
              H 
Sbjct  315   IHK  317



>gb|KDP35277.1| hypothetical protein JCGZ_09436 [Jatropha curcas]
Length=325

 Score =   153 bits (387),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 146/285 (51%), Gaps = 17/285 (6%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+           G+ ++   
Sbjct  44    EEKPFDFLRTLFEGVIAGGAAGVVVETALYPIDTIKTRLQAAHGG-------GKIILK--  94

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
                GLY G++ NIA   P SAL+   YE  K  LL  L     +VAH  AG    VA S 
Sbjct  95    ---GLYSGLAGNIAGVLPASALFVGVYEPTKQKLLRMLPENLSAVAHLTAGAVGGVAASL  151

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             I  P+E VKQ+MQ    + +  NA+  II R G   LYAG+G+ L R++P   ++F  YE
Sbjct  152   IRVPTEVVKQRMQT-GQFTSAPNAVRLIISREGFKGLYAGYGSFLLRDLPFDAVQFCIYE  210

Query  872   SLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVL  693
              L+     + Q ++  N     + G  AG+     TTP DV+KTRL  Q   +NQY G+ 
Sbjct  211   QLRIGYKVAAQREL--NDPENAIIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYKGIF  267

Query  692   HTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               ++ + + EG   L +GL PR++     G++FF   ES KR  S
Sbjct  268   DCVQTVVREEGPNALLKGLGPRVLWIGIGGSIFFGVLESTKRFLS  312



>ref|XP_009792044.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X2 [Nicotiana sylvestris]
Length=318

 Score =   152 bits (384),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 151/294 (51%), Gaps = 19/294 (6%)
 Frame = -3

Query  1409  KEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERG  1230
             +EKP   L   +   AG  AG+ V   L+P+DTIKT +Q+ R               +  
Sbjct  42    EEKPFDFL---QGVIAGGTAGVVVETVLYPIDTIKTRLQAARGG------------GQIA  86

Query  1229  VLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFI  1050
             + GLY G++ N+A   P SA++   YE  K  LL  L     +VAH  AG    +A SF+
Sbjct  87    LKGLYSGLAGNLAGVLPASAIFVGVYEPAKQKLLKMLPENLSAVAHLTAGALGGIAASFV  146

Query  1049  FTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYES  870
               P+E +KQ+MQ R  + +  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE 
Sbjct  147   RVPTEVIKQRMQTR-QFASAPDAVRLIVSKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQ  205

Query  869   LKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLH  690
             L+     + + D+  N     V G  AG+     TTP DV+KTRL  Q   +NQY G++ 
Sbjct  206   LRIGYKLAAKRDL--NDPENAVIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYKGIVD  262

Query  689   TLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQR  528
              ++ I   EG   L +G+ PR++     G++FF   E  KR  + +   ++A +
Sbjct  263   CVRTIVAEEGAPALLKGIGPRVLWIGIGGSIFFGVLERTKRYLAQNRPDNAASK  316



>ref|XP_009792043.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X1 [Nicotiana sylvestris]
Length=322

 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/295 (34%), Positives = 151/295 (51%), Gaps = 17/295 (6%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R               + 
Sbjct  42    EEKPFDFLRILFEGVIAGGTAGVVVETVLYPIDTIKTRLQAARGG------------GQI  89

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
              + GLY G++ N+A   P SA++   YE  K  LL  L     +VAH  AG    +A SF
Sbjct  90    ALKGLYSGLAGNLAGVLPASAIFVGVYEPAKQKLLKMLPENLSAVAHLTAGALGGIAASF  149

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             +  P+E +KQ+MQ R  + +  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE
Sbjct  150   VRVPTEVIKQRMQTR-QFASAPDAVRLIVSKEGFKGLYAGYGSFLLRDLPFDAIQFCIYE  208

Query  872   SLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVL  693
              L+     + + D+  N     V G  AG+     TTP DV+KTRL  Q   +NQY G++
Sbjct  209   QLRIGYKLAAKRDL--NDPENAVIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYKGIV  265

Query  692   HTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQR  528
               ++ I   EG   L +G+ PR++     G++FF   E  KR  + +   ++A +
Sbjct  266   DCVRTIVAEEGAPALLKGIGPRVLWIGIGGSIFFGVLERTKRYLAQNRPDNAASK  320



>ref|XP_008678917.1| PREDICTED: uncharacterized protein LOC103653882 isoform X5 [Zea 
mays]
Length=526

 Score =   155 bits (392),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A+    HA AGA+AG  VS+ LHP+DT+KT+IQ+    Q   Y+  R  + ERGVLGLY 
Sbjct  350   AVTINRHAVAGALAGTAVSVSLHPIDTVKTIIQANSYGQSSVYHTLRRTLIERGVLGLYG  409

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G++S +A SAPISA+YT TYE+VKGALLP    EY S+AHC AGGC+S+ATSF+FTPSE 
Sbjct  410   GLASKLACSAPISAIYTLTYETVKGALLPVFPKEYHSIAHCAAGGCSSIATSFVFTPSEC  469

Query  1031  VKQQMQVRSHYKNC  990
             +KQQMQV SHY+NC
Sbjct  470   IKQQMQVGSHYQNC  483



>ref|XP_003630125.1| S-adenosylmethionine mitochondrial carrier protein [Medicago 
truncatula]
 gb|AET04601.1| S-adenosylmethionine carrier protein [Medicago truncatula]
Length=324

 Score =   151 bits (381),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 102/297 (34%), Positives = 152/297 (51%), Gaps = 22/297 (7%)
 Frame = -3

Query  1439  NSESEISVVAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
             NS + +SV  +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R  +K   
Sbjct  29    NSFASVSV-GQEKPFDFLRTLFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGEKLL-  86

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
                        + GLY G++ N+A   P SAL+   YE  K  LL        + AH  A
Sbjct  87    -----------LKGLYSGLAGNLAGVLPASALFVGVYEPAKQKLLRMFPENLSAFAHLTA  135

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             G    +A SF+  P+E VKQ+MQ    + +  NA+  I  R G    YAG+G+ L R++P
Sbjct  136   GAIGGIAASFVRVPTEVVKQRMQT-GQFTSASNAVRFIASREGFKGFYAGYGSFLLRDLP  194

Query  902   HSIIKFYTYESLKQ--LMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQT  729
                I+F  YE ++   ++++    +   N ++    G  AG+     TTP DV+KTRL  
Sbjct  195   FDAIQFCLYEQIRLGYMLAARRNLNDPENAII----GAFAGALTGAITTPLDVIKTRLMV  250

Query  728   QVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             Q P +NQY G++  ++ I K EG     +G+ PR++     G++FF   ES KR  +
Sbjct  251   QGP-ANQYKGIVDCVQTIIKEEGPGAFLKGIGPRVLWIGIGGSIFFGVLESTKRFLA  306



>gb|ADE77358.1| unknown [Picea sitchensis]
Length=326

 Score =   151 bits (381),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/284 (35%), Positives = 152/284 (54%), Gaps = 22/284 (8%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E A AGA AG+ V   L+P+DTIKT +Q+ R       + G+ ++      GLY G++ N
Sbjct  55    EGAVAGATAGVVVETVLYPIDTIKTRLQAAR-------FGGKILLK-----GLYSGLAGN  102

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE VK  LL  L   Y ++AH +AG       S +  P+E VKQ+M
Sbjct  103   LAGVLPASAIFVGVYEPVKKKLLEILPDNYNAIAHLLAGTAGGATASLVRVPTEVVKQRM  162

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK---QLMSSS  846
             Q    + N  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE L+   +L++  
Sbjct  163   QT-GQFANAPDAVRCIVAKEGARGLYAGYGSFLLRDLPFDAIQFCIYEQLRIGYKLVAKR  221

Query  845   VQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKS  666
               +D +N      + G  AG+     TTP DV+KTRL  Q   S QY GV   +++I + 
Sbjct  222   DLYDPENA-----LIGAFAGAVTGAITTPLDVIKTRLMVQ-GTSKQYKGVFDCVQKIVRE  275

Query  665   EGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSA  534
             EG   L +G+ PR++     G++FF   E  K++     H++ +
Sbjct  276   EGASTLTKGIGPRVLWIGIGGSIFFGVLERTKKILLDRRHENKS  319



>ref|XP_008456740.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Cucumis melo]
 ref|XP_008456742.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Cucumis melo]
Length=312

 Score =   150 bits (380),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/278 (36%), Positives = 145/278 (52%), Gaps = 18/278 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E A AG++A   +   L+P+DTIKT +Q+           G+ V+      GLY G++ N
Sbjct  42    EGAIAGSVASFVIEAALYPIDTIKTRLQAVHGG-------GKIVLK-----GLYSGLTGN  89

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +    P +A++   YE  K  LL  L     ++AH  AG    VA+S I  P+E VKQ+M
Sbjct  90    LVGMLPATAIFVGVYEPTKQTLLNSLPENLNALAHLTAGVVGGVASSIIRVPTEVVKQRM  149

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q  SH+ +  NA+  I+ R G   LYAG+G+ L R++P   I+F  YE L+     + Q 
Sbjct  150   QT-SHFASASNAVQAIVSREGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRIGYKLAAQR  208

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSN-QYDGVLHTLKEIGKSEG  660
             D   N     + G  +G+     TTPFDV+KTRL  Q  GSN QY G+    + I K EG
Sbjct  209   D--PNDPENALIGAFSGAVTGAITTPFDVIKTRLMVQ--GSNSQYQGIRDCCRTIMKEEG  264

Query  659   LKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLH  546
              +   +G+ PR++     GA+FF   E  K++ +   H
Sbjct  265   ARAFLKGMGPRVLWIGLGGAIFFGVLEKTKQMLANQRH  302



>ref|XP_002893808.1| At1g34065 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70067.1| At1g34065 [Arabidopsis lyrata subsp. lyrata]
Length=321

 Score =   150 bits (380),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 99/300 (33%), Positives = 151/300 (50%), Gaps = 22/300 (7%)
 Frame = -3

Query  1415  VAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             V ++ PCH L    E    G +AG+ V   L+P+DTIKT +Q  R   K  +        
Sbjct  42    VKQDDPCHFLRVLYESLITGGLAGVVVEAALYPIDTIKTRVQVARDGGKIIWK-------  94

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
                  GLY G+  N+    P SAL+   YE  K  LL  L     +VAH  AG      +
Sbjct  95    -----GLYSGLGGNLVGVLPASALFFGVYEPTKQKLLKVLPENLSAVAHLAAGALGGAVS  149

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             S +  P+E VKQ+MQ    + +  +A+  II + G   +YAG+G+ L R++P   ++F  
Sbjct  150   SIVRVPTEVVKQRMQT-GQFASAPDAVRLIIAKEGFGGMYAGYGSFLLRDLPFDALQFCV  208

Query  878   YESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDG  699
             YE L+     + + D+  N     + G  AG+   + TTP DV+KTRL  Q  G+ QY G
Sbjct  209   YEQLRIGYKLAARRDL--NDPENAMIGAFAGAVTGVLTTPLDVIKTRLMVQGAGT-QYKG  265

Query  698   VLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHH  519
             V   +K I + EG   L++G+ PR++     G++FF   E  K++ S       +Q++H+
Sbjct  266   VSDCIKTIIREEGSSALWKGMGPRVLWIGIGGSIFFGVLEKTKQILS-----ERSQKSHN  320



>ref|XP_009595343.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X2 [Nicotiana tomentosiformis]
Length=318

 Score =   150 bits (379),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 97/281 (35%), Positives = 145/281 (52%), Gaps = 19/281 (7%)
 Frame = -3

Query  1409  KEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERG  1230
             +EKP   L   +   AG  AG+ V   L+P+DTIKT +Q+ R               +  
Sbjct  42    EEKPFDFL---QGVIAGGTAGVVVETALYPIDTIKTRLQAARGG------------GQIA  86

Query  1229  VLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFI  1050
             + GLY G++ N+A   P SA++   YE  K  LL  L     +VAH  AG    +A SF+
Sbjct  87    LKGLYSGLAGNLAGVLPASAIFVGVYEPAKQKLLKMLPENLSAVAHLTAGALGGIAASFV  146

Query  1049  FTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYES  870
               P+E +KQ+MQ R  + +  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE 
Sbjct  147   RVPTEVIKQRMQTR-QFASAPDAVRLIVSKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQ  205

Query  869   LKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLH  690
             L+     + + D+  N     V G  AG+     TTP DV+KTRL  Q   +NQY G++ 
Sbjct  206   LRIGYKLAAKRDL--NDPENAVIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYKGIVD  262

Query  689   TLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKR  567
              ++ I   EG   L +G+ PR++     G++FF   E  KR
Sbjct  263   CVRIIVAEEGAPALLKGIGPRVLWIGIGGSIFFGVLERTKR  303



>emb|CAF04055.2| S-adenosylmethionine transporter [Nicotiana benthamiana]
Length=326

 Score =   150 bits (379),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 99/295 (34%), Positives = 151/295 (51%), Gaps = 17/295 (6%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R               + 
Sbjct  46    EEKPFDFLRILFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGG------------GQI  93

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
              + GLY G++ N+A   P SA++   YE  K  LL  L     +VAH  AG    +A SF
Sbjct  94    ALKGLYSGLAGNLAGVLPASAIFVGVYEPAKQKLLKMLPENLSAVAHLTAGALGGLAASF  153

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             +  P+E +KQ+MQ R  + +  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE
Sbjct  154   VRVPTEVIKQRMQTR-QFASAPDAVRLIVSKEGFKGLYAGYGSFLLRDLPFDAIQFCIYE  212

Query  872   SLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVL  693
              L+     + + D+  N     V G  AG+     TTP DV+KTRL  Q   +NQY G++
Sbjct  213   QLRIGYKLAAKRDL--NDPENAVIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYKGII  269

Query  692   HTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQR  528
               ++ I   EG   L +G+ PR++     G++FF   E  KR  + +   ++A +
Sbjct  270   DCVRTIVTEEGAPALLKGIGPRVLWIGIGGSIFFGVLERTKRYLAQNRPDNAASK  324



>gb|AAY34159.1| At1g34065 [Arabidopsis thaliana]
 emb|CAJ91124.1| S-adenosylmethionine carrier [Arabidopsis thaliana]
Length=321

 Score =   150 bits (379),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 151/300 (50%), Gaps = 22/300 (7%)
 Frame = -3

Query  1415  VAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             V ++ PCH L    E    G +AG+ V   L+P+DTIKT IQ  R   K  +        
Sbjct  42    VKQDDPCHFLRVLYESLITGGLAGVVVEAALYPIDTIKTRIQVARDGGKIIWK-------  94

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
                  GLY G+  N+    P SAL+   YE  K  LL  L     +VAH  AG      +
Sbjct  95    -----GLYSGLGGNLVGVLPASALFFGVYEPTKQKLLKVLPDNLSAVAHLAAGALGGAVS  149

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             S +  P+E VKQ+MQ    + +  +A+  II + G   +YAG+G+ L R++P   ++F  
Sbjct  150   SIVRVPTEVVKQRMQT-GQFVSAPDAVRLIIAKEGFGGMYAGYGSFLLRDLPFDALQFCV  208

Query  878   YESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDG  699
             YE L+     + + D+  N     + G  AG+   + TTP DV+KTRL  Q  G+ QY G
Sbjct  209   YEQLRIGYKLAARRDL--NDPENAMIGAFAGAVTGVLTTPLDVIKTRLMVQGSGT-QYKG  265

Query  698   VLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHH  519
             V   +K I + EG   L++G+ PR++     G++FF   E  K++ S       +Q++H+
Sbjct  266   VSDCIKTIIREEGSSALWKGMGPRVLWIGIGGSIFFGVLEKTKQILS-----ERSQKSHN  320



>ref|XP_009595342.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X1 [Nicotiana tomentosiformis]
Length=322

 Score =   149 bits (377),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 98/282 (35%), Positives = 145/282 (51%), Gaps = 17/282 (6%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R               + 
Sbjct  42    EEKPFDFLRILFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGG------------GQI  89

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
              + GLY G++ N+A   P SA++   YE  K  LL  L     +VAH  AG    +A SF
Sbjct  90    ALKGLYSGLAGNLAGVLPASAIFVGVYEPAKQKLLKMLPENLSAVAHLTAGALGGIAASF  149

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             +  P+E +KQ+MQ R  + +  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE
Sbjct  150   VRVPTEVIKQRMQTR-QFASAPDAVRLIVSKEGFKGLYAGYGSFLLRDLPFDAIQFCIYE  208

Query  872   SLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVL  693
              L+     + + D+  N     V G  AG+     TTP DV+KTRL  Q   +NQY G++
Sbjct  209   QLRIGYKLAAKRDL--NDPENAVIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYKGIV  265

Query  692   HTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKR  567
               ++ I   EG   L +G+ PR++     G++FF   E  KR
Sbjct  266   DCVRIIVAEEGAPALLKGIGPRVLWIGIGGSIFFGVLERTKR  307



>ref|NP_564436.4| S-adenosylmethionine carrier 2 [Arabidopsis thaliana]
 sp|F4HT41.1|SAMC2_ARATH RecName: Full=Probable S-adenosylmethionine carrier 2, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE31668.1| S-adenosylmethionine carrier 2 [Arabidopsis thaliana]
Length=345

 Score =   150 bits (378),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 151/300 (50%), Gaps = 22/300 (7%)
 Frame = -3

Query  1415  VAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             V ++ PCH L    E    G +AG+ V   L+P+DTIKT IQ  R   K  +        
Sbjct  66    VKQDDPCHFLRVLYESLITGGLAGVVVEAALYPIDTIKTRIQVARDGGKIIWK-------  118

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
                  GLY G+  N+    P SAL+   YE  K  LL  L     +VAH  AG      +
Sbjct  119   -----GLYSGLGGNLVGVLPASALFFGVYEPTKQKLLKVLPDNLSAVAHLAAGALGGAVS  173

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             S +  P+E VKQ+MQ    + +  +A+  II + G   +YAG+G+ L R++P   ++F  
Sbjct  174   SIVRVPTEVVKQRMQT-GQFVSAPDAVRLIIAKEGFGGMYAGYGSFLLRDLPFDALQFCV  232

Query  878   YESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDG  699
             YE L+     + + D+  N     + G  AG+   + TTP DV+KTRL  Q  G+ QY G
Sbjct  233   YEQLRIGYKLAARRDL--NDPENAMIGAFAGAVTGVLTTPLDVIKTRLMVQGSGT-QYKG  289

Query  698   VLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHH  519
             V   +K I + EG   L++G+ PR++     G++FF   E  K++ S       +Q++H+
Sbjct  290   VSDCIKTIIREEGSSALWKGMGPRVLWIGIGGSIFFGVLEKTKQILS-----ERSQKSHN  344



>ref|XP_004140954.1| PREDICTED: uncharacterized mitochondrial carrier C12B10.09-like 
[Cucumis sativus]
Length=313

 Score =   148 bits (373),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/274 (36%), Positives = 140/274 (51%), Gaps = 18/274 (7%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E A AG  A   V   L+P+DTIKT +Q+     K              + GLY G++ N
Sbjct  42    EGAIAGGAASFVVEAALYPIDTIKTRLQAVHGGGK------------VALKGLYSGLAGN  89

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +    P +A++   YE  K  LL  L     ++AH  AG    VA+S I  P+E VKQ+M
Sbjct  90    LVGMLPATAIFVGIYEPTKQTLLNSLPENLNALAHLTAGVVGGVASSIIRVPTEVVKQRM  149

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q  SH+ +  NA+  I+ R G   LYAG+G+ L R++P   I+F  YE L+     + Q 
Sbjct  150   QT-SHFASASNAVQVIVSREGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRIGYKLAAQR  208

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSN-QYDGVLHTLKEIGKSEG  660
             D   N     + G  +G+     TTPFDV+KTRL  Q  GSN QY G+    + I K EG
Sbjct  209   D--PNDPENAIIGAFSGAVTGAITTPFDVIKTRLMVQ--GSNGQYQGIRDCCRTIMKEEG  264

Query  659   LKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
              +   +G+ PR++     GA+FF   E  K++ +
Sbjct  265   ARAFLKGMGPRVLWIGLGGAIFFGVLEKTKQMLA  298



>ref|XP_004288103.1| PREDICTED: S-adenosylmethionine mitochondrial carrier protein-like 
[Fragaria vesca subsp. vesca]
Length=327

 Score =   148 bits (373),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 98/273 (36%), Positives = 140/273 (51%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+      GLY G++ N
Sbjct  58    EGVIAGGTAGVVVETALYPIDTIKTRLQAARGG-------GKIVLK-----GLYSGLAGN  105

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             IA   P SA++   YE  K  LL        ++AH  AG C  +A S I  P+E VKQ+M
Sbjct  106   IAGVLPASAIFVGVYEPTKQKLLKMFPENLSALAHFTAGACGGIAASLIRVPTEVVKQRM  165

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +   A+  I  + G   LYAG+G+ L R++P   I+F  YE L+  +   V  
Sbjct  166   QT-GQFTSASAAVRLIAAKEGFKGLYAGYGSFLLRDLPFDAIQFCLYEQLR--IGYKVAA  222

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
               + N     V G  AG+     TTP DV+KTRL  Q   +NQY G+L  ++ I + EG 
Sbjct  223   KRELNDPENAVIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYKGILDCVQTIVREEGP  281

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L +G+ PR++     G++FF   E  KRL +
Sbjct  282   PALLKGIGPRVLWIGIGGSIFFGVLERTKRLLA  314



>ref|XP_010499947.1| PREDICTED: probable S-adenosylmethionine carrier 2, chloroplastic 
[Camelina sativa]
 ref|XP_010499948.1| PREDICTED: probable S-adenosylmethionine carrier 2, chloroplastic 
[Camelina sativa]
 ref|XP_010499949.1| PREDICTED: probable S-adenosylmethionine carrier 2, chloroplastic 
[Camelina sativa]
Length=318

 Score =   147 bits (372),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 94/286 (33%), Positives = 146/286 (51%), Gaps = 21/286 (7%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E    G +AG+ V   L+P+DTIKT +Q+ R   K  +             GLY G+  N
Sbjct  53    ESLITGGLAGVVVEAALYPIDTIKTRVQAARDGGKIIWK------------GLYSGLGGN  100

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +    P SAL+   YE  K  LL  L   + +VAH  AG      +S +  P+E VKQ+M
Sbjct  101   LVGVLPASALFFGVYEPTKQKLLKVLPENFSAVAHLAAGALGGAVSSIVRVPTEVVKQRM  160

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  II + G   +YAG+G+ L R++P   ++F  YE L+     + + 
Sbjct  161   QT-GQFASARDAVRLIIAKEGFGGMYAGYGSFLLRDLPFDALQFCVYEQLRIGYKLAARR  219

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+  N     + G  AG+   + TTP DV+KTRL  Q  G+ QY GV   +K I + EG 
Sbjct  220   DL--NDPENAMLGAFAGAVTGVLTTPLDVIKTRLMVQGAGT-QYKGVADCVKTIIREEGP  276

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHH  519
               L++G+ PR++     G++FF   E  K++ S       +Q++H+
Sbjct  277   SALWKGMGPRVLWIGIGGSIFFGVLEKTKQILS-----ERSQKSHN  317



>emb|CAF25317.1| S-adenosylmethionine transporter [Capsicum annuum]
Length=326

 Score =   147 bits (372),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 104/299 (35%), Positives = 154/299 (52%), Gaps = 25/299 (8%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+   
Sbjct  46    EEKPFDFLRILFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGG-------GQIVLK--  96

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
                GLY G++ N+A   P SA++   YE  K  LL        +VAH  AG    +A SF
Sbjct  97    ---GLYSGLAGNLAGVLPASAIFVGVYEPAKQKLLKMFPENLSAVAHLSAGALGGIAASF  153

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             +  P+E +KQ+MQ R  + +  +A+  I+ + G   LYAG+ + L R++P   I+F  YE
Sbjct  154   VRVPTEVIKQRMQTR-QFASPPDAVRLIVSKEGFKGLYAGYRSFLLRDLPFDAIQFCIYE  212

Query  872   SLK---QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQY  705
              L+   +L +     D +N      V G  AG+     TTP DV+KTRL  Q  GS NQY
Sbjct  213   QLRIGYKLAAKRELNDPENA-----VIGAFAGALTGAITTPLDVIKTRLMIQ--GSANQY  265

Query  704   DGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQR  528
              G++  +K I   EG   L +G+ PR++     G++FF   E  KR  + +L  ++A +
Sbjct  266   KGIVDCVKTIVAEEGPPALLKGIGPRVLWIGIGGSIFFGVLERTKRFLAQNLPDNAASK  324



>ref|XP_007048160.1| S-adenosylmethionine carrier 1 [Theobroma cacao]
 gb|EOX92317.1| S-adenosylmethionine carrier 1 [Theobroma cacao]
Length=324

 Score =   147 bits (372),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 150/299 (50%), Gaps = 18/299 (6%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP + L    E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+   
Sbjct  43    EEKPFNFLRILFEGIIAGGTAGVVVETALYPIDTIKTRLQAARGG-------GKIVLK--  93

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
                GLY G++ N+A   P SAL+   YE  K  LL        + AH  AG    +A S 
Sbjct  94    ---GLYSGLAGNLAGVLPASALFVGVYEPTKQKLLKLFPENLSAFAHLTAGAVGGIAASL  150

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             I  P+E VKQ+MQ    + +  +A+  I  + G   LYAG+G+ L R+ P   I+F  YE
Sbjct  151   IRVPTEVVKQRMQT-GQFTSASDAVRLIASKEGFKGLYAGYGSFLLRDFPFDAIQFCIYE  209

Query  872   SLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVL  693
              L+    ++ + D+  N     + G  AG+     TTP DV+KTRL  Q  G NQY G+ 
Sbjct  210   QLRIGYKAAARRDL--NDPENAIIGAFAGALTGAITTPLDVIKTRLMVQGSG-NQYKGIF  266

Query  692   HTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHE  516
               ++ I + EG   L +G+ PR++     G++FF   ES KR F        +Q + H+
Sbjct  267   DCVQTIVREEGPPALLKGIGPRVLWIGIGGSIFFGVLESTKR-FLAQTRPPPSQHSKHD  324



>ref|XP_006367413.1| PREDICTED: S-adenosylmethionine mitochondrial carrier protein-like 
[Solanum tuberosum]
Length=326

 Score =   147 bits (372),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 102/286 (36%), Positives = 144/286 (50%), Gaps = 25/286 (9%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q  R               + 
Sbjct  46    EEKPFDFLRILFEGVIAGGTAGVVVETALYPIDTIKTRLQVARGG------------GQI  93

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
              + GLY G+  N+A   P SA++   YE  K  LL        +VAH  AG    +A SF
Sbjct  94    ALKGLYSGLLGNLAGVLPASAIFVGVYEPAKQKLLKMFPENLSAVAHLTAGALGGIAASF  153

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             +  P+E +KQ+MQ R  + +  +A+  I+ + G   LYAG+G  L R++P   I+F  YE
Sbjct  154   VRVPTEVIKQRMQTR-QFASAPDAVRLIVSKEGFKGLYAGYGPFLLRDLPFDAIQFCIYE  212

Query  872   SLK---QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQY  705
              L+   +L +     D +N      V G  AG+     TTP DV+KTRL TQ  GS NQY
Sbjct  213   QLRIGYKLAAKRELNDPENA-----VIGAFAGALTGAITTPLDVIKTRLMTQ--GSANQY  265

Query  704   DGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKR  567
              G++  +K I   EG   L +G+ PR++     G++FF   E  KR
Sbjct  266   KGIVDCVKTIVAEEGPPALLKGIGPRVLWIGIGGSIFFGVLERTKR  311



>ref|XP_004504005.1| PREDICTED: uncharacterized mitochondrial carrier C12B10.09-like 
[Cicer arietinum]
Length=327

 Score =   147 bits (371),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 103/314 (33%), Positives = 157/314 (50%), Gaps = 23/314 (7%)
 Frame = -3

Query  1448  IECNSESEISVVAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQK  1272
             ++ NS + +SV  ++ P   L    E   AG  AG+ V   L+P+DTIKT +Q+ R  +K
Sbjct  32    LQRNSFASVSV-GEQNPFDFLRTLFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGEK  90

Query  1271  PFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAH  1092
                           + GLY G++ N+    P SAL+   YE VK  LL        + AH
Sbjct  91    LL------------LKGLYSGLAGNLVGVLPASALFVGVYEPVKQKLLRMFPENLSAFAH  138

Query  1091  CVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCR  912
               AG    +A SF+  P+E VKQ+MQ    + +   A+  I  R G    YAG+G+ L R
Sbjct  139   LTAGAIGGIAASFVRVPTEVVKQRMQT-GQFTSASGAVRFIASREGFRGFYAGYGSFLLR  197

Query  911   NVPHSIIKFYTYESLKQ--LMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
             ++P   I+F  YE ++   ++++    +   N ++    G  AG+     TTP DV+KTR
Sbjct  198   DLPFDAIQFCIYEQIRMGYMLAARRNLNDPENAII----GAFAGALTGAITTPLDVIKTR  253

Query  737   LQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             L  Q P +NQY G+   ++ I K EG   L +G+ PR++     G++FF   ES KR  +
Sbjct  254   LMIQGP-ANQYKGIADCVQTIIKEEGPGALLKGVGPRVLWIGIGGSIFFGVLESTKRALA  312

Query  557   LDLHQSSAQRTHHE  516
              +      Q T+ E
Sbjct  313   -ERRPKLVQSTNSE  325


 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 54/208 (26%), Positives = 84/208 (40%), Gaps = 34/208 (16%)
 Frame = -3

Query  1124  FLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGG---  954
             FL T ++ V   +AGG A V       P + +K ++Q                 RGG   
Sbjct  50    FLRTLFEGV---IAGGTAGVVVETALYPIDTIKTRLQAA---------------RGGEKL  91

Query  953   -LPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTA  777
              L  LY+G    L   +P S +    YE +KQ +     F    +    L  G + G  A
Sbjct  92    LLKGLYSGLAGNLVGVLPASALFVGVYEPVKQKLLR--MFPENLSAFAHLTAGAIGGIAA  149

Query  776   ALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGAL  597
             +    P +VVK R+QT      Q+      ++ I   EG +G Y G    L+  +   A+
Sbjct  150   SFVRVPTEVVKQRMQT-----GQFTSASGAVRFIASREGFRGFYAGYGSFLLRDLPFDAI  204

Query  596   FFASYESFKRLFSLDLHQSSAQRTHHEP  513
              F  YE  +  + L     +A+R  ++P
Sbjct  205   QFCIYEQIRMGYML-----AARRNLNDP  227



>gb|AFK45388.1| unknown [Lotus japonicus]
Length=313

 Score =   147 bits (370),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 99/283 (35%), Positives = 150/283 (53%), Gaps = 22/283 (8%)
 Frame = -3

Query  1367  FAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnias  1188
              AG +AG+ V   L+P+DTIKT +Q  R         G  +I +    GLY G++ N+  
Sbjct  50    IAGGIAGVAVEAALYPIDTIKTRLQVARG--------GGEIILK----GLYSGLAGNLVG  97

Query  1187  sapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVR  1008
               P SA++   YE  K  LL  L     +VAH  AG     A+S I  P+E VKQ+MQ  
Sbjct  98    VLPASAIFIGVYEPAKQKLLKSLPENLSAVAHIAAGVIGGTASSLIRVPTEVVKQRMQTE  157

Query  1007  SHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQ  828
               +K+   A+  II   G   L+AG+G+ L R++P   I+   YE L+    ++ + D++
Sbjct  158   -QFKSAPAAVRLIIANEGFRGLFAGYGSFLLRDLPFDAIELCIYEQLRIGYKAAAKRDLK  216

Query  827   N--NTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGL  657
             +  N ++  V G + G+     TTP DVVKTRL  Q  GS N Y G+   ++ I K EG 
Sbjct  217   DPENAMLGAVAGAITGAV----TTPLDVVKTRLMVQ--GSQNHYKGISDCVRTIIKEEGA  270

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQR  528
               L++G+ PR++     G++FF   E  K++ +   HQ+ AQ+
Sbjct  271   HALFKGIGPRVLWIGVGGSIFFGVLEKTKQILAQKHHQADAQK  313



>gb|EYU31105.1| hypothetical protein MIMGU_mgv1a010029mg [Erythranthe guttata]
 gb|EYU31106.1| hypothetical protein MIMGU_mgv1a010029mg [Erythranthe guttata]
Length=324

 Score =   146 bits (369),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/273 (35%), Positives = 139/273 (51%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R   K                GLY G++ N
Sbjct  55    EGVIAGGTAGVVVETALYPIDTIKTRLQAARGGGKILLK------------GLYSGLAGN  102

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +    P SA++   YE  K  LL  L     +VAH  AG    +A S I  P+E VKQ+M
Sbjct  103   LVGVLPASAVFVGVYEPAKQKLLRALPENLSAVAHLTAGALGGLAASCIRVPTEVVKQRM  162

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  I+ + G   LYAG+G+ L R++P   ++F  YE L+     + + 
Sbjct  163   QT-GQFTSAPDAVRLIVSKEGFKGLYAGYGSFLLRDLPFDALQFCIYEQLRLGYKMAAKR  221

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+  N   T + G  AG+     TTP DV+KTRL  Q   +NQY G+   ++ I + EG 
Sbjct  222   DL--NAPETAIVGAFAGALTGAVTTPLDVIKTRLMVQ-GSANQYKGIFDCVQTIVREEGS  278

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L +G+ PR++     G++FF   ES KR  S
Sbjct  279   NALLKGIGPRVLWIGIGGSIFFGVLESTKRFLS  311



>ref|XP_002969176.1| hypothetical protein SELMODRAFT_146160 [Selaginella moellendorffii]
 gb|EFJ30292.1| hypothetical protein SELMODRAFT_146160 [Selaginella moellendorffii]
Length=310

 Score =   146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 99/284 (35%), Positives = 146/284 (51%), Gaps = 17/284 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E A AGA AG+ V   L+P+DTIKT +Q+ R         G+ V+      GLY G++ N
Sbjct  32    EGAIAGATAGVVVETVLYPIDTIKTRLQAARTS-------GKIVLK-----GLYSGLAGN  79

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +    P SA++   YE VK  L   L     S+AH  AG    +A S +  P+E VKQ+M
Sbjct  80    LLGVLPASAIFVGVYEPVKRKLEECLPDHLSSIAHLTAGATGGLAASLVRVPTEVVKQRM  139

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q R  +     A+  I+   G   LYAG+G+ L R++P   I+F  YE LK       + 
Sbjct  140   QTR-EFPRAHIAVRSIVSNEGFRGLYAGFGSFLLRDLPFDAIQFCIYEQLKIGYKKMARR  198

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+ ++   T + G  AG+     TTP DV+KTRL  Q   SN Y G++  +++I + EG 
Sbjct  199   DLYDSE--TALVGAFAGALTGALTTPLDVIKTRLMIQ-GKSNAYKGIVDCVQKIVQEEGA  255

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRT  525
               L +G+ PR++     G++FF   E  K++     HQ    +T
Sbjct  256   GALTKGIGPRVMWIGIGGSIFFGVLEKTKQVLEQS-HQKKVIKT  298



>emb|CDP17607.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/273 (35%), Positives = 145/273 (53%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E A AGA AG+ V   L+P+DTIKT +Q+           G  +I    + GLY G++ N
Sbjct  46    EGAVAGATAGVVVESVLYPIDTIKTRLQAVHG--------GGKII----LRGLYSGLAGN  93

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +    P SA++   YE  K  LL        ++A+  AG    VA+S +  P+E VKQ+M
Sbjct  94    LVGVLPASAIFVGVYEPTKQMLLKSFPESLSALAYLTAGAVGGVASSIVRVPTEVVKQRM  153

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  NA+  I+ + G   LYAG+G+ L R++P   ++F  YE L+     + + 
Sbjct  154   QT-GQFSSAPNAVHCIVAKEGFRGLYAGFGSFLLRDLPFDAVQFCIYEQLRIGYKLAARR  212

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+  N   T + G  AG+     TTP DV+KTRL  Q   + QY+G+LH +  I + EG 
Sbjct  213   DL--NDPETAMIGAFAGAITGAITTPLDVIKTRLMVQ-GSAKQYEGILHCVGTIVREEGT  269

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L++G+ PR++     G++FF   E  K+L S
Sbjct  270   SSLFKGIGPRVLWIGIGGSIFFGVLERTKKLLS  302



>gb|EAZ39471.1| hypothetical protein OsJ_23900 [Oryza sativa Japonica Group]
Length=277

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/274 (34%), Positives = 141/274 (51%), Gaps = 16/274 (6%)
 Frame = -3

Query  1379  QEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGiss  1200
             +E   AG  AG+ V   L+P+DTIKT +Q+ +   K  +             GLY G+  
Sbjct  10    REGVIAGGAAGVVVETALYPIDTIKTRLQAAKGGSKIQWK------------GLYAGLGG  57

Query  1199  niassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQ  1020
             NIA   P SA++   YE  K  LL        +VAH  AG     A+S I  P+E VKQ+
Sbjct  58    NIAGVLPASAIFIGVYEPTKRKLLEMFPENLSAVAHLTAGAIGGAASSLIRVPTEVVKQR  117

Query  1019  MQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQ  840
             MQ+ S +K   +A+  IIR+ G   LYAG+G+ L R++P   I+F  YE L+     + +
Sbjct  118   MQM-SQFKTAPDAVRLIIRKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRIGYKLAAK  176

Query  839   FDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEG  660
              D+++      + G  AG+     TTP DV+KTRL  Q   +NQY G++   + I + EG
Sbjct  177   RDLKDGE--NALIGAFAGAITGAITTPLDVLKTRLMVQ-GQANQYRGIISCAQTILREEG  233

Query  659   LKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
                  +G+ PR++     G++FF   E  K + +
Sbjct  234   AGAFLKGIEPRVLWIGIGGSIFFGVLEKTKSILA  267



>ref|XP_010319792.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Solanum lycopersicum]
 ref|XP_010319793.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Solanum lycopersicum]
Length=326

 Score =   146 bits (368),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/285 (35%), Positives = 143/285 (50%), Gaps = 23/285 (8%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q  R               + 
Sbjct  46    EEKPFDFLRILFEGVIAGGTAGVVVETALYPIDTIKTRLQVARGG------------GQI  93

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
              + GLY G+  N+A   P SA++   YE  K  LL        +VAH  AG    +A SF
Sbjct  94    ALKGLYSGLLGNLAGVLPASAIFVGVYEPAKQKLLKMFPENLSAVAHLTAGALGGIAASF  153

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             +  P+E +KQ+MQ R  + +  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE
Sbjct  154   VRVPTEVIKQRMQTR-QFASAPDAVRLIVSKEGFKGLYAGYGSFLLRDLPFDAIQFCIYE  212

Query  872   SLK---QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYD  702
              L+   +L +     D +N      V G  AG+     TTP DV+KTRL TQ   +NQY 
Sbjct  213   QLRIGYKLAAKRELNDPENA-----VIGAFAGALTGAITTPLDVIKTRLMTQ-GSANQYK  266

Query  701   GVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKR  567
              ++  +K I   EG   L +G+ PR++     G++FF   E  KR
Sbjct  267   SIVDCVKTIVAEEGPPALLKGIGPRVLWIGIGGSIFFGVLERTKR  311



>ref|XP_006654303.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Oryza brachyantha]
Length=287

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 155/309 (50%), Gaps = 30/309 (10%)
 Frame = -3

Query  1412  AKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISE  1236
             A+EKP + L    E   AG  AG+ V   L+P+DTIKT +Q+ R         G S I  
Sbjct  5     AEEKPFNFLQILCEGVIAGGTAGVVVETALYPIDTIKTRLQAAR---------GGSQIQW  55

Query  1235  RGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATS  1056
             +G   LY G++ NIA   P SA++   YE  K  LL        +VAH  AG    +A S
Sbjct  56    KG---LYSGLAGNIAGVLPASAVFVGIYEPTKRKLLETFPENLSAVAHFTAGAIGGIAAS  112

Query  1055  FIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTY  876
              I  P+E VKQ+MQ    +++  +A+  I+ + G   LYAG+G+ L R++P   I+F  Y
Sbjct  113   LIRVPTEVVKQRMQT-GQFRSAPDAVRLIVGKEGFKGLYAGYGSFLLRDLPFDAIQFCIY  171

Query  875   ESLK---QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQY  705
             E L+   +LM+     D +N      + G  AG+     TTP DV+KTRL  Q   +NQY
Sbjct  172   EQLRIGYKLMAKRELNDPENA-----LIGAFAGAITGAITTPLDVMKTRLMVQ-GSANQY  225

Query  704   DGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRT  525
              G++   + I + EG     +G+ PR++     G++FF   E  K L        + +R+
Sbjct  226   SGIVSCAQTILREEGPGAFLKGIEPRVLWIGIGGSIFFGVLEKTKSLL-------AERRS  278

Query  524   HHEPCFGDD  498
                P   DD
Sbjct  279   REPPTVKDD  287



>ref|NP_001059405.1| Os07g0295000 [Oryza sativa Japonica Group]
 dbj|BAC84529.1| mitochondrial aspartate-glutamate carrier protein-like [Oryza 
sativa Japonica Group]
 dbj|BAF21319.1| Os07g0295000 [Oryza sativa Japonica Group]
 dbj|BAG92726.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94047.1| unnamed protein product [Oryza sativa Japonica Group]
Length=284

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/273 (34%), Positives = 140/273 (51%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ +   K  +             GLY G+  N
Sbjct  18    EGVIAGGAAGVVVETALYPIDTIKTRLQAAKGGSKIQWK------------GLYAGLGGN  65

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             IA   P SA++   YE  K  LL        +VAH  AG     A+S I  P+E VKQ+M
Sbjct  66    IAGVLPASAIFIGVYEPTKRKLLEMFPENLSAVAHLTAGAIGGAASSLIRVPTEVVKQRM  125

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q+ S +K   +A+  IIR+ G   LYAG+G+ L R++P   I+F  YE L+     + + 
Sbjct  126   QM-SQFKTAPDAVRLIIRKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRIGYKLAAKR  184

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+++      + G  AG+     TTP DV+KTRL  Q   +NQY G++   + I + EG 
Sbjct  185   DLKDGE--NALIGAFAGAITGAITTPLDVLKTRLMVQGQ-ANQYRGIISCAQTILREEGA  241

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
                 +G+ PR++     G++FF   E  K + +
Sbjct  242   GAFLKGIEPRVLWIGIGGSIFFGVLEKTKSILA  274



>ref|XP_004148454.1| PREDICTED: uncharacterized mitochondrial carrier C12B10.09-like 
[Cucumis sativus]
Length=306

 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 147/288 (51%), Gaps = 23/288 (8%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+   
Sbjct  25    EEKPFDFLRTVFEGVIAGGTAGVVVETALYPIDTIKTRLQAVRGG-------GQIVLK--  75

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
                GLY G+  NIA   P SAL+   YE  K  LL        ++AH  AG    +A S 
Sbjct  76    ---GLYAGLGGNIAGVLPASALFVGVYEPTKQKLLRTFPESLSALAHFTAGAIGGIAASL  132

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             I  P+E VKQ+MQ    + +  +A+  I  + G   LYAG+G+ L R++P   I+F  YE
Sbjct  133   IRVPTEVVKQRMQT-GQFASAPDAVRLIATKEGFKGLYAGYGSFLLRDLPFDAIQFCIYE  191

Query  872   SLK---QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYD  702
              L+   +L +     D +N      + G  AG+     TTP DV+KTRL  Q   +NQY 
Sbjct  192   QLRIGYKLAAKRELNDPENA-----IIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYK  245

Query  701   GVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             G++  ++ I + EG   L +G+ PR++     G++FF   ES KRL +
Sbjct  246   GIIDCVQTIVREEGAPALLKGIGPRVLWIGIGGSIFFGVLESTKRLLA  293



>ref|XP_010268594.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X3 [Nelumbo nucifera]
 ref|XP_010268595.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X3 [Nelumbo nucifera]
 ref|XP_010268596.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X3 [Nelumbo nucifera]
Length=301

 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 100/303 (33%), Positives = 153/303 (50%), Gaps = 19/303 (6%)
 Frame = -3

Query  1415  VAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             + +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R   K           
Sbjct  17    MGEEKPFDFLRILFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGGKIL---------  67

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
                + GLY G++ N+A   P SA++   YE  K  LL        +VAH  AG     A+
Sbjct  68    ---LKGLYSGLAGNLAGVLPASAIFVGVYEPTKQKLLQSFPENLSAVAHLTAGAIGGAAS  124

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             S I  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+G+ L R++P   I+F  
Sbjct  125   SLIRVPTEVVKQRMQT-GQFASAPDAVRLIVAKEGFKGLYAGYGSFLLRDLPFDAIQFCI  183

Query  878   YESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDG  699
             YE L+     + + D+  N     + G  AG+     TTP DV+KTRL  Q   +NQY G
Sbjct  184   YEQLRIGYKLAARRDL--NDPENAIIGAFAGALTGAVTTPLDVIKTRLMVQ-GSANQYKG  240

Query  698   VLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHH  519
             ++  ++ I + EG +   +G+ PR++     G++FF   E  K+L  L   +  AQ+ + 
Sbjct  241   IIGCVQTIVREEGTQAFLKGIGPRVLWIGIGGSIFFGVLERTKQL--LAQRRPGAQKENF  298

Query  518   EPC  510
             + C
Sbjct  299   KQC  301



>ref|XP_010268598.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X4 [Nelumbo nucifera]
Length=286

 Score =   144 bits (363),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 146/289 (51%), Gaps = 18/289 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R   K                GLY G++ N
Sbjct  16    EGVIAGGTAGVVVETALYPIDTIKTRLQAARGGGKILLK------------GLYSGLAGN  63

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE  K  LL        +VAH  AG     A+S I  P+E VKQ+M
Sbjct  64    LAGVLPASAIFVGVYEPTKQKLLQSFPENLSAVAHLTAGAIGGAASSLIRVPTEVVKQRM  123

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE L+     + + 
Sbjct  124   QT-GQFASAPDAVRLIVAKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRIGYKLAARR  182

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+  N     + G  AG+     TTP DV+KTRL  Q   +NQY G++  ++ I + EG 
Sbjct  183   DL--NDPENAIIGAFAGALTGAVTTPLDVIKTRLMVQ-GSANQYKGIIGCVQTIVREEGT  239

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHEPC  510
             +   +G+ PR++     G++FF   E  K+L  L   +  AQ+ + + C
Sbjct  240   QAFLKGIGPRVLWIGIGGSIFFGVLERTKQL--LAQRRPGAQKENFKQC  286



>ref|XP_010461233.1| PREDICTED: probable S-adenosylmethionine carrier 2, chloroplastic 
[Camelina sativa]
Length=333

 Score =   145 bits (366),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 102/310 (33%), Positives = 155/310 (50%), Gaps = 23/310 (7%)
 Frame = -3

Query  1445  ECNSESEISVVAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKP  1269
             + NS S I V   + P H L    E    G +AG+ V   L+P+DTIKT +Q+ R   K 
Sbjct  45    QINSCSSICV-RHDDPGHFLRVLYESLITGGLAGVVVEAALYPIDTIKTRVQAARDGGKI  103

Query  1268  FYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHC  1089
              +             GLY G+  N+    P SAL+   YE  K  LL  L     +VAH 
Sbjct  104   IWK------------GLYSGLGGNLVGVLPASALFFGVYEPTKQKLLKVLPENLSAVAHL  151

Query  1088  VAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRN  909
              AG      +S +  P+E VKQ+MQ    + +  +A+  II + G   +YAG+G+ L R+
Sbjct  152   AAGALGGAVSSIVRVPTEVVKQRMQT-GQFASAPDAVRLIIAKEGFGGMYAGYGSFLLRD  210

Query  908   VPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQT  729
             +P   ++F  YE L+     + + D+  N     + G  AG+   + TTP DV+KTRL  
Sbjct  211   LPFDALQFCVYEQLRIGYKLAARRDL--NDPENAMLGAFAGAVTGVLTTPLDVIKTRLMV  268

Query  728   QVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDL  549
             Q  G+ QY GV   +K I + EG   L++G+ PR++     G++FF   E  K++ S   
Sbjct  269   QGAGT-QYKGVADCVKTIIREEGPSALWKGMGPRVLWIGIGGSIFFGVLEKTKQILS---  324

Query  548   HQSSAQRTHH  519
                 +Q++H+
Sbjct  325   --ERSQKSHN  332



>ref|XP_010268593.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X2 [Nelumbo nucifera]
Length=322

 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 100/303 (33%), Positives = 153/303 (50%), Gaps = 19/303 (6%)
 Frame = -3

Query  1415  VAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             + +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R   K           
Sbjct  38    MGEEKPFDFLRILFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGGKIL---------  88

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
                + GLY G++ N+A   P SA++   YE  K  LL        +VAH  AG     A+
Sbjct  89    ---LKGLYSGLAGNLAGVLPASAIFVGVYEPTKQKLLQSFPENLSAVAHLTAGAIGGAAS  145

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             S I  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+G+ L R++P   I+F  
Sbjct  146   SLIRVPTEVVKQRMQT-GQFASAPDAVRLIVAKEGFKGLYAGYGSFLLRDLPFDAIQFCI  204

Query  878   YESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDG  699
             YE L+     + + D+  N     + G  AG+     TTP DV+KTRL  Q   +NQY G
Sbjct  205   YEQLRIGYKLAARRDL--NDPENAIIGAFAGALTGAVTTPLDVIKTRLMVQ-GSANQYKG  261

Query  698   VLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHH  519
             ++  ++ I + EG +   +G+ PR++     G++FF   E  K+L  L   +  AQ+ + 
Sbjct  262   IIGCVQTIVREEGTQAFLKGIGPRVLWIGIGGSIFFGVLERTKQL--LAQRRPGAQKENF  319

Query  518   EPC  510
             + C
Sbjct  320   KQC  322



>gb|EAZ03558.1| hypothetical protein OsI_25694 [Oryza sativa Indica Group]
Length=284

 Score =   144 bits (362),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 140/273 (51%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ +   K  +             GLY G+  N
Sbjct  18    EGVIAGGAAGVVVETALYPIDTIKTRLQAAKGGSKIQWK------------GLYAGLGGN  65

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             IA   P SA++   YE  K  LL        +VAH  AG     A+S I  P+E VKQ+M
Sbjct  66    IAGVLPASAIFIGVYEPTKRKLLEMFPENLSAVAHLTAGAIGGAASSLIRVPTEVVKQRM  125

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q+ S +K   +A+  IIR+ G+  LYAG+G+ L R++P   I+F  YE L+     + + 
Sbjct  126   QM-SQFKTAPDAVRLIIRKEGIKGLYAGYGSFLLRDLPFDAIQFCIYEQLRIGYKLAAKR  184

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+++      + G  AG+     TTP DV+KTRL  Q   + QY G++   + I + EG 
Sbjct  185   DLKDRE--NALIGAFAGAITGAITTPLDVLKTRLMVQ-EQAKQYRGIISCAQTILREEGA  241

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
                 +G+ PR++     G++FF   E  K + +
Sbjct  242   GAFLKGIEPRVLWIGIGGSIFFGVLEKTKSILA  274



>ref|XP_010268592.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X1 [Nelumbo nucifera]
Length=325

 Score =   145 bits (365),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 100/303 (33%), Positives = 153/303 (50%), Gaps = 19/303 (6%)
 Frame = -3

Query  1415  VAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             + +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R   K           
Sbjct  41    MGEEKPFDFLRILFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGGKIL---------  91

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
                + GLY G++ N+A   P SA++   YE  K  LL        +VAH  AG     A+
Sbjct  92    ---LKGLYSGLAGNLAGVLPASAIFVGVYEPTKQKLLQSFPENLSAVAHLTAGAIGGAAS  148

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             S I  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+G+ L R++P   I+F  
Sbjct  149   SLIRVPTEVVKQRMQT-GQFASAPDAVRLIVAKEGFKGLYAGYGSFLLRDLPFDAIQFCI  207

Query  878   YESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDG  699
             YE L+     + + D+  N     + G  AG+     TTP DV+KTRL  Q   +NQY G
Sbjct  208   YEQLRIGYKLAARRDL--NDPENAIIGAFAGALTGAVTTPLDVIKTRLMVQ-GSANQYKG  264

Query  698   VLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHH  519
             ++  ++ I + EG +   +G+ PR++     G++FF   E  K+L  L   +  AQ+ + 
Sbjct  265   IIGCVQTIVREEGTQAFLKGIGPRVLWIGIGGSIFFGVLERTKQL--LAQRRPGAQKENF  322

Query  518   EPC  510
             + C
Sbjct  323   KQC  325



>ref|XP_010478825.1| PREDICTED: probable S-adenosylmethionine carrier 2, chloroplastic 
isoform X1 [Camelina sativa]
Length=320

 Score =   145 bits (365),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 151/300 (50%), Gaps = 22/300 (7%)
 Frame = -3

Query  1415  VAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             V ++ P H L    E    G +AG+ V   L+P+DTIKT +Q+ R   K  +        
Sbjct  41    VRQDDPGHFLRVLYESLITGGLAGVVVEAALYPIDTIKTRVQAARDGGKIIWK-------  93

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
                  GLY G+  N+    P SAL+   YE  K  LL  L     +VAH  AG      +
Sbjct  94    -----GLYSGLGGNLVGVLPASALFFGVYEPTKQKLLKVLPENLSAVAHLAAGALGGAVS  148

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             S +  P+E VKQ+MQ    + +  +A+  II + G   +YAG+G+ L R++P   ++F  
Sbjct  149   SIVRVPTEVVKQRMQT-GQFASAPDAVRLIIAKEGFGGMYAGYGSFLLRDLPFDALQFCV  207

Query  878   YESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDG  699
             YE L+     + + D+  N     + G  AG+   + TTP DV+KTRL  Q  G+ +Y G
Sbjct  208   YEQLRIGYKLAARRDL--NDPENAMLGAFAGAVTGVLTTPLDVIKTRLMVQGAGT-RYKG  264

Query  698   VLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHH  519
             V   +K I + EG   L++G+ PR++     G++FF   E  K++ S       +Q++H+
Sbjct  265   VADCVKTIIREEGSSALWKGMGPRVLWIGIGGSIFFGVLEKTKQILS-----ERSQKSHN  319



>ref|XP_010478826.1| PREDICTED: probable S-adenosylmethionine carrier 2, chloroplastic 
isoform X2 [Camelina sativa]
Length=318

 Score =   144 bits (364),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 151/300 (50%), Gaps = 22/300 (7%)
 Frame = -3

Query  1415  VAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             V ++ P H L    E    G +AG+ V   L+P+DTIKT +Q+ R   K  +        
Sbjct  39    VRQDDPGHFLRVLYESLITGGLAGVVVEAALYPIDTIKTRVQAARDGGKIIWK-------  91

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
                  GLY G+  N+    P SAL+   YE  K  LL  L     +VAH  AG      +
Sbjct  92    -----GLYSGLGGNLVGVLPASALFFGVYEPTKQKLLKVLPENLSAVAHLAAGALGGAVS  146

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             S +  P+E VKQ+MQ    + +  +A+  II + G   +YAG+G+ L R++P   ++F  
Sbjct  147   SIVRVPTEVVKQRMQT-GQFASAPDAVRLIIAKEGFGGMYAGYGSFLLRDLPFDALQFCV  205

Query  878   YESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDG  699
             YE L+     + + D+  N     + G  AG+   + TTP DV+KTRL  Q  G+ +Y G
Sbjct  206   YEQLRIGYKLAARRDL--NDPENAMLGAFAGAVTGVLTTPLDVIKTRLMVQGAGT-RYKG  262

Query  698   VLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHH  519
             V   +K I + EG   L++G+ PR++     G++FF   E  K++ S       +Q++H+
Sbjct  263   VADCVKTIIREEGSSALWKGMGPRVLWIGIGGSIFFGVLEKTKQILS-----ERSQKSHN  317



>ref|XP_010526619.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010526620.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=324

 Score =   145 bits (365),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 101/287 (35%), Positives = 144/287 (50%), Gaps = 18/287 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+      GLY G++ N
Sbjct  55    EGVIAGGTAGVVVETALYPIDTIKTRLQAARGG-------GKIVLK-----GLYSGLAGN  102

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             IA   P SAL+   YE  K  LL        +VAH  AG     A S I  P+E VKQ+M
Sbjct  103   IAGVLPASALFVGVYEPTKQKLLKTFPEHLNAVAHLTAGAIGGFAASLIRVPTEVVKQRM  162

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  I  + G   LYAG+G+ L R++P   I+F  YE L+     + Q 
Sbjct  163   QT-GQFTSAPDAVRLIASKEGFRGLYAGYGSFLLRDLPFDAIQFCIYEQLRLGYKRAAQR  221

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             ++  N     V G  AG+     TTP DV+KTRL  Q   + QY G+   ++ I K EG 
Sbjct  222   EL--NDPENAVIGAFAGALTGAITTPLDVIKTRLMVQ-GSTKQYRGIFDCVQTIAKEEGA  278

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHE  516
                 +G+ PR++     G++FF   ES KR  +L   +S+A+    E
Sbjct  279   SAFLKGIGPRVLWIGIGGSIFFGVLESTKR--ALAQRRSAARHDSKE  323



>ref|XP_008457910.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X1 [Cucumis melo]
Length=319

 Score =   144 bits (364),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 147/288 (51%), Gaps = 23/288 (8%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+   
Sbjct  39    EEKPFDFLRTVFEGVIAGGTAGVVVETALYPIDTIKTRLQAVRGG-------GQIVLK--  89

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
                GLY G+  NIA   P SAL+   YE  K  LL        ++AH  AG    +A S 
Sbjct  90    ---GLYAGLGGNIAGVLPASALFVGVYEPTKQKLLRTFPESLSALAHFTAGAIGGIAASL  146

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             I  P+E VKQ+MQ    + +  +A+  I  + G   LYAG+G+ L R++P   I+F  YE
Sbjct  147   IRVPTEVVKQRMQT-GQFASAPDAVRLIATKEGFKGLYAGYGSFLLRDLPFDAIQFCIYE  205

Query  872   SLK---QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYD  702
              L+   +L +     D +N      + G  AG+     TTP DV+KTRL  Q   +NQY 
Sbjct  206   QLRIGYKLAAKRELNDPENA-----IIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYK  259

Query  701   GVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             G++  ++ I + EG   L +G+ PR++     G++FF   ES KRL +
Sbjct  260   GIVDCVQTIVREEGAPALLKGIGPRVLWIGIGGSIFFGVLESTKRLLA  307



>emb|CDP12870.1| unnamed protein product [Coffea canephora]
Length=351

 Score =   145 bits (366),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 101/290 (35%), Positives = 144/290 (50%), Gaps = 24/290 (8%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKT-----------------VIQSCRADQKPFYYIGRS  1248
             +   AG  AG+ V   L+P+DTIKT                 +IQS  AD+      G  
Sbjct  54    DGVIAGGTAGVVVETALYPIDTIKTRLQAEMFGFFFSPSFFCIIQSVVADESSSAAQGGG  113

Query  1247  VISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCAS  1068
              I+ RG   LY G++ N+A   P SA++   YE  K  LL     ++ +VAH  AG    
Sbjct  114   KINLRG---LYSGLTGNLAGVLPASAVFVGVYEPTKQKLLKLFPEKFSAVAHLTAGAIGG  170

Query  1067  VATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIK  888
             +A S I  P+E VKQ+MQ R  + +  +A+  II + G   LYAG+ + L R++P   I+
Sbjct  171   IAASLIRVPTEVVKQRMQTR-QFASPPDAVRLIISKEGFRGLYAGYKSFLLRDLPFDAIQ  229

Query  887   FYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQ  708
             F  YE L+     + + D+  N       G  AG+     TTP DV+KTRL  Q   +NQ
Sbjct  230   FCIYEQLRIGYKMAAKRDL--NDPENAAIGAFAGALTGAITTPLDVIKTRLMVQ-GSTNQ  286

Query  707   YDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             Y GV   ++ I + EG   L +G  PR++     G++FF   ES KR  S
Sbjct  287   YRGVFDCVQAIVREEGPPALLKGFGPRVLWIGIGGSIFFGVLESAKRFLS  336



>ref|XP_006466113.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X1 [Citrus sinensis]
 ref|XP_006466114.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X2 [Citrus sinensis]
 ref|XP_006466115.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X3 [Citrus sinensis]
 ref|XP_006466116.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X4 [Citrus sinensis]
 ref|XP_006466117.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X5 [Citrus sinensis]
Length=320

 Score =   144 bits (363),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 138/273 (51%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R   K  +             GLY G++ N
Sbjct  51    EGVIAGGTAGVVVETALYPIDTIKTRLQAVRGGGKINFK------------GLYSGLAGN  98

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SAL+   YE  K  LL        + AH  AG     A S +  P+E VKQ++
Sbjct  99    LAGVLPASALFVGVYEPTKQKLLQIFPENLSAAAHLTAGAIGGFAASLVRVPTEVVKQRL  158

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    Y +  +A+  I  + G   LYAG+G+ L R++P   I+F  YE L+    ++ + 
Sbjct  159   QT-GQYASAPDAVRLIASKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRIGYKAAARR  217

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+  N     + G  AG+     TTP DV+KTRL  Q   +NQY G+   ++ I + EG 
Sbjct  218   DL--NDPENAIIGAFAGAITGAITTPLDVIKTRLMVQ-GSANQYKGIFDCVQTIVREEGP  274

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L +G+ PR++     G++FF   ES KR+ +
Sbjct  275   PALLKGIGPRVMWIGIGGSIFFGVLESTKRMLA  307



>gb|KGN62097.1| hypothetical protein Csa_2G297210 [Cucumis sativus]
Length=327

 Score =   144 bits (364),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 147/288 (51%), Gaps = 23/288 (8%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+   
Sbjct  46    EEKPFDFLRTVFEGVIAGGTAGVVVETALYPIDTIKTRLQAVRGG-------GQIVLK--  96

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
                GLY G+  NIA   P SAL+   YE  K  LL        ++AH  AG    +A S 
Sbjct  97    ---GLYAGLGGNIAGVLPASALFVGVYEPTKQKLLRTFPESLSALAHFTAGAIGGIAASL  153

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             I  P+E VKQ+MQ    + +  +A+  I  + G   LYAG+G+ L R++P   I+F  YE
Sbjct  154   IRVPTEVVKQRMQT-GQFASAPDAVRLIATKEGFKGLYAGYGSFLLRDLPFDAIQFCIYE  212

Query  872   SLK---QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYD  702
              L+   +L +     D +N      + G  AG+     TTP DV+KTRL  Q   +NQY 
Sbjct  213   QLRIGYKLAAKRELNDPENA-----IIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYK  266

Query  701   GVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             G++  ++ I + EG   L +G+ PR++     G++FF   ES KRL +
Sbjct  267   GIIDCVQTIVREEGAPALLKGIGPRVLWIGIGGSIFFGVLESTKRLLA  314



>ref|XP_002530256.1| mitochondrial carrier protein, putative [Ricinus communis]
 gb|EEF32126.1| mitochondrial carrier protein, putative [Ricinus communis]
Length=325

 Score =   144 bits (363),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 99/284 (35%), Positives = 145/284 (51%), Gaps = 17/284 (6%)
 Frame = -3

Query  1415  VAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             V  +KP   L    E   AG  AG+ V   L+P+DTIKT +Q+           G+ V+ 
Sbjct  42    VKDDKPFDFLRTLFEGVIAGGTAGVVVETALYPIDTIKTRLQAAHGG-------GKIVLK  94

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
                  GLY G++ N+A   P SAL+   YE  K  LL        +VAH  AG    VA 
Sbjct  95    -----GLYSGLAGNLAGVLPASALFVGVYEPTKQKLLQMFPENLSAVAHLTAGAIGGVAA  149

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             S I  P+E VKQ+MQ    + +  +A+  II + G   +YAG+G+ L R++P   I+F  
Sbjct  150   SLIRVPTEVVKQRMQT-GQFTSAPDAVRLIISKEGFKGMYAGYGSFLLRDLPFDAIQFCI  208

Query  878   YESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDG  699
             YE L+    ++ + ++  N     V G  AG+     TTP DV+KTRL  Q   +NQY G
Sbjct  209   YEQLRIGYKAAARREL--NDPENAVIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYTG  265

Query  698   VLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKR  567
             +   ++ + + EG   L +G+ PR++     G++FF   ES KR
Sbjct  266   IFDCVQTVVREEGPTALLKGIGPRVLWIGIGGSIFFGVLESTKR  309



>ref|XP_010542975.1| PREDICTED: probable S-adenosylmethionine carrier 2, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=325

 Score =   144 bits (363),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 101/323 (31%), Positives = 163/323 (50%), Gaps = 22/323 (7%)
 Frame = -3

Query  1523  CDETKYENRSDSGLDDYGPNQRFGGIECNSESEISVVAKEKPCHALAK-QEHAFAGAMAG  1347
             C +T  +  + + + D  P ++    + N+ S ISV  ++ P   L+   E   AG  AG
Sbjct  12    CSQTASDAVALTRISDPDPIKK----QINAFSAISV-KQDDPSRFLSLFYESVIAGGTAG  66

Query  1346  IFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisAL  1167
             + V   L+P+DTIKT +Q+         + G  +I +    GLY G+  N+    P SA+
Sbjct  67    VIVEAALYPIDTIKTRLQAA--------HDGGKIILK----GLYSGLGGNLVGVLPASAI  114

Query  1166  YTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCW  987
             +   YE  K  LL  L     + AH  AG     ++S +  P+E VKQ+MQ    + +  
Sbjct  115   FIGVYEPAKQKLLKLLPENLSAFAHLTAGALGGASSSIVRVPTEVVKQRMQT-GQFSSAS  173

Query  986   NALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTL  807
             +A+  I+ + G   LY G+G+ L R++P   ++F  YE L+     + + D+  N     
Sbjct  174   DAVCQIVAKEGFRGLYTGFGSFLLRDLPFDAVQFCVYEQLRIGYKLAARRDL--NGPENA  231

Query  806   VCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPR  627
             + G  AG+     TTPFDV+KTRL  Q  GS +Y GV   ++ I + EG   L++G+ PR
Sbjct  232   MLGAFAGAVTGALTTPFDVIKTRLMVQGAGS-KYKGVSDCVRTIVREEGSSALWKGIGPR  290

Query  626   LVMYMTQGALFFASYESFKRLFS  558
             ++     G++FF   E  K++ S
Sbjct  291   ILWIGVGGSIFFGVLEKTKQILS  313



>ref|XP_003532851.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X1 [Glycine max]
 ref|XP_006585311.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X2 [Glycine max]
Length=326

 Score =   144 bits (363),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 100/309 (32%), Positives = 152/309 (49%), Gaps = 19/309 (6%)
 Frame = -3

Query  1439  NSESEISVVAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
             NS + +S+   EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R  +K   
Sbjct  32    NSFASVSM-GDEKPFDFLRTLFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGEKLI-  89

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
                        + GLY G++ N+    P SAL+   YE +K  LL        +  H  A
Sbjct  90    -----------LKGLYSGLAGNLVGVLPASALFVGVYEPIKQKLLRIFPEHLSAFTHLTA  138

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             G    +A S I  P+E +KQ+MQ    + +   A+  I  + G    YAG+G+ L R++P
Sbjct  139   GAIGGIAASLIRVPTEVIKQRMQT-GQFASASGAVRFIASKEGFKGFYAGYGSFLLRDLP  197

Query  902   HSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV  723
                I+F  YE ++     + Q ++  N     + G  AG+     TTP DV+KTRL  Q 
Sbjct  198   FDAIQFCIYEQIRIGYMLAAQRNL--NDPENAIIGAFAGALTGAITTPLDVIKTRLMVQ-  254

Query  722   PGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQ  543
               +NQY G++  ++ I K EG +   +G+ PR++     G++FF   ES KR  S +   
Sbjct  255   GSANQYKGIVDCVQTIIKEEGPRAFLKGIGPRVLWIGIGGSIFFGVLESTKRFLS-ERRP  313

Query  542   SSAQRTHHE  516
             +  Q T+ E
Sbjct  314   TVPQNTYSE  322



>ref|NP_001130185.1| uncharacterized protein LOC100191279 [Zea mays]
 gb|ACF78330.1| unknown [Zea mays]
 gb|AFW73248.1| carrier C12B10.09 isoform 1 [Zea mays]
 gb|AFW73249.1| carrier C12B10.09 isoform 2 [Zea mays]
 gb|AFW73250.1| carrier C12B10.09 isoform 3 [Zea mays]
 gb|AFW73251.1| carrier C12B10.09 isoform 4 [Zea mays]
Length=287

 Score =   143 bits (360),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 96/276 (35%), Positives = 144/276 (52%), Gaps = 22/276 (8%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E + AG  AG+ V   L+P+DTIKT +Q+ R         G S I  +G   LY G++ N
Sbjct  18    EGSIAGGTAGVVVETALYPIDTIKTRLQAAR---------GGSRIEWKG---LYSGLAGN  65

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +    P SA++   YE  K  LL  L     +VAH  AG    +A S +  P+E VKQ+M
Sbjct  66    LTGVLPASAIFVGVYEPTKRKLLETLPENLSAVAHFTAGAIGGIAASLVRVPTEVVKQRM  125

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK---QLMSSS  846
             Q    +K+  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE L+   +L++  
Sbjct  126   QT-GQFKSAPDAVRLIVAKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRIGYKLVAKR  184

Query  845   VQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKS  666
                D +N      + G  AG+     TTP DV+KTRL  Q  G NQY G++   + I + 
Sbjct  185   ELNDPENA-----LIGAFAGAITGAITTPLDVMKTRLMVQGQG-NQYTGIVSCAQTILRE  238

Query  665   EGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             EG K   +G+ PR++     G++FF   E  K + +
Sbjct  239   EGPKAFLKGIEPRVLWIGIGGSIFFGMLEKTKSMLA  274



>gb|ACG42110.1| mitochondrial carrier C12B10.09 [Zea mays]
Length=287

 Score =   143 bits (360),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 96/276 (35%), Positives = 144/276 (52%), Gaps = 22/276 (8%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E + AG  AG+ V   L+P+DTIKT +Q+ R         G S I  +G   LY G++ N
Sbjct  18    EGSIAGGTAGVVVETALYPIDTIKTRLQAAR---------GGSRIEWKG---LYSGLAGN  65

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +    P SA++   YE  K  LL  L     +VAH  AG    +A S +  P+E VKQ+M
Sbjct  66    LTGVLPASAIFVGVYEPTKRKLLETLPENLSAVAHFTAGAIGGIAASLVRVPTEVVKQRM  125

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK---QLMSSS  846
             Q    +K+  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE L+   +L++  
Sbjct  126   QT-GQFKSAPDAVRLIVAKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRIGYKLVAKR  184

Query  845   VQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKS  666
                D +N      + G  AG+     TTP DV+KTRL  Q  G NQY G++   + I + 
Sbjct  185   ELNDPENA-----LIGAFAGAITGAITTPLDVMKTRLMVQGQG-NQYTGIVSCAQTILRE  238

Query  665   EGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             EG K   +G+ PR++     G++FF   E  K + +
Sbjct  239   EGPKAFLKGIEPRVLWIGIGGSIFFGVLEKTKSMLA  274



>ref|XP_002452854.1| hypothetical protein SORBIDRAFT_04g033610 [Sorghum bicolor]
 gb|EES05830.1| hypothetical protein SORBIDRAFT_04g033610 [Sorghum bicolor]
Length=286

 Score =   143 bits (360),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 146/276 (53%), Gaps = 22/276 (8%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E + AG  AG+ V   L+P+DTIKT +Q+ R         G S I  +G   LY G++ N
Sbjct  18    EGSIAGGTAGVVVETALYPIDTIKTRLQAAR---------GGSRIEWKG---LYSGLAGN  65

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE  K  LL  L     +VAH  AG    +A S +  P+E VKQ+M
Sbjct  66    LAGVLPASAIFVGVYEPTKRKLLETLPENLSAVAHFTAGAIGGIAASLVRVPTEVVKQRM  125

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK---QLMSSS  846
             Q    +K+  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE L+   +L++  
Sbjct  126   QT-GQFKSAPDAVRLIVGKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRIGYKLVARR  184

Query  845   VQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKS  666
                D +N      + G  +G+     TTPFDV+KTRL  Q  G NQY G++   + I + 
Sbjct  185   ELNDPENA-----LIGAFSGAITGAITTPFDVMKTRLMVQGQG-NQYTGIVSCAQTILRE  238

Query  665   EGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             EG K   +G+ PR++     G++FF   E  K + +
Sbjct  239   EGPKAFLKGIEPRVLWIGIGGSIFFGVLEKTKSMLA  274



>ref|XP_011021953.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Populus euphratica]
Length=321

 Score =   144 bits (363),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 95/274 (35%), Positives = 137/274 (50%), Gaps = 18/274 (7%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R   K                GLY G++ N
Sbjct  50    EGVIAGGTAGVVVETALYPIDTIKTRLQAARGGGKIMLK------------GLYSGLAGN  97

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SAL+   YE  K  LL        +VAH  AG    +A S I  P+E +KQ+M
Sbjct  98    LAGVLPASALFVGVYEPTKQKLLKTFPENLSAVAHLTAGAVGGIAASLIRVPTEVIKQRM  157

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  I+ + G    YAG+G+ L R++P   I+F  YE L+     + Q 
Sbjct  158   QT-GQFTSAPDAVRLIVSKEGFKGFYAGYGSFLLRDLPFDAIQFCIYEQLRIGYRVAAQR  216

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEG  660
             D+  N       G  AG+     TTP DV+KTRL  Q  GS NQY G++  +  + + EG
Sbjct  217   DL--NDPENAAIGAFAGALTGAITTPLDVIKTRLMVQ--GSANQYKGIVDCVSTVVREEG  272

Query  659   LKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
                L +G+ PR++     G++FF   E  KRL +
Sbjct  273   PTALLKGIGPRVLWIGIGGSIFFGVLERTKRLLA  306



>ref|XP_006585312.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X3 [Glycine max]
Length=288

 Score =   143 bits (360),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 97/298 (33%), Positives = 146/298 (49%), Gaps = 18/298 (6%)
 Frame = -3

Query  1406  EKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERG  1230
             EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R  +K              
Sbjct  4     EKPFDFLRTLFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGEKLI------------  51

Query  1229  VLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFI  1050
             + GLY G++ N+    P SAL+   YE +K  LL        +  H  AG    +A S I
Sbjct  52    LKGLYSGLAGNLVGVLPASALFVGVYEPIKQKLLRIFPEHLSAFTHLTAGAIGGIAASLI  111

Query  1049  FTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYES  870
               P+E +KQ+MQ    + +   A+  I  + G    YAG+G+ L R++P   I+F  YE 
Sbjct  112   RVPTEVIKQRMQT-GQFASASGAVRFIASKEGFKGFYAGYGSFLLRDLPFDAIQFCIYEQ  170

Query  869   LKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLH  690
             ++     + Q ++  N     + G  AG+     TTP DV+KTRL  Q   +NQY G++ 
Sbjct  171   IRIGYMLAAQRNL--NDPENAIIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYKGIVD  227

Query  689   TLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHE  516
              ++ I K EG +   +G+ PR++     G++FF   ES KR  S +   +  Q T+ E
Sbjct  228   CVQTIIKEEGPRAFLKGIGPRVLWIGIGGSIFFGVLESTKRFLS-ERRPTVPQNTYSE  284



>ref|XP_002279217.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X3 [Vitis vinifera]
Length=327

 Score =   144 bits (362),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 140/273 (51%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R   K  +             GLY G++ N
Sbjct  55    EGIVAGGTAGVVVETALYPIDTIKTRLQAVRGGGKIVWN------------GLYSGLAGN  102

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE  K  LL        +VAH  AG    +A S +  P+E VKQ+M
Sbjct  103   LAGVLPASAIFVGVYEPTKQKLLQIFPENLTAVAHLTAGAIGGLAASLVRVPTEVVKQRM  162

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  I+ + G   LYAG+ + L R++P   I+F  YE ++     + + 
Sbjct  163   QT-GQFASAPDAVRMIVSKEGFKGLYAGYRSFLLRDLPFDAIQFCIYEQMRIGYKLAAKR  221

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+  N     + G  AG+     TTP DV+KTRL  Q P +NQY+G++  ++ I + EG 
Sbjct  222   DL--NDPENALIGAFAGALTGAITTPLDVIKTRLMVQGP-ANQYNGIIDCVQTIVREEGP  278

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L +G+ PR++     G++FF   E  KR  +
Sbjct  279   PALLKGIGPRVLWIGIGGSIFFGVLERTKRALA  311



>ref|XP_010261037.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X1 [Nelumbo nucifera]
 ref|XP_010261038.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X1 [Nelumbo nucifera]
Length=345

 Score =   144 bits (363),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 111/351 (32%), Positives = 170/351 (48%), Gaps = 28/351 (8%)
 Frame = -3

Query  1586  MSSSEVHGYSSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFGGIECNSE-------S  1428
             M   ++ G   EK   S       T + +   S  D  G ++      CNS+       +
Sbjct  1     MGIRKLSGKREEKKRISRTLMGPLTLFVDAKSSPADFSGSHK---SKICNSQWDQRKFFA  57

Query  1427  EISVVAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGR  1251
              IS  ++EKP + L    E   AG  AG+ V   L+P+DTIKT +Q+ R         G 
Sbjct  58    SIST-SEEKPFNFLRVLFEGVIAGGTAGVIVETALYPIDTIKTRLQAARG--------GG  108

Query  1250  SVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCA  1071
              ++ +    GLY G++ N+A   P SAL+   YE  K  LL        ++AH  AG   
Sbjct  109   EILLK----GLYSGLAGNLAGVLPASALFVGVYEPTKQKLLRSFPENLSAIAHLTAGAIG  164

Query  1070  SVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSII  891
              VA S I  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+G+ L R++P   I
Sbjct  165   GVAASLIRVPTEVVKQRMQT-GQFASAPDAVHLIVAKEGFKGLYAGYGSFLLRDLPFDAI  223

Query  890   KFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSN  711
             +F  YE L+     + + D+  N     + G  AG+     TTP DV+KTRL  Q   +N
Sbjct  224   QFCIYEQLRLGYKLAAKRDL--NDPENAIIGAFAGALTGAITTPLDVIKTRLMVQ-GSAN  280

Query  710   QYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             QY G+   ++ + + EG   L +G+ PR++     G++FF   E  K+L +
Sbjct  281   QYKGIFDCVQTLVREEGPSALLKGIGPRVLWIGIGGSIFFGVLERTKQLLA  331


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 85/208 (41%), Gaps = 34/208 (16%)
 Frame = -3

Query  1124  FLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGG---  954
             FL   ++ V   +AGG A V       P + +K ++Q                 RGG   
Sbjct  69    FLRVLFEGV---IAGGTAGVIVETALYPIDTIKTRLQAA---------------RGGGEI  110

Query  953   -LPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTA  777
              L  LY+G    L   +P S +    YE  KQ +  S  F    + +  L  G + G  A
Sbjct  111   LLKGLYSGLAGNLAGVLPASALFVGVYEPTKQKLLRS--FPENLSAIAHLTAGAIGGVAA  168

Query  776   ALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGAL  597
             +L   P +VVK R+QT      Q+      +  I   EG KGLY G    L+  +   A+
Sbjct  169   SLIRVPTEVVKQRMQT-----GQFASAPDAVHLIVAKEGFKGLYAGYGSFLLRDLPFDAI  223

Query  596   FFASYESFKRLFSLDLHQSSAQRTHHEP  513
              F  YE  +  + L     +A+R  ++P
Sbjct  224   QFCIYEQLRLGYKL-----AAKRDLNDP  246



>gb|ACG43941.1| mitochondrial carrier C12B10.09 [Zea mays]
Length=287

 Score =   142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/276 (35%), Positives = 144/276 (52%), Gaps = 22/276 (8%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E + AG  AG+ V   L+P+DTIKT +Q+ R         G S I  +G   LY G++ N
Sbjct  18    EGSIAGGTAGVVVETALYPIDTIKTRLQAAR---------GGSRIEWKG---LYSGLAGN  65

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +    P SA++   YE  K  LL  L     +VAH  AG    +A S +  P+E VKQ+M
Sbjct  66    LTGVLPASAIFVGVYEPTKRKLLETLPENLSAVAHFTAGAIGGIAASLVRVPTEVVKQRM  125

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK---QLMSSS  846
             Q    +K+  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE L+   +L++  
Sbjct  126   QT-GQFKSAPDAVRLIVAKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRIGYKLVAKR  184

Query  845   VQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKS  666
                D +N      + G  AG+     TTP DV+KTRL  Q  G NQY G++   + I + 
Sbjct  185   ELNDPENA-----LIGAFAGAITGAITTPLDVMKTRLMVQGQG-NQYTGIVICAQTILRE  238

Query  665   EGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             EG K   +G+ PR++     G++FF   E  K + +
Sbjct  239   EGPKAFLKGIEPRVLWIGIGGSIFFGVLEKTKSMLA  274



>ref|XP_010261039.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X2 [Nelumbo nucifera]
Length=325

 Score =   143 bits (361),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 97/286 (34%), Positives = 148/286 (52%), Gaps = 17/286 (6%)
 Frame = -3

Query  1412  AKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISE  1236
             ++EKP + L    E   AG  AG+ V   L+P+DTIKT +Q+ R         G  ++ +
Sbjct  42    SEEKPFNFLRVLFEGVIAGGTAGVIVETALYPIDTIKTRLQAARG--------GGEILLK  93

Query  1235  RGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATS  1056
                 GLY G++ N+A   P SAL+   YE  K  LL        ++AH  AG    VA S
Sbjct  94    ----GLYSGLAGNLAGVLPASALFVGVYEPTKQKLLRSFPENLSAIAHLTAGAIGGVAAS  149

Query  1055  FIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTY  876
              I  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+G+ L R++P   I+F  Y
Sbjct  150   LIRVPTEVVKQRMQT-GQFASAPDAVHLIVAKEGFKGLYAGYGSFLLRDLPFDAIQFCIY  208

Query  875   ESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGV  696
             E L+     + + D+  N     + G  AG+     TTP DV+KTRL  Q   +NQY G+
Sbjct  209   EQLRLGYKLAAKRDL--NDPENAIIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYKGI  265

Query  695   LHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
                ++ + + EG   L +G+ PR++     G++FF   E  K+L +
Sbjct  266   FDCVQTLVREEGPSALLKGIGPRVLWIGIGGSIFFGVLERTKQLLA  311


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 85/208 (41%), Gaps = 34/208 (16%)
 Frame = -3

Query  1124  FLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGG---  954
             FL   ++ V   +AGG A V       P + +K ++Q                 RGG   
Sbjct  49    FLRVLFEGV---IAGGTAGVIVETALYPIDTIKTRLQAA---------------RGGGEI  90

Query  953   -LPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTA  777
              L  LY+G    L   +P S +    YE  KQ +  S  F    + +  L  G + G  A
Sbjct  91    LLKGLYSGLAGNLAGVLPASALFVGVYEPTKQKLLRS--FPENLSAIAHLTAGAIGGVAA  148

Query  776   ALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGAL  597
             +L   P +VVK R+QT      Q+      +  I   EG KGLY G    L+  +   A+
Sbjct  149   SLIRVPTEVVKQRMQT-----GQFASAPDAVHLIVAKEGFKGLYAGYGSFLLRDLPFDAI  203

Query  596   FFASYESFKRLFSLDLHQSSAQRTHHEP  513
              F  YE  +  + L     +A+R  ++P
Sbjct  204   QFCIYEQLRLGYKL-----AAKRDLNDP  226



>ref|XP_007019619.1| S-adenosylmethionine carrier 2 [Theobroma cacao]
 gb|EOY16844.1| S-adenosylmethionine carrier 2 [Theobroma cacao]
Length=326

 Score =   143 bits (361),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 147/298 (49%), Gaps = 20/298 (7%)
 Frame = -3

Query  1439  NSESEISV---VAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQK  1272
               ES++S    V  E P H      E   AGA AG+ V   L+P+DTIKT +Q+ R    
Sbjct  30    KEESKLSASVHVGDENPFHFFRVFYESVIAGATAGVVVEAALYPIDTIKTRLQAARGG--  87

Query  1271  PFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAH  1092
                  G+ ++      GLY G+  N+A   P SA++   YE  K  LL        + AH
Sbjct  88    -----GKEILK-----GLYSGLGGNLAGVLPASAIFLGVYEPAKQKLLKAFPENMSAFAH  137

Query  1091  CVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCR  912
               AG     A+S +  P+E VKQ+MQ    + +   A+  I+ + G   LYAG+G+ L R
Sbjct  138   LTAGALGGAASSLVRVPTEVVKQRMQT-GQFASAPAAVRLIVAKEGFKGLYAGYGSFLLR  196

Query  911   NVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQ  732
             ++P   I+F  YE L+     + Q D+  N     + G  AG+     TTP DV+KTRL 
Sbjct  197   DLPFDAIQFCIYEQLRIGYKLAAQRDL--NDPENAILGAFAGAITGAVTTPLDVIKTRLM  254

Query  731   TQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
              Q   + QY G+   ++ I K EG   L +G+ PR++     G++FF   E  K++ +
Sbjct  255   VQ-GSAKQYKGIFDCVRTIVKEEGTHALLKGIGPRVLWIGLGGSIFFGVLEKTKQMLA  311



>ref|XP_009119224.1| PREDICTED: protein MITOFERRINLIKE 1, chloroplastic isoform X2 
[Brassica rapa]
Length=397

 Score =   145 bits (365),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 102/269 (38%), Positives = 148/269 (55%), Gaps = 19/269 (7%)
 Frame = -3

Query  1343  FVSLCLHPMDTIKTVIQSCRADQ---KPFYYIGRSVISERGVLGLYRGissniassapis  1173
             F  +CL P+DTIKT +Q+  A Q     F  + ++   ERG+LG Y G+S+ I  S   S
Sbjct  112   FTYVCLLPLDTIKTKLQAKGASQLYSSSFDAVVKT-FQERGILGFYSGVSAVIVGSTFSS  170

Query  1172  ALYTFTYESVKGALLPFLHTEYQSV-AHCVAGGCASVATSFIFTPSERVKQQMQVRSHYK  996
             A+Y  T E  K  L  F   E+  V     AG   ++ +S I  P E + Q+MQV +  +
Sbjct  171   AVYFGTCEFGKSLLGKF--PEFPPVLIPPTAGAMGNIISSAIMVPKELITQRMQVGASGR  228

Query  995   NCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNN--  822
               +  L+ I+ + G+  LYAG+ A L RN+P  ++ + ++E LK  +    Q   QNN  
Sbjct  229   RSYQVLLEILEKDGILGLYAGYSATLLRNLPAGVLSYSSFEYLKAAVLEKTQ---QNNLE  285

Query  821   TLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV-------PGSNQYDGVLHTLKEIGKSE  663
              L ++ CG LAG+ +A  TTP DVVKTRL TQV        G+  YDGV  T+K+I K E
Sbjct  286   PLQSVCCGALAGAISASITTPLDVVKTRLMTQVHVEAANKLGAAMYDGVAGTVKQILKEE  345

Query  662   GLKGLYRGLTPRLVMYMTQGALFFASYES  576
             GL G  RG+ PR+V      A+ + ++E+
Sbjct  346   GLVGFTRGMGPRVVHSACFSAIGYFAFET  374



>ref|XP_002452606.1| hypothetical protein SORBIDRAFT_04g028930 [Sorghum bicolor]
 gb|EES05582.1| hypothetical protein SORBIDRAFT_04g028930 [Sorghum bicolor]
Length=287

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/273 (34%), Positives = 144/273 (53%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E + AG  AG+ V   L+P+DTIKT +Q+ R         G S I  +G   LY G++ N
Sbjct  18    EGSIAGGTAGVVVETALYPIDTIKTRLQAAR---------GGSRIEWKG---LYSGLAGN  65

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE  K  LL  L     +VAH  AG    +A S +  P+E VKQ+M
Sbjct  66    LAGVLPASAIFVGVYEPTKRKLLETLPENLSAVAHFTAGAIGGIAASLVRVPTEVVKQRM  125

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    +K+  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE ++    +  + 
Sbjct  126   QT-GQFKSAPDAVRLIVAKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQIRIGYKAVARR  184

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             ++  N     + G  AG+     TTP DV+KTRL  Q  G NQY G+++  + I + EG 
Sbjct  185   EL--NDPENALIGAFAGAITGAITTPLDVMKTRLMVQGQG-NQYTGIVNCAQTILREEGP  241

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             K   +G+ PR++     G++FF   E  K + +
Sbjct  242   KAFLKGIEPRVLWIGIGGSIFFGVLEKTKSMLA  274



>ref|XP_004981046.1| PREDICTED: S-adenosylmethionine mitochondrial carrier protein-like 
[Setaria italica]
Length=289

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/276 (35%), Positives = 145/276 (53%), Gaps = 22/276 (8%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E + AG  AG+ V   L+P+DTIKT +Q+ R         G S I  +G   LY G++ N
Sbjct  20    EGSIAGGTAGVVVETALYPIDTIKTRLQAAR---------GGSRIEWKG---LYSGLAGN  67

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE  K  LL  L     +VAH  AG    +A S +  P+E VKQ+M
Sbjct  68    LAGVLPASAIFVGVYEPTKRKLLETLPENLSAVAHFTAGAIGGIAASLVRVPTEVVKQRM  127

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK---QLMSSS  846
             Q R  +K+  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE ++   +L++  
Sbjct  128   QTR-QFKSAPDAVRLIVAKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQIRIGYKLVAKR  186

Query  845   VQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKS  666
                D +N      + G  AG+     TTP DV+KTRL  Q  G NQY G++   + I + 
Sbjct  187   ELNDPENA-----LIGAFAGAITGAVTTPLDVMKTRLMVQGQG-NQYSGIVSCAQTILRE  240

Query  665   EGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             EG     +G+ PR++     G++FF   E  K + +
Sbjct  241   EGPMAFLKGIEPRVLWIGIGGSIFFGVLEKTKSMLA  276



>ref|XP_011100076.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Sesamum indicum]
 ref|XP_011100077.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Sesamum indicum]
Length=324

 Score =   143 bits (360),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/273 (35%), Positives = 141/273 (52%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ ++      GLY G++ N
Sbjct  55    EGVIAGGTAGVVVETALYPIDTIKTRLQAARGG-------GKIILK-----GLYSGLAGN  102

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE  K  LL  L     +VAH  AG    +A+SFI  P+E VKQ+M
Sbjct  103   LAGVLPASAVFIGVYEPAKQQLLRNLPENLSAVAHLTAGVLGGIASSFIRVPTEVVKQRM  162

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  I  + G   LYAG+G+ L R++P   I+F  YE L+     + + 
Sbjct  163   QT-GQFTSASDAVRLIASKEGFKGLYAGYGSFLLRDLPFDAIQFCLYEQLRIGYKLAAKR  221

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+  N     + G  AG+     TTP DV+KTRL  Q   +NQY G    ++ I + EG 
Sbjct  222   DL--NDPENAIIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYKGFFDCVQTIVREEGP  278

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L +G+ PR++     G++FF   E  KR  +
Sbjct  279   SALLKGVGPRVLWIGIGGSIFFGVLERTKRFLA  311



>ref|XP_001785199.1| predicted protein [Physcomitrella patens]
 gb|EDQ49978.1| predicted protein [Physcomitrella patens]
Length=365

 Score =   144 bits (362),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 151/289 (52%), Gaps = 17/289 (6%)
 Frame = -3

Query  1421  SVVAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSV  1245
             SVV  +KP + L    E A AGA AG+ V   L+P+DTIKT +Q+ R+  K  +      
Sbjct  79    SVVEPQKPINFLRVLVEGAIAGATAGVVVETALYPIDTIKTRLQAARSGGKIVFK-----  133

Query  1244  ISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASV  1065
                    GLY G++ N+A   P SA++   YE +K  LL        SVAH  AG     
Sbjct  134   -------GLYSGLAGNLAGVLPASAIFVGVYEPMKRKLLDIFPDHLSSVAHLTAGAAGGA  186

Query  1064  ATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKF  885
               S I  P+E VKQ+MQ    + +  +A+  I+ + G+  LYAG+G+ L R++P   I+F
Sbjct  187   TASLIRVPTEVVKQRMQT-GQFPSAHSAVRQILAKEGVRGLYAGFGSFLLRDLPFDAIQF  245

Query  884   YTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQY  705
               YE L+  +   V  D+ +  L T + G  +G+     TTP DV+KTRL TQ      Y
Sbjct  246   CIYEQLRLGLKKVVNRDLLD--LETALVGATSGAITGAVTTPLDVIKTRLMTQ-GAKGHY  302

Query  704   DGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
              G+   + +I + EG   L +G+ PR++     G++FFA  E  K+L +
Sbjct  303   KGIGDCVSKIIQEEGAGALLKGIGPRVMWIGIGGSIFFAVLERTKQLLA  351



>ref|XP_010652872.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X2 [Vitis vinifera]
Length=335

 Score =   143 bits (361),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 140/273 (51%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R   K  +             GLY G++ N
Sbjct  63    EGIVAGGTAGVVVETALYPIDTIKTRLQAVRGGGKIVWN------------GLYSGLAGN  110

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE  K  LL        +VAH  AG    +A S +  P+E VKQ+M
Sbjct  111   LAGVLPASAIFVGVYEPTKQKLLQIFPENLTAVAHLTAGAIGGLAASLVRVPTEVVKQRM  170

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  I+ + G   LYAG+ + L R++P   I+F  YE ++     + + 
Sbjct  171   QT-GQFASAPDAVRMIVSKEGFKGLYAGYRSFLLRDLPFDAIQFCIYEQMRIGYKLAAKR  229

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+  N     + G  AG+     TTP DV+KTRL  Q P +NQY+G++  ++ I + EG 
Sbjct  230   DL--NDPENALIGAFAGALTGAITTPLDVIKTRLMVQGP-ANQYNGIIDCVQTIVREEGP  286

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L +G+ PR++     G++FF   E  KR  +
Sbjct  287   PALLKGIGPRVLWIGIGGSIFFGVLERTKRALA  319



>ref|XP_006441382.1| hypothetical protein CICLE_v10021207mg [Citrus clementina]
 ref|XP_006441383.1| hypothetical protein CICLE_v10021207mg [Citrus clementina]
 gb|ESR54622.1| hypothetical protein CICLE_v10021207mg [Citrus clementina]
 gb|ESR54623.1| hypothetical protein CICLE_v10021207mg [Citrus clementina]
Length=320

 Score =   142 bits (359),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/273 (34%), Positives = 137/273 (50%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R   K  +             GLY G++ N
Sbjct  51    EGVIAGGTAGVVVETALYPIDTIKTRLQAVRGGGKINFK------------GLYSGLAGN  98

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SAL+   YE  K  LL        + AH  AG     A S +  P+E VKQ++
Sbjct  99    LAGVLPASALFVGVYEPTKQKLLQIFPENLSAAAHLTAGAIGGFAASLVRVPTEVVKQRL  158

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    Y +  +A+  I  + G   LYAG+G+ L R++P   I+F  YE L+    ++ + 
Sbjct  159   QT-GQYASAPDAVRLIASKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRISYKAAARR  217

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+  N     + G  AG+     TTP DV+KTRL  Q   +NQY G+   ++ I + EG 
Sbjct  218   DL--NDPENAIIGAFAGAITGAITTPLDVIKTRLMVQ-GSANQYKGIFDCVQTIVREEGP  274

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L +G+ PR++     G++FF   E  KR+ +
Sbjct  275   PALLKGIGPRVMWIGIGGSIFFGVLERTKRMLA  307



>ref|XP_010652871.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
isoform X1 [Vitis vinifera]
Length=351

 Score =   143 bits (361),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 140/273 (51%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R   K  +             GLY G++ N
Sbjct  79    EGIVAGGTAGVVVETALYPIDTIKTRLQAVRGGGKIVWN------------GLYSGLAGN  126

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE  K  LL        +VAH  AG    +A S +  P+E VKQ+M
Sbjct  127   LAGVLPASAIFVGVYEPTKQKLLQIFPENLTAVAHLTAGAIGGLAASLVRVPTEVVKQRM  186

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  I+ + G   LYAG+ + L R++P   I+F  YE ++     + + 
Sbjct  187   QT-GQFASAPDAVRMIVSKEGFKGLYAGYRSFLLRDLPFDAIQFCIYEQMRIGYKLAAKR  245

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+  N     + G  AG+     TTP DV+KTRL  Q P +NQY+G++  ++ I + EG 
Sbjct  246   DL--NDPENALIGAFAGALTGAITTPLDVIKTRLMVQGP-ANQYNGIIDCVQTIVREEGP  302

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L +G+ PR++     G++FF   E  KR  +
Sbjct  303   PALLKGIGPRVLWIGIGGSIFFGVLERTKRALA  335



>ref|XP_001771578.1| predicted protein [Physcomitrella patens]
 gb|EDQ63608.1| predicted protein [Physcomitrella patens]
Length=288

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 96/267 (36%), Positives = 146/267 (55%), Gaps = 10/267 (4%)
 Frame = -3

Query  1370  AFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnia  1191
             A AGA AG+ V   L+P+DTIKT +Q C  +    +  G   + +    GLY G++ N+A
Sbjct  13    AVAGATAGVVVEAALYPIDTIKTRLQVCTMNAA--HLGGNPSLFK----GLYSGLAGNLA  66

Query  1190  ssapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQV  1011
                P SA++   YE VK  LL  L  ++ S+AH  AG C    +S I  P+E VKQ+MQ 
Sbjct  67    GVLPASAVFVGVYEPVKRKLLSVLPDQFSSIAHLTAGVCGGGISSLIRVPTEVVKQRMQT  126

Query  1010  RSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDI  831
                + +  +A+  I+ + G+  LYAG+ + L R++P    +F  YE LK   +  V+ ++
Sbjct  127   -GQFVSPQSAVRQIVAKEGIRGLYAGFRSFLLRDLPFDAFQFCIYEQLKISYAKRVRREL  185

Query  830   QNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKG  651
               N   T   G +AG+     TTP DV+KTRL  Q P + QY G+   + +I + EG   
Sbjct  186   --NDTETAFIGAIAGAMTGAVTTPLDVIKTRLMIQGP-NQQYKGIQDCVVKIIRDEGAGT  242

Query  650   LYRGLTPRLVMYMTQGALFFASYESFK  570
             L++GL PR++     G++FF + E  K
Sbjct  243   LFQGLGPRILWIGVGGSIFFGALEKTK  269



>ref|XP_007143580.1| hypothetical protein PHAVU_007G083700g [Phaseolus vulgaris]
 gb|ESW15574.1| hypothetical protein PHAVU_007G083700g [Phaseolus vulgaris]
Length=310

 Score =   142 bits (358),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 148/281 (53%), Gaps = 24/281 (9%)
 Frame = -3

Query  1367  FAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnias  1188
              AG +AG+ V   L+P+DTIKT +Q  R         G+ V+      GLY G+S N+  
Sbjct  50    IAGGVAGVMVETALYPIDTIKTRLQVARDG-------GKIVLK-----GLYSGLSGNLVG  97

Query  1187  sapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVR  1008
               P SA++   YE  K  LL  L     +VAH  AG    +A+S +  P+E +KQ+MQ+ 
Sbjct  98    VLPASAIFIGVYEPTKQQLLKSLPENLSAVAHFAAGAIGGIASSVVRVPTEVIKQRMQI-  156

Query  1007  SHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK---QLMSSSVQF  837
               +++  +A+  I+   G   LYAG+G+ L R++P   I+   YE L+   +L +     
Sbjct  157   GQFRSAPDAVRLILSNEGFKGLYAGYGSFLLRDLPFDAIELCIYEQLRIGYKLAAKRDPN  216

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQ-YDGVLHTLKEIGKSEG  660
             D +N  L     G +AG+     TTP DVVKTRL  Q  GS + Y G+   ++ I K EG
Sbjct  217   DPENAML-----GAVAGAITGAVTTPLDVVKTRLMVQ--GSQKHYKGISDCVRTIIKEEG  269

Query  659   LKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSS  537
              + L++G+ PR++     G++FF   E  KR+ + + H  +
Sbjct  270   TRALFKGIGPRVLWIGVGGSIFFCVLEKTKRILAQNRHPKA  310



>ref|XP_011044281.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X3 [Populus euphratica]
Length=291

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 151/296 (51%), Gaps = 18/296 (6%)
 Frame = -3

Query  1442  CNSESEISVVAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPF  1266
             C S + +S  A+ KP + L A  E   AG  AG+     L+P+DTIKT +Q+     K  
Sbjct  5     CRSFASVSA-AENKPFYFLHAVYEGIIAGGAAGVIAEAVLYPIDTIKTRLQAVHGGGK--  61

Query  1265  YYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCV  1086
                    I+ +G   LY G++ N+A   P SA++   YE  K  LL  L     +VA   
Sbjct  62    -------INLKG---LYSGLAGNLAGVLPASAIFVGVYEPTKQKLLKSLPENLSAVAQLT  111

Query  1085  AGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNV  906
             AG     A+S I  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+G+ L R++
Sbjct  112   AGAIGGAASSLIRVPTEVVKQRMQT-GQFASAPDAIHLIVSKEGFKGLYAGYGSFLLRDL  170

Query  905   PHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ  726
             P   I+F  YE +      + + D ++  +   + G  AG+     TTP DVVKTRL  Q
Sbjct  171   PFDAIQFCIYEQMLMGYKLAAKRDPKDAEIA--IVGAFAGAITGAMTTPLDVVKTRLMVQ  228

Query  725   VPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
                +NQY G+    + I K EG + L +G+ PR++     GA+FF   E  +++ +
Sbjct  229   -GSANQYKGIFDCARTIAKEEGTRALLKGVGPRVLWIGVGGAIFFGVLEKTRQILA  283



>gb|EPS64138.1| hypothetical protein M569_10643, partial [Genlisea aurea]
Length=283

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 100/295 (34%), Positives = 150/295 (51%), Gaps = 17/295 (6%)
 Frame = -3

Query  1439  NSESEISVVAKEKPCHALAKQEHAF-AGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
             N  + ++V  + KP          F AG  AG+ V   L+P+DTIKT +Q+ R       
Sbjct  2     NLFASVNVSIENKPFDFFRTVFDGFIAGGAAGVVVETALYPIDTIKTRLQAVRGG-----  56

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
               G+ ++S     GLY G++ N+A   P SA +   YE VK  LL        SVA+  A
Sbjct  57    --GKIILS-----GLYSGLAGNLAGVLPASAAFVGVYEPVKQKLLRSFPENLSSVAYLTA  109

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             G    +A SFI  P+E VKQ++Q    + +   A+  I+ R G   LYAG+G+ L R++P
Sbjct  110   GVLGGIAASFIRVPTEVVKQRLQT-GQFSSAHEAVRIIVSREGFRGLYAGYGSFLLRDLP  168

Query  902   HSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV  723
                I+F  +E ++     + + D+ +      + G  AG+     TTP DVVKTRL  Q 
Sbjct  169   FDAIQFCIFEQIRLGYKLAAKRDLSDPE--NAIIGAFAGAVTGAITTPLDVVKTRLMIQG  226

Query  722   PGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
              G   Y G++  ++ I K EG   L +GL PR++     G++FF   ES KR+ +
Sbjct  227   SG-KHYKGIIDCMQTIVKEEGPHTLLKGLGPRVLWIGIGGSIFFGVLESTKRILA  280


 Score = 55.5 bits (132),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 81/195 (42%), Gaps = 29/195 (15%)
 Frame = -3

Query  1088  VAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGG---LPSLYAGWGAVL  918
             +AGG A V       P + +K ++Q               +R GG   L  LY+G    L
Sbjct  27    IAGGAAGVVVETALYPIDTIKTRLQA--------------VRGGGKIILSGLYSGLAGNL  72

Query  917   CRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTR  738
                +P S      YE +KQ +  S  F    +++  L  G L G  A+    P +VVK R
Sbjct  73    AGVLPASAAFVGVYEPVKQKLLRS--FPENLSSVAYLTAGVLGGIAASFIRVPTEVVKQR  130

Query  737   LQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             LQT      Q+      ++ I   EG +GLY G    L+  +   A+ F  +E  +  + 
Sbjct  131   LQT-----GQFSSAHEAVRIIVSREGFRGLYAGYGSFLLRDLPFDAIQFCIFEQIRLGYK  185

Query  557   LDLHQSSAQRTHHEP  513
             L     +A+R   +P
Sbjct  186   L-----AAKRDLSDP  195



>ref|NP_001055312.1| Os05g0361900 [Oryza sativa Japonica Group]
 gb|AAT38102.1| putative mitochondrial carrier protein [Oryza sativa Japonica 
Group]
 gb|AAV31398.1| putative mitochondrial carrier protein [Oryza sativa Japonica 
Group]
 dbj|BAF17226.1| Os05g0361900 [Oryza sativa Japonica Group]
 dbj|BAG96823.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96924.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87320.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63422.1| hypothetical protein OsJ_18234 [Oryza sativa Japonica Group]
Length=288

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 104/305 (34%), Positives = 151/305 (50%), Gaps = 25/305 (8%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP + L    E   AG  AG+ V   L+P+DTIKT +Q+ R         G S I  +
Sbjct  7     EEKPFNFLQILCEGVIAGGTAGVVVETALYPIDTIKTRLQAAR---------GGSQIQWK  57

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
             G   LY G++ NIA   P SA++   YE  K  LL        +VAH  AG    +A S 
Sbjct  58    G---LYSGLAGNIAGVLPASAVFVGIYEPTKRKLLETFPENLSAVAHFTAGAIGGIAASL  114

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             I  P+E VKQ+MQ    +++  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE
Sbjct  115   IRVPTEVVKQRMQT-GQFRSAPDAVRLIVGKEGFRGLYAGYGSFLLRDLPFDAIQFCIYE  173

Query  872   SLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVL  693
              L+  +   V    + N     + G  AG+     TTP DV+KTRL  Q   +NQY G++
Sbjct  174   QLR--IGYKVVAKRELNDPENALIGAFAGAITGAITTPLDVMKTRLMVQ-GSANQYSGIV  230

Query  692   HTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHEP  513
                + I + EG     +G+ PR++     G++FF   E  K +         A+R   EP
Sbjct  231   SCAQTILREEGPGAFLKGIEPRVLWIGIGGSIFFGVLEKTKSML--------AERRSREP  282

Query  512   CFGDD  498
               G D
Sbjct  283   PAGKD  287



>ref|XP_006842198.1| hypothetical protein AMTR_s00078p00165690 [Amborella trichopoda]
 gb|ERN03873.1| hypothetical protein AMTR_s00078p00165690 [Amborella trichopoda]
Length=313

 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 150/301 (50%), Gaps = 27/301 (9%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             KEKP        E   AG  AG+ V   L+P+DTIKT +Q+ +         G  +I + 
Sbjct  36    KEKPFDFFRTLFEGMIAGGTAGVVVETALYPIDTIKTRLQAAQG--------GGKIILQ-  86

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
                GLY G++ N+A   P SA++   YE  K  LL        + AH  AG     A+S 
Sbjct  87    ---GLYSGLAGNLAGVLPASAIFVGVYEPTKQKLLKIFPENLNAFAHLTAGAIGGAASSL  143

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             +  P+E VKQ+MQ    + +  +A+  I+   G   LYAG+G+ L R++P   I+F  YE
Sbjct  144   VRVPTEVVKQRMQT-GQFASAPSAVRLIVANEGFKGLYAGYGSFLLRDIPFDAIQFCIYE  202

Query  872   SLK---QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYD  702
              L+   ++++    +D +N      + G  AG+     TTP DV+KTRL  Q   +NQY 
Sbjct  203   QLRIGYKIVARRDLYDPENA-----LIGAFAGALTGAMTTPLDVIKTRLMVQ-GSTNQYK  256

Query  701   GVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTH  522
             G+   ++ I K EG   L +G+ PR++     G++FF   E  K    L L Q  A++  
Sbjct  257   GIFDCIQTIVKEEGPSALLKGIGPRVLWIGIGGSIFFGVLERTK----LILSQRDAKKKD  312

Query  521   H  519
             H
Sbjct  313   H  313



>emb|CDX89771.1| BnaA10g03110D [Brassica napus]
Length=397

 Score =   144 bits (362),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 101/269 (38%), Positives = 148/269 (55%), Gaps = 19/269 (7%)
 Frame = -3

Query  1343  FVSLCLHPMDTIKTVIQSCRADQ---KPFYYIGRSVISERGVLGLYRGissniassapis  1173
             F  +CL P+DTIKT +Q+  A Q     F  + ++   ERG+LG Y G+S+ I  S   S
Sbjct  112   FTYVCLLPLDTIKTKLQAKGASQLYSSSFDAVVKT-FQERGILGFYSGVSAVIVGSTFSS  170

Query  1172  ALYTFTYESVKGALLPFLHTEYQSV-AHCVAGGCASVATSFIFTPSERVKQQMQVRSHYK  996
             A+Y  T E  K  L  F   E+  V     AG   ++ +S I  P E + Q+MQV +  +
Sbjct  171   AVYFGTCEFGKSLLGKF--PEFPPVLIPPTAGAMGNIISSAIMVPKELITQRMQVGASGR  228

Query  995   NCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNN--  822
               +  L+ I+ + G+  LYAG+ A L RN+P  ++ + ++E LK  +    Q   QNN  
Sbjct  229   RSYQVLLEILEKDGILGLYAGYSATLLRNLPAGVLSYSSFEYLKAAVLEKTQ---QNNLE  285

Query  821   TLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV-------PGSNQYDGVLHTLKEIGKSE  663
              L ++ CG LAG+ +A  TTP DVVKTRL TQV        G+  YDGV  T+++I K E
Sbjct  286   PLQSVCCGALAGAISASITTPLDVVKTRLMTQVHVEAANKLGAAMYDGVAGTVRQILKEE  345

Query  662   GLKGLYRGLTPRLVMYMTQGALFFASYES  576
             GL G  RG+ PR+V      A+ + ++E+
Sbjct  346   GLVGFTRGMGPRVVHSACFSAIGYFAFET  374



>ref|XP_006473125.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=330

 Score =   142 bits (358),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 104/335 (31%), Positives = 163/335 (49%), Gaps = 28/335 (8%)
 Frame = -3

Query  1559  SSEKHSTSEYCACDETKYENRSDSGLDDYGPNQRFGGIECNSESEISVVAKEKPCHAL-A  1383
             S  K S   Y   DE    +   +G D+  P   F  +  N+E       ++KP + L  
Sbjct  8     SPTKSSVISYGLTDELVLRSELWNGRDE--PRVAFASV--NAE-------EDKPFNFLHV  56

Query  1382  KQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGis  1203
               + A AG  AG+FV   L+P+DTIKT +Q+     K              + GLY G+ 
Sbjct  57    LFDCAIAGGTAGVFVEAALYPIDTIKTRLQAAHGGGKI------------NLKGLYSGLV  104

Query  1202  sniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQ  1023
              N+A + P SA++   YE VK  LL        + AH  AG     A+S +  P+E +KQ
Sbjct  105   GNLAGAFPASAIFLGIYEPVKQKLLETFPENLSAFAHLTAGAVGGAASSLVRVPTEVIKQ  164

Query  1022  QMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSV  843
             ++Q    + +  +A+  I+RR GL  L+AG+G+ L R++P   I+F  YE L      + 
Sbjct  165   RIQT-GQFTSAPDAVRLIVRREGLKGLFAGYGSFLLRDLPFDAIQFCIYEQLLLGYKLAA  223

Query  842   QFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSE  663
             + ++ N      + G  AG+     T P DV+KTRL  Q   +NQY G+   +  I + E
Sbjct  224   RRNLSNTE--NAIVGAFAGAITGAVTAPLDVIKTRLMVQ-GSANQYKGICDCVSTIAREE  280

Query  662   GLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             G+  L++G+ PR++     G++FF   E  K + +
Sbjct  281   GISTLFKGMGPRVLWIGIGGSIFFGVLEKTKVVLA  315



>ref|XP_011044279.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X1 [Populus euphratica]
Length=313

 Score =   141 bits (356),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 149/296 (50%), Gaps = 18/296 (6%)
 Frame = -3

Query  1442  CNSESEISVVAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPF  1266
             C S + +S  A+ KP + L A  E   AG  AG+     L+P+DTIKT +Q+     K  
Sbjct  27    CRSFASVSA-AENKPFYFLHAVYEGIIAGGAAGVIAEAVLYPIDTIKTRLQAVHGGGK--  83

Query  1265  YYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCV  1086
                         + GLY G++ N+A   P SA++   YE  K  LL  L     +VA   
Sbjct  84    ----------INLKGLYSGLAGNLAGVLPASAIFVGVYEPTKQKLLKSLPENLSAVAQLT  133

Query  1085  AGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNV  906
             AG     A+S I  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+G+ L R++
Sbjct  134   AGAIGGAASSLIRVPTEVVKQRMQT-GQFASAPDAIHLIVSKEGFKGLYAGYGSFLLRDL  192

Query  905   PHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQ  726
             P   I+F  YE +      + + D ++  +   + G  AG+     TTP DVVKTRL  Q
Sbjct  193   PFDAIQFCIYEQMLMGYKLAAKRDPKDAEIA--IVGAFAGAITGAMTTPLDVVKTRLMVQ  250

Query  725   VPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
                +NQY G+    + I K EG + L +G+ PR++     GA+FF   E  +++ +
Sbjct  251   -GSANQYKGIFDCARTIAKEEGTRALLKGVGPRVLWIGVGGAIFFGVLEKTRQILA  305



>ref|XP_002524353.1| mitochondrial carrier protein, putative [Ricinus communis]
 gb|EEF38093.1| mitochondrial carrier protein, putative [Ricinus communis]
Length=328

 Score =   142 bits (357),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 142/287 (49%), Gaps = 17/287 (6%)
 Frame = -3

Query  1415  VAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             V  +KP   L A  E   AG +AG+     L+P+DTIKT +Q+     K           
Sbjct  42    VKDDKPVDFLGAFVEGLIAGGIAGVVADAALYPLDTIKTRLQAAHGGGKIM---------  92

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
                + GLY G+  N+A S P SAL+   YE VK  LL  L     S A   AG      +
Sbjct  93    ---LKGLYSGLGGNLAGSLPASALFVGVYEPVKQKLLKSLPENLSSFAQLTAGAVGGAIS  149

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             S +  P+E VKQ+MQ    + +  N +  I+ + G   LY G+G+ L R++P   ++F  
Sbjct  150   SLVRVPTEVVKQRMQT-GQFTSATNVVRVIVAKEGFKGLYVGYGSFLLRDLPFDAVQFCI  208

Query  878   YESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDG  699
             YE L      + Q D+++  +   V G  AG+     TTP DV+KTRL  Q  G NQY G
Sbjct  209   YEQLLTRYKLAAQRDLKDPEIA--VIGAFAGAITGALTTPLDVIKTRLMVQGSG-NQYKG  265

Query  698   VLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             +    + I + EG+  L +G+ PR++     G++FF   E  K++ +
Sbjct  266   IFDCARTISREEGVHALLKGIGPRVLWIGIGGSIFFGVLEKTKQMIA  312


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 85/196 (43%), Gaps = 23/196 (12%)
 Frame = -3

Query  1100  VAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAV  921
             V   +AGG A V       P + +K ++Q                    L  LY+G G  
Sbjct  55    VEGLIAGGIAGVVADAALYPLDTIKTRLQAAHGGGKIM-----------LKGLYSGLGGN  103

Query  920   LCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKT  741
             L  ++P S +    YE +KQ +  S+  ++  ++   L  G + G+ ++L   P +VVK 
Sbjct  104   LAGSLPASALFVGVYEPVKQKLLKSLPENL--SSFAQLTAGAVGGAISSLVRVPTEVVKQ  161

Query  740   RLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLF  561
             R+QT      Q+    + ++ I   EG KGLY G    L+  +   A+ F  YE      
Sbjct  162   RMQT-----GQFTSATNVVRVIVAKEGFKGLYVGYGSFLLRDLPFDAVQFCIYEQL----  212

Query  560   SLDLHQSSAQRTHHEP  513
              L  ++ +AQR   +P
Sbjct  213   -LTRYKLAAQRDLKDP  227



>emb|CBI21530.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   143 bits (360),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 140/273 (51%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R   K  +             GLY G++ N
Sbjct  94    EGIVAGGTAGVVVETALYPIDTIKTRLQAVRGGGKIVWN------------GLYSGLAGN  141

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE  K  LL        +VAH  AG    +A S +  P+E VKQ+M
Sbjct  142   LAGVLPASAIFVGVYEPTKQKLLQIFPENLTAVAHLTAGAIGGLAASLVRVPTEVVKQRM  201

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  I+ + G   LYAG+ + L R++P   I+F  YE ++     + + 
Sbjct  202   QT-GQFASAPDAVRMIVSKEGFKGLYAGYRSFLLRDLPFDAIQFCIYEQMRIGYKLAAKR  260

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+  N     + G  AG+     TTP DV+KTRL  Q P +NQY+G++  ++ I + EG 
Sbjct  261   DL--NDPENALIGAFAGALTGAITTPLDVIKTRLMVQGP-ANQYNGIIDCVQTIVREEGP  317

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L +G+ PR++     G++FF   E  KR  +
Sbjct  318   PALLKGIGPRVLWIGIGGSIFFGVLERTKRALA  350



>gb|EEC79066.1| hypothetical protein OsI_19641 [Oryza sativa Indica Group]
Length=288

 Score =   140 bits (354),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 103/305 (34%), Positives = 151/305 (50%), Gaps = 25/305 (8%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP + L    E   AG  AG+ V   L+P+DTIKT +Q+ R         G S I  +
Sbjct  7     EEKPFNFLQILCEGVIAGGTAGVVVETALYPIDTIKTRLQAAR---------GGSQIQWK  57

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
             G   LY G++ NIA   P SA++   YE  K  LL        +VAH  AG    +A S 
Sbjct  58    G---LYSGLAGNIAGVLPASAVFVGIYEPTKRKLLETFPENLSAVAHFTAGAIGGIAASL  114

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             I  P+E VKQ+MQ    +++  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE
Sbjct  115   IRVPTEVVKQRMQT-GQFRSAPDAVRLIVGKEGFRGLYAGYGSFLLRDLPFDAIQFCIYE  173

Query  872   SLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVL  693
              L+  +   +    + N     + G  AG+     TTP DV+KTRL  Q   +NQY G++
Sbjct  174   QLR--IGYKIVAKRELNDPENALIGAFAGAITGAITTPLDVMKTRLMVQ-GSANQYSGIV  230

Query  692   HTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHEP  513
                + I + EG     +G+ PR++     G++FF   E  K +         A+R   EP
Sbjct  231   SCAQTILREEGPGAFLKGIEPRVLWIGIGGSIFFGVLEKTKSML--------AERRSREP  282

Query  512   CFGDD  498
               G D
Sbjct  283   PAGKD  287



>ref|XP_002973887.1| hypothetical protein SELMODRAFT_100740, partial [Selaginella 
moellendorffii]
 gb|EFJ24842.1| hypothetical protein SELMODRAFT_100740, partial [Selaginella 
moellendorffii]
Length=285

 Score =   140 bits (354),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 147/285 (52%), Gaps = 13/285 (5%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVL-GLYRGiss  1200
             E A AGA AG+ V   L+P+DTIKT     R  +    +  R+  S + VL GLY G++ 
Sbjct  1     EGAIAGATAGVVVETVLYPIDTIKT-----RLQESSNLFAART--SGKIVLKGLYSGLAG  53

Query  1199  niassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQ  1020
             N+    P SA++   YE VK  L   L     S+AH  AG    +A S +  P+E VKQ+
Sbjct  54    NLLGVLPASAIFVGVYEPVKRKLEECLPDHLSSIAHLTAGATGGLAASLVRVPTEVVKQR  113

Query  1019  MQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQ  840
             MQ R  +     A+  I+   G   LYAG+G+ L R++P   I+F  YE LK       +
Sbjct  114   MQTR-EFPRAHIAVRSIVSNEGFRGLYAGFGSFLLRDLPFDAIQFCIYEQLKIGYKKMAR  172

Query  839   FDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEG  660
              D+ ++   T + G  AG+     TTP DV+KTRL  Q   SN Y G++  +++I + EG
Sbjct  173   RDLYDSE--TALVGAFAGALTGALTTPLDVIKTRLMIQ-GKSNAYKGIVDCVQKIVQEEG  229

Query  659   LKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRT  525
                L +G+ PR++     G++FF   E  K++     HQ    +T
Sbjct  230   AGALTKGIGPRVMWIGIGGSIFFGVLEKTKQVLEQS-HQKKVIKT  273



>ref|XP_008232365.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Prunus mume]
Length=324

 Score =   141 bits (356),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 92/273 (34%), Positives = 141/273 (52%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+      GLY G++ N
Sbjct  55    EGVIAGGTAGVVVETALYPIDTIKTRLQAARGG-------GKIVLK-----GLYSGLAGN  102

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE  K  LL        ++AH  AG    VA S +  P+E VKQ+M
Sbjct  103   LAGVLPASAIFVGVYEPTKQKLLKMFPENLSALAHFTAGAFGGVAASLVRVPTEVVKQRM  162

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  I  + G    YAG+G++L R++P   I+F  YE L+    ++ + 
Sbjct  163   QT-GQFTSASDAVRLIASKEGFKGFYAGYGSLLLRDLPFDAIQFCLYEQLRLGYKAAAKR  221

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             ++  N     + G  AG+     TTP DV+KTRL  Q   +NQY G++  ++ I + EG 
Sbjct  222   EL--NDPENAIIGAFAGALTGAATTPLDVIKTRLMVQ-GSANQYKGIIDCVQTIVREEGP  278

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L +G+ PR++     G++FF   E  KR  S
Sbjct  279   PALLKGIGPRVLWIGIGGSIFFGVLERTKRFLS  311



>ref|XP_006580309.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006580310.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X2 [Glycine max]
Length=326

 Score =   141 bits (356),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 99/311 (32%), Positives = 154/311 (50%), Gaps = 23/311 (7%)
 Frame = -3

Query  1439  NSESEISVVAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
             NS + +S+   EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R  +K   
Sbjct  32    NSFASVSM-GDEKPFDFLRILFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGEKLI-  89

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
                        + GLY G++ N+    P SAL+   YE +K  LL        +  H  A
Sbjct  90    -----------LKGLYSGLAGNLVGVLPASALFVGVYEPIKQKLLRVFPEHLSAFTHLTA  138

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             G    +A S I  P+E +KQ+MQ    + +   A+  I  + G    YAG+G+ L R++P
Sbjct  139   GAIGGIAASLIRVPTEVIKQRMQT-GQFTSASGAVRFIASKEGFKGFYAGYGSFLLRDLP  197

Query  902   HSIIKFYTYESLK--QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQT  729
                I+F  YE ++   ++++    +   N ++    G  AG+     TTP DV+KTRL  
Sbjct  198   FDAIQFCIYEQIRIGYMLAARRNLNDPENAII----GAFAGALTGAITTPLDVIKTRLMV  253

Query  728   QVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDL  549
             Q   +NQY G++  ++ I K EG +   +G+ PR++     G++FF   ES KR F  + 
Sbjct  254   Q-GSANQYKGIVDCVQTIIKEEGPRAFLKGIGPRVLWIGIGGSIFFGVLESTKR-FLAER  311

Query  548   HQSSAQRTHHE  516
               +  Q T+ E
Sbjct  312   RPTLPQNTYSE  322



>ref|XP_002306360.2| mitochondrial substrate carrier family protein [Populus trichocarpa]
 gb|EEE93356.2| mitochondrial substrate carrier family protein [Populus trichocarpa]
Length=312

 Score =   141 bits (355),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 94/274 (34%), Positives = 137/274 (50%), Gaps = 27/274 (10%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R   K                GLY G++ N
Sbjct  50    EGVIAGGTAGVVVETALYPIDTIKTRLQAARGGGKIMLK------------GLYSGLAGN  97

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SAL+   YE  K  LL        +VAH  AG    +A S I  P+E VKQ+M
Sbjct  98    LAGVLPASALFVGVYEPTKQKLLKTFPENLSAVAHLTAGAVGGIAASLIRVPTEVVKQRM  157

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  I+ + G    YAG+G+ L R++P   I+F  YE L+      + +
Sbjct  158   QT-GQFTSAPDAVRLIVSKEGFKGFYAGYGSFLLRDLPFDAIQFCIYEQLR------IGY  210

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEG  660
              + N  +     G  AG+     TTP DV+KTRL  Q  GS NQY G++  +  + + EG
Sbjct  211   RVANAAI-----GAFAGALTGAITTPLDVIKTRLMVQ--GSANQYKGIVDCVSTVVREEG  263

Query  659   LKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
                L +G+ PR++     G++FF   E  KRL +
Sbjct  264   PTALLKGIGPRVLWIGIGGSIFFGVLERTKRLLA  297



>emb|CDY18275.1| BnaC05g02980D [Brassica napus]
Length=397

 Score =   143 bits (360),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 101/269 (38%), Positives = 147/269 (55%), Gaps = 19/269 (7%)
 Frame = -3

Query  1343  FVSLCLHPMDTIKTVIQSCRADQ---KPFYYIGRSVISERGVLGLYRGissniassapis  1173
             F  +CL P+DTIKT +Q+  A Q     F  + ++   ERG+LG Y G+S+ I  S   S
Sbjct  112   FTYVCLLPLDTIKTKLQAKGASQLYSSSFDAVVKT-FQERGILGFYSGVSAVIVGSTFSS  170

Query  1172  ALYTFTYESVKGALLPFLHTEYQSV-AHCVAGGCASVATSFIFTPSERVKQQMQVRSHYK  996
             A+Y  T E  K  L  F   E+  V     AG   ++ +S I  P E + Q+MQV    +
Sbjct  171   AVYFGTCEFGKSLLGKF--PEFPPVLIPPTAGAMGNIVSSAIMVPKELITQRMQVGVSGR  228

Query  995   NCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNN--  822
               +  L+ I+ + G+  LYAG+ A L RN+P  ++ + ++E LK  +    Q   QNN  
Sbjct  229   RSYQVLLEILEKDGILGLYAGYSATLLRNLPAGVLSYSSFEYLKAAVLEKTQ---QNNLE  285

Query  821   TLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV-------PGSNQYDGVLHTLKEIGKSE  663
              L ++ CG LAG+ +A  TTP DVVKTRL TQV        G+  YDGV  T+++I K E
Sbjct  286   PLQSVCCGALAGAISASITTPLDVVKTRLMTQVHVEAANKLGAAMYDGVAGTVRQILKEE  345

Query  662   GLKGLYRGLTPRLVMYMTQGALFFASYES  576
             GL G  RG+ PR+V      A+ + ++E+
Sbjct  346   GLVGFTRGMGPRVVHSACFSAIGYFAFET  374


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 74/161 (46%), Gaps = 10/161 (6%)
 Frame = -3

Query  1043  PSERVKQQMQVRSH---YKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             P + +K ++Q +     Y + ++A++   +  G+   Y+G  AV+  +   S + F T E
Sbjct  119   PLDTIKTKLQAKGASQLYSSSFDAVVKTFQERGILGFYSGVSAVIVGSTFSSAVYFGTCE  178

Query  872   SLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVL  693
               K L+    +F      L+    G +    ++    P +++  R+Q  V G   Y    
Sbjct  179   FGKSLLGKFPEFP---PVLIPPTAGAMGNIVSSAIMVPKELITQRMQVGVSGRRSY----  231

Query  692   HTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFK  570
               L EI + +G+ GLY G +  L+  +  G L ++S+E  K
Sbjct  232   QVLLEILEKDGILGLYAGYSATLLRNLPAGVLSYSSFEYLK  272



>ref|XP_006580311.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X3 [Glycine max]
Length=288

 Score =   140 bits (352),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 96/300 (32%), Positives = 148/300 (49%), Gaps = 22/300 (7%)
 Frame = -3

Query  1406  EKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERG  1230
             EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R  +K              
Sbjct  4     EKPFDFLRILFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGEKLI------------  51

Query  1229  VLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFI  1050
             + GLY G++ N+    P SAL+   YE +K  LL        +  H  AG    +A S I
Sbjct  52    LKGLYSGLAGNLVGVLPASALFVGVYEPIKQKLLRVFPEHLSAFTHLTAGAIGGIAASLI  111

Query  1049  FTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYES  870
               P+E +KQ+MQ    + +   A+  I  + G    YAG+G+ L R++P   I+F  YE 
Sbjct  112   RVPTEVIKQRMQT-GQFTSASGAVRFIASKEGFKGFYAGYGSFLLRDLPFDAIQFCIYEQ  170

Query  869   LK--QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGV  696
             ++   ++++    +   N ++    G  AG+     TTP DV+KTRL  Q   +NQY G+
Sbjct  171   IRIGYMLAARRNLNDPENAII----GAFAGALTGAITTPLDVIKTRLMVQ-GSANQYKGI  225

Query  695   LHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHE  516
             +  ++ I K EG +   +G+ PR++     G++FF   ES KR F  +   +  Q T+ E
Sbjct  226   VDCVQTIIKEEGPRAFLKGIGPRVLWIGIGGSIFFGVLESTKR-FLAERRPTLPQNTYSE  284



>ref|XP_007205556.1| hypothetical protein PRUPE_ppa008636mg [Prunus persica]
 gb|EMJ06755.1| hypothetical protein PRUPE_ppa008636mg [Prunus persica]
Length=324

 Score =   140 bits (354),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/273 (34%), Positives = 140/273 (51%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+      GLY G++ N
Sbjct  55    EGVIAGGTAGVVVETALYPIDTIKTRLQAARGG-------GKIVLK-----GLYSGLAGN  102

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE  K  LL        ++AH  AG    VA S +  P+E VKQ+M
Sbjct  103   LAGVLPASAIFVGVYEPTKQKLLKMFPENLSALAHFTAGAFGGVAASLVRVPTEVVKQRM  162

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  I  + G    YAG+G+ L R++P   I+F  YE L+    ++ + 
Sbjct  163   QT-GQFTSASDAVRLIASKEGFKGFYAGYGSFLLRDLPFDAIQFCLYEQLRLGYKAAAKR  221

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             ++  N     + G  AG+     TTP DV+KTRL  Q   +NQY G++  ++ I + EG 
Sbjct  222   EL--NDPENAIIGAFAGALTGAATTPLDVIKTRLMVQ-GSANQYKGIIDCVQTIVREEGP  278

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L +G+ PR++     G++FF   E  KR  S
Sbjct  279   PALLKGIGPRVLWIGIGGSIFFGVLERTKRFLS  311



>ref|XP_006473127.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X4 [Citrus sinensis]
 ref|XP_006473128.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X5 [Citrus sinensis]
Length=276

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/277 (33%), Positives = 144/277 (52%), Gaps = 16/277 (6%)
 Frame = -3

Query  1388  LAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRG  1209
             +A  + A AG  AG+FV   L+P+DTIKT +Q+     K         I+ +G   LY G
Sbjct  1     MAFADCAIAGGTAGVFVEAALYPIDTIKTRLQAAHGGGK---------INLKG---LYSG  48

Query  1208  issniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERV  1029
             +  N+A + P SA++   YE VK  LL        + AH  AG     A+S +  P+E +
Sbjct  49    LVGNLAGAFPASAIFLGIYEPVKQKLLETFPENLSAFAHLTAGAVGGAASSLVRVPTEVI  108

Query  1028  KQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSS  849
             KQ++Q    + +  +A+  I+RR GL  L+AG+G+ L R++P   I+F  YE L      
Sbjct  109   KQRIQT-GQFTSAPDAVRLIVRREGLKGLFAGYGSFLLRDLPFDAIQFCIYEQLLLGYKL  167

Query  848   SVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGK  669
             + + ++ N      + G  AG+     T P DV+KTRL  Q   +NQY G+   +  I +
Sbjct  168   AARRNLSNTE--NAIVGAFAGAITGAVTAPLDVIKTRLMVQ-GSANQYKGICDCVSTIAR  224

Query  668   SEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
              EG+  L++G+ PR++     G++FF   E  K + +
Sbjct  225   EEGISTLFKGMGPRVLWIGIGGSIFFGVLEKTKVVLA  261



>ref|XP_006473126.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X3 [Citrus sinensis]
Length=323

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 139/271 (51%), Gaps = 16/271 (6%)
 Frame = -3

Query  1370  AFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnia  1191
             A AG  AG+FV   L+P+DTIKT +Q+     K              + GLY G+  N+A
Sbjct  54    AIAGGTAGVFVEAALYPIDTIKTRLQAAHGGGKI------------NLKGLYSGLVGNLA  101

Query  1190  ssapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQV  1011
              + P SA++   YE VK  LL        + AH  AG     A+S +  P+E +KQ++Q 
Sbjct  102   GAFPASAIFLGIYEPVKQKLLETFPENLSAFAHLTAGAVGGAASSLVRVPTEVIKQRIQT  161

Query  1010  RSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDI  831
                + +  +A+  I+RR GL  L+AG+G+ L R++P   I+F  YE L      + + ++
Sbjct  162   -GQFTSAPDAVRLIVRREGLKGLFAGYGSFLLRDLPFDAIQFCIYEQLLLGYKLAARRNL  220

Query  830   QNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKG  651
              N      + G  AG+     T P DV+KTRL  Q   +NQY G+   +  I + EG+  
Sbjct  221   SNTE--NAIVGAFAGAITGAVTAPLDVIKTRLMVQ-GSANQYKGICDCVSTIAREEGIST  277

Query  650   LYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             L++G+ PR++     G++FF   E  K + +
Sbjct  278   LFKGMGPRVLWIGIGGSIFFGVLEKTKVVLA  308



>gb|KHN17041.1| Putative mitochondrial carrier C12B10.09 [Glycine soja]
Length=297

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/281 (35%), Positives = 145/281 (52%), Gaps = 24/281 (9%)
 Frame = -3

Query  1367  FAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnias  1188
              AG  AG+ V   L+P+DTIKT +Q  R         G+ V+      GLY G++ NI  
Sbjct  33    IAGGAAGVVVETALYPIDTIKTRLQVARDG-------GKIVLK-----GLYSGLAGNIVG  80

Query  1187  sapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVR  1008
               P SA++   YE  K  LL  L     +VAH  AG    +A+S +  P+E VKQ+MQ+ 
Sbjct  81    VLPASAIFIGVYEPTKQQLLKSLPENLSAVAHFAAGAIGGIASSVVRVPTEVVKQRMQI-  139

Query  1007  SHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK---QLMSSSVQF  837
               +K+  +A+  I+   G   L+AG+G+ L R++P   I+   YE L+   +L +     
Sbjct  140   GQFKSAPDAVRLIVANEGFKGLFAGYGSFLLRDLPFDAIELCIYEQLRIGYKLAAKRDPN  199

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEG  660
             D +N  L     G +AG+     TTP DVVKTRL  Q  GS N Y G+   ++ I K EG
Sbjct  200   DPENAML-----GAVAGAVTGAVTTPLDVVKTRLMVQ--GSQNHYKGISDCVRTIVKEEG  252

Query  659   LKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSS  537
                L++G+ PR++     G++FF   E  K++ +   H  +
Sbjct  253   SHALFKGIGPRVLWIGIGGSIFFCVLEKTKKILAQKRHSKA  293


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 86/207 (42%), Gaps = 32/207 (15%)
 Frame = -3

Query  1124  FLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGG---  954
             FL   Y     C+AGG A V       P + +K ++QV               R GG   
Sbjct  24    FLRVLYDG---CIAGGAAGVVVETALYPIDTIKTRLQVA--------------RDGGKIV  66

Query  953   LPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAA  774
             L  LY+G    +   +P S I    YE  KQ +  S+  ++  + +     G + G  ++
Sbjct  67    LKGLYSGLAGNIVGVLPASAIFIGVYEPTKQQLLKSLPENL--SAVAHFAAGAIGGIASS  124

Query  773   LFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALF  594
             +   P +VVK R+Q       Q+      ++ I  +EG KGL+ G    L+  +   A+ 
Sbjct  125   VVRVPTEVVKQRMQI-----GQFKSAPDAVRLIVANEGFKGLFAGYGSFLLRDLPFDAIE  179

Query  593   FASYESFKRLFSLDLHQSSAQRTHHEP  513
                YE  +  + L     +A+R  ++P
Sbjct  180   LCIYEQLRIGYKL-----AAKRDPNDP  201



>ref|XP_007159774.1| hypothetical protein PHAVU_002G266200g [Phaseolus vulgaris]
 gb|ESW31768.1| hypothetical protein PHAVU_002G266200g [Phaseolus vulgaris]
Length=327

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 154/311 (50%), Gaps = 23/311 (7%)
 Frame = -3

Query  1439  NSESEISVVAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
             NS + +S+   EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R  +K   
Sbjct  32    NSFASVSM-GDEKPFDFLRTLFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGEKLI-  89

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
                        + GLY G++ N+A   P SAL+   YE +K  LL        + +H  A
Sbjct  90    -----------LKGLYSGLAGNLAGVLPASALFVGVYEPIKQKLLRIFPENLSAFSHLTA  138

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             G    +A S I  P+E +KQ+MQ    + +   A+  I  +      YAG+G+ L R++P
Sbjct  139   GAIGGLAASLIRVPTEVIKQRMQT-GQFTSASGAVRFIASKERFKGFYAGYGSFLLRDLP  197

Query  902   HSIIKFYTYESLK--QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQT  729
                I+F  YE ++   ++++    +   N     V G  AG+     TTP DV+KTRL  
Sbjct  198   FDAIQFCIYEQIRIGYMLAARRNLNDPENA----VIGAFAGALTGAITTPLDVIKTRLMV  253

Query  728   QVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDL  549
             Q   +NQY G++  ++ I K EG     +G+ PR++     G++FF   ES KR F  + 
Sbjct  254   Q-GSANQYKGIVDCVQTIIKEEGPSAFLKGIGPRVLWIGIGGSIFFGVLESTKR-FLAER  311

Query  548   HQSSAQRTHHE  516
               + +Q TH +
Sbjct  312   RPTVSQHTHSD  322



>gb|ACU23159.1| unknown [Glycine max]
Length=306

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/281 (35%), Positives = 145/281 (52%), Gaps = 24/281 (9%)
 Frame = -3

Query  1367  FAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnias  1188
              AG  AG+ V   L+P+DTIKT +Q  R         G+ V+      GLY G++ NI  
Sbjct  33    IAGGAAGVVVETALYPIDTIKTRLQVARDG-------GKIVLK-----GLYSGLAGNIVG  80

Query  1187  sapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVR  1008
               P SA++   YE  K  LL  L     +VAH  AG    +A+S +  P+E VKQ+MQ+ 
Sbjct  81    VLPASAIFIGVYEPTKQQLLKSLPENLSAVAHFAAGAIGGIASSVVRVPTEVVKQRMQI-  139

Query  1007  SHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK---QLMSSSVQF  837
               +K+  +A+  I+   G   L+AG+G+ L R++P   I+   YE L+   +L +     
Sbjct  140   GQFKSAPDAVRLIVANEGFKGLFAGYGSFLLRDLPFDAIELCIYEQLRIGYKLAAKRDPN  199

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEG  660
             D +N  L     G +AG+     TTP DVVKTRL  Q  GS N Y G+   ++ I K EG
Sbjct  200   DPENAML-----GAVAGAVTGAVTTPLDVVKTRLMVQ--GSQNHYKGISDCVRTIVKEEG  252

Query  659   LKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSS  537
                L++G+ PR++     G++FF   E  K++ +   H  +
Sbjct  253   SHALFKGIGPRVLWIGIGGSIFFCVLEKTKKILAQKWHSKA  293


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 86/207 (42%), Gaps = 32/207 (15%)
 Frame = -3

Query  1124  FLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGG---  954
             FL   Y     C+AGG A V       P + +K ++QV               R GG   
Sbjct  24    FLRVLYDG---CIAGGAAGVVVETALYPIDTIKTRLQVA--------------RDGGKIV  66

Query  953   LPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAA  774
             L  LY+G    +   +P S I    YE  KQ +  S+  ++  + +     G + G  ++
Sbjct  67    LKGLYSGLAGNIVGVLPASAIFIGVYEPTKQQLLKSLPENL--SAVAHFAAGAIGGIASS  124

Query  773   LFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALF  594
             +   P +VVK R+Q       Q+      ++ I  +EG KGL+ G    L+  +   A+ 
Sbjct  125   VVRVPTEVVKQRMQI-----GQFKSAPDAVRLIVANEGFKGLFAGYGSFLLRDLPFDAIE  179

Query  593   FASYESFKRLFSLDLHQSSAQRTHHEP  513
                YE  +  + L     +A+R  ++P
Sbjct  180   LCIYEQLRIGYKL-----AAKRDPNDP  201



>ref|XP_003558587.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Brachypodium distachyon]
Length=287

 Score =   139 bits (349),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 101/308 (33%), Positives = 151/308 (49%), Gaps = 31/308 (10%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +E+P + L    E   AG  AG+ V   L+P+DTIKT +Q+ +A        G  +  E 
Sbjct  6     QERPFNFLQVLCEGVIAGGAAGVVVEAALYPIDTIKTRLQAVQA--------GSQIQWE-  56

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
                GLY G+  N+    P SAL+   YE  K  LL  L     +VAH  AG     A S 
Sbjct  57    ---GLYSGLGGNLVGVLPASALFVGIYEPTKKKLLDVLPENLSAVAHLTAGAVGGFAASL  113

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
                P+E +KQ+MQ    +++  NA+  I+R+ G   LYAG+G+ L R++P   I+F  YE
Sbjct  114   FRVPTEVIKQRMQT-GQFRSAPNAVRLIVRKEGFKGLYAGYGSFLLRDLPFDAIQFCIYE  172

Query  872   SLK---QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYD  702
              L+   +L++     D +N      + G  AG+     TTP DV+KTRL  Q   + QY 
Sbjct  173   QLRIGYKLVAKRELNDPENA-----LIGAFAGAITGAITTPLDVLKTRLMVQ-GQTKQYS  226

Query  701   GVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTH  522
             G++   + I + EG     RG+ PR++     G++FF   E  K +         A+R+ 
Sbjct  227   GIVSCAQTILREEGPVAFLRGIEPRVLWIGIGGSIFFGVLEKTKAVL--------AERSS  278

Query  521   HEPCFGDD  498
             H+     D
Sbjct  279   HKTLADKD  286



>ref|XP_009119223.1| PREDICTED: protein MITOFERRINLIKE 1, chloroplastic isoform X1 
[Brassica rapa]
Length=397

 Score =   141 bits (355),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 101/269 (38%), Positives = 146/269 (54%), Gaps = 19/269 (7%)
 Frame = -3

Query  1343  FVSLCLHPMDTIKTVIQSCRADQ---KPFYYIGRSVISERGVLGLYRGissniassapis  1173
             F  +CL P+DTIKT +Q+  A Q     F  + ++   ERG+LG Y G+S+ I  S   S
Sbjct  112   FTYVCLLPLDTIKTKLQAKGASQLYSSSFDAVVKT-FQERGILGFYSGVSAVIVGSTFSS  170

Query  1172  ALYTFTYESVKGALLPFLHTEYQSV-AHCVAGGCASVATSFIFTPSERVKQQMQVRSHYK  996
             A+Y  T E  K  L  F   E+  V     AG   ++ +S I  P E + Q+MQV +  +
Sbjct  171   AVYFGTCEFGKSLLGKF--PEFPPVLIPPTAGAMGNIISSAIMVPKELITQRMQVGASGR  228

Query  995   NCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNN--  822
               +  L+ I+ + G+  LYAG+ A L RN+P  ++ + ++E LK  +    Q   QNN  
Sbjct  229   RSYQVLLEILEKDGILGLYAGYSATLLRNLPAGVLSYSSFEYLKAAVLEKTQ---QNNLE  285

Query  821   TLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQV-------PGSNQYDGVLHTLKEIGKSE  663
              L ++ CG LAG+ +A  TTP DVVKTRL TQV        G+  YDGV    K+I K E
Sbjct  286   PLQSVCCGALAGAISASITTPLDVVKTRLMTQVHVEAANKLGAAMYDGVAGAGKQILKEE  345

Query  662   GLKGLYRGLTPRLVMYMTQGALFFASYES  576
             GL G  RG+ PR+V      A+ + ++E+
Sbjct  346   GLVGFTRGMGPRVVHSACFSAIGYFAFET  374



>ref|XP_007159773.1| hypothetical protein PHAVU_002G266200g [Phaseolus vulgaris]
 gb|ESW31767.1| hypothetical protein PHAVU_002G266200g [Phaseolus vulgaris]
Length=289

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 148/300 (49%), Gaps = 22/300 (7%)
 Frame = -3

Query  1406  EKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERG  1230
             EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+ R  +K              
Sbjct  4     EKPFDFLRTLFEGVIAGGTAGVVVETALYPIDTIKTRLQAARGGEKLI------------  51

Query  1229  VLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFI  1050
             + GLY G++ N+A   P SAL+   YE +K  LL        + +H  AG    +A S I
Sbjct  52    LKGLYSGLAGNLAGVLPASALFVGVYEPIKQKLLRIFPENLSAFSHLTAGAIGGLAASLI  111

Query  1049  FTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYES  870
               P+E +KQ+MQ    + +   A+  I  +      YAG+G+ L R++P   I+F  YE 
Sbjct  112   RVPTEVIKQRMQT-GQFTSASGAVRFIASKERFKGFYAGYGSFLLRDLPFDAIQFCIYEQ  170

Query  869   LK--QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGV  696
             ++   ++++    +   N     V G  AG+     TTP DV+KTRL  Q   +NQY G+
Sbjct  171   IRIGYMLAARRNLNDPENA----VIGAFAGALTGAITTPLDVIKTRLMVQ-GSANQYKGI  225

Query  695   LHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHE  516
             +  ++ I K EG     +G+ PR++     G++FF   ES KR F  +   + +Q TH +
Sbjct  226   VDCVQTIIKEEGPSAFLKGIGPRVLWIGIGGSIFFGVLESTKR-FLAERRPTVSQHTHSD  284



>gb|KFK32946.1| hypothetical protein AALP_AA6G309900 [Arabis alpina]
Length=382

 Score =   140 bits (354),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 97/263 (37%), Positives = 148/263 (56%), Gaps = 11/263 (4%)
 Frame = -3

Query  1343  FVSLCLHPMDTIKTVIQSCRADQ---KPFYYIGRSVISERGVLGLYRGissniassapis  1173
             F  +CLHP+DTIKT +Q+  A Q     F  I ++   E+G+LG Y G+S+ I  S   S
Sbjct  106   FTYVCLHPLDTIKTKLQTKGASQLYSSSFDAIVKT-FQEKGILGFYSGVSAVIVGSTFSS  164

Query  1172  ALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKN  993
             A+Y  T E  K +LL   H     +    AG   ++ +S I  P E + Q+MQV +  ++
Sbjct  165   AVYFGTCEFGK-SLLSKFHGFPPVLIPPTAGAMGNIISSAIMVPKELITQRMQVGAGVRS  223

Query  992   CWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNN--T  819
              +  L+ I+ + G+  LYAG+ A L RN+P  ++ + ++E LK  +   +Q   Q N   
Sbjct  224   -YQVLLQILEKDGILGLYAGYSATLLRNLPAGVLSYSSFEYLKAAVLERMQ---QTNLEP  279

Query  818   LMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRG  639
             L ++ CG LAG+ +A  TTP DVVKTRL TQ+  +  Y GV  T+++I   EGL G  RG
Sbjct  280   LQSVCCGALAGAISASITTPLDVVKTRLMTQIHVAAMYTGVAGTVRQIVTEEGLVGFTRG  339

Query  638   LTPRLVMYMTQGALFFASYESFK  570
             + PR+V      A+ + ++E+ K
Sbjct  340   MGPRVVHSACFSAIGYFAFETAK  362



>ref|XP_006473124.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X1 [Citrus sinensis]
Length=331

 Score =   139 bits (351),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 139/271 (51%), Gaps = 16/271 (6%)
 Frame = -3

Query  1370  AFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnia  1191
             A AG  AG+FV   L+P+DTIKT +Q+     K              + GLY G+  N+A
Sbjct  62    AIAGGTAGVFVEAALYPIDTIKTRLQAAHGGGKI------------NLKGLYSGLVGNLA  109

Query  1190  ssapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQV  1011
              + P SA++   YE VK  LL        + AH  AG     A+S +  P+E +KQ++Q 
Sbjct  110   GAFPASAIFLGIYEPVKQKLLETFPENLSAFAHLTAGAVGGAASSLVRVPTEVIKQRIQT  169

Query  1010  RSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDI  831
                + +  +A+  I+RR GL  L+AG+G+ L R++P   I+F  YE L      + + ++
Sbjct  170   -GQFTSAPDAVRLIVRREGLKGLFAGYGSFLLRDLPFDAIQFCIYEQLLLGYKLAARRNL  228

Query  830   QNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKG  651
              N      + G  AG+     T P DV+KTRL  Q   +NQY G+   +  I + EG+  
Sbjct  229   SNTE--NAIVGAFAGAITGAVTAPLDVIKTRLMVQ-GSANQYKGICDCVSTIAREEGIST  285

Query  650   LYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             L++G+ PR++     G++FF   E  K + +
Sbjct  286   LFKGMGPRVLWIGIGGSIFFGVLEKTKVVLA  316



>ref|XP_002263642.1| PREDICTED: protein MITOFERRINLIKE 1, chloroplastic [Vitis vinifera]
Length=401

 Score =   141 bits (355),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 106/280 (38%), Positives = 148/280 (53%), Gaps = 23/280 (8%)
 Frame = -3

Query  1343  FVSLCLHPMDTIKTVIQSCRADQKPFYYIGR-----SVISERGVLGLYRGissniassap  1179
             F   CLHP+DTIKT +Q+  A +    Y G          ERGVLG Y GIS+ I  SA 
Sbjct  117   FTYFCLHPLDTIKTKLQTRGASE---IYKGTLDAIVKTFQERGVLGFYSGISAVIVGSAA  173

Query  1178  isALYTFTYESVKGALLPFLHTEYQSV-AHCVAGGCASVATSFIFTPSERVKQQMQVRSH  1002
              SA+Y  T E  K  L      +Y S+     AG   ++ +S I  P E + Q+MQ  + 
Sbjct  174   SSAVYFGTCEFGKSILAKV--PQYPSLLIPPTAGAMGNIMSSAIMVPKELITQRMQAGAK  231

Query  1001  YKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNN  822
              ++ W  L+GI+ R G+  LYAG+ A L RN+P  ++ + ++E LK  + S  + D    
Sbjct  232   GRS-WQVLLGILERDGILGLYAGYSATLLRNLPAGVLSYSSFEYLKAAVLSRTKND-SLE  289

Query  821   TLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPG-------SNQYDGVLHTLKEIGKSE  663
                ++ CG LAG+ +A  TTP DVVKTRL TQV G       +  Y GV  T+K+I + E
Sbjct  290   PFQSVCCGALAGAISASLTTPLDVVKTRLMTQVHGEAINKVSAAMYSGVSATVKQILRDE  349

Query  662   GLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQ  543
             G  GL  G+ PR+V      AL + ++E+ K      LHQ
Sbjct  350   GWVGLTSGMGPRVVHSACFSALGYFAFETAKMAI---LHQ  386



>gb|KDO83816.1| hypothetical protein CISIN_1g020666mg [Citrus sinensis]
Length=323

 Score =   139 bits (351),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 138/271 (51%), Gaps = 16/271 (6%)
 Frame = -3

Query  1370  AFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnia  1191
             A AG  AG+FV   L+P+DTIKT +Q+     K              + GLY G+  N+A
Sbjct  54    AIAGGTAGVFVEAALYPIDTIKTRLQAAHGGGKI------------NLKGLYSGLVGNLA  101

Query  1190  ssapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQV  1011
              + P SA++   YE VK  LL        + AH  AG     A+S +  P+E +KQ++Q 
Sbjct  102   GAFPASAIFLGIYEPVKQKLLETFPENLSAFAHLTAGAVGGAASSLVRVPTEVIKQRIQT  161

Query  1010  RSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDI  831
                + +  +A+  I+RR GL  L+AG+G+ L R++P   I+F  YE L      + +  +
Sbjct  162   -GQFTSAPDAVRLIVRREGLKGLFAGYGSFLLRDLPFDAIQFCIYEQLLLGYKLAARRSL  220

Query  830   QNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKG  651
              N      + G  AG+     T P DV+KTRL  Q   +NQY G+   +  I + EG+  
Sbjct  221   SNAE--NAIVGAFAGAITGAVTAPLDVIKTRLMVQ-GSANQYKGICDCVSTIAREEGIST  277

Query  650   LYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             L++G+ PR++     G++FF   E  K + +
Sbjct  278   LFKGMGPRVLWIGIGGSIFFGVLEKTKEVLA  308


 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 81/195 (42%), Gaps = 21/195 (11%)
 Frame = -3

Query  1124  FLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPS  945
             FLH  +      +AGG A V       P + +K ++Q  +H     N          L  
Sbjct  46    FLHVLFDC---AIAGGTAGVFVEAALYPIDTIKTRLQA-AHGGGKIN----------LKG  91

Query  944   LYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFT  765
             LY+G    L    P S I    YE +KQ +  +  F    +    L  G + G+ ++L  
Sbjct  92    LYSGLVGNLAGAFPASAIFLGIYEPVKQKLLET--FPENLSAFAHLTAGAVGGAASSLVR  149

Query  764   TPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFAS  585
              P +V+K R+QT      Q+      ++ I + EGLKGL+ G    L+  +   A+ F  
Sbjct  150   VPTEVIKQRIQT-----GQFTSAPDAVRLIVRREGLKGLFAGYGSFLLRDLPFDAIQFCI  204

Query  584   YESFKRLFSLDLHQS  540
             YE     + L   +S
Sbjct  205   YEQLLLGYKLAARRS  219



>ref|XP_005645456.1| mitochondrial carrier [Coccomyxa subellipsoidea C-169]
 gb|EIE20912.1| mitochondrial carrier [Coccomyxa subellipsoidea C-169]
Length=312

 Score =   139 bits (350),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 91/262 (35%), Positives = 139/262 (53%), Gaps = 11/262 (4%)
 Frame = -3

Query  1331  CLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTY  1152
              L+P+DTIKT +Q+  +         R++    G   LY G+  N+A   P SA++   Y
Sbjct  48    ALYPLDTIKTRLQTATSGGGL-----RALWQSGGNKALYSGVLGNLAGVVPASAIFMGVY  102

Query  1151  ESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIG  972
             E VK A+   +    Q +     G  A +A SF+  P+E VKQ+MQ    +     A+ G
Sbjct  103   EPVKTAVERRVPENRQFLGSLSGGVAAGLAASFVRVPTEVVKQRMQT-GEFTGAIRAVQG  161

Query  971   IIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLM----TLV  804
             I+RR G   L+AG+G+ L R++P   I+F  YE LK+   +S++      T +    T V
Sbjct  162   IVRREGARGLFAGYGSFLLRDLPFDAIEFMAYEQLKKAYKASLKRGTSGRTELSAGETSV  221

Query  803   CGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRL  624
              G LAG+   L TTP DV+KTRL TQ   S +YDG+    ++I + EG    ++G  PR+
Sbjct  222   VGALAGAVTGLVTTPLDVIKTRLMTQGV-SRKYDGIFDCARKIAQQEGTATFFKGWEPRV  280

Query  623   VMYMTQGALFFASYESFKRLFS  558
             +     G +FF + E  K+L++
Sbjct  281   LWISIGGCVFFTALEEAKKLYA  302


 Score = 62.4 bits (150),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 82/175 (47%), Gaps = 13/175 (7%)
 Frame = -3

Query  1043  PSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK  864
             P + +K ++Q  +        L  + + GG  +LY+G    L   VP S I    YE +K
Sbjct  51    PLDTIKTRLQTATSG----GGLRALWQSGGNKALYSGVLGNLAGVVPASAIFMGVYEPVK  106

Query  863   QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFT-TPFDVVKTRLQTQVPGSNQYDGVLHT  687
               +   V    +N   +  + GG+A   AA F   P +VVK R+QT      ++ G +  
Sbjct  107   TAVERRVP---ENRQFLGSLSGGVAAGLAASFVRVPTEVVKQRMQT-----GEFTGAIRA  158

Query  686   LKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTH  522
             ++ I + EG +GL+ G    L+  +   A+ F +YE  K+ +   L + ++ RT 
Sbjct  159   VQGIVRREGARGLFAGYGSFLLRDLPFDAIEFMAYEQLKKAYKASLKRGTSGRTE  213



>ref|XP_010314471.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X2 [Solanum lycopersicum]
Length=307

 Score =   139 bits (349),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 138/257 (54%), Gaps = 16/257 (6%)
 Frame = -3

Query  1328  LHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYE  1149
             L+P+DTIKT +Q+ R         G  +I +    GLY G++ N+    P SA++   YE
Sbjct  61    LYPIDTIKTRLQAVRG--------GGQIILK----GLYSGLAGNLVGVLPASAIFVGVYE  108

Query  1148  SVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGI  969
               K  LL        ++AH  AG     A+S +  P+E VKQ+MQ    + +  +A+  I
Sbjct  109   PTKRKLLDSFPENLSALAHLTAGAIGGAASSIVRVPTEVVKQRMQT-GQFSSAPDAVRLI  167

Query  968   IRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLA  789
             + + G   LYAG+G+ L R++P   I+F  YE L+     + + D++++     + G  A
Sbjct  168   VAKEGFRGLYAGYGSFLLRDLPFDAIQFCLYEQLRMGYKLAAKRDLKDSE--NAMIGAFA  225

Query  788   GSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMT  609
             G+     TTP DV+KTRL  Q   + QY+G+LH +K I + EG   L++G+ PR++    
Sbjct  226   GAITGAITTPLDVIKTRLMVQ-GSAKQYEGILHCVKTIARDEGASTLFKGIGPRVLWIGI  284

Query  608   QGALFFASYESFKRLFS  558
              G++FF   E  K+L +
Sbjct  285   GGSIFFGVLERTKKLVA  301



>ref|XP_004252565.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X1 [Solanum lycopersicum]
Length=308

 Score =   139 bits (349),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 138/257 (54%), Gaps = 16/257 (6%)
 Frame = -3

Query  1328  LHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYE  1149
             L+P+DTIKT +Q+ R         G  +I +    GLY G++ N+    P SA++   YE
Sbjct  62    LYPIDTIKTRLQAVRG--------GGQIILK----GLYSGLAGNLVGVLPASAIFVGVYE  109

Query  1148  SVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGI  969
               K  LL        ++AH  AG     A+S +  P+E VKQ+MQ    + +  +A+  I
Sbjct  110   PTKRKLLDSFPENLSALAHLTAGAIGGAASSIVRVPTEVVKQRMQT-GQFSSAPDAVRLI  168

Query  968   IRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLA  789
             + + G   LYAG+G+ L R++P   I+F  YE L+     + + D++++     + G  A
Sbjct  169   VAKEGFRGLYAGYGSFLLRDLPFDAIQFCLYEQLRMGYKLAAKRDLKDSE--NAMIGAFA  226

Query  788   GSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMT  609
             G+     TTP DV+KTRL  Q   + QY+G+LH +K I + EG   L++G+ PR++    
Sbjct  227   GAITGAITTPLDVIKTRLMVQ-GSAKQYEGILHCVKTIARDEGASTLFKGIGPRVLWIGI  285

Query  608   QGALFFASYESFKRLFS  558
              G++FF   E  K+L +
Sbjct  286   GGSIFFGVLERTKKLVA  302



>ref|XP_010665074.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X7 [Vitis vinifera]
Length=318

 Score =   139 bits (349),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 154/299 (52%), Gaps = 18/299 (6%)
 Frame = -3

Query  1448  IECNSESEISVVAKE-KPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQ  1275
             ++C+S+ E     KE KP   L    E   AG +AG+ V   L+P+DTIKT +Q+     
Sbjct  21    LKCSSQREQKKSFKEDKPFSFLHVFWEGLVAGGIAGVVVEAALYPIDTIKTRLQAAHGG-  79

Query  1274  KPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVA  1095
                   G+ V+      GLY G++ N+A   P SA++   YE  K  LL  +     + A
Sbjct  80    ------GKIVLK-----GLYSGLAGNLAGVLPASAIFVGVYEPTKQKLLKTIPENLSAFA  128

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLC  915
             H  AG     A+S +  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+G+ L 
Sbjct  129   HLTAGAVGGAASSLVRVPTEVVKQRMQT-GQFASATDAVQLIVAKEGFKGLYAGYGSFLL  187

Query  914   RNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRL  735
             R++P   ++F  YE L+     + Q D+  N     + G  +G+     TTP DV+KTRL
Sbjct  188   RDLPFDALQFCIYEQLRIGYKLAAQRDL--NDPENAMIGAFSGAITGAITTPLDVIKTRL  245

Query  734   QTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               Q   +NQY G+   ++ + + EG   L++G+ PR++     G++FF   E  K++ +
Sbjct  246   MVQ-GSANQYKGIFDCVRTVIREEGTPALFKGIGPRVLWIGIGGSIFFVILERTKQVVA  303



>ref|XP_008793473.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Phoenix dactylifera]
Length=326

 Score =   139 bits (349),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 149/302 (49%), Gaps = 20/302 (7%)
 Frame = -3

Query  1415  VAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             V  EKP + L    E   AG  AG+ V   L+P+DTIKT +Q+     K ++        
Sbjct  40    VGGEKPLNFLRVFCEGIIAGGTAGVVVETVLYPIDTIKTRLQAAHGGSKIYWK-------  92

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
                  GLY G++ N+A   P SA++   YE  K  LL        + AH  AG     A+
Sbjct  93    -----GLYSGLAGNLAGVLPASAVFVGIYEPTKRKLLEVFPANLSAFAHLTAGAIGGAAS  147

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             S I  P+E VKQ+MQ    + +  +A+  II + G   LYAG+ + L R++P   I+F  
Sbjct  148   SLIRVPTEVVKQRMQT-GQFASAPDAVRLIIAKEGFRGLYAGYSSFLLRDLPFDAIQFCI  206

Query  878   YESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDG  699
             YE L+  +   +    + N     V G  AG+     TTP DV+KTRL  Q   +NQY+G
Sbjct  207   YEQLR--IGYKIAARRELNDPENAVIGAFAGAITGAVTTPLDVMKTRLMVQ-GSANQYNG  263

Query  698   VLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHH  519
             +L+  + I + EG     +G+ PR++     G++FF+  E  KRL S      S + T  
Sbjct  264   LLNCAQTIMREEGPAAFLKGIGPRVLWIGIGGSIFFSVLERTKRLAS---QWGSTEDTKS  320

Query  518   EP  513
             +P
Sbjct  321   DP  322



>ref|XP_007413762.1| hypothetical protein MELLADRAFT_117468 [Melampsora larici-populina 
98AG31]
 gb|EGG02969.1| hypothetical protein MELLADRAFT_117468 [Melampsora larici-populina 
98AG31]
Length=281

 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 96/270 (36%), Positives = 145/270 (54%), Gaps = 16/270 (6%)
 Frame = -3

Query  1364  AGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniass  1185
             +GAMAG+ V L  +P+DT+KT +QS    Q  F       I+  G  G+YRG+ S    S
Sbjct  16    SGAMAGLTVDLFFYPLDTLKTRLQS----QAGF-------ITSGGFKGVYRGLGSVAVGS  64

Query  1184  apisALYTFTYESVKGALLPFLHTEYQS-VAHCVAGGCASVATSFIFTPSERVKQQMQVR  1008
             AP +AL+  TYE  K  L+P L     + V+H ++     +A   +  P+E VKQ+ Q  
Sbjct  65    APGAALFFTTYEQCKNRLVPSLLPNISAPVSHIISASLGEIAACLVRVPTEVVKQRQQTS  124

Query  1007  SHYKNCWNA--LIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFD  834
             ++  N  +A  L  ++++GG  +LY G+   + R VP ++I+F  YE LK    +  Q  
Sbjct  125   TYGTNTTSADVLKLVVQQGGARALYQGFLITISREVPFALIQFPLYEQLKLYAKAKRQSS  184

Query  833   IQNNTLMTL--VCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEG  660
              Q +    L  +CG +AGSTAA  TTP DV+KTR+       ++   +L TL +I + EG
Sbjct  185   SQKDLPAHLAALCGSIAGSTAAAITTPLDVIKTRIMLSERSGHKRVRILTTLIDIQRKEG  244

Query  659   LKGLYRGLTPRLVMYMTQGALFFASYESFK  570
                 ++GL PR +     GA+F   YE+ K
Sbjct  245   FSAFWKGLIPRTLWIGLGGAVFLGVYEASK  274



>ref|XP_010665072.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X5 [Vitis vinifera]
Length=324

 Score =   138 bits (348),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 154/299 (52%), Gaps = 18/299 (6%)
 Frame = -3

Query  1448  IECNSESEISVVAKE-KPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQ  1275
             ++C+S+ E     KE KP   L    E   AG +AG+ V   L+P+DTIKT +Q+     
Sbjct  6     LKCSSQREQKKSFKEDKPFSFLHVFWEGLVAGGIAGVVVEAALYPIDTIKTRLQAAHGG-  64

Query  1274  KPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVA  1095
                   G+ V+      GLY G++ N+A   P SA++   YE  K  LL  +     + A
Sbjct  65    ------GKIVLK-----GLYSGLAGNLAGVLPASAIFVGVYEPTKQKLLKTIPENLSAFA  113

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLC  915
             H  AG     A+S +  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+G+ L 
Sbjct  114   HLTAGAVGGAASSLVRVPTEVVKQRMQT-GQFASATDAVQLIVAKEGFKGLYAGYGSFLL  172

Query  914   RNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRL  735
             R++P   ++F  YE L+     + Q D+  N     + G  +G+     TTP DV+KTRL
Sbjct  173   RDLPFDALQFCIYEQLRIGYKLAAQRDL--NDPENAMIGAFSGAITGAITTPLDVIKTRL  230

Query  734   QTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               Q   +NQY G+   ++ + + EG   L++G+ PR++     G++FF   E  K++ +
Sbjct  231   MVQ-GSANQYKGIFDCVRTVIREEGTPALFKGIGPRVLWIGIGGSIFFVILERTKQVVA  288



>ref|XP_008678918.1| PREDICTED: uncharacterized protein LOC103653882 isoform X6 [Zea 
mays]
Length=526

 Score =   141 bits (356),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -3

Query  1391  ALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYR  1212
             A+    HA AGA+AG  VS+ LHP+DT+KT+IQ+    Q   Y+  R  + ERGVLGLY 
Sbjct  350   AVTINRHAVAGALAGTAVSVSLHPIDTVKTIIQANSYGQSSVYHTLRRTLIERGVLGLYG  409

Query  1211  GissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSER  1032
             G++S +A SAPISA+YT TYE+VKGALLP    EY S+AHC AGGC+S+ATSF+FTPSE 
Sbjct  410   GLASKLACSAPISAIYTLTYETVKGALLPVFPKEYHSIAHCAAGGCSSIATSFVFTPSEC  469

Query  1031  VKQQMQ  1014
             +KQQMQ
Sbjct  470   IKQQMQ  475



>ref|XP_010665073.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X6 [Vitis vinifera]
Length=320

 Score =   138 bits (348),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 154/299 (52%), Gaps = 18/299 (6%)
 Frame = -3

Query  1448  IECNSESEISVVAKE-KPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQ  1275
             ++C+S+ E     KE KP   L    E   AG +AG+ V   L+P+DTIKT +Q+     
Sbjct  21    LKCSSQREQKKSFKEDKPFSFLHVFWEGLVAGGIAGVVVEAALYPIDTIKTRLQAAHGG-  79

Query  1274  KPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVA  1095
                   G+ V+      GLY G++ N+A   P SA++   YE  K  LL  +     + A
Sbjct  80    ------GKIVLK-----GLYSGLAGNLAGVLPASAIFVGVYEPTKQKLLKTIPENLSAFA  128

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLC  915
             H  AG     A+S +  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+G+ L 
Sbjct  129   HLTAGAVGGAASSLVRVPTEVVKQRMQT-GQFASATDAVQLIVAKEGFKGLYAGYGSFLL  187

Query  914   RNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRL  735
             R++P   ++F  YE L+     + Q D+  N     + G  +G+     TTP DV+KTRL
Sbjct  188   RDLPFDALQFCIYEQLRIGYKLAAQRDL--NDPENAMIGAFSGAITGAITTPLDVIKTRL  245

Query  734   QTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               Q   +NQY G+   ++ + + EG   L++G+ PR++     G++FF   E  K++ +
Sbjct  246   MVQ-GSANQYKGIFDCVRTVIREEGTPALFKGIGPRVLWIGIGGSIFFVILERTKQVVA  303



>ref|XP_003562380.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Brachypodium distachyon]
Length=287

 Score =   137 bits (345),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 100/299 (33%), Positives = 148/299 (49%), Gaps = 27/299 (9%)
 Frame = -3

Query  1409  KEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP + L    E   AG  AG+ V   L+P+DTIKT +Q+ RA  +  +          
Sbjct  6     EEKPFNFLQVLCEGVIAGGTAGVVVETALYPIDTIKTRLQAARAGSQIQWK---------  56

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
                GLY G+  N+    P SAL+   YE  K  LL        +VAH  AG     A S 
Sbjct  57    ---GLYSGLGGNLVGVLPASALFVGIYEPTKRKLLDVFPENLSAVAHLTAGAVGGFAASL  113

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             I  P+E VKQ+MQ    +K+   A+  I+ + G   LYAG+G+ L R++P   I+F  YE
Sbjct  114   IRVPTEVVKQRMQT-GQFKSAPGAVRLIVGKEGFKGLYAGYGSFLLRDLPFDAIQFCIYE  172

Query  872   SLK---QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYD  702
              L+   +L++     D +N      + G  AG+     TTP DV+KTRL  Q   + QY 
Sbjct  173   QLRIGYKLVAKRELNDPENA-----LIGAFAGAITGAITTPLDVLKTRLMVQGQ-TKQYS  226

Query  701   GVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRT  525
             G++   K I + EG     +G+ PR++     G++FF   E  K +    L + S+++T
Sbjct  227   GIVSCAKTILREEGPGAFLKGIEPRVLWIGIGGSIFFGVLEKTKAV----LAERSSRKT  281



>ref|XP_009109466.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Brassica rapa]
Length=326

 Score =   138 bits (347),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 97/273 (36%), Positives = 138/273 (51%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+      GLY G++ N
Sbjct  57    EGFIAGGTAGVVVETALYPIDTIKTRLQAARGG-------GKIVLK-----GLYSGLAGN  104

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             IA   P SAL+   YE  K  LL        +VAH  AG    +A S I  P+E VKQ+M
Sbjct  105   IAGVLPASALFVGVYEPTKQKLLKTFPDHLSAVAHLTAGAIGGLAASLIRVPTEVVKQRM  164

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  NA+  I  + G   LYAG+ + L R++P   I+F  YE L      + + 
Sbjct  165   QT-GQFASAPNAVRVIASQEGFKGLYAGYRSFLLRDLPFDAIQFCIYEQLCLGYKKAARR  223

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             ++  N     + G  AG+     TTP DV+KTRL  Q   + QY G++  ++ I K EG 
Sbjct  224   EL--NDPENALIGAFAGALTGAVTTPLDVIKTRLMVQ-GSAKQYQGIVDCVQTIVKEEGA  280

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L +G+ PR++     G++FF   ES KR  S
Sbjct  281   SALLKGIGPRVLWIGIGGSIFFGVLESTKRTLS  313



>ref|XP_010665071.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X4 [Vitis vinifera]
Length=325

 Score =   138 bits (347),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 154/299 (52%), Gaps = 18/299 (6%)
 Frame = -3

Query  1448  IECNSESEISVVAKE-KPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQ  1275
             ++C+S+ E     KE KP   L    E   AG +AG+ V   L+P+DTIKT +Q+     
Sbjct  21    LKCSSQREQKKSFKEDKPFSFLHVFWEGLVAGGIAGVVVEAALYPIDTIKTRLQAAHGG-  79

Query  1274  KPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVA  1095
                   G+ V+      GLY G++ N+A   P SA++   YE  K  LL  +     + A
Sbjct  80    ------GKIVLK-----GLYSGLAGNLAGVLPASAIFVGVYEPTKQKLLKTIPENLSAFA  128

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLC  915
             H  AG     A+S +  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+G+ L 
Sbjct  129   HLTAGAVGGAASSLVRVPTEVVKQRMQT-GQFASATDAVQLIVAKEGFKGLYAGYGSFLL  187

Query  914   RNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRL  735
             R++P   ++F  YE L+     + Q D+  N     + G  +G+     TTP DV+KTRL
Sbjct  188   RDLPFDALQFCIYEQLRIGYKLAAQRDL--NDPENAMIGAFSGAITGAITTPLDVIKTRL  245

Query  734   QTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               Q   +NQY G+   ++ + + EG   L++G+ PR++     G++FF   E  K++ +
Sbjct  246   MVQ-GSANQYKGIFDCVRTVIREEGTPALFKGIGPRVLWIGIGGSIFFVILERTKQVVA  303



>gb|EWM26453.1| s-adenosylmethionine mitochondrial carrier protein [Nannochloropsis 
gaditana]
Length=436

 Score =   140 bits (352),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 103/278 (37%), Positives = 147/278 (53%), Gaps = 17/278 (6%)
 Frame = -3

Query  1367  FAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnias  1188
              +GA+AGI V L L P+DTIKT +Q+  A+ K          S   + G+Y G+   + +
Sbjct  126   LSGAVAGITVDLTLFPLDTIKTRLQAS-ANTK---------FSLDLLRGVYDGVGPGLVA  175

Query  1187  sapisALYTFTYESVKGAL-LPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQV  1011
             SAP  A +   Y+S K  L   F   +   + + VA     +  S +  P E VKQ+MQ 
Sbjct  176   SAPACAAFFGAYDSFKRGLSARFPDPKCAPLVNMVAAAGGDLTQSVVRVPFEVVKQRMQ-  234

Query  1010  RSHYKNCWN-ALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFD  834
              +  +  W  A+  I+   G    +AGW A+  R++P  II+F  YE+LK + +      
Sbjct  235   -AGVERTWREAVRNIMASTGPRGFFAGWSALALRDLPFDIIEFPLYEALKDVWAERKGGK  293

Query  833   IQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQ-YDGVLHTLKEIGKSEGL  657
             ++  T  + VCG LAG  AA  TTP DVVKTRL TQ   S Q Y G+L  L  + + EG+
Sbjct  294   LE--TWESSVCGSLAGGIAAGLTTPLDVVKTRLMTQRRDSGQVYAGLLDCLVRVAREEGI  351

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQ  543
               LY+GL PR+V     GA+FF +YE+FK +    L Q
Sbjct  352   GALYKGLVPRVVNIALGGAIFFGAYEAFKSVADRALVQ  389



>ref|XP_010665070.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X3 [Vitis vinifera]
 emb|CBI22773.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   138 bits (347),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 98/310 (32%), Positives = 159/310 (51%), Gaps = 19/310 (6%)
 Frame = -3

Query  1448  IECNSESEISVVAKE-KPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQ  1275
             ++C+S+ E     KE KP   L    E   AG +AG+ V   L+P+DTIKT +Q+     
Sbjct  21    LKCSSQREQKKSFKEDKPFSFLHVFWEGLVAGGIAGVVVEAALYPIDTIKTRLQAAHGG-  79

Query  1274  KPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVA  1095
                   G+ V+      GLY G++ N+A   P SA++   YE  K  LL  +     + A
Sbjct  80    ------GKIVLK-----GLYSGLAGNLAGVLPASAIFVGVYEPTKQKLLKTIPENLSAFA  128

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLC  915
             H  AG     A+S +  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+G+ L 
Sbjct  129   HLTAGAVGGAASSLVRVPTEVVKQRMQT-GQFASATDAVQLIVAKEGFKGLYAGYGSFLL  187

Query  914   RNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRL  735
             R++P   ++F  YE L+     + Q D+  N     + G  +G+     TTP DV+KTRL
Sbjct  188   RDLPFDALQFCIYEQLRIGYKLAAQRDL--NDPENAMIGAFSGAITGAITTPLDVIKTRL  245

Query  734   QTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSL  555
               Q   +NQY G+   ++ + + EG   L++G+ PR++     G++FF   E  K++ + 
Sbjct  246   MVQ-GSANQYKGIFDCVRTVIREEGTPALFKGIGPRVLWIGIGGSIFFVILERTKQVVA-  303

Query  554   DLHQSSAQRT  525
               H  + ++T
Sbjct  304   QTHTRTEKKT  313



>ref|XP_005854766.1| s-adenosylmethionine mitochondrial carrier protein [Nannochloropsis 
gaditana CCMP526]
 ref|XP_005855414.1| s-adenosylmethionine mitochondrial carrier protein [Nannochloropsis 
gaditana CCMP526]
 gb|EKU20945.1| s-adenosylmethionine mitochondrial carrier protein [Nannochloropsis 
gaditana CCMP526]
 gb|EKU21593.1| s-adenosylmethionine mitochondrial carrier protein [Nannochloropsis 
gaditana CCMP526]
Length=468

 Score =   140 bits (353),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 103/278 (37%), Positives = 147/278 (53%), Gaps = 17/278 (6%)
 Frame = -3

Query  1367  FAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnias  1188
              +GA+AGI V L L P+DTIKT +Q+  A+ K    + R         G+Y G+   + +
Sbjct  158   LSGAVAGITVDLTLFPLDTIKTRLQAS-ANTKFSLDLLR---------GVYDGVGPGLVA  207

Query  1187  sapisALYTFTYESVKGAL-LPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQV  1011
             SAP  A +   Y+S K  L   F   +   + + VA     +  S +  P E VKQ+MQ 
Sbjct  208   SAPACAAFFGAYDSFKRGLSARFPDPKCAPLVNMVAAAGGDLTQSVVRVPFEVVKQRMQ-  266

Query  1010  RSHYKNCWN-ALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFD  834
              +  +  W  A+  I+   G    +AGW A+  R++P  II+F  YE+LK + +      
Sbjct  267   -AGVERTWREAVRNIMASTGPRGFFAGWSALALRDLPFDIIEFPLYEALKDVWAERKGGK  325

Query  833   IQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQ-YDGVLHTLKEIGKSEGL  657
             ++  T  + VCG LAG  AA  TTP DVVKTRL TQ   S Q Y G+L  L  + + EG+
Sbjct  326   LE--TWESSVCGSLAGGIAAGLTTPLDVVKTRLMTQRRDSGQVYAGLLDCLVRVAREEGI  383

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQ  543
               LY+GL PR+V     GA+FF +YE+FK +    L Q
Sbjct  384   GALYKGLVPRVVNIALGGAIFFGAYEAFKSVADRALVQ  421



>ref|XP_010665068.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X1 [Vitis vinifera]
 ref|XP_010665069.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
isoform X2 [Vitis vinifera]
Length=339

 Score =   138 bits (347),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 154/299 (52%), Gaps = 18/299 (6%)
 Frame = -3

Query  1448  IECNSESEISVVAKE-KPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQ  1275
             ++C+S+ E     KE KP   L    E   AG +AG+ V   L+P+DTIKT +Q+     
Sbjct  21    LKCSSQREQKKSFKEDKPFSFLHVFWEGLVAGGIAGVVVEAALYPIDTIKTRLQAAHGG-  79

Query  1274  KPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVA  1095
                   G+ V+      GLY G++ N+A   P SA++   YE  K  LL  +     + A
Sbjct  80    ------GKIVLK-----GLYSGLAGNLAGVLPASAIFVGVYEPTKQKLLKTIPENLSAFA  128

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLC  915
             H  AG     A+S +  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+G+ L 
Sbjct  129   HLTAGAVGGAASSLVRVPTEVVKQRMQT-GQFASATDAVQLIVAKEGFKGLYAGYGSFLL  187

Query  914   RNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRL  735
             R++P   ++F  YE L+     + Q D+  N     + G  +G+     TTP DV+KTRL
Sbjct  188   RDLPFDALQFCIYEQLRIGYKLAAQRDL--NDPENAMIGAFSGAITGAITTPLDVIKTRL  245

Query  734   QTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               Q   +NQY G+   ++ + + EG   L++G+ PR++     G++FF   E  K++ +
Sbjct  246   MVQ-GSANQYKGIFDCVRTVIREEGTPALFKGIGPRVLWIGIGGSIFFVILERTKQVVA  303



>ref|XP_007019441.1| Mitochondrial carrier protein, putative [Theobroma cacao]
 gb|EOY16666.1| Mitochondrial carrier protein, putative [Theobroma cacao]
Length=422

 Score =   139 bits (350),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 101/276 (37%), Positives = 155/276 (56%), Gaps = 19/276 (7%)
 Frame = -3

Query  1343  FVSLCLHPMDTIKTVIQSCRADQ---KPFYYIGRSVISERGVLGLYRGissniassapis  1173
             F  +CLHP+DTIKT +Q+  A +     F  I ++    +G+LG YRG+S+ I  S   S
Sbjct  140   FTYVCLHPLDTIKTKMQTRGASEIYANTFDAIVKT-FQTKGILGFYRGVSAVIVGSTASS  198

Query  1172  ALYTFTYESVKGALLPFLHTEYQSV-AHCVAGGCASVATSFIFTPSERVKQQMQVRSHYK  996
             A+Y  T E  K  L      +Y ++     AG   ++ +S I  P E + Q+MQ  +  +
Sbjct  199   AVYFGTCEFGKSILS---KLDYPALLIPPTAGAMGNIVSSAIMVPKELITQRMQAGAKGR  255

Query  995   NCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQ-LMSSSVQFDIQNNT  819
             + W  L+ I+ + G+  LYAG+ A L RN+P  ++ + ++E LK  ++S + Q +++   
Sbjct  256   S-WEVLLRILEKDGILGLYAGYSATLLRNLPAGVLSYSSFEYLKAAVLSRTKQTNLE--P  312

Query  818   LMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSN----QYDGVLHTLKEIGKSEGLKG  651
             + ++ CG LAG+ +A  TTP DVVKTRL TQV G+      Y GV  TLK+I K EG  G
Sbjct  313   IQSVFCGALAGAISASLTTPLDVVKTRLMTQVHGNKAVAAMYSGVNATLKQILKDEGWIG  372

Query  650   LYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQ  543
             L RG+ PR+V      AL + ++E+ +      LHQ
Sbjct  373   LTRGMGPRVVHSACFSALGYFAFETARLTI---LHQ  405



>ref|XP_009419300.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009419301.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=320

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 97/289 (34%), Positives = 144/289 (50%), Gaps = 17/289 (6%)
 Frame = -3

Query  1421  SVVAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSV  1245
             SV   E+P + L A  +   AGA AG+ V   L+P+DTIKT +Q+     K  +      
Sbjct  38    SVTMGEEPFNFLRALCDGVIAGATAGVVVETVLYPIDTIKTRLQAAHGVSKIHWK-----  92

Query  1244  ISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASV  1065
                    GLY G++ N+A   P S ++   YE  K  LL        + AH  AG    V
Sbjct  93    -------GLYSGLAGNLAGVLPASGIFVGIYEPTKHKLLKVFPENLSAFAHLTAGAIGGV  145

Query  1064  ATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKF  885
             A S I  P+E VKQ+MQ    + +  NA+  I+ + G+  LYAG+ + L R++P   I+F
Sbjct  146   AASLIRVPTEVVKQRMQT-GQFTSAPNAVRLIVAKEGIRGLYAGYSSFLLRDLPFDAIQF  204

Query  884   YTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQY  705
               YE L+     + Q ++ +      + G  AG+     TTP DV+KTRL  Q   +NQY
Sbjct  205   CIYEQLRIGYKIAAQRELSDPE--NAIIGAFAGALTGAITTPLDVLKTRLMVQ-GSANQY  261

Query  704   DGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
              GV+   + I K EG    ++G+ PR++     G++FF   E  K + S
Sbjct  262   KGVISCAQMILKEEGPAAFFKGIGPRVLWIGIGGSIFFGVLERSKLVLS  310



>ref|XP_005709304.1| mitochondrial carrier (BOU / S-adenosylmethionine carrier) [Galdieria 
sulphuraria]
 gb|EME32784.1| mitochondrial carrier (BOU / S-adenosylmethionine carrier) [Galdieria 
sulphuraria]
Length=344

 Score =   137 bits (346),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 102/295 (35%), Positives = 155/295 (53%), Gaps = 26/295 (9%)
 Frame = -3

Query  1436  SESEISVVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYI  1257
             S ++ S V KE P  +L+ +    +GA AG  V   L P+DT+KT +Q  +        +
Sbjct  55    SHNKKSSVEKE-PSPSLSFRVGLISGAFAGAIVDFVLFPLDTLKTRLQVRQG-------V  106

Query  1256  GRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGG  1077
               S +  RG+   YRG+   +A+SAP  A +  TY+  K     +L   YQ + H ++  
Sbjct  107   AWSTLLFRGI---YRGLGPAVAASAPAGAAFFGTYDFTKHITSQWLSEPYQVLGHMLSAI  163

Query  1076  CASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHS  897
                VA S +  P E VKQ +Q    + +   A+  II+R G+  LY GW +++ R +P  
Sbjct  164   AGDVAGSTVRVPFEVVKQNLQA-GIFSSSRQAVSHIIQREGIVGLYRGWLSLILREIPFD  222

Query  896   IIKFYTYESLKQLMSSSVQFDIQNN-----TLMTLVCGGLAGSTAALFTTPFDVVKTRLQ  732
             II+F  YE LK+      Q+  + N     T  +  CG +AG+ AA FTTP DV KTRL 
Sbjct  223   IIEFPLYEYLKK------QWRRRRNGAALETWQSATCGSIAGAVAAAFTTPLDVAKTRLM  276

Query  731   TQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKR  567
              Q   ++ Y G+  T+  I K EG+  L+ G+ PR++     GA+FF S+E+ K+
Sbjct  277   LQ---NSPYRGIASTILRIAKEEGIPCLFSGIVPRVLWIGLGGAIFFGSFETCKQ  328



>ref|XP_004998043.1| hypothetical protein PTSG_02054 [Salpingoeca rosetta]
 gb|EGD79087.1| hypothetical protein PTSG_02054 [Salpingoeca rosetta]
Length=288

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 150/281 (53%), Gaps = 20/281 (7%)
 Frame = -3

Query  1370  AFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnia  1191
             AF G +AG  V + L+P+DT+KT +QS +     F+  G       G  G+YRG+SS   
Sbjct  26    AFGGCVAGPAVDIVLYPIDTVKTRLQSAQG----FFKAG-------GFKGVYRGLSSAAL  74

Query  1190  ssapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQV  1011
              SAP +A +  +YE  K  +  F+  +Y  V    AG  A + T+ +  P E VKQQ+Q 
Sbjct  75    GSAPAAACFFASYEGTKAIMAGFVPDDYAVVREMTAGSVAEMTTAVVRMPFEVVKQQLQ-  133

Query  1010  RSHYKNCWNALIG-IIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFD  834
              +H     +A +  I++  GLP  + G+ +++ R +P S I+F  YESLK+ ++   + +
Sbjct  134   -AHVHPTTSACVSHILKTKGLPGFWEGYVSLVMREIPFSFIQFPLYESLKRGVARLEKVE  192

Query  833   IQN-NTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             +++       VCG +AG  +A  TTP DVVKTR+  Q       D V   L  I + EG+
Sbjct  193   VKDLPAWQGSVCGSIAGGISAAVTTPLDVVKTRIILQ----QNTDNVPRALVHIYQREGI  248

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSA  534
             K L+ G+ PR       GA+FF ++E  ++++   LH   A
Sbjct  249   KALFAGVLPRTAFIALGGAIFFGAFEKARKVY-WTLHDKFA  288



>ref|XP_008372045.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Malus domestica]
 ref|XP_008372046.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Malus domestica]
Length=324

 Score =   137 bits (345),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 149/309 (48%), Gaps = 17/309 (6%)
 Frame = -3

Query  1481  DDYGPNQRFGGIECNSESEISVVAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIK  1305
             D+Y    ++  I          + +EKP   L    E   AG  AG+ V   L+P+DTIK
Sbjct  19    DEYSQKTQYAPIGTRKSFASVSMQEEKPFDFLRTLFEGVIAGGTAGVVVETALYPIDTIK  78

Query  1304  TVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLP  1125
             T +Q+ R         GR         GLY G++ N+A   P SA++   YE  K  LL 
Sbjct  79    TRLQAARGG-------GRIAFX-----GLYSGLTGNLAGVLPASAIFVGVYEPAKKKLLK  126

Query  1124  FLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPS  945
                    ++AH  AG    +A S +  P+E VKQ+MQ    + +   A+  I  + G   
Sbjct  127   IFPENLSALAHFTAGAFGGIAASLVRVPTEVVKQRMQT-GQFTSASVAVRHIAFKEGFKG  185

Query  944   LYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFT  765
              YAG+G+ L R++P   I+F  YE L+     + + ++  N     + G  AG+     T
Sbjct  186   FYAGYGSFLLRDLPFDAIQFCLYEQLRLGYKKAAKREL--NDPENAIIGAFAGAVTGAIT  243

Query  764   TPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFAS  585
             TP DV+KTRL  Q   +NQY G++  ++ + + EG   L +G+ PR++     G++FF  
Sbjct  244   TPLDVIKTRLMVQ-GSANQYKGIIDCVQTVVREEGRSALLKGIGPRVLWIGIGGSIFFGV  302

Query  584   YESFKRLFS  558
              E  K+L +
Sbjct  303   LERTKQLLA  311



>ref|XP_009337443.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009337444.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Pyrus x bretschneideri]
Length=324

 Score =   137 bits (345),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 95/309 (31%), Positives = 148/309 (48%), Gaps = 17/309 (6%)
 Frame = -3

Query  1481  DDYGPNQRFGGIECNSESEISVVAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIK  1305
             D+Y    ++  I          + +EKP   L    E   AG  AG+ V   L+P+DTIK
Sbjct  19    DEYSQKTQYAPIGTQKSFASVSMQEEKPFDFLRTLFEGVIAGGTAGVVVETALYPIDTIK  78

Query  1304  TVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLP  1125
             T +Q+ R   K              + GLY G++ N+A   P SA++   YE  K  LL 
Sbjct  79    TRLQAARGGGK------------IAIKGLYSGLTGNLAGVLPASAIFVGVYEPAKKKLLK  126

Query  1124  FLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPS  945
                    ++AH  AG    +A S +  P+E VKQ+MQ    + +   A+  I  + G   
Sbjct  127   IFPENLSALAHFTAGAFGGIAASLVRVPTEVVKQRMQT-GQFTSASVAVRHIAFKEGFKG  185

Query  944   LYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFT  765
              YAG+G+ L R++P   I+F  YE L+     + + ++  N     + G  AG+     T
Sbjct  186   FYAGYGSFLLRDLPFDAIQFCLYEQLRLGYKKAAKREL--NDPENAIIGAFAGAVTGAIT  243

Query  764   TPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFAS  585
             TP DV+KTRL  Q   +NQY G++  ++ + + EG   L +G+ PR++     G++FF  
Sbjct  244   TPLDVIKTRLMVQ-GSANQYKGIIDCVQTVVREEGRSALLKGIGPRVLWIGIGGSIFFGV  302

Query  584   YESFKRLFS  558
              E  K L +
Sbjct  303   LERTKLLLA  311



>gb|KDO45531.1| hypothetical protein CISIN_1g046528mg [Citrus sinensis]
Length=289

 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/273 (33%), Positives = 133/273 (49%), Gaps = 27/273 (10%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q                       GLY G++ N
Sbjct  31    EGVIAGGTAGVVVETALYPIDTIKTRLQ-----------------------GLYSGLAGN  67

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SAL+   YE  K  LL        + AH  AG     A S +  P+E VKQ++
Sbjct  68    LAGVLPASALFVGVYEPTKQKLLQIFPENLSAAAHLTAGAIGGFAASLVRVPTEVVKQRL  127

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    Y +  +A+  I  + G   LYAG+G+ L R++P   I+F  YE L+    ++ + 
Sbjct  128   QT-GQYASAPDAVRLIASKEGFKGLYAGYGSFLLRDLPFDAIQFCIYEQLRISYKAAARR  186

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+  N     + G  AG+     TTP DV+KTRL  Q   +NQY G+   ++ I + EG 
Sbjct  187   DL--NDPENAIIGAFAGAITGAITTPLDVIKTRLMVQ-GSANQYKGIFDCVQTIVREEGP  243

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               L +G+ PR++     G++FF   E  KR+ +
Sbjct  244   PALLKGIGPRVMWIGIGGSIFFGVLERTKRMLA  276



>gb|KHN34018.1| Putative mitochondrial carrier C12B10.09 [Glycine soja]
Length=323

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 99/311 (32%), Positives = 154/311 (50%), Gaps = 26/311 (8%)
 Frame = -3

Query  1439  NSESEISVVAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFY  1263
             NS + +S+   EKP   L    E   AG  AG+ V   L+P+DTIKT +Q+         
Sbjct  32    NSFASVSM-GDEKPFDFLRILFEGVIAGGTAGVVVETVLYPIDTIKTRLQA---------  81

Query  1262  YIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVA  1083
               G  +I +    GLY G++ N+    P SAL+   YE +K  LL        +  H  A
Sbjct  82    --GEKLILK----GLYSGLAGNLVGVLPASALFVGVYEPIKQKLLRVFPEHLSAFTHLTA  135

Query  1082  GGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVP  903
             G    +A S I  P+E +KQ+MQ    + +   A+  I  + G    YAG+G+ L R++P
Sbjct  136   GAIGGIAASLIRVPTEVIKQRMQT-GQFTSASGAVRFIASKEGFKGFYAGYGSFLLRDLP  194

Query  902   HSIIKFYTYESLK--QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQT  729
                I+F  YE ++   ++++    +   N ++    G  AG+     TTP DV+KTRL  
Sbjct  195   FDAIQFCIYEQIRIGYMLAARRNLNDPENAII----GAFAGALTGAITTPLDVIKTRLMV  250

Query  728   QVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDL  549
             Q   +NQY G++  ++ I K EG +   +G+ PR++     G++FF   ES KR F  + 
Sbjct  251   Q-GSANQYKGIVDCVQTIIKEEGPRAFLKGIGPRVLWIGIGGSIFFGVLESTKR-FLAER  308

Query  548   HQSSAQRTHHE  516
               +  Q T+ E
Sbjct  309   RPTLPQNTYSE  319



>ref|XP_004290480.1| PREDICTED: S-adenosylmethionine mitochondrial carrier protein-like 
[Fragaria vesca subsp. vesca]
Length=303

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 142/270 (53%), Gaps = 18/270 (7%)
 Frame = -3

Query  1367  FAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnias  1188
              AG  AG+ V   L+P+DTIKT +Q   A  K              + GLY G++ N+A 
Sbjct  38    IAGGAAGVVVEAALYPIDTIKTRLQVAHAGGKIM------------LKGLYSGLAGNLAG  85

Query  1187  sapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVR  1008
               P SA++   YE  K  LL  L     ++AH  AG     A+S +  P+E VKQ+MQ  
Sbjct  86    VLPASAIFVGVYEPTKQKLLKSLPENLSALAHLTAGAIGGAASSIVRVPTEVVKQRMQT-  144

Query  1007  SHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQ  828
             + + +  +A+  II + G   LY G+G+ L R++P   ++F  YE L+     + + D+ 
Sbjct  145   AQFASAPDAVRLIIAKEGFKGLYTGYGSFLLRDLPFDAVQFCIYEQLRIGFKLAARRDL-  203

Query  827   NNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEGLKG  651
             N+  + +V G  AG+     TTP DV+KTRL  Q  GS NQY G+   ++ I + EG   
Sbjct  204   NDPEVAMV-GAFAGAITGAITTPLDVIKTRLMVQ--GSENQYRGICDCVRTIMREEGNHA  260

Query  650   LYRGLTPRLVMYMTQGALFFASYESFKRLF  561
             L++G+ PR++     G++FF   E  K++ 
Sbjct  261   LWKGIGPRVLWIGIGGSIFFGVLERTKQIL  290


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 87/192 (45%), Gaps = 23/192 (12%)
 Frame = -3

Query  1088  VAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRN  909
             +AGG A V       P + +K ++QV +H          I+ +G    LY+G    L   
Sbjct  38    IAGGAAGVVVEAALYPIDTIKTRLQV-AHAGG------KIMLKG----LYSGLAGNLAGV  86

Query  908   VPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQT  729
             +P S I    YE  KQ +  S+  ++  + L  L  G + G+ +++   P +VVK R+QT
Sbjct  87    LPASAIFVGVYEPTKQKLLKSLPENL--SALAHLTAGAIGGAASSIVRVPTEVVKQRMQT  144

Query  728   QVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDL  549
                   Q+      ++ I   EG KGLY G    L+  +   A+ F  YE  +  F L  
Sbjct  145   A-----QFASAPDAVRLIIAKEGFKGLYTGYGSFLLRDLPFDAVQFCIYEQLRIGFKL--  197

Query  548   HQSSAQRTHHEP  513
                +A+R  ++P
Sbjct  198   ---AARRDLNDP  206



>ref|XP_007946282.1| PREDICTED: S-adenosylmethionine mitochondrial carrier protein, 
partial [Orycteropus afer afer]
Length=265

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 101/282 (36%), Positives = 145/282 (51%), Gaps = 24/282 (9%)
 Frame = -3

Query  1367  FAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnias  1188
              AG +AG+ V L L P+DTIKT +QS +   K             G  G+Y G+ S    
Sbjct  3     LAGGVAGVSVDLILFPLDTIKTRLQSPQGFNK-----------AGGFRGIYAGVPSAAIG  51

Query  1187  sapisALYTFTYESVKGALLPFLHTEYQS----VAHCVAGGCASVATSFIFTPSERVKQQ  1020
             S P +A +  TYE VK     FLHT+  S    V H +A     V    I  PSE VKQ+
Sbjct  52    SFPNAAAFFITYEYVKW----FLHTDSSSYLMPVKHMLAASAGEVIACLIRVPSEVVKQR  107

Query  1019  MQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQ  840
              QV S     +     I+ + G+  LY G+ + + R +P S+++F  +ESLK L S   +
Sbjct  108   AQV-SASSRTFQIFTNILYQEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWSW--R  164

Query  839   FDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDG-VLHTLKEIGKSE  663
              D   ++  + VCG  AG  AA+ TTP DV KTR+     GS+   G VL TL E+ +++
Sbjct  165   QDHVVDSWQSAVCGAFAGGFAAVVTTPLDVAKTRIMLAKVGSSTASGNVLSTLHEVWRTQ  224

Query  662   GLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSS  537
             GL GL+ G+ PR+      G +F  +Y+  + L  L+L + S
Sbjct  225   GLAGLFAGVFPRMTAISLGGFIFLGAYDQTRSLL-LELGRGS  265



>ref|XP_006657622.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Oryza brachyantha]
Length=296

 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/273 (33%), Positives = 138/273 (51%), Gaps = 16/273 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ +   K  +             GLY G+  N
Sbjct  27    EGVIAGGAAGVVVETALYPIDTIKTRLQAAKGGSKIQWE------------GLYAGLGGN  74

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             IA   P SA++   YE  K  LL        ++AH  AG      +S I  P+E VKQ+M
Sbjct  75    IAGVLPASAIFIGVYEPTKRKLLEVFPENLSALAHLTAGAIGGAVSSLIRVPTEVVKQRM  134

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q+ S +K   +A+  II +  L  LYAG+G+ L R++P   ++F  YE L+     + + 
Sbjct  135   QM-SQFKTAPDAVRLIIHKERLRGLYAGYGSFLLRDLPFDALQFCIYEQLRIGYKLAAKR  193

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             D+++      + G  AG+     TTP DV+KTRL  Q   +NQY G++   + I + EG 
Sbjct  194   DLKDGE--NALIGAFAGAITGAITTPLDVLKTRLMVQGQ-ANQYRGIISCAQTILREEGA  250

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
                 +G+ PR++     G++FF   E  K + +
Sbjct  251   GAFLKGIEPRVLWIGIGGSIFFGVLEKTKSILA  283



>gb|EMT09770.1| S-adenosylmethionine mitochondrial carrier protein [Aegilops 
tauschii]
Length=302

 Score =   136 bits (342),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 91/276 (33%), Positives = 136/276 (49%), Gaps = 10/276 (4%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q     +   +Y      S+    GLY G+  N
Sbjct  20    EGVIAGGAAGVVVETALYPIDTIKTRLQDTHIKKNCRFYPAARAGSQIQWKGLYSGLGGN  79

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +    P SAL+   YE  K  LL        +VAH  AG    +  S I  P+E VKQ+M
Sbjct  80    LVGVLPASALFVGIYEPTKRKLLDMFPENLSAVAHLTAGAVGGLGASLIRVPTEVVKQRM  139

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK---QLMSSS  846
             Q    ++   +A+  I+ + G   L+AG+G+ L R++P   I+F  YE L+   +LM+  
Sbjct  140   QT-GQFRTAPDAVRLIVAKEGFRGLFAGYGSFLLRDLPFDAIQFCIYEQLRIGYKLMAKR  198

Query  845   VQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKS  666
                D +N      + G  AG+     TTP DV+KTRL  Q   + QY G++   K I + 
Sbjct  199   ELKDPENA-----LIGAFAGAITGAITTPLDVLKTRLMIQGQ-TKQYSGIVSCAKTILRE  252

Query  665   EGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             EG     +G+ PR++     G++FF   E  K + +
Sbjct  253   EGPGAFLKGIEPRVLWIGIGGSIFFGVLEKTKSVLA  288



>ref|XP_002307518.2| hypothetical protein POPTR_0005s21910g [Populus trichocarpa]
 gb|EEE94514.2| hypothetical protein POPTR_0005s21910g [Populus trichocarpa]
Length=302

 Score =   136 bits (342),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 95/291 (33%), Positives = 147/291 (51%), Gaps = 16/291 (5%)
 Frame = -3

Query  1412  AKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISE  1236
             A+ KP + L A  E   AG  AG+     L+P+DTIKT +Q+       F       ++ 
Sbjct  14    AENKPFYFLHAVYEGIIAGGAAGVIAEAVLYPIDTIKTRLQASGLILYQF------ALAV  67

Query  1235  RG-----VLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCA  1071
             RG     + GLY G++ N+A   P SA++   YE  K  LL  L     ++A   AG   
Sbjct  68    RGGGKINLKGLYSGLAGNLAGVLPASAIFVGIYEPTKQKLLKSLPENLSALAQLTAGAIG  127

Query  1070  SVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSII  891
               A+S +  P+E VKQ+MQ    + +  +A+  I+ + G   LY G+G+ L R++P   I
Sbjct  128   GAASSLVRVPTEVVKQRMQT-GQFASAPDAIRLIVSKEGFKGLYVGYGSFLLRDLPFDAI  186

Query  890   KFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSN  711
             +F  YE +      + + D ++  +   + G  AG+     TTP DVVKTRL  Q   +N
Sbjct  187   QFCIYEQMLMGYKLAAKRDPKDAEIA--IVGAFAGAITGAMTTPLDVVKTRLMVQ-GSAN  243

Query  710   QYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             QY G+    + I K EG + L +G+ PR++     GA+FF   E  K++ +
Sbjct  244   QYKGIFDCARTIAKEEGTRALLKGIGPRVLWIGVGGAIFFGVLEKTKQILA  294



>ref|XP_010259890.1| PREDICTED: mitochondrial substrate carrier family protein E isoform 
X1 [Nelumbo nucifera]
Length=360

 Score =   137 bits (346),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 116/339 (34%), Positives = 170/339 (50%), Gaps = 51/339 (15%)
 Frame = -3

Query  1403  KPCHALAKQEHAF----AGAMAGIFVSLCLHPMDTIKTVIQSCRA-----DQKPFYYIGR  1251
             +P +   KQ   +     GA+AG F    +HP+DTIKT IQS         QK  + + R
Sbjct  17    QPTNGTPKQFFVWREFLWGAIAGAFGEGMMHPVDTIKTRIQSQAMISGYQSQKNIFQMVR  76

Query  1250  SVISERGVLGLYRGissniassapisALYTFTYESVKG---ALLPFLHTEYQSVAHCVAG  1080
             +V    G+ G YRGI   +  S    A Y    ES K     L P L   +   +H +AG
Sbjct  77    TVWVADGLRGFYRGIGPGLTGSLATGATYFGVIESTKKWVEELHPNLGGHW---SHFIAG  133

Query  1079  GCASVATSFIFTPSERVKQQMQVRSHYKNCWNALI------------------GIIRRG-  957
                    SFI+ P E +KQ+MQV+   +N W++++                  G+++ G 
Sbjct  134   AVGDTLGSFIYVPCEVIKQRMQVQGT-RNSWSSMVIKENACKKSGVQMYSYYSGMLQAGF  192

Query  956   ------GLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQ------FDIQNNTLM  813
                   G+  LYAG+ + L R+VP + +    YE+LK L     Q      F + N +L 
Sbjct  193   SIWKEQGMKGLYAGYWSTLARDVPFAGLMVTFYEALKDLTEYGKQKWMPNHFHV-NTSLE  251

Query  812   TLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSN-QYDGVLHTLKEIGKSEGLKGLYRGL  636
              LV GGLAG  +A  TTPFDVVKTRLQ Q  GS  +Y+G L  +  I ++EG+KG++RG 
Sbjct  252   GLVLGGLAGGFSAYLTTPFDVVKTRLQVQ--GSTIRYNGWLDAIWRIWRAEGMKGMFRGS  309

Query  635   TPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHH  519
              PR++ Y+   AL F + E  +  F+ DL+   +++  H
Sbjct  310   VPRVIWYIPASALTFMAVEFLRDHFNGDLNSKDSRKVKH  348



>ref|XP_010915071.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Elaeis guineensis]
Length=326

 Score =   136 bits (343),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 141/289 (49%), Gaps = 19/289 (7%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+     K  +             GLY G++ N
Sbjct  54    EGIIAGGTAGVVVEAVLYPIDTIKTRLQAAHGGSKIHWK------------GLYSGLAGN  101

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE  K  LL        + AH  AG     A+S I  P+E VKQ++
Sbjct  102   LAGVLPASAVFVGIYEPTKRKLLEIFPENLSAFAHLTAGAIGGAASSLIRVPTEVVKQRL  161

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  +A+  II + G   LYAG+ + L R++P   I+F  YE L+  +   +  
Sbjct  162   QT-GQFASAPDAVRLIIAKEGFRGLYAGYSSFLLRDLPFDAIQFCIYEQLR--IGYKIAA  218

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
               + N     + G  AG+     TTP DV+KTRL  Q   +NQY+G+L+  + I + EG 
Sbjct  219   RRELNDPENAIIGAFAGAITGAITTPLDVMKTRLMVQ-GSANQYNGLLNCAQTIIREEGP  277

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHEPC  510
                 +G+ PR++     G++FF   E  KRL S    Q SA  T   P 
Sbjct  278   TAFLKGIGPRVLWIGIGGSIFFGVLERTKRLVS---QQGSAGDTKSNPV  323



>ref|XP_010063818.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW71082.1| hypothetical protein EUGRSUZ_F04181 [Eucalyptus grandis]
Length=314

 Score =   136 bits (343),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 94/280 (34%), Positives = 146/280 (52%), Gaps = 17/280 (6%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+     K         I+ RG   LY G++ N
Sbjct  51    EGIVAGGTAGVVVEAALYPIDTIKTRLQAAHGGGK---------IALRG---LYSGLAGN  98

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +A   P SA++   YE  K  LL        ++AH  AG    +A+S +  P+E VKQ+M
Sbjct  99    LAGVLPASAIFVGVYEPTKQKLLRAFPDNLSALAHLTAGALGGLASSLVRVPTEVVKQRM  158

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q R  + +  +A+  II R G   LYAG+G+ L R++P   ++F  YE L+       + 
Sbjct  159   QTR-EFASAPSAVRLIIAREGFRGLYAGYGSFLLRDLPFDAVQFCIYEQLRIGYRIVARR  217

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGL  657
             +++++     + G  AG+     TTP DV+KTRL  Q   + QY  + H +K I + EG 
Sbjct  218   ELKDHE--NAMIGAFAGAITGAITTPLDVIKTRLMIQ-GATKQYRSISHCVKNIIQEEGP  274

Query  656   KGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSS  537
               L +G+ PR++     G++FF+  E  K++ + D H  S
Sbjct  275   AALMKGVGPRVLWIGIGGSIFFSILERTKQILA-DRHSKS  313



>ref|XP_002868906.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45165.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=325

 Score =   136 bits (343),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 140/275 (51%), Gaps = 20/275 (7%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+      GLY G++ N
Sbjct  56    EGFIAGGTAGVVVETALYPIDTIKTRLQAARGG-------GKIVLK-----GLYSGLAGN  103

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             IA   P SAL+   YE  K  LL        +VAH  AG    +A S I  P+E VKQ+M
Sbjct  104   IAGVLPASALFVGVYEPTKQKLLKTFPDHLSAVAHLTAGAIGGLAASLIRVPTEVVKQRM  163

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  NA+  I  + G   LYAG+ + L R++P   I+F  YE L      + + 
Sbjct  164   QT-GQFTSAPNAVRLIASKEGFRGLYAGYRSFLLRDLPFDAIQFCIYEQLCLGYKKAARR  222

Query  836   DIQN--NTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSE  663
             D+ +  N L+    G  AG+     TTP DV+KTRL  Q   + QY G++  ++ I + E
Sbjct  223   DLSDPENALI----GAFAGALTGAVTTPLDVIKTRLMVQ-GSAKQYQGIVDCVQTIVREE  277

Query  662   GLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             G   L +G+ PR++     G++FF   ES KR  +
Sbjct  278   GAPALLKGIGPRVLWIGIGGSIFFGVLESTKRTLA  312



>ref|XP_009363686.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009363687.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Pyrus x bretschneideri]
Length=324

 Score =   136 bits (343),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 95/309 (31%), Positives = 148/309 (48%), Gaps = 17/309 (6%)
 Frame = -3

Query  1481  DDYGPNQRFGGIECNSESEISVVAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIK  1305
             D+Y    ++  I          + +EKP   L    E   AG  AG+ V   L+P+DTIK
Sbjct  19    DEYSQKTQYAPIGTRKSFASVSMQEEKPFDFLRTLFEGVIAGGTAGVVVETALYPIDTIK  78

Query  1304  TVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYESVKGALLP  1125
             T +Q+ R   K  +             GLY G++ N+A   P SA++   YE  K  LL 
Sbjct  79    TRLQAARGGGKIAFK------------GLYSGLTGNLAGVLPASAIFVGVYEPAKKKLLK  126

Query  1124  FLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPS  945
                    ++AH  AG    +A S +  P+E VKQ+MQ    + +   A+  I  + G   
Sbjct  127   IFPENLSALAHFTAGAFGGIAASLVRVPTEVVKQRMQT-GQFTSASVAVRHIAFKEGFKG  185

Query  944   LYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFT  765
              YAG+G+ L R++P   I+F  YE L+     + + ++  N     + G  AG+     T
Sbjct  186   FYAGYGSFLLRDLPFDAIQFCLYEQLRLGYKKAAKREL--NDPENAIIGAFAGAVTGAIT  243

Query  764   TPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFAS  585
             TP DV+KTRL  Q   +NQY G++  ++ + + EG   L +G+ PR++     G++FF  
Sbjct  244   TPLDVIKTRLMVQ-GSANQYKGIIDCVQTVVREEGRSALLKGIGPRVLWIGIGGSIFFGV  302

Query  584   YESFKRLFS  558
              E  K L +
Sbjct  303   LERTKLLLA  311



>ref|XP_006361619.1| PREDICTED: putative mitochondrial carrier protein PET8-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006361620.1| PREDICTED: putative mitochondrial carrier protein PET8-like isoform 
X2 [Solanum tuberosum]
Length=308

 Score =   136 bits (342),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 137/257 (53%), Gaps = 16/257 (6%)
 Frame = -3

Query  1328  LHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYE  1149
             L+P+DTIKT +Q+ R         G  +I +    GLY G++ N+    P SA++   YE
Sbjct  62    LYPIDTIKTRLQAVRG--------GGQIILK----GLYSGLAGNLVGVLPASAIFIGVYE  109

Query  1148  SVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGI  969
               K  LL        ++AH  AG     A+S +  P+E VKQ+MQ    + +  +A+  I
Sbjct  110   PAKRKLLDSFPENLSALAHLTAGAIGGAASSIVRVPTEVVKQRMQT-GQFSSAPDAVRLI  168

Query  968   IRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLA  789
             + + G   LYAG+ + L R++P   I+F  YE L+     + + D++++     + G  A
Sbjct  169   VAKEGFRGLYAGYDSFLLRDLPFDAIQFCLYEQLRMGYKLAAKRDLKDSE--NAMIGAFA  226

Query  788   GSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMT  609
             G+     TTP DV+KTRL  Q   + QY+G+LH +K I + EG   L++G+ PR++    
Sbjct  227   GAITGAITTPLDVIKTRLMVQ-GSAKQYEGILHCVKTIAREEGASTLFKGIGPRVLWIGI  285

Query  608   QGALFFASYESFKRLFS  558
              G++FF   E  K+L +
Sbjct  286   GGSIFFGVLERTKKLVA  302



>ref|XP_006361621.1| PREDICTED: putative mitochondrial carrier protein PET8-like isoform 
X3 [Solanum tuberosum]
Length=307

 Score =   135 bits (341),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 137/257 (53%), Gaps = 16/257 (6%)
 Frame = -3

Query  1328  LHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissniassapisALYTFTYE  1149
             L+P+DTIKT +Q+ R         G  +I +    GLY G++ N+    P SA++   YE
Sbjct  61    LYPIDTIKTRLQAVRG--------GGQIILK----GLYSGLAGNLVGVLPASAIFIGVYE  108

Query  1148  SVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGI  969
               K  LL        ++AH  AG     A+S +  P+E VKQ+MQ    + +  +A+  I
Sbjct  109   PAKRKLLDSFPENLSALAHLTAGAIGGAASSIVRVPTEVVKQRMQT-GQFSSAPDAVRLI  167

Query  968   IRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLA  789
             + + G   LYAG+ + L R++P   I+F  YE L+     + + D++++     + G  A
Sbjct  168   VAKEGFRGLYAGYDSFLLRDLPFDAIQFCLYEQLRMGYKLAAKRDLKDSE--NAMIGAFA  225

Query  788   GSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMT  609
             G+     TTP DV+KTRL  Q   + QY+G+LH +K I + EG   L++G+ PR++    
Sbjct  226   GAITGAITTPLDVIKTRLMVQ-GSAKQYEGILHCVKTIAREEGASTLFKGIGPRVLWIGI  284

Query  608   QGALFFASYESFKRLFS  558
              G++FF   E  K+L +
Sbjct  285   GGSIFFGVLERTKKLVA  301



>emb|CDP18274.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   138 bits (347),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 102/300 (34%), Positives = 154/300 (51%), Gaps = 27/300 (9%)
 Frame = -3

Query  1343  FVSLCLHPMDTIKTVIQSCRADQKPFYYIGR-----SVISERGVLGLYRGissniassap  1179
             F  +CLHP+DTIKT +Q+  A +    Y G           RG+LG Y G+S+ I  S  
Sbjct  130   FTYVCLHPLDTIKTKLQTKGASE---IYSGTVDAIVKTFKTRGILGFYSGVSAVIVGSTA  186

Query  1178  isALYTFTYESVKGAL--LPFLHTEYQSV-AHCVAGGCASVATSFIFTPSERVKQQMQVR  1008
              SA+Y  T E  K  L  +P    +Y +V     AG   ++ +S I  P E + Q+MQ  
Sbjct  187   SSAVYFGTCEFGKSVLSEIP----QYPAVLIPPTAGAMGNIVSSAIMVPKELITQRMQAG  242

Query  1007  SHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQ  828
             +  ++ W  L+ I+++ G+  LYAG+ A L RN+P  ++ + ++E LK  + +S    + 
Sbjct  243   AKGRS-WEVLLKILKKDGILGLYAGYSATLLRNLPAGVLSYSSFEYLKAAVLNSTH-QVH  300

Query  827   NNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPG-------SNQYDGVLHTLKEIGK  669
                  ++ CG LAG+ +A  TTP DVVKTRL TQV G       +  Y GV  T+K+I K
Sbjct  301   LEPFQSVCCGALAGAISASLTTPLDVVKTRLMTQVHGEAVNKVAAVMYSGVSATVKQILK  360

Query  668   SEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFSLDLHQSSAQRTHHEPCFGDDSTL  489
              EG  G  RG+ PR+V      A+ + ++E+ +      LHQ   Q+          ST+
Sbjct  361   EEGWIGFTRGMGPRVVHSACFSAIGYFAFETARLTI---LHQYLKQKELQNMALDSSSTV  417



>ref|XP_009408931.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=291

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 97/289 (34%), Positives = 144/289 (50%), Gaps = 17/289 (6%)
 Frame = -3

Query  1421  SVVAKEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSV  1245
             SV   E+P + L A  +   AGA AG  V   L+P+DTIKT +Q+     K ++      
Sbjct  9     SVTMGEEPFNFLRALCDGVIAGATAGGVVETVLYPIDTIKTRLQAAHGGSKIYWR-----  63

Query  1244  ISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASV  1065
                    GLY G++ N+A   P SA++   YE  K  LL        + AH  AG     
Sbjct  64    -------GLYSGLAGNLAGVLPASAIFVGIYEPTKQKLLRVFPENLSAFAHLTAGAIGGA  116

Query  1064  ATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKF  885
             A+SFI  P+E VKQ+MQ    + +  NA+  I+ + G   LYAG+ + L R++P   I+F
Sbjct  117   ASSFIRVPTEVVKQRMQT-GQFTSAPNAVRLIVAKEGFRGLYAGYSSFLLRDLPFDAIQF  175

Query  884   YTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQY  705
               YE ++  +   +    + N     + G  AG+     TTP DV+KTRL  Q   +NQY
Sbjct  176   CIYEQIR--IGYKIAARRELNDPENAIIGAFAGAITGAITTPLDVMKTRLMVQ-GSANQY  232

Query  704   DGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
              G+L+  + I + EG     +G+ PR++     G++FF   E  K L S
Sbjct  233   KGLLNCAQTILREEGPAAFLKGIGPRVLWIGIGGSIFFGVLERTKLLLS  281



>ref|XP_006434531.1| hypothetical protein CICLE_v10001842mg [Citrus clementina]
 gb|ESR47771.1| hypothetical protein CICLE_v10001842mg [Citrus clementina]
Length=323

 Score =   136 bits (342),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 136/271 (50%), Gaps = 16/271 (6%)
 Frame = -3

Query  1370  AFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissnia  1191
             A AG  AG+FV   L+P+DTIKT +Q+     K              + GLY G+  N+A
Sbjct  54    AIAGGTAGVFVEAALYPIDTIKTRLQAAHGGGKI------------NLKGLYSGLVGNLA  101

Query  1190  ssapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQV  1011
                P SA++   YE VK  LL        + AH  AG     A+S +  P+E +KQ++Q 
Sbjct  102   GVFPASAIFLGIYEPVKQKLLETFPENLSAFAHLTAGAVGGAASSLVRVPTEVIKQRIQT  161

Query  1010  RSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDI  831
                + +  +A+  I+RR GL  L+AG+G+ L R++P   I+F  YE L      + +  +
Sbjct  162   -GQFTSAPDAVRLIVRREGLKGLFAGYGSFLLRDLPFDAIQFCIYEQLLLGYKLAARRSL  220

Query  830   QNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKG  651
              N      + G  AG+     T P DV+KTRL  Q   +NQY G+   +  I + EG+  
Sbjct  221   SNAE--NAIVGAFAGAITGAVTAPLDVIKTRLMVQ-GSANQYKGICDCVSTIAREEGIST  277

Query  650   LYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             L++G+  R++     G++FF   E  K + +
Sbjct  278   LFKGMGRRVLWIGIGGSIFFGVLEKTKEVLA  308


 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 81/195 (42%), Gaps = 21/195 (11%)
 Frame = -3

Query  1124  FLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPS  945
             FLH  +      +AGG A V       P + +K ++Q  +H     N          L  
Sbjct  46    FLHVLFDC---AIAGGTAGVFVEAALYPIDTIKTRLQA-AHGGGKIN----------LKG  91

Query  944   LYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFT  765
             LY+G    L    P S I    YE +KQ +  +  F    +    L  G + G+ ++L  
Sbjct  92    LYSGLVGNLAGVFPASAIFLGIYEPVKQKLLET--FPENLSAFAHLTAGAVGGAASSLVR  149

Query  764   TPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFAS  585
              P +V+K R+QT      Q+      ++ I + EGLKGL+ G    L+  +   A+ F  
Sbjct  150   VPTEVIKQRIQT-----GQFTSAPDAVRLIVRREGLKGLFAGYGSFLLRDLPFDAIQFCI  204

Query  584   YESFKRLFSLDLHQS  540
             YE     + L   +S
Sbjct  205   YEQLLLGYKLAARRS  219



>dbj|BAJ88489.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=293

 Score =   135 bits (339),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 90/276 (33%), Positives = 138/276 (50%), Gaps = 22/276 (8%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ RA  +  +             GLY G+  N
Sbjct  23    EGVIAGGAAGVVVETALYPIDTIKTRLQAARAGSQIQWK------------GLYSGLGGN  70

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             +    P SAL+   YE  K  LL        +VAH  AG    + +S I  P+E VKQ+M
Sbjct  71    LVGVLPASALFVGIYEPTKRKLLDMFPENLSAVAHLTAGAVGGLGSSLIRVPTEVVKQRM  130

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLK---QLMSSS  846
             Q    ++   +A+  I+ + G   L+AG+G+ L R++P   I+F  YE L+   ++M+  
Sbjct  131   QT-GQFRTAPDAVRLIVAKEGFRGLFAGYGSFLLRDLPFDAIQFCIYEQLRIGYKIMAKR  189

Query  845   VQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKS  666
                D +N      + G  AG+     TTP DV+KTRL  Q   + QY G++   K I + 
Sbjct  190   ELKDPENA-----LIGAFAGAITGAITTPLDVLKTRLMIQ-GQTKQYSGIVSCAKTILRE  243

Query  665   EGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             EG     +G+ PR++     G++FF+  E  K + +
Sbjct  244   EGPGAFLKGIEPRVLWIGIGGSIFFSVLEKTKSVLA  279



>ref|XP_010025529.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Eucalyptus grandis]
 ref|XP_010025530.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Eucalyptus grandis]
 gb|KCW62227.1| hypothetical protein EUGRSUZ_H04887 [Eucalyptus grandis]
Length=327

 Score =   135 bits (341),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 102/285 (36%), Positives = 148/285 (52%), Gaps = 17/285 (6%)
 Frame = -3

Query  1409  KEKPCHAL-AKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISER  1233
             +EKP     A  +   AG  AG+ V   L+P+DTIKT +Q+ R   K  +          
Sbjct  43    EEKPFDFFRALFDGVIAGGTAGVVVETALYPIDTIKTRLQAVRGGGKINFQ---------  93

Query  1232  GVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSF  1053
                GLY G++ N+A   P SAL+   YE  K  LL      + ++AH  AG    VA S 
Sbjct  94    ---GLYSGLAGNLAGVLPASALFVGVYEPTKQKLLRTFPENFSALAHLAAGALGGVAASL  150

Query  1052  IFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYE  873
             I  P+E VKQ+MQ R  + +  +A+  I+ + G   LYAG+G+ L R++P   I+F  YE
Sbjct  151   IRVPTEVVKQRMQTR-QFNSAPDAVRLIVSKEGFKGLYAGYGSFLLRDLPFDAIQFCIYE  209

Query  872   SLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVL  693
              L+    ++ + ++  N       G  AG+     TTP DV+KTRL TQ P +NQY GV 
Sbjct  210   QLRLGYKAAARREL--NDPENAAIGAFAGALTGAITTPLDVIKTRLMTQGP-ANQYRGVF  266

Query  692   HTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
               ++ I + EG   L +G+ PR++     G++FF   ES KR  S
Sbjct  267   DCVQTIVREEGPSALLKGIEPRVLWIGIGGSIFFGVLESTKRFLS  311



>ref|XP_002946492.1| hypothetical protein VOLCADRAFT_86841 [Volvox carteri f. nagariensis]
 gb|EFJ52419.1| hypothetical protein VOLCADRAFT_86841 [Volvox carteri f. nagariensis]
Length=317

 Score =   135 bits (340),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 150/291 (52%), Gaps = 18/291 (6%)
 Frame = -3

Query  1418  VVAKEKPCHALAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIG----R  1251
             V A   P   +A    A AGA AG  V L L+P+DTIKT +Q+          IG    +
Sbjct  39    VPAVNAPVWRVAAGNLA-AGATAGCAVELALYPIDTIKTRLQAM---------IGGGGLK  88

Query  1250  SVISERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCA  1071
             S++   G  GLY G+  N+A  AP SA++   YE  K A+   +  + Q +   VAG  A
Sbjct  89    SLLQSGGGKGLYAGVWGNLAGVAPASAIFMAFYEPTKKAVQSEVPADKQYLGPVVAGMVA  148

Query  1070  SVATSFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSII  891
               A+S I  P+E VKQ++Q    +     A+  I+ R GL  LYAG+GA + R++P   I
Sbjct  149   GTASSLIRVPTEVVKQRLQT-GEFTGAVKAVRTILGREGLRGLYAGYGAFMLRDLPFDAI  207

Query  890   KFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSN  711
             +F  YE +K+    +V+ ++      T + G +AG    + TTP DV+KTRL TQ   S 
Sbjct  208   EFVAYEQIKKAYGMTVRRELHPGE--TSIVGAIAGGFTGVITTPLDVLKTRLMTQ-GASG  264

Query  710   QYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             +Y  +L     I ++EGL     G  PRL+     G +FF   E+ K+ ++
Sbjct  265   RYKNLLDATVTIARTEGLGAFMSGWQPRLIWISLGGFVFFPVLEAAKKYYA  315


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 91/194 (47%), Gaps = 25/194 (13%)
 Frame = -3

Query  1103  SVAHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKNCWNALIG------IIRRGGLPSL  942
             +  +  AG  A  A      P + +K ++Q          A+IG      +++ GG   L
Sbjct  50    AAGNLAAGATAGCAVELALYPIDTIKTRLQ----------AMIGGGGLKSLLQSGGGKGL  99

Query  941   YAG-WGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFT  765
             YAG WG  L    P S I    YE  K+ + S V  D Q   L  +V G +AG+ ++L  
Sbjct  100   YAGVWGN-LAGVAPASAIFMAFYEPTKKAVQSEVPADKQY--LGPVVAGMVAGTASSLIR  156

Query  764   TPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFAS  585
              P +VVK RLQT      ++ G +  ++ I   EGL+GLY G    ++  +   A+ F +
Sbjct  157   VPTEVVKQRLQT-----GEFTGAVKAVRTILGREGLRGLYAGYGAFMLRDLPFDAIEFVA  211

Query  584   YESFKRLFSLDLHQ  543
             YE  K+ + + + +
Sbjct  212   YEQIKKAYGMTVRR  225



>ref|XP_006285873.1| hypothetical protein CARUB_v10007368mg [Capsella rubella]
 gb|EOA18771.1| hypothetical protein CARUB_v10007368mg [Capsella rubella]
Length=324

 Score =   135 bits (339),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 96/275 (35%), Positives = 139/275 (51%), Gaps = 20/275 (7%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+      GLY G++ N
Sbjct  55    EGFIAGGTAGVVVETALYPIDTIKTRLQAARGG-------GKIVLK-----GLYSGLAGN  102

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             IA   P SAL+   YE  K  LL        +VAH  AG    +A S I  P+E VKQ+M
Sbjct  103   IAGVLPASALFVGVYEPTKQKLLKTFPDHLSAVAHLTAGAIGGLAASLIRVPTEVVKQRM  162

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  NA+  I  + G   LYAG+ + L R++P   I+F  YE L      + + 
Sbjct  163   QT-GQFTSAPNAVRLIASKEGFKGLYAGYRSFLLRDLPFDAIQFCIYEQLCLGYKKAARR  221

Query  836   DIQN--NTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSE  663
             ++ +  N L+    G  AG+     TTP DV+KTRL  Q   S QY G++  ++ I + E
Sbjct  222   ELSDPENALI----GAFAGALTGAVTTPLDVIKTRLMVQ-GSSKQYQGIVDCVQTIVRDE  276

Query  662   GLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             G   L +G+ PR++     G++FF   E  KR  +
Sbjct  277   GAPALLKGIGPRVLWIGIGGSIFFGVLERTKRTLA  311



>ref|XP_008441537.1| PREDICTED: protein MITOFERRINLIKE 1, chloroplastic [Cucumis melo]
 ref|XP_008441538.1| PREDICTED: protein MITOFERRINLIKE 1, chloroplastic [Cucumis melo]
Length=391

 Score =   136 bits (342),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 98/268 (37%), Positives = 148/268 (55%), Gaps = 15/268 (6%)
 Frame = -3

Query  1343  FVSLCLHPMDTIKTVIQSCRADQ--KPFYYIGRSVISERGVLGLYRGissniassapisA  1170
             F  +CL P+DTIKT +Q+  A +  K  +         RG+LG Y GIS+ I  SA  SA
Sbjct  108   FTYVCLLPLDTIKTRLQTKGASEIYKNTFDAVVKTFQSRGILGFYSGISAVIVGSAASSA  167

Query  1169  LYTFTYESVKGALLPFLHTEYQSV-AHCVAGGCASVATSFIFTPSERVKQQMQVRSHYKN  993
             +Y  T E  K  L  F   +Y S+     AG   ++ +S +  P E + Q+MQV +  ++
Sbjct  168   VYFGTCEFGKSILSKF---DYPSLLIPPTAGAMGNIISSAVMVPKELITQRMQVGAKGRS  224

Query  992   CWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLM  813
              W  LI I+ + G+  LYAG+ A L RN+P  ++ + ++E LK  + S  + D +   + 
Sbjct  225   -WEVLIQILEKDGIMGLYAGYFATLLRNLPAGVLSYSSFEYLKAAVLSKTKSD-KLEPIQ  282

Query  812   TLVCGGLAGSTAALFTTPFDVVKTRLQTQVPG-------SNQYDGVLHTLKEIGKSEGLK  654
             ++ CG LAG+ +A  TTP DVVKTRL TQV G       +  Y GV  T+K+I + EG  
Sbjct  283   SVCCGALAGAISATLTTPLDVVKTRLMTQVHGEAANKVSAVMYSGVSATIKQILQEEGWI  342

Query  653   GLYRGLTPRLVMYMTQGALFFASYESFK  570
             GL RG+ PR++      A+ + ++E+ K
Sbjct  343   GLTRGMGPRVLHSACFAAIGYFAFETAK  370



>ref|XP_002964333.1| hypothetical protein SELMODRAFT_166450 [Selaginella moellendorffii]
 gb|EFJ34666.1| hypothetical protein SELMODRAFT_166450 [Selaginella moellendorffii]
Length=346

 Score =   135 bits (339),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 98/299 (33%), Positives = 154/299 (52%), Gaps = 26/299 (9%)
 Frame = -3

Query  1388  LAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQ-----------SCRADQKPFYYIGRSVI  1242
             L  ++H  AG++AGI   + + P+DT+KT IQ           +  A       I RS++
Sbjct  40    LGFRQHMLAGSLAGIVEHVAMFPVDTLKTRIQMITSPCGGSGATAAATVGSSSTISRSLV  99

Query  1241  S---ERGVLGLYRGissniassapisALYTFTYESVKG--ALLPFLHTEYQSVAHCVAGG  1077
             S     G LGLYRG+ + +  + P  A+Y   YE  K    +       Y  +AH  AG 
Sbjct  100   SLLKHEGPLGLYRGVGAMVLGAGPSHAVYFAAYEECKRRFEVDGGGGGGYHPIAHMSAGA  159

Query  1076  CASVATSFIFTPSERVKQQMQVR-SHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPH  900
             CA++A+  + TP + VKQ++Q++ S Y    + +  I R  GL   YA +   +  NVP 
Sbjct  160   CATIASDAVSTPMDVVKQRLQLKNSPYAGLGDCVRKIARSEGLRGFYASYRTTVVMNVPF  219

Query  899   SIIKFYTYESLKQLMSS-----SVQFDIQNNTLMT-LVCGGLAGSTAALFTTPFDVVKTR  738
             + + F TYE+ K+ +            +    L+T +V GG AG+ A+  TTP DVVKTR
Sbjct  220   TGVHFATYEAAKKALGELQGGGGGVGGMSEEHLVTHVVAGGSAGALASAVTTPLDVVKTR  279

Query  737   LQTQ-VPGSNQY--DGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFK  570
             LQ Q V G+ ++    VL   + I   EG+  L++G+ PR++ +    A+ +A+YE+ K
Sbjct  280   LQCQGVCGAERFSSSSVLEVARTIASHEGIGALFKGMMPRILFHTPAAAISWATYEAGK  338


 Score = 62.4 bits (150),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 83/191 (43%), Gaps = 18/191 (9%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQVRSH---------------YKNCWNALIGIIRR  960
             H +AG  A +       P + +K ++Q+ +                      +L+ +++ 
Sbjct  45    HMLAGSLAGIVEHVAMFPVDTLKTRIQMITSPCGGSGATAAATVGSSSTISRSLVSLLKH  104

Query  959   GGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGST  780
              G   LY G GA++    P   + F  YE  K+            + +  +  G  A   
Sbjct  105   EGPLGLYRGVGAMVLGAGPSHAVYFAAYEECKRRFEVDGGGGGGYHPIAHMSAGACATIA  164

Query  779   AALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGA  600
             +   +TP DVVK RLQ +   ++ Y G+   +++I +SEGL+G Y      +VM +    
Sbjct  165   SDAVSTPMDVVKQRLQLK---NSPYAGLGDCVRKIARSEGLRGFYASYRTTVVMNVPFTG  221

Query  599   LFFASYESFKR  567
             + FA+YE+ K+
Sbjct  222   VHFATYEAAKK  232



>emb|CDY49847.1| BnaC02g44060D [Brassica napus]
Length=389

 Score =   136 bits (342),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 98/274 (36%), Positives = 139/274 (51%), Gaps = 18/274 (7%)
 Frame = -3

Query  1376  EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVISERGVLGLYRGissn  1197
             E   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+      GLY G++ N
Sbjct  120   EGFIAGGTAGVVVETALYPIDTIKTRLQATRGG-------GKIVLK-----GLYSGLAGN  167

Query  1196  iassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVATSFIFTPSERVKQQM  1017
             IA   P SAL+   YE  K  LL        +VAH  AG    +A S I  P+E VKQ+M
Sbjct  168   IAGVLPASALFVGVYEPTKQKLLKTFPDHLSAVAHLTAGAIGGLAASLIRVPTEVVKQRM  227

Query  1016  QVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQF  837
             Q    + +  NA+  I  + G   LYAG+ + L R++P   I+F  YE L      + + 
Sbjct  228   QT-GQFASAPNAVRVIASQEGFKGLYAGYRSFLLRDLPFDAIQFCIYEQLCLGYKKAARR  286

Query  836   DIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGS-NQYDGVLHTLKEIGKSEG  660
             ++  N     + G  AG+     TTP DV+KTRL  Q  GS  QY G++  ++ I K EG
Sbjct  287   EL--NDPENALIGAFAGALTGAVTTPLDVIKTRLMVQ--GSAKQYQGIVDCVQTIVKEEG  342

Query  659   LKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
                L +G+ PR++     G++FF   ES KR  +
Sbjct  343   ASALLKGIGPRVLWIGIGGSIFFGVLESTKRTLA  376



>ref|XP_010681056.1| PREDICTED: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=327

 Score =   134 bits (338),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 101/290 (35%), Positives = 148/290 (51%), Gaps = 23/290 (8%)
 Frame = -3

Query  1415  VAKEKPCHALAKQ-EHAFAGAMAGIFVSLCLHPMDTIKTVIQSCRADQKPFYYIGRSVIS  1239
             + +EKP   +    +   AG  AG+ V   L+P+DTIKT +Q+ R         G+ V+ 
Sbjct  42    MGEEKPFDFIQTLVDGIIAGGTAGVVVETVLYPIDTIKTRLQAARGG-------GKIVLK  94

Query  1238  ERGVLGLYRGissniassapisALYTFTYESVKGALLPFLHTEYQSVAHCVAGGCASVAT  1059
                  GLY G++ N+A   P SA +   YE  K  LL  L     +VAH  AG    VA 
Sbjct  95    -----GLYSGLAGNLAGVLPASAAFLGVYEPTKQKLLRLLPENLSAVAHLTAGAAGGVAA  149

Query  1058  SFIFTPSERVKQQMQVRSHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPHSIIKFYT  879
             S I  P+E VKQ+MQ    + +  +A+  I+ + G   LYAG+ + L R++P   I+F  
Sbjct  150   SLIRVPTEVVKQRMQT-GQFTSAPDAVRLIVSKEGFKGLYAGYRSFLLRDLPFDAIQFCL  208

Query  878   YESLK---QLMSSSVQFDIQNNTLMTLVCGGLAGSTAALFTTPFDVVKTRLQTQVPGSNQ  708
             YE ++   +L +     D +N      V G  AG+     TTP DV+KTRL  Q  G NQ
Sbjct  209   YEQIRLGYKLAAKRELNDPENA-----VIGAFAGALTGAITTPLDVIKTRLMIQGSG-NQ  262

Query  707   YDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFKRLFS  558
             Y G++  ++ I + EG   L +G+ PR++     G++FF   ES KR  S
Sbjct  263   YKGIVDCVQTIVREEGAPALLKGIGPRVLWIGIGGSIFFGVLESTKRFLS  312



>ref|XP_002967701.1| hypothetical protein SELMODRAFT_169433 [Selaginella moellendorffii]
 gb|EFJ31048.1| hypothetical protein SELMODRAFT_169433 [Selaginella moellendorffii]
Length=346

 Score =   135 bits (339),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 98/299 (33%), Positives = 154/299 (52%), Gaps = 26/299 (9%)
 Frame = -3

Query  1388  LAKQEHAFAGAMAGIFVSLCLHPMDTIKTVIQ-----------SCRADQKPFYYIGRSVI  1242
             L  ++H  AG++AGI   + + P+DT+KT IQ           +  A       I RS++
Sbjct  40    LGFRQHMLAGSLAGIVEHVAMFPVDTLKTRIQMITSPCGGSGATAAATVGSSSTISRSLV  99

Query  1241  S---ERGVLGLYRGissniassapisALYTFTYESVKG--ALLPFLHTEYQSVAHCVAGG  1077
             S     G LGLYRG+ + +  + P  A+Y   YE  K    +       Y  +AH  AG 
Sbjct  100   SLLKHEGPLGLYRGVGAMVLGAGPSHAVYFAAYEECKRRFEVDGGGGGGYHPIAHMSAGA  159

Query  1076  CASVATSFIFTPSERVKQQMQVR-SHYKNCWNALIGIIRRGGLPSLYAGWGAVLCRNVPH  900
             CA++A+  + TP + VKQ++Q++ S Y    + +  I R  GL   YA +   +  NVP 
Sbjct  160   CATIASDAVSTPMDVVKQRLQLKNSPYAGLGDCVRKIARSEGLRGFYASYRTTVVMNVPF  219

Query  899   SIIKFYTYESLKQLMSS-----SVQFDIQNNTLMT-LVCGGLAGSTAALFTTPFDVVKTR  738
             + + F TYE+ K+ +            +    L+T +V GG AG+ A+  TTP DVVKTR
Sbjct  220   TGVHFATYEAAKKALGELQGGGGGVGGMSEEHLVTHVVAGGSAGALASAVTTPLDVVKTR  279

Query  737   LQTQ-VPGSNQY--DGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGALFFASYESFK  570
             LQ Q V G+ ++    VL   + I   EG+  L++G+ PR++ +    A+ +A+YE+ K
Sbjct  280   LQCQGVCGAERFSSSSVLEVARTIASHEGVGALFKGMMPRILFHTPAAAISWATYEAGK  338


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 83/191 (43%), Gaps = 18/191 (9%)
 Frame = -3

Query  1094  HCVAGGCASVATSFIFTPSERVKQQMQVRSH---------------YKNCWNALIGIIRR  960
             H +AG  A +       P + +K ++Q+ +                      +L+ +++ 
Sbjct  45    HMLAGSLAGIVEHVAMFPVDTLKTRIQMITSPCGGSGATAAATVGSSSTISRSLVSLLKH  104

Query  959   GGLPSLYAGWGAVLCRNVPHSIIKFYTYESLKQLMSSSVQFDIQNNTLMTLVCGGLAGST  780
              G   LY G GA++    P   + F  YE  K+            + +  +  G  A   
Sbjct  105   EGPLGLYRGVGAMVLGAGPSHAVYFAAYEECKRRFEVDGGGGGGYHPIAHMSAGACATIA  164

Query  779   AALFTTPFDVVKTRLQTQVPGSNQYDGVLHTLKEIGKSEGLKGLYRGLTPRLVMYMTQGA  600
             +   +TP DVVK RLQ +   ++ Y G+   +++I +SEGL+G Y      +VM +    
Sbjct  165   SDAVSTPMDVVKQRLQLK---NSPYAGLGDCVRKIARSEGLRGFYASYRTTVVMNVPFTG  221

Query  599   LFFASYESFKR  567
             + FA+YE+ K+
Sbjct  222   VHFATYEAAKK  232



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9637311595890