BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c19153_g1_i2 len=1683 path=[1661:0-324 1986:325-384 @2046@!:385-1513
3175:1514-1682]

Length=1683
                                                                      Score     E

ref|XP_009589214.1|  PREDICTED: transcription factor PIF3-like          295   6e-87   
ref|XP_009774962.1|  PREDICTED: transcription factor PIF3-like is...    294   2e-86   
ref|XP_009774964.1|  PREDICTED: transcription factor PIF3-like is...    293   3e-86   
ref|XP_006358519.1|  PREDICTED: transcription factor PIF3-like          288   2e-84   
ref|XP_010313958.1|  PREDICTED: transcription factor PIF3               288   6e-84   
ref|XP_009794217.1|  PREDICTED: transcription factor PIF3-like          274   1e-79   
emb|CDP15171.1|  unnamed protein product                                275   3e-79   
emb|CAN76246.1|  hypothetical protein VITISV_023382                     256   7e-73   Vitis vinifera
ref|XP_007031278.1|  Phytochrome interacting factor 3, putative i...    256   2e-72   
ref|XP_007031279.1|  Phytochrome interacting factor 3, putative i...    256   3e-72   
ref|XP_007207211.1|  hypothetical protein PRUPE_ppa001899mg             256   4e-72   
ref|XP_008246329.1|  PREDICTED: transcription factor PIF3               254   3e-71   
ref|XP_007031281.1|  Phytochrome interacting factor 3, putative i...    252   1e-70   
ref|XP_010659764.1|  PREDICTED: transcription factor PIF3-like is...    251   3e-70   
ref|XP_010659765.1|  PREDICTED: transcription factor PIF3-like is...    251   3e-70   
ref|XP_007031280.1|  Phytochrome interacting factor 3, putative i...    245   2e-68   
ref|XP_009366015.1|  PREDICTED: transcription factor PIF3-like is...    233   5e-64   
ref|XP_011087566.1|  PREDICTED: transcription factor PIF3 isoform X1    232   2e-63   
ref|XP_011087568.1|  PREDICTED: transcription factor PIF3 isoform X2    231   3e-63   
ref|XP_004302325.1|  PREDICTED: transcription factor PIF3-like          230   1e-62   
ref|XP_008370333.1|  PREDICTED: transcription factor PIF3 isoform X1    228   6e-62   
ref|XP_006382253.1|  Phytochrome-interacting factor 3 family protein    223   4e-60   
ref|XP_006423961.1|  hypothetical protein CICLE_v10027890mg             222   1e-59   
ref|XP_011039054.1|  PREDICTED: transcription factor PIF3-like is...    221   1e-59   
ref|XP_009365453.1|  PREDICTED: transcription factor PIF3-like          219   6e-59   
ref|XP_011039053.1|  PREDICTED: transcription factor PIF3-like is...    217   6e-58   
ref|XP_002512587.1|  conserved hypothetical protein                     217   8e-58   Ricinus communis
ref|XP_011039055.1|  PREDICTED: transcription factor PIF3-like is...    216   9e-58   
gb|AEX32796.1|  phytochrome-interacting factor 3                        215   2e-57   
ref|XP_008388421.1|  PREDICTED: transcription factor PIF3-like          215   2e-57   
emb|CBI39676.3|  unnamed protein product                                204   2e-54   
ref|XP_010240811.1|  PREDICTED: transcription factor PIF3-like is...    205   7e-54   
ref|XP_006605776.1|  PREDICTED: transcription factor PIF3-like          202   9e-53   
gb|KHN26204.1|  Transcription factor PIF3                               202   9e-53   
ref|XP_010240809.1|  PREDICTED: transcription factor PIF3-like is...    199   6e-52   
ref|XP_008800313.1|  PREDICTED: transcription factor PIF3-like is...    196   7e-51   
ref|XP_008800314.1|  PREDICTED: transcription factor PIF3-like is...    196   9e-51   
gb|KHN43378.1|  Transcription factor PIF3                               194   3e-50   
ref|XP_006604778.1|  PREDICTED: transcription factor PIF3-like is...    192   7e-50   
gb|KHN24194.1|  Transcription factor PIF3                               191   5e-49   
ref|XP_006589101.1|  PREDICTED: transcription factor PIF3-like          191   5e-49   
gb|KDO56397.1|  hypothetical protein CISIN_1g006040mg                   179   3e-45   
gb|KDO56396.1|  hypothetical protein CISIN_1g006040mg                   179   5e-45   
gb|KDO56394.1|  hypothetical protein CISIN_1g006040mg                   178   5e-45   
gb|KDO56393.1|  hypothetical protein CISIN_1g006040mg                   178   7e-45   
ref|XP_008807920.1|  PREDICTED: transcription factor PIF3-like is...    177   1e-44   
ref|XP_008807923.1|  PREDICTED: transcription factor PIF3-like is...    177   1e-44   
ref|XP_010941465.1|  PREDICTED: transcription factor PIF3-like is...    177   2e-44   
ref|XP_010941466.1|  PREDICTED: transcription factor PIF3-like is...    177   2e-44   
ref|XP_010909460.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    172   8e-43   
gb|KHN14203.1|  Transcription factor PIF3                               169   7e-42   
ref|XP_010659766.1|  PREDICTED: transcription factor PIF3-like is...    169   7e-42   
ref|XP_010553700.1|  PREDICTED: transcription factor PIF3-like          166   5e-41   
ref|XP_007145054.1|  hypothetical protein PHAVU_007G206000g             166   9e-41   
ref|XP_006840391.1|  hypothetical protein AMTR_s00045p00141060          166   2e-40   
ref|XP_010674470.1|  PREDICTED: transcription factor PIF3-like          164   4e-40   
ref|XP_003591255.1|  Transcription factor PIF3                          163   4e-40   
gb|KFK43254.1|  phytochrome-interacting factor                          161   1e-39   
ref|XP_010042473.1|  PREDICTED: transcription factor PIF3-like          162   2e-39   
ref|XP_008453043.1|  PREDICTED: transcription factor PIF3 isoform X1    161   5e-39   
ref|XP_010458240.1|  PREDICTED: transcription factor PIF3-like          158   2e-38   
ref|XP_010549193.1|  PREDICTED: transcription factor PIF3-like is...    158   2e-38   
ref|XP_010549189.1|  PREDICTED: transcription factor PIF3-like is...    157   4e-38   
ref|XP_008453053.1|  PREDICTED: transcription factor PIF3 isoform X2    157   7e-38   
ref|XP_010490103.1|  PREDICTED: transcription factor PIF3-like          155   1e-37   
ref|XP_010475789.1|  PREDICTED: transcription factor PIF3               155   2e-37   
ref|XP_009366017.1|  PREDICTED: transcription factor PIF3-like is...    152   3e-36   
ref|XP_010549185.1|  PREDICTED: transcription factor PIF3-like is...    152   4e-36   
ref|NP_172424.1|  transcription factor PIF3                             147   5e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAC99771.1|  phytochrome-associated protein 3                        146   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008370334.1|  PREDICTED: transcription factor PIF3 isoform X2    146   2e-34   
gb|KHG19219.1|  Transcription factor PIF3                               144   2e-33   
gb|KHG19220.1|  Transcription factor PIF3                               144   2e-33   
ref|XP_006417565.1|  hypothetical protein EUTSA_v10007343mg             140   1e-32   
ref|XP_006303172.1|  hypothetical protein CARUB_v10008815mg             140   2e-32   
ref|XP_010094912.1|  hypothetical protein L484_022662                   141   4e-32   
gb|AES82347.2|  phytochrome-interacting factor 3.1                      140   6e-32   
ref|XP_002889756.1|  hypothetical protein ARALYDRAFT_471048             137   1e-31   
ref|XP_009335549.1|  PREDICTED: transcription factor PIF3-like is...    136   6e-31   
ref|XP_009148251.1|  PREDICTED: transcription factor PIF3 isoform X2    135   7e-31   
ref|XP_009148249.1|  PREDICTED: transcription factor PIF3 isoform X1    135   8e-31   
ref|XP_008807924.1|  PREDICTED: transcription factor PIF3-like is...    134   3e-30   
emb|CDX94963.1|  BnaC05g07080D                                          132   8e-30   
gb|AEK06077.1|  phytochrome-interacting factor 3.1                      132   2e-29   
gb|AEK06083.1|  phytochrome-interacting factor 3.1                      132   2e-29   
gb|AEK06076.1|  phytochrome-interacting factor 3.1                      132   2e-29   
emb|CDY64745.1|  BnaA06g37850D                                          130   2e-29   
gb|AEK06080.1|  phytochrome-interacting factor 3.1                      132   2e-29   
ref|XP_009401973.1|  PREDICTED: transcription factor PIF3-like is...    132   2e-29   
gb|AEK06075.1|  phytochrome-interacting factor 3.1                      132   2e-29   
ref|XP_009401971.1|  PREDICTED: transcription factor PIF3-like is...    132   2e-29   
ref|XP_011023895.1|  PREDICTED: transcription factor PIF3-like          131   5e-29   
gb|KDP23327.1|  hypothetical protein JCGZ_23160                         131   8e-29   
ref|XP_002319450.2|  hypothetical protein POPTR_0013s00310g             130   1e-28   Populus trichocarpa [western balsam poplar]
ref|XP_003626129.1|  Transcription factor PIF3                          130   2e-28   
ref|XP_010271074.1|  PREDICTED: transcription factor PIF3 isoform X2    130   2e-28   
ref|XP_010233063.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    127   9e-28   
ref|XP_003591254.1|  Transcription factor PIF3                          127   9e-28   
ref|XP_004495811.1|  PREDICTED: transcription factor PIF3-like is...    126   3e-27   
ref|XP_004495812.1|  PREDICTED: transcription factor PIF3-like is...    126   3e-27   
ref|XP_010271069.1|  PREDICTED: transcription factor PIF3 isoform X1    124   1e-26   
gb|ABD33186.1|  Helix-loop-helix DNA-binding                            123   4e-26   Medicago truncatula
ref|XP_008776593.1|  PREDICTED: transcription factor PIF4-like is...    117   9e-25   
ref|XP_008776592.1|  PREDICTED: transcription factor PIF4-like is...    117   9e-25   
ref|XP_010070105.1|  PREDICTED: transcription factor PIF3-like is...    107   3e-21   
ref|XP_010070104.1|  PREDICTED: transcription factor PIF3-like is...    107   3e-21   
ref|XP_009591142.1|  PREDICTED: transcription factor PIF3-like        99.8    3e-21   
ref|XP_010070103.1|  PREDICTED: transcription factor PIF3-like is...    107   3e-21   
ref|XP_006645783.1|  PREDICTED: transcription factor PIF1-like          107   5e-21   
ref|XP_010906805.1|  PREDICTED: transcription factor PIF4-like is...    106   6e-21   
ref|XP_010906815.1|  PREDICTED: transcription factor PIF4-like is...    106   7e-21   
ref|XP_010914796.1|  PREDICTED: transcription factor PIF3-like is...    106   8e-21   
emb|CDP03833.1|  unnamed protein product                                106   8e-21   
ref|XP_010914797.1|  PREDICTED: transcription factor PIF3-like is...    106   8e-21   
ref|XP_008811817.1|  PREDICTED: transcription factor PIF4-like is...    106   9e-21   
ref|XP_008811822.1|  PREDICTED: transcription factor PIF4-like is...    105   1e-20   
ref|XP_008811825.1|  PREDICTED: transcription factor PIF4-like is...    105   1e-20   
ref|XP_008811826.1|  PREDICTED: transcription factor PIF4-like is...    105   1e-20   
ref|XP_009399053.1|  PREDICTED: transcription factor PIF4-like          104   2e-20   
gb|KHN48974.1|  Transcription factor PIF1                               100   4e-20   
gb|KGN61033.1|  hypothetical protein Csa_2G035330                       104   5e-20   
ref|XP_004144801.1|  PREDICTED: transcription factor PIF3-like          103   6e-20   
gb|EEC70435.1|  hypothetical protein OsI_01449                          103   7e-20   Oryza sativa Indica Group [Indian rice]
dbj|BAD81566.1|  putative BP-5 protein                                  102   1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042775.2|  Os01g0286100                                       102   1e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEE54353.1|  hypothetical protein OsJ_01348                          102   2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|KDO44799.1|  hypothetical protein CISIN_1g0077971mg                95.9    2e-19   
ref|XP_007145052.1|  hypothetical protein PHAVU_007G206000g             101   2e-19   
ref|XP_002466767.1|  hypothetical protein SORBIDRAFT_01g013843          101   2e-19   Sorghum bicolor [broomcorn]
ref|XP_004982351.1|  PREDICTED: transcription factor PIF1-like is...    101   3e-19   
ref|XP_004982350.1|  PREDICTED: transcription factor PIF1-like is...    101   3e-19   
ref|XP_004982352.1|  PREDICTED: transcription factor PIF1-like is...    101   3e-19   
ref|XP_010904661.1|  PREDICTED: transcription factor PIF4-like is...    101   3e-19   
ref|XP_010904660.1|  PREDICTED: transcription factor PIF4-like is...    101   3e-19   
gb|EMT27650.1|  Transcription factor PIF3                             98.6    4e-19   
ref|XP_006576979.1|  PREDICTED: transcription factor PIF1-like is...    100   4e-19   
ref|XP_003521328.1|  PREDICTED: transcription factor PIF1-like is...    100   4e-19   
emb|CDY06358.1|  BnaA09g48450D                                          100   5e-19   
ref|XP_009118315.1|  PREDICTED: transcription factor PIF3-like          100   5e-19   
gb|KDO44794.1|  hypothetical protein CISIN_1g0077971mg                97.8    5e-19   
ref|XP_006594070.1|  PREDICTED: transcription factor PIF1-like is...    100   5e-19   
gb|KDO44798.1|  hypothetical protein CISIN_1g0077971mg                98.2    5e-19   
gb|KDO44796.1|  hypothetical protein CISIN_1g0077971mg                97.4    5e-19   
ref|XP_007049883.1|  Phytochrome interacting factor 3-like 5, put...    100   6e-19   
ref|XP_007049885.1|  Phytochrome interacting factor 3-like 5, put...    100   6e-19   
gb|EYU17967.1|  hypothetical protein MIMGU_mgv1a007316mg              99.0    6e-19   
gb|EYU46364.1|  hypothetical protein MIMGU_mgv1a007040mg              98.6    9e-19   
gb|KDO44791.1|  hypothetical protein CISIN_1g0077971mg                97.4    1e-18   
gb|KDO44792.1|  hypothetical protein CISIN_1g0077971mg                97.4    1e-18   
tpg|DAA50359.1|  TPA: putative HLH DNA-binding domain superfamily...  99.8    1e-18   
ref|NP_001147809.1|  PIL5                                             99.4    1e-18   Zea mays [maize]
gb|KHG01839.1|  Transcription factor PIF1 -like protein               99.4    1e-18   
ref|XP_004967640.1|  PREDICTED: transcription factor PIF3-like is...  99.8    1e-18   
gb|KHG18014.1|  Transcription factor PIF1 -like protein               99.4    1e-18   
dbj|BAJ90328.1|  predicted protein                                    95.1    1e-18   
ref|XP_004967645.1|  PREDICTED: transcription factor PIF3-like is...  99.4    1e-18   
emb|CDY22636.1|  BnaC08g42700D                                        99.0    1e-18   
ref|XP_010245662.1|  PREDICTED: transcription factor PIF1-like is...  99.0    2e-18   
gb|KCW89801.1|  hypothetical protein EUGRSUZ_A02043                   97.4    2e-18   
ref|XP_010245661.1|  PREDICTED: transcription factor PIF1-like is...  99.0    2e-18   
ref|XP_010245660.1|  PREDICTED: transcription factor PIF1-like is...  99.0    2e-18   
ref|XP_010054152.1|  PREDICTED: transcription factor PIF5             98.6    2e-18   
ref|XP_010245663.1|  PREDICTED: transcription factor PIF1-like is...  98.6    2e-18   
ref|XP_007144439.1|  hypothetical protein PHAVU_007G156200g           98.2    3e-18   
tpg|DAA54248.1|  TPA: putative HLH DNA-binding domain superfamily...  98.6    3e-18   
gb|AGW52145.1|  PIL                                                   98.2    3e-18   
gb|KCW89798.1|  hypothetical protein EUGRSUZ_A02043                   98.2    3e-18   
ref|XP_004495025.1|  PREDICTED: transcription factor PIF1-like is...  98.2    3e-18   
ref|XP_004499538.1|  PREDICTED: transcription factor PIF4-like is...  97.8    3e-18   
ref|XP_006386276.1|  hypothetical protein POPTR_0002s05630g           97.8    4e-18   
ref|XP_011026200.1|  PREDICTED: transcription factor PIF4             97.8    4e-18   
ref|XP_004499540.1|  PREDICTED: transcription factor PIF4-like is...  97.8    4e-18   
ref|XP_004499539.1|  PREDICTED: transcription factor PIF4-like is...  97.8    4e-18   
gb|AHM26454.1|  PIF3                                                  90.5    4e-18   
dbj|BAJ93366.1|  predicted protein                                    97.4    4e-18   
tpg|DAA54246.1|  TPA: putative HLH DNA-binding domain superfamily...  95.9    4e-18   
ref|XP_006437070.1|  hypothetical protein CICLE_v10031028mg           97.8    4e-18   
gb|AHM26463.1|  PIF3                                                  90.5    4e-18   
ref|XP_006437072.1|  hypothetical protein CICLE_v10031028mg           97.8    4e-18   
gb|AHM26452.1|  PIF3                                                  90.1    5e-18   
gb|AHM26451.1|  PIF3                                                  90.1    5e-18   
gb|AHM26455.1|  PIF3                                                  90.1    5e-18   
ref|XP_006437068.1|  hypothetical protein CICLE_v10031028mg           97.4    5e-18   
ref|XP_006437071.1|  hypothetical protein CICLE_v10031028mg           97.8    5e-18   
gb|AHM26476.1|  PIF3                                                  90.1    5e-18   
ref|XP_006651623.1|  PREDICTED: transcription factor PIF5-like        95.5    5e-18   
ref|XP_002278399.1|  PREDICTED: transcription factor PIF4             97.4    5e-18   Vitis vinifera
ref|XP_006485005.1|  PREDICTED: transcription factor PIF4-like is...  97.4    6e-18   
ref|XP_006485007.1|  PREDICTED: transcription factor PIF4-like is...  97.4    6e-18   
ref|XP_006437069.1|  hypothetical protein CICLE_v10031028mg           97.4    6e-18   
ref|XP_006485006.1|  PREDICTED: transcription factor PIF4-like is...  97.4    6e-18   
ref|XP_011083103.1|  PREDICTED: transcription factor PIF1             97.1    6e-18   
emb|CBI22065.3|  unnamed protein product                              97.1    7e-18   
ref|NP_001067246.1|  Os12g0610200                                     96.3    8e-18   Oryza sativa Japonica Group [Japonica rice]
gb|ABA99362.2|  Helix-loop-helix DNA-binding domain containing pr...  96.3    8e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69654.1|  hypothetical protein OsI_39066                        96.3    8e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_010247965.1|  PREDICTED: transcription factor PIF5-like        96.3    1e-17   
ref|XP_008777260.1|  PREDICTED: transcription factor PIF3-like        96.3    1e-17   
tpg|DAA51720.1|  TPA: putative HLH DNA-binding domain superfamily...  95.9    2e-17   
ref|XP_008665528.1|  PREDICTED: transcription factor PIF5 isoform X2  95.9    2e-17   
gb|KEH42414.1|  transcription factor                                  95.5    2e-17   
ref|XP_008665523.1|  PREDICTED: transcription factor PIF5 isoform X1  95.5    2e-17   
ref|XP_007162650.1|  hypothetical protein PHAVU_001G168700g           95.1    2e-17   
gb|ABF97814.1|  Helix-loop-helix DNA-binding domain containing pr...  95.1    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97813.1|  Helix-loop-helix DNA-binding domain containing pr...  95.1    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003559649.1|  PREDICTED: transcription factor PIF1-like        94.7    2e-17   
ref|XP_004493862.1|  PREDICTED: transcription factor PIF1-like is...  95.1    2e-17   
ref|XP_002521150.1|  Phytochrome-interacting factor, putative         95.5    2e-17   Ricinus communis
ref|XP_007051317.1|  Phytochrome interacting factor 3, putative       95.5    3e-17   
ref|XP_004493861.1|  PREDICTED: transcription factor PIF1-like is...  95.1    3e-17   
gb|EAY91148.1|  hypothetical protein OsI_12756                        94.7    3e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_004493860.1|  PREDICTED: transcription factor PIF1-like is...  95.1    3e-17   
ref|XP_004493863.1|  PREDICTED: transcription factor PIF1-like is...  94.7    3e-17   
ref|XP_001764406.1|  predicted protein                                95.5    4e-17   
ref|XP_010109673.1|  hypothetical protein L484_015158                 94.4    5e-17   
ref|XP_008447346.1|  PREDICTED: transcription factor PIF1-like is...  92.8    5e-17   
gb|KGN44558.1|  hypothetical protein Csa_7G333400                     94.4    5e-17   
ref|XP_004139727.1|  PREDICTED: transcription factor PIF1-like        94.4    5e-17   
gb|KDP26428.1|  hypothetical protein JCGZ_17586                       94.0    7e-17   
ref|XP_001764602.1|  predicted protein                                94.4    7e-17   
ref|XP_010936085.1|  PREDICTED: transcription factor PIF1-like is...  92.8    8e-17   
ref|XP_004247109.1|  PREDICTED: transcription factor PIF1-like        94.0    8e-17   
ref|XP_008461998.1|  PREDICTED: transcription factor PIF1             93.6    8e-17   
ref|XP_010936084.1|  PREDICTED: transcription factor PIF1-like is...  92.4    9e-17   
ref|XP_008447345.1|  PREDICTED: transcription factor PIF1-like is...  93.2    1e-16   
gb|EYU35367.1|  hypothetical protein MIMGU_mgv1a019493mg              90.1    1e-16   
ref|XP_002981138.1|  hypothetical protein SELMODRAFT_114141           86.3    1e-16   
ref|XP_009591396.1|  PREDICTED: transcription factor PIF1-like        93.2    1e-16   
ref|XP_002982619.1|  hypothetical protein SELMODRAFT_116654           85.9    1e-16   
ref|XP_007201708.1|  hypothetical protein PRUPE_ppa004070mg           92.8    2e-16   
gb|KCW58688.1|  hypothetical protein EUGRSUZ_H01336                   92.8    2e-16   
gb|KCW58687.1|  hypothetical protein EUGRSUZ_H01336                   92.8    2e-16   
ref|XP_008235752.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  92.0    2e-16   
gb|KGN58326.1|  hypothetical protein Csa_3G622450                     92.4    2e-16   
ref|XP_002983759.1|  hypothetical protein SELMODRAFT_118904           85.5    2e-16   
ref|XP_008789575.1|  PREDICTED: transcription factor APG-like         91.3    2e-16   
ref|XP_006350296.1|  PREDICTED: transcription factor PIF1-like is...  92.0    3e-16   
ref|XP_010904655.1|  PREDICTED: transcription factor PIF4-like is...  92.0    3e-16   
ref|XP_006350295.1|  PREDICTED: transcription factor PIF1-like is...  92.0    3e-16   
ref|XP_009757612.1|  PREDICTED: transcription factor PIF4             91.3    4e-16   
ref|XP_009407100.1|  PREDICTED: transcription factor PIF1-like        90.5    4e-16   
ref|XP_009602219.1|  PREDICTED: transcription factor PIF4             91.3    4e-16   
ref|XP_003625475.1|  Transcription factor PIF1                        90.9    5e-16   
gb|ABN08903.1|  Helix-loop-helix DNA-binding                          90.9    5e-16   Medicago truncatula
ref|XP_010231744.1|  PREDICTED: transcription factor APG-like         89.0    5e-16   
gb|KEH23988.1|  transcription factor                                  90.5    6e-16   
gb|ACR38655.1|  unknown                                               90.1    6e-16   Zea mays [maize]
ref|XP_006364548.1|  PREDICTED: transcription factor PIF1-like        90.9    6e-16   
ref|NP_001051465.1|  Os03g0782500                                     89.7    7e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004303901.1|  PREDICTED: transcription factor PIF5-like        90.9    7e-16   
gb|ABF99197.1|  Helix-loop-helix DNA-binding domain containing pr...  89.7    7e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010652458.1|  PREDICTED: transcription factor PIF1 isoform X3  90.5    8e-16   
emb|CBI37249.3|  unnamed protein product                              90.1    8e-16   
gb|KHN09413.1|  Transcription factor PIF1                             87.8    8e-16   
gb|KDO65840.1|  hypothetical protein CISIN_1g014090mg                 89.4    8e-16   
ref|XP_010652457.1|  PREDICTED: transcription factor PIF1 isoform X2  90.5    8e-16   
ref|XP_007048912.1|  Phytochrome interacting factor 3-like 6, put...  89.4    9e-16   
ref|XP_010228906.1|  PREDICTED: transcription factor PIF5-like        89.7    9e-16   
ref|XP_010904653.1|  PREDICTED: transcription factor PIF4-like is...  90.5    9e-16   
ref|XP_001766358.1|  predicted protein                                83.6    9e-16   
ref|XP_010904659.1|  PREDICTED: transcription factor PIF4-like is...  90.5    9e-16   
ref|XP_010904658.1|  PREDICTED: transcription factor PIF4-like is...  90.5    1e-15   
ref|XP_010904657.1|  PREDICTED: transcription factor PIF4-like is...  90.5    1e-15   
gb|AFK46721.1|  unknown                                               89.0    1e-15   
ref|XP_006480179.1|  PREDICTED: transcription factor PIF1-like is...  90.1    1e-15   
ref|XP_010652454.1|  PREDICTED: transcription factor PIF1 isoform X1  90.1    1e-15   
ref|XP_009794497.1|  PREDICTED: transcription factor PIF1             90.1    1e-15   
ref|XP_010904656.1|  PREDICTED: transcription factor PIF4-like is...  90.5    1e-15   
ref|XP_003626080.1|  Transcription factor SPATULA                     88.6    1e-15   
gb|ACR35132.1|  unknown                                               90.5    1e-15   Zea mays [maize]
ref|XP_006443673.1|  hypothetical protein CICLE_v10019585mg           90.1    1e-15   
ref|XP_004164938.1|  PREDICTED: transcription factor PIF1-like        90.1    1e-15   
ref|XP_011024540.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  90.5    1e-15   
ref|XP_004152073.1|  PREDICTED: transcription factor PIF1-like        90.1    1e-15   
gb|KDO65837.1|  hypothetical protein CISIN_1g014090mg                 89.4    1e-15   
gb|KCW50158.1|  hypothetical protein EUGRSUZ_K03592                   90.1    1e-15   
ref|XP_008654839.1|  PREDICTED: uncharacterized protein LOC100279...  90.5    1e-15   
gb|EEE60044.1|  hypothetical protein OsJ_12829                        89.7    1e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76276.1|  hypothetical protein OsI_13762                        89.7    1e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_010038342.1|  PREDICTED: transcription factor PIF1-like is...  89.7    1e-15   
ref|XP_002984591.1|  hypothetical protein SELMODRAFT_29179            82.4    1e-15   
ref|XP_009397370.1|  PREDICTED: transcription factor PIF4-like        89.7    1e-15   
ref|XP_002303090.1|  PHYTOCHROME INTERACTING FACTOR 3-LIKE 5 fami...  89.7    2e-15   
ref|XP_010038341.1|  PREDICTED: transcription factor PIF1-like is...  89.7    2e-15   
ref|XP_009407082.1|  PREDICTED: transcription factor PIF5-like        88.2    2e-15   
ref|XP_002306764.2|  hypothetical protein POPTR_0005s22870g           89.7    2e-15   
gb|EEC78487.1|  hypothetical protein OsI_18387                        87.0    2e-15   
ref|XP_008796446.1|  PREDICTED: transcription factor PIF1-like        88.2    2e-15   
ref|XP_010684995.1|  PREDICTED: transcription factor PIF1-like        89.4    2e-15   
ref|XP_001772223.1|  predicted protein                                82.4    2e-15   
emb|CDP16054.1|  unnamed protein product                              89.0    2e-15   
ref|XP_004292266.1|  PREDICTED: transcription factor PIF1-like        89.0    2e-15   
ref|XP_007048908.1|  Phytochrome interacting factor 3-like 6, put...  89.0    3e-15   
ref|XP_007048909.1|  Phytochrome interacting factor 3-like 6, put...  89.0    3e-15   
ref|XP_008372429.1|  PREDICTED: transcription factor PIF1-like        89.0    3e-15   
ref|XP_007048911.1|  Phytochrome interacting factor 3-like 6, put...  87.8    3e-15   
dbj|BAL63287.1|  basic helix-loop-helix protein APG                   88.2    3e-15   
ref|XP_010093617.1|  Transcription factor SPATULA                     87.4    3e-15   
ref|XP_006575134.1|  PREDICTED: transcription factor PIF1-like        83.2    3e-15   
ref|XP_002978656.1|  hypothetical protein SELMODRAFT_39143            81.6    3e-15   
gb|KHN36350.1|  Transcription factor PIF1                             85.1    3e-15   
ref|XP_006357888.1|  PREDICTED: transcription factor PIF4-like        88.6    3e-15   
ref|XP_004243631.1|  PREDICTED: transcription factor PIF4             88.6    3e-15   
ref|NP_001146660.1|  putative HLH DNA-binding domain superfamily ...  87.4    3e-15   
dbj|BAJ92170.1|  predicted protein                                    86.7    3e-15   
ref|XP_004240467.1|  PREDICTED: transcription factor PIF1-like is...  88.6    4e-15   
ref|XP_010321805.1|  PREDICTED: transcription factor PIF1-like is...  88.6    4e-15   
ref|XP_008382659.1|  PREDICTED: transcription factor PIF1-like        88.6    4e-15   
ref|XP_004960433.1|  PREDICTED: transcription factor PIF3-like        88.2    4e-15   
ref|XP_011032743.1|  PREDICTED: transcription factor PIF4-like is...  88.6    4e-15   
ref|XP_007048910.1|  Phytochrome interacting factor 3-like 6, put...  88.2    4e-15   
ref|XP_011100371.1|  PREDICTED: transcription factor PIF4             88.2    4e-15   
ref|NP_001054593.1|  Os05g0139100                                     88.2    4e-15   
ref|XP_008348351.1|  PREDICTED: transcription factor PIF4-like        88.2    4e-15   
ref|XP_002273729.1|  PREDICTED: transcription factor PIF3             88.2    4e-15   
ref|XP_011032741.1|  PREDICTED: transcription factor PIF4-like is...  88.6    4e-15   
ref|XP_011032742.1|  PREDICTED: transcription factor PIF4-like is...  88.6    4e-15   
ref|XP_009372305.1|  PREDICTED: transcription factor PIF1             88.2    4e-15   
gb|EEE62266.1|  hypothetical protein OsJ_17053                        87.4    4e-15   
dbj|BAF00716.1|  putative bHLH transcription factor                   87.0    5e-15   
ref|NP_849996.1|  transcription factor PIF1                           87.0    5e-15   
ref|XP_008342323.1|  PREDICTED: transcription factor PIF4-like        88.2    5e-15   
ref|XP_010093193.1|  hypothetical protein L484_013318                 87.8    5e-15   
gb|EMT23685.1|  Transcription factor PIF3                             86.3    6e-15   
ref|XP_002466350.1|  hypothetical protein SORBIDRAFT_01g006190        87.0    6e-15   
dbj|BAJ95450.1|  predicted protein                                    86.7    6e-15   
dbj|BAJ89764.1|  predicted protein                                    86.7    7e-15   
ref|XP_009376949.1|  PREDICTED: transcription factor PIF4             87.4    8e-15   
ref|XP_004981538.1|  PREDICTED: transcription factor PIF4-like is...  86.7    8e-15   
ref|XP_002439246.1|  hypothetical protein SORBIDRAFT_09g003090        87.0    8e-15   
gb|EMT29569.1|  Transcription factor PIF5                             84.3    8e-15   
ref|XP_004963135.1|  PREDICTED: transcription factor PIF4-like is...  86.7    8e-15   
gb|EPS58336.1|  hypothetical protein M569_16479                       81.6    9e-15   
gb|AAD24380.1|  unknown protein                                       87.0    9e-15   
ref|NP_179608.2|  transcription factor PIF1                           87.0    1e-14   
ref|XP_006297599.1|  hypothetical protein CARUB_v10013621mg           86.7    1e-14   
ref|XP_010940774.1|  PREDICTED: putative transcription factor bHL...  86.3    1e-14   
ref|XP_002442504.1|  hypothetical protein SORBIDRAFT_08g021000        87.0    1e-14   
ref|XP_002883941.1|  hypothetical protein ARALYDRAFT_319546           86.3    1e-14   
emb|CAD32238.1|  BP-5 protein                                         84.7    1e-14   
dbj|BAJ92913.1|  predicted protein                                    86.7    1e-14   
dbj|BAJ90909.1|  predicted protein                                    86.7    1e-14   
dbj|BAK07789.1|  predicted protein                                    86.3    1e-14   
gb|ABK95099.1|  unknown                                               86.7    1e-14   
ref|XP_002320931.2|  hypothetical protein POPTR_0014s10700g           86.7    2e-14   
ref|XP_010489088.1|  PREDICTED: transcription factor PIF1-like        86.7    2e-14   
ref|XP_003536955.1|  PREDICTED: transcription factor PIF1-like is...  86.3    2e-14   
gb|KHG22328.1|  Transcription factor PIF5 -like protein               84.3    2e-14   
ref|XP_002515170.1|  hypothetical protein RCOM_1343120                86.3    2e-14   
ref|XP_010416217.1|  PREDICTED: transcription factor PIF1-like is...  85.9    2e-14   
ref|XP_002459338.1|  hypothetical protein SORBIDRAFT_02g002760        85.5    2e-14   
emb|CDY31989.1|  BnaA07g00060D                                        85.5    2e-14   
ref|XP_010667415.1|  PREDICTED: transcription factor SPATULA-like...  85.1    3e-14   
ref|XP_008657287.1|  PREDICTED: transcription factor PIF5-like        84.0    3e-14   
gb|AFW57548.1|  putative HLH DNA-binding domain superfamily protein   85.5    3e-14   
gb|EMS55398.1|  Transcription factor PIF5                             84.3    3e-14   
ref|XP_008662938.1|  PREDICTED: transcription factor APG-like         85.5    3e-14   
ref|XP_010416208.1|  PREDICTED: transcription factor PIF1-like is...  85.5    3e-14   
ref|XP_004154488.1|  PREDICTED: transcription factor bHLH82-like      81.6    3e-14   
ref|XP_010667416.1|  PREDICTED: transcription factor SPATULA-like...  84.7    3e-14   
ref|XP_011016535.1|  PREDICTED: transcription factor PIF3-like is...  85.5    3e-14   
ref|XP_011040055.1|  PREDICTED: transcription factor PIF3-like        85.5    3e-14   
gb|KFK40384.1|  hypothetical protein AALP_AA3G366400                  85.5    4e-14   
ref|XP_006408930.1|  hypothetical protein EUTSA_v10001974mg           85.1    4e-14   
emb|CDY05725.1|  BnaC07g00780D                                        85.1    4e-14   
gb|KHG14782.1|  Transcription factor PIF3                             84.7    4e-14   
gb|KHG14783.1|  Transcription factor PIF3                             84.7    4e-14   
ref|XP_010467931.1|  PREDICTED: transcription factor PIF1-like        84.7    5e-14   
ref|XP_010264023.1|  PREDICTED: transcription factor PIF1-like is...  84.7    5e-14   
gb|EPS62617.1|  hypothetical protein M569_12173                       78.6    5e-14   
ref|NP_001168665.1|  putative HLH DNA-binding domain superfamily ...  84.0    5e-14   
gb|ACN27555.1|  unknown                                               83.6    6e-14   
emb|CDY67566.1|  BnaCnng55460D                                        82.4    6e-14   
dbj|BAC19953.1|  transcription factor BHLH9-like protein              84.0    6e-14   
ref|NP_001058876.2|  Os07g0143200                                     84.3    6e-14   
ref|XP_006339939.1|  PREDICTED: transcription factor SPATULA-like     83.6    6e-14   
ref|XP_004955437.1|  PREDICTED: transcription factor PIF4-like        83.6    6e-14   
gb|AEV57494.1|  rice phytochrome-interacting factor 4                 84.0    6e-14   
ref|XP_009356576.1|  PREDICTED: transcription factor PIF4-like        84.7    7e-14   
ref|NP_001056902.2|  Os06g0164400                                     80.9    8e-14   
ref|XP_007204562.1|  hypothetical protein PRUPE_ppa014897mg           81.6    8e-14   
ref|XP_009597633.1|  PREDICTED: transcription factor PIF1-like        84.0    9e-14   
ref|NP_001147257.1|  protein SPATULA                                  80.1    1e-13   
gb|EEE66551.1|  hypothetical protein OsJ_23063                        83.6    1e-13   
ref|NP_001146943.1|  protein SPATULA                                  80.1    1e-13   
ref|XP_008241481.1|  PREDICTED: transcription factor SPATULA isof...  82.0    1e-13   
ref|XP_007216256.1|  hypothetical protein PRUPE_ppa017228mg           83.6    1e-13   
ref|XP_010228426.1|  PREDICTED: transcription factor PIF4-like is...  82.4    1e-13   
ref|XP_010228425.1|  PREDICTED: transcription factor PIF4-like is...  82.4    1e-13   
ref|XP_009412363.1|  PREDICTED: transcription factor PIF3-like is...  84.0    1e-13   
ref|XP_009412387.1|  PREDICTED: transcription factor PIF3-like is...  83.6    1e-13   
ref|XP_008667885.1|  PREDICTED: protein SPATULA isoform X2            80.1    1e-13   
ref|XP_002447108.1|  hypothetical protein SORBIDRAFT_06g028750        79.7    2e-13   
ref|XP_010525635.1|  PREDICTED: transcription factor PIF4 isoform X2  82.8    2e-13   
gb|EEC81506.1|  hypothetical protein OsI_24867                        83.6    2e-13   
gb|EPS60825.1|  hypothetical protein M569_13976                       78.2    2e-13   
ref|XP_010525627.1|  PREDICTED: transcription factor PIF4 isoform X1  82.8    2e-13   
ref|XP_006656678.1|  PREDICTED: transcription factor SPATULA-like     80.1    2e-13   
gb|ADG56590.1|  ALCATRAZ/SPATULA-like protein                         82.0    2e-13   
ref|XP_004976829.1|  PREDICTED: transcription factor PIF1-like        79.3    2e-13   
ref|XP_002510190.1|  conserved hypothetical protein                   80.9    2e-13   
ref|XP_007160865.1|  hypothetical protein PHAVU_001G023200g           80.5    2e-13   
gb|KDO65836.1|  hypothetical protein CISIN_1g014090mg                 82.4    2e-13   
gb|KDO84121.1|  hypothetical protein CISIN_1g0227822mg                78.6    2e-13   
gb|KHG02827.1|  Transcription factor SPATULA -like protein            79.7    2e-13   
ref|XP_007160864.1|  hypothetical protein PHAVU_001G023200g           80.5    2e-13   
ref|XP_007047306.1|  Homeodomain-like superfamily protein, putati...  81.6    2e-13   
gb|KDO84120.1|  hypothetical protein CISIN_1g0227822mg                78.6    2e-13   
ref|XP_008241480.1|  PREDICTED: transcription factor SPATULA isof...  82.0    3e-13   
dbj|BAD19423.1|  hypothetical protein                                 77.4    3e-13   
gb|KFK30312.1|  hypothetical protein AALP_AA7G245600                  80.9    3e-13   
ref|XP_002523613.1|  conserved hypothetical protein                   81.6    3e-13   
ref|XP_009420906.1|  PREDICTED: transcription factor SPATULA-like     80.5    3e-13   
gb|ABK23705.1|  unknown                                               80.5    3e-13   
gb|KDP41706.1|  hypothetical protein JCGZ_16113                       80.5    3e-13   
ref|XP_008241478.1|  PREDICTED: transcription factor SPATULA isof...  81.6    3e-13   
ref|XP_010315963.1|  PREDICTED: transcription factor SPATULA isof...  81.3    3e-13   
emb|CBI21410.3|  unnamed protein product                              81.3    3e-13   
ref|XP_010315964.1|  PREDICTED: transcription factor SPATULA isof...  81.3    4e-13   
ref|XP_010652804.1|  PREDICTED: transcription factor SPATULA          81.3    4e-13   
ref|XP_008658092.1|  PREDICTED: putative HLH DNA-binding domain s...  79.7    4e-13   
ref|NP_001140849.1|  putative HLH DNA-binding domain superfamily ...  79.0    4e-13   
ref|XP_008367659.1|  PREDICTED: transcription factor SPATULA-like...  80.5    4e-13   
ref|XP_004142005.1|  PREDICTED: uncharacterized protein LOC101217594  81.3    4e-13   
ref|XP_006595974.1|  PREDICTED: transcription factor SPATULA-like     79.7    4e-13   
ref|XP_009783823.1|  PREDICTED: transcription factor SPATULA-like...  80.9    4e-13   
ref|XP_006473302.1|  PREDICTED: transcription factor SPATULA-like...  79.7    4e-13   
ref|XP_006473301.1|  PREDICTED: transcription factor SPATULA-like...  79.7    4e-13   
gb|EMT30687.1|  Transcription factor PIF5                             79.0    5e-13   
gb|ACM41588.1|  bHLH transcription factor MYC5                        80.1    5e-13   
ref|NP_001131794.1|  putative HLH DNA-binding domain superfamily ...  79.7    5e-13   
gb|EPS67626.1|  hypothetical protein M569_07148                       77.0    5e-13   
ref|XP_009607891.1|  PREDICTED: transcription factor SPATULA isof...  80.5    5e-13   
ref|XP_004157205.1|  PREDICTED: uncharacterized protein LOC101227644  80.9    5e-13   
gb|KCW54935.1|  hypothetical protein EUGRSUZ_I00906                   78.2    5e-13   
ref|XP_009783822.1|  PREDICTED: transcription factor SPATULA-like...  80.9    6e-13   
gb|EMS46835.1|  Transcription factor PIF5                             79.7    6e-13   
ref|XP_011099122.1|  PREDICTED: transcription factor SPATULA-like     80.5    6e-13   
ref|XP_003561052.1|  PREDICTED: transcription factor SPATULA-like     80.1    6e-13   
ref|XP_008440296.1|  PREDICTED: transcription factor SPATULA          80.9    6e-13   
ref|XP_007224914.1|  hypothetical protein PRUPE_ppa021918mg           79.7    6e-13   
ref|XP_007047305.1|  Homeodomain-like superfamily protein isoform 2   80.1    6e-13   
ref|XP_010112171.1|  Transcription factor SPATULA                     80.1    6e-13   
ref|XP_008367660.1|  PREDICTED: transcription factor SPATULA-like...  80.1    6e-13   
ref|XP_007163252.1|  hypothetical protein PHAVU_001G218800g           81.6    6e-13   
emb|CDY06867.1|  BnaC01g09660D                                        81.3    6e-13   
gb|KHG00584.1|  Transcription factor SPATULA -like protein            80.5    6e-13   
ref|XP_009607890.1|  PREDICTED: transcription factor SPATULA isof...  80.5    6e-13   
ref|NP_001147052.1|  protein SPATULA                                  78.6    6e-13   
ref|XP_009359830.1|  PREDICTED: transcription factor SPATULA-like...  79.7    7e-13   
ref|XP_009359822.1|  PREDICTED: transcription factor SPATULA-like...  80.1    7e-13   
emb|CDY35222.1|  BnaA01g08090D                                        81.3    7e-13   
ref|XP_009129263.1|  PREDICTED: transcription factor bHLH119-like...  80.9    7e-13   
ref|XP_010548419.1|  PREDICTED: transcription factor SPATULA-like     78.6    7e-13   
dbj|BAD67851.1|  basic helix-loop-helix protein SPATULA-like          79.3    7e-13   
ref|XP_008464685.1|  PREDICTED: transcription factor PIF4-like        81.3    8e-13   
gb|EAY99814.1|  hypothetical protein OsI_21804                        79.3    8e-13   
ref|XP_010531245.1|  PREDICTED: transcription factor SPATULA-like...  79.3    8e-13   
ref|XP_009130461.1|  PREDICTED: LOW QUALITY PROTEIN: putative tra...  80.9    8e-13   
ref|XP_010932049.1|  PREDICTED: transcription factor SPATULA          80.1    8e-13   
ref|XP_008338329.1|  PREDICTED: transcription factor SPATULA          80.1    8e-13   
ref|XP_004149520.1|  PREDICTED: transcription factor PIF5-like        80.9    9e-13   
emb|CDY35224.1|  BnaA01g08070D                                        78.6    9e-13   
ref|XP_010688822.1|  PREDICTED: transcription factor ALC-like         78.6    1e-12   
ref|XP_008229596.1|  PREDICTED: transcription factor PIF4-like        79.0    1e-12   
ref|XP_010240432.1|  PREDICTED: transcription factor PIF1-like is...  77.4    1e-12   
ref|XP_009367270.1|  PREDICTED: transcription factor SPATULA-like     79.7    1e-12   
gb|KDP31951.1|  hypothetical protein JCGZ_12412                       79.3    1e-12   
ref|XP_003580559.1|  PREDICTED: transcription factor PIF1-like is...  77.4    1e-12   
gb|KEH33641.1|  transcription factor                                  80.5    1e-12   
ref|XP_008340273.1|  PREDICTED: transcription factor SPATULA-like...  79.3    1e-12   
gb|KDO86766.1|  hypothetical protein CISIN_1g038097mg                 78.2    1e-12   
ref|XP_006854256.1|  hypothetical protein AMTR_s00039p00032460        80.5    1e-12   
ref|XP_009129259.1|  PREDICTED: transcription factor bHLH119-like...  80.5    1e-12   
emb|CDP02508.1|  unnamed protein product                              79.7    1e-12   
dbj|BAK05983.1|  predicted protein                                    79.7    1e-12   
ref|XP_010446691.1|  PREDICTED: transcription factor SPATULA-like...  79.7    1e-12   
ref|XP_011074391.1|  PREDICTED: transcription factor SPATULA-like     77.8    1e-12   
ref|XP_008340258.1|  PREDICTED: transcription factor SPATULA-like...  79.7    1e-12   
ref|XP_008340265.1|  PREDICTED: transcription factor SPATULA-like...  79.3    1e-12   
ref|XP_007141451.1|  hypothetical protein PHAVU_008G196800g           80.5    1e-12   
ref|XP_006856483.1|  hypothetical protein AMTR_s00046p00066610        80.1    1e-12   
emb|CDP01313.1|  unnamed protein product                              78.6    1e-12   
ref|XP_008793896.1|  PREDICTED: transcription factor SPATULA-like...  79.0    2e-12   
ref|XP_002454736.1|  hypothetical protein SORBIDRAFT_04g036450        77.8    2e-12   
ref|XP_008793895.1|  PREDICTED: transcription factor SPATULA-like...  79.0    2e-12   
gb|AAK98706.1|AC069158_18  Putative SPATULA                           78.2    2e-12   
ref|XP_006282937.1|  hypothetical protein CARUB_v10007459mg           79.7    2e-12   
emb|CCE46185.1|  bHLH transcription factor                            79.7    2e-12   
ref|XP_008793893.1|  PREDICTED: transcription factor SPATULA-like...  79.0    2e-12   
ref|XP_008793889.1|  PREDICTED: transcription factor SPATULA-like...  79.0    2e-12   
ref|XP_010927433.1|  PREDICTED: putative transcription factor bHL...  79.0    2e-12   
ref|XP_008447613.1|  PREDICTED: transcription factor PIF7-like is...  79.3    2e-12   
ref|XP_011016536.1|  PREDICTED: transcription factor PIF3-like is...  80.1    2e-12   
gb|AAK09221.1|AC084320_8  putative phytochrome interacting factor     77.4    2e-12   
gb|AHK05707.1|  bHLH transcription factor SPT                         78.6    2e-12   
ref|XP_007047304.1|  Basic helix-loop-helix DNA-binding superfami...  79.7    2e-12   
ref|XP_004499049.1|  PREDICTED: transcription factor SPATULA-like...  77.0    2e-12   
ref|XP_010927432.1|  PREDICTED: putative transcription factor bHL...  79.0    2e-12   
ref|XP_008793886.1|  PREDICTED: transcription factor SPATULA-like...  79.0    2e-12   



>ref|XP_009589214.1| PREDICTED: transcription factor PIF3-like [Nicotiana tomentosiformis]
Length=709

 Score =   295 bits (756),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 227/487 (47%), Positives = 284/487 (58%), Gaps = 77/487 (16%)
 Frame = +3

Query  423   MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSD  596
             MPLSEFLKM +   ESG+++ +S++   LS  P +D  ELVWENGQI MQGQSS AKK+ 
Sbjct  1     MPLSEFLKMARGKLESGQQRISSTT--HLSSFPENDLVELVWENGQIMMQGQSSSAKKNP  58

Query  597   NLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQ  776
               +++          S+IGK  +  S+L++MP SVP+ E+DL Q+DE  PWL Y+  +  
Sbjct  59    IPNKLPSNV------SKIGKFGVMDSMLNDMPLSVPTDELDLIQEDEGVPWLGYAADDSL  112

Query  777   SQEYGSQLLPEISGTTANEPSPHDGFPLI---GASKSVV---------NSGQRNATKLDC  920
              Q+Y SQ LPEISG TANEPS    F LI   G+S  ++         N+G     K+  
Sbjct  113   QQDYCSQFLPEISGLTANEPSRQSEFGLINKRGSSDKMIRDSHSVPIHNAGNFEQRKVSP  172

Query  921   SPRFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQA--------KNQDTE  1076
             S +F LL S + Q+ + L SGVSD+ SS  S    S+  DS   QA        K Q   
Sbjct  173   SSKFSLLCSLAPQKGH-LESGVSDVFSSKISNTPVSVYGDSGQNQAAAGEVKSIKIQKQN  231

Query  1077  TTRTCPPTLLNFSNFSRPVVLAR-ANLQN-----------TLEAKGKREKEIKENAQNPA  1220
              + +C  +L NFS+FSRP    + A LQN           T+EAKG +E E   N+ N  
Sbjct  232   MSGSC-SSLPNFSHFSRPATFVKAAKLQNITGGPNVSDSYTVEAKGSKEGENVTNSHNNV  290

Query  1221  KTALIEACSTSRKESDLKSQPNL-----------------RTKFEQTDASRED--TNDA-  1340
               A +E   +S+KE+DL    N+                   + EQ+D    D  +N A 
Sbjct  291   NAAAVEDYLSSKKENDLHYPTNVVPSQLESRASGDSFHDRSCRVEQSDNVFRDRSSNSAN  350

Query  1341  ------------DKVHGNKAVE-PgacssvcsgssaERASNDQSHSLKRRARENEESGCP  1481
                         D   G + VE    CSSVCSGSSAER S+DQ H+LKR+ R+NE+SGCP
Sbjct  351   TPGQFTGAKATTDTADGERNVEHGVVCSSVCSGSSAERGSSDQPHNLKRKTRDNEDSGCP  410

Query  1482  SEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKA  1661
             SED +EES G KK  P RGGTG KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKA
Sbjct  411   SEDVEEESVGIKKTCPTRGGTGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKA  470

Query  1662  DKASMLD  1682
             DKASMLD
Sbjct  471   DKASMLD  477



>ref|XP_009774962.1| PREDICTED: transcription factor PIF3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009774963.1| PREDICTED: transcription factor PIF3-like isoform X1 [Nicotiana 
sylvestris]
Length=719

 Score =   294 bits (752),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 230/488 (47%), Positives = 287/488 (59%), Gaps = 77/488 (16%)
 Frame = +3

Query  423   MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSD  596
             MPLSEFLKM +   ESG++K +S++   LS  P ++  ELVWENGQI MQGQSS AKK+ 
Sbjct  1     MPLSEFLKMARGKLESGQQKISSTT--HLSSFPENELVELVWENGQIMMQGQSSSAKKNP  58

Query  597   NLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQ  776
                 +  K   NAS  +IGK  +   +L++MP SVP GE+DL Q+DE  PWL Y+  +  
Sbjct  59    ----IPNKLPSNAS--KIGKFGVMDPMLNDMPLSVPIGELDLIQEDEGVPWLGYAADDSL  112

Query  777   SQEYGSQLLPEISGTTANEPSPHDGFPLI---GASKSVVNSGQ----RNATKLD---CSP  926
              Q+Y SQ LPEISG T NEP+    F LI   G+S  ++   Q     NA   D    SP
Sbjct  113   QQDYCSQFLPEISGLTTNEPAGQSEFGLINKRGSSDKMIRDSQSVPIHNAVNFDQRKVSP  172

Query  927   --RFGLLASWSSQQANP----LVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTR-  1085
               +F LL S + Q+ +     L  GVSDI SS  S N  S+L DS   Q    D ++ + 
Sbjct  173   SSKFSLLCSLAPQKGHASIPSLGPGVSDIFSSKTSNNSVSVLGDSNQSQVSAGDVKSVKI  232

Query  1086  -------TCPPTLLNFSNFSRPVVLARAN-LQNT----------LEAKGKREKEIKENAQ  1211
                    +C  +LLNFS+FSRP    +A  LQN           LEAKG +E E   N+ 
Sbjct  233   QKQNMPGSC-SSLLNFSHFSRPATFVKATKLQNITGVLASDSSALEAKGCKEGENVTNSH  291

Query  1212  NPAKTALIEACSTSRKESDLK----SQPNLR-------------TKFEQTD-ASREDTND  1337
             N    A +E   + +KES L+    + P+ R             ++ EQ+D   RE  +D
Sbjct  292   NHVNAAAVEDYLSFKKESGLQYPTSAVPSQRESRASGASFHDRSSRVEQSDNVFRESNSD  351

Query  1338  --ADKVHGNKAV-----------EPgacssvcsgssaERASNDQSHSLKRRARENEESGC  1478
                 +  G KA                CSSVCSGSSAER S+DQ H+LKR++R+NE+SGC
Sbjct  352   NTPGQFTGAKATTDTADGEGNAEHGVVCSSVCSGSSAERGSSDQPHNLKRKSRDNEDSGC  411

Query  1479  PSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK  1658
             PSED +EES G KK+ P RGGTG KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK
Sbjct  412   PSEDVEEESVGVKKSCPTRGGTGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK  471

Query  1659  ADKASMLD  1682
             ADKASMLD
Sbjct  472   ADKASMLD  479



>ref|XP_009774964.1| PREDICTED: transcription factor PIF3-like isoform X2 [Nicotiana 
sylvestris]
Length=711

 Score =   293 bits (751),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 230/488 (47%), Positives = 287/488 (59%), Gaps = 77/488 (16%)
 Frame = +3

Query  423   MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSD  596
             MPLSEFLKM +   ESG++K +S++   LS  P ++  ELVWENGQI MQGQSS AKK+ 
Sbjct  1     MPLSEFLKMARGKLESGQQKISSTT--HLSSFPENELVELVWENGQIMMQGQSSSAKKNP  58

Query  597   NLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQ  776
                 +  K   NAS  +IGK  +   +L++MP SVP GE+DL Q+DE  PWL Y+  +  
Sbjct  59    ----IPNKLPSNAS--KIGKFGVMDPMLNDMPLSVPIGELDLIQEDEGVPWLGYAADDSL  112

Query  777   SQEYGSQLLPEISGTTANEPSPHDGFPLI---GASKSVVNSGQ----RNATKLD---CSP  926
              Q+Y SQ LPEISG T NEP+    F LI   G+S  ++   Q     NA   D    SP
Sbjct  113   QQDYCSQFLPEISGLTTNEPAGQSEFGLINKRGSSDKMIRDSQSVPIHNAVNFDQRKVSP  172

Query  927   --RFGLLASWSSQQANP----LVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTR-  1085
               +F LL S + Q+ +     L  GVSDI SS  S N  S+L DS   Q    D ++ + 
Sbjct  173   SSKFSLLCSLAPQKGHASIPSLGPGVSDIFSSKTSNNSVSVLGDSNQSQVSAGDVKSVKI  232

Query  1086  -------TCPPTLLNFSNFSRPVVLARAN-LQNT----------LEAKGKREKEIKENAQ  1211
                    +C  +LLNFS+FSRP    +A  LQN           LEAKG +E E   N+ 
Sbjct  233   QKQNMPGSC-SSLLNFSHFSRPATFVKATKLQNITGVLASDSSALEAKGCKEGENVTNSH  291

Query  1212  NPAKTALIEACSTSRKESDLK----SQPNLR-------------TKFEQTD-ASREDTND  1337
             N    A +E   + +KES L+    + P+ R             ++ EQ+D   RE  +D
Sbjct  292   NHVNAAAVEDYLSFKKESGLQYPTSAVPSQRESRASGASFHDRSSRVEQSDNVFRESNSD  351

Query  1338  --ADKVHGNKAV-----------EPgacssvcsgssaERASNDQSHSLKRRARENEESGC  1478
                 +  G KA                CSSVCSGSSAER S+DQ H+LKR++R+NE+SGC
Sbjct  352   NTPGQFTGAKATTDTADGEGNAEHGVVCSSVCSGSSAERGSSDQPHNLKRKSRDNEDSGC  411

Query  1479  PSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK  1658
             PSED +EES G KK+ P RGGTG KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK
Sbjct  412   PSEDVEEESVGVKKSCPTRGGTGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK  471

Query  1659  ADKASMLD  1682
             ADKASMLD
Sbjct  472   ADKASMLD  479



>ref|XP_006358519.1| PREDICTED: transcription factor PIF3-like [Solanum tuberosum]
Length=716

 Score =   288 bits (738),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 236/500 (47%), Positives = 288/500 (58%), Gaps = 82/500 (16%)
 Frame = +3

Query  423   MPLSEFLKML--KNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS-  593
             MPLSEFLKM   K ESG++K +S++  +LS  P +D  EL W+NGQI MQGQSS AKKS 
Sbjct  1     MPLSEFLKMAIGKLESGQQKISSTT--NLSSFPENDLIELKWQNGQIVMQGQSSSAKKST  58

Query  594   ------DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                    + S  R+K  GN+S+S+IGK  L  ++L++M  SVP+ E+DL Q+DE  PWL 
Sbjct  59    VHNNFQSSASGDRDKYTGNSSTSKIGKFGLMDTMLNDMSLSVPTDELDLIQEDEGVPWLG  118

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLI----------GASKSV-----VNS  890
             Y   +   Q+Y +QLLPEISG TANE S    F LI          G S SV     VN 
Sbjct  119   YPADDSLQQDYCAQLLPEISGVTANEQSRQSVFGLINKRGSSDKMIGDSHSVPVHNAVNF  178

Query  891   GQRNATKLDCSPRFGLLASWSSQQANP----LVSGVSDIGSSNGSINLDSILKDSVPPQA  1058
              QRN +K+  S RF  L+S  SQ+ +     L SGVSDI SS  S    S+L DS   +A
Sbjct  179   EQRNTSKVSPSSRFSPLSSLPSQKGHASIPTLESGVSDIFSSKNSNTPMSVLGDSNQSKA  238

Query  1059  KNQDTETTRT----CP---PTLLNFSNFSRPVVLARA-NLQNT-----------LEAKGK  1181
                D ++ +      P     LLNFS+FSRP    +A  LQ++           LEAKGK
Sbjct  239   SAGDVKSNKIQKQNMPGNRSNLLNFSHFSRPATFVKAAKLQSSTGGSNVSDSPILEAKGK  298

Query  1182  REKEIKENAQNPAKTALIEACSTSRKE-----------SDLKSQP------NLRTKFEQT  1310
             +  E      N    A  E   TS+K+           S L+S+P      +   + EQ+
Sbjct  299   KGGEKVAIGDNHVSAAATENYLTSKKDNVPHYPTNGVPSQLESRPSGASFHDRSCQVEQS  358

Query  1311  DASREDT-----NDADKVHGNKAV-----------EPgacssvcsgssaERASNDQSHSL  1442
             D +  D      N  D+  G KA               ACSSVCSGSSAER S+DQ  +L
Sbjct  359   DNAFRDCSSNNDNTRDQFTGAKATKDIADGERNVEHGVACSSVCSGSSAERGSSDQPLNL  418

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ R+NEES C SED +EES G KK   ARGGTG KRSRAAEVHNLSERRRRDRINEKM
Sbjct  419   KRKTRDNEESECRSEDVEEESVGIKKTCAARGGTGSKRSRAAEVHNLSERRRRDRINEKM  478

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIPNCNKADKASMLD
Sbjct  479   RALQELIPNCNKADKASMLD  498



>ref|XP_010313958.1| PREDICTED: transcription factor PIF3 [Solanum lycopersicum]
 ref|XP_010313963.1| PREDICTED: transcription factor PIF3 [Solanum lycopersicum]
 ref|XP_010313968.1| PREDICTED: transcription factor PIF3 [Solanum lycopersicum]
Length=723

 Score =   288 bits (736),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 234/500 (47%), Positives = 292/500 (58%), Gaps = 82/500 (16%)
 Frame = +3

Query  423   MPLSEFLKML--KNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS-  593
             MPLSEFLKM   K ESG++K +S+S  +LS  P +D  EL W+NGQI MQGQ+S AKKS 
Sbjct  1     MPLSEFLKMAIGKPESGQQKISSTS--NLSSFPENDLVELKWQNGQIVMQGQNSSAKKST  58

Query  594   --DNL----SRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
               +NL    S  R+K  GN+S+S+IGK  L  S+L++M  +VP+GE+DL Q+DE  PWL 
Sbjct  59    VPNNLPSSASGDRDKYTGNSSTSKIGKFGLMDSMLNDMSLTVPTGELDLIQEDEGVPWLG  118

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLI----------GASKSV-----VNS  890
             Y   +   Q+Y +QLLPEISG TANE S    F LI          G S SV     VN 
Sbjct  119   YPADDSLQQDYCAQLLPEISGVTANEQSGQSVFGLINKRGSSDKMIGDSHSVPVHNAVNF  178

Query  891   GQRNATKLDCSPRFGLLASWSSQQANP----LVSGVSDIGSSNGSINLDSILKDSVPPQA  1058
              +RN +K+  S RF  L+S  SQ+ +     L SGVSD+ SS  S    S+L +S   +A
Sbjct  179   ERRNTSKVSPSSRFSPLSSLPSQKGHASIPTLESGVSDVFSSKNSNTPLSVLGESNQSKA  238

Query  1059  KNQDTETTRT----CP---PTLLNFSNFSRPVVLARA-NLQNT-----------LEAKGK  1181
                D ++ R      P     LLNFS+FSRP  L +A  LQ++           LEAKGK
Sbjct  239   SAGDAKSNRIQKQNMPGNRSNLLNFSHFSRPATLVKAAKLQSSTGGSNISGSPILEAKGK  298

Query  1182  REKEIKENAQNPAKTALIEACSTSRKE-----------SDLKSQP------NLRTKFEQT  1310
             + +E      N    A  E   TS+K+           S L+S+P      +   + EQ+
Sbjct  299   KGEEKVTIGDNHVSAAATENFLTSKKDNFPHYPTNGVSSQLESRPSGASFHDRSCQAEQS  358

Query  1311  D-ASREDTNDADKVH--------------GNKAVEPgacssvc-sgssaERASNDQSHSL  1442
             D A R+ +++ D  H              G + VE G   S   SGSSAER S+DQ  +L
Sbjct  359   DNAFRDCSSNNDNTHDHFTSAKATKDIADGERNVEHGVACSSVCSGSSAERGSSDQPLNL  418

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ R+NEE  C SED +EES G KK   ARGGTG KRSRAAEVHNLSERRRRDRINEKM
Sbjct  419   KRKTRDNEEFECRSEDVEEESVGIKKPCAARGGTGSKRSRAAEVHNLSERRRRDRINEKM  478

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIPNCNKADKASMLD
Sbjct  479   RALQELIPNCNKADKASMLD  498



>ref|XP_009794217.1| PREDICTED: transcription factor PIF3-like [Nicotiana sylvestris]
Length=650

 Score =   274 bits (701),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 215/489 (44%), Positives = 281/489 (57%), Gaps = 72/489 (15%)
 Frame = +3

Query  423   MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSD  596
             MPLSEFLKM +   ESG+ K  SS+ D  S L   +  ELVWENGQI MQ +SS+AKKS 
Sbjct  1     MPLSEFLKMARGKLESGQEK-RSSTTDPSSSLE-DELVELVWENGQIVMQSRSSRAKKSP  58

Query  597   NLS-------RMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                       R+++K  GN+S+++IGK  +  S+ D MP SVP+ EM+L+++DE+ PWL+
Sbjct  59    TFINLPSSSLRVKDKFTGNSSTTKIGKFGVMDSMFDNMPLSVPNDEMELTEEDEMVPWLS  118

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFP----------LIGASKSV-----VNS  890
             YS ++   Q+Y S LLPEISG T NEPS   GF           + GAS SV     VNS
Sbjct  119   YSANDSPQQDYHSPLLPEISGLTVNEPSGRRGFASMDKRGISNQMNGASHSVPIHNIVNS  178

Query  891   GQRNATKLDCSPRFGLLASWSSQQAN----PLVSGVSDIGSSNGSINLD-SILKDSVPPQ  1055
              Q NA+KL  S  F LL S + ++++    PL S +SDI SSN S N+  S    S   Q
Sbjct  179   EQGNASKLSPS-TFNLLCSGAPKKSSAPILPLGSRISDIISSNTSCNMPVSTFGYSNSSQ  237

Query  1056  AKNQDTETTRT----CP---PTLLNFSNFSRPVVLARA-NLQNTLEAKGKREKEIKENAQ  1211
             A     ++ +      P    +LLNF++FSRP+    A +  +T+ A+G  E+E   +++
Sbjct  238   ASAGVIKSMKMQKQNIPGNSSSLLNFAHFSRPITGGSAVSGSSTIGARGNIERENGGSSR  297

Query  1212  NPAKTALIEACSTSRKESDLKSQPNLRTK----------------FEQTD----------  1313
             N       E+  +S KE+D+ S P + +                  EQ+D          
Sbjct  298   NRVSEVPFESYFSSEKENDVHSPPYMASSKVESKGSVGLHERACPIEQSDNLCGDSPSNN  357

Query  1314  -ASREDTNDADKVH----GNKAVEPgacssvcsgss-aERASNDQSHSLKRRARENEESG  1475
               SR+    A+ +     G + VEP    S     S AERAS+D   +LKR+ R+NEES 
Sbjct  358   DMSRDQFTGANAIKEFPDGERNVEPVVVCSSVCSGSSAERASSDHPRTLKRKTRDNEESE  417

Query  1476  CPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN  1655
               SED +EES G K A PARGG G KRSRAAEVHNLSERRRRDRINEKM ALQ+LIPNCN
Sbjct  418   FQSEDVEEESVGIKSAYPARGGAGSKRSRAAEVHNLSERRRRDRINEKMSALQDLIPNCN  477

Query  1656  KADKASMLD  1682
             K DKASMLD
Sbjct  478   KVDKASMLD  486



>emb|CDP15171.1| unnamed protein product [Coffea canephora]
Length=717

 Score =   275 bits (703),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 210/486 (43%), Positives = 274/486 (56%), Gaps = 68/486 (14%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
             MPLSEFL+M + +    +P ++S  DLSP   +D  EL+WENGQI MQGQS++ KKS NL
Sbjct  1     MPLSEFLRMARGKLESAQPKTASPADLSPATENDLVELLWENGQILMQGQSNRVKKSPNL  60

Query  603   S-------RMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYS  761
             +        +R++  GN S+S++GK    GS L++  PSV SGE  L+Q+DE+ PWLNY 
Sbjct  61    NDFPSQEPGIRDRFTGNVSTSKVGKFVEIGSTLNDAMPSVRSGETYLNQEDEMGPWLNYP  120

Query  762   PSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLI--GASKSV--------VNSG----QR  899
               +G   ++ S++LPEISG T NEPS  + F  +  G+   V        V++G     R
Sbjct  121   VDDGFRSDFCSEILPEISGVTGNEPSTLNSFGSVVKGSCNQVPQHSYTVPVHNGLDIEAR  180

Query  900   NATKLDCSPRFGLLASWSSQQAN----PLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQ  1067
             NA+K+  S R GLL+ +SSQQ      P  SGVS +  +  S N  +   D+V  QA   
Sbjct  181   NASKVSSS-RTGLLSPYSSQQCQLSVAPAGSGVSSVVMNTTSNNPVTFFGDTVQGQASPG  239

Query  1068  DTETTRT----CPPTLLNFSNFSRPVVLARANLQNT----LEAKGKREKEIKENAQNPAK  1223
                + +          LNF++FSRP  L RANL+ T           EK    ++ +P K
Sbjct  240   GLVSMKMQNQKVASNFLNFTHFSRPAALVRANLEKTDGIAASCSSGIEKVSAVSSTSPVK  299

Query  1224  TALIEACSTSRKESDLKSQPNL-------RTKF-----EQTDASREDT-NDADKVHGNKA  1364
             +   +  S S+K+  + SQP L       R  F     E   A R D  +  D +  +K+
Sbjct  300   STH-KPSSNSQKDICVHSQPKLVSTKVDSRPSFDKPPEESCRAQRPDNLHWDDSIKNDKS  358

Query  1365  -------------------VEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPS  1484
                                VEP   +S   S +S E ASNDQ H+LKR+  +NEES   S
Sbjct  359   SSPIISSSITKEVKDCENPVEPVVAASSVCSANSGEGASNDQMHTLKRKHCDNEESESRS  418

Query  1485  EDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKAD  1664
             ED +EES G KK A ARG +G KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKAD
Sbjct  419   EDIEEESVGIKKVAHARGVSGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKAD  478

Query  1665  KASMLD  1682
             KASMLD
Sbjct  479   KASMLD  484



>emb|CAN76246.1| hypothetical protein VITISV_023382 [Vitis vinifera]
Length=627

 Score =   256 bits (653),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 205/494 (41%), Positives = 271/494 (55%), Gaps = 81/494 (16%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS---  593
             MP SE  +M K   G+ +      +DLS  P +DF ELVWE GQI MQGQSS+A+KS   
Sbjct  1     MPFSELYRMAK---GKPESVQQKTNDLSFGPENDFVELVWEGGQIMMQGQSSRARKSPLS  57

Query  594   ----DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYS  761
                  +  + R+K  G+ ++S++GK      +L++ P SVPS EM LSQDD++ PWLNY 
Sbjct  58    NSFPSHTPKPRDKDTGHGTNSKMGKFGSMDFILNDFPLSVPSAEMGLSQDDDMVPWLNYP  117

Query  762   PSNGQSQEYGSQLLPEISGTTANEPSPHDGFP----------LIGASKSV-----VNSGQ  896
                    +Y S  L E+SG T NE S H  F            I  S ++     V+  Q
Sbjct  118   IDESLQHDYCSDFLQELSGVTVNELSTHCNFASGEKRNSNNQTIKDSNTISAHNGVSLEQ  177

Query  897   RNATKLDCS------PRFGLLASWSSQQANPLV----SGVSDIGSSN-----------GS  1013
              NA+K   +      PR   L   SSQQ   L     S VSD  S+N            S
Sbjct  178   GNASKASAAGVEPSRPRSSQLYPPSSQQCQTLFPSMRSKVSDPISNNTSNAMHHTVSGNS  237

Query  1014  INLDSILKDSVPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQN----------T  1163
             I L +        + + QD   TR     L+NFS+FSRP  L +ANLQN          +
Sbjct  238   IRLPASTSGFSSTKTQKQDPGQTRNNS-GLMNFSHFSRPAALVKANLQNIGAIAGPSSSS  296

Query  1164  LEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQP-------NLRTKFEQTDASR  1322
              +  G ++K+   +++NPA++  +++    +K+ D  S+P       +L+    +T    
Sbjct  297   KDRIGSKDKQPAASSRNPAESRHVDSSCGLQKDVDSHSEPVMVPASVDLKPVVAKT---M  353

Query  1323  EDTNDADK--VH-----------GNKAVEPgacssvc-sgssaERASNDQSHSLKRRARE  1460
             E+   A++  VH           G K++EP    S   SG+S ERASND  H+LKR+ R+
Sbjct  354   EEPLPAEQSPVHLPRRTAKGIPDGEKSIEPAVACSSVCSGNSVERASNDPKHNLKRKCRD  413

Query  1461  NEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQEL  1640
              EES CPSED +EES G +K+APA+GGTG KRSRAAEVHNLSERRRRDRINEKMRALQEL
Sbjct  414   TEESECPSEDVEEESVGVRKSAPAKGGTGSKRSRAAEVHNLSERRRRDRINEKMRALQEL  473

Query  1641  IPNCNKADKASMLD  1682
             IPNCNK DKASMLD
Sbjct  474   IPNCNKVDKASMLD  487



>ref|XP_007031278.1| Phytochrome interacting factor 3, putative isoform 1 [Theobroma 
cacao]
 gb|EOY11780.1| Phytochrome interacting factor 3, putative isoform 1 [Theobroma 
cacao]
Length=729

 Score =   256 bits (655),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 212/509 (42%), Positives = 277/509 (54%), Gaps = 92/509 (18%)
 Frame = +3

Query  423   MPLSEFLKMLKNE---SGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK-  590
             MPLSE  +M + +   S ++ P+ S+  DLS +P +DF ELV ENGQI MQGQSSKA++ 
Sbjct  1     MPLSELYRMARGKLDSSQDKNPSCST--DLSFVPENDFVELVLENGQILMQGQSSKARRI  58

Query  591   -----------SDNLSRMREKCVGNASS-SRIGKLDLAGSVLDEMPPSVPSGEMDLSQDD  734
                          +  + R+K  GN  + +++GK     SVL E+P SVPS EM L+QDD
Sbjct  59    PACNSLPSHCLPSHTPKTRDKDTGNGGTNTKMGKFGTIDSVLSEIPMSVPSAEMSLNQDD  118

Query  735   EIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGA-SKSV-------VNS  890
             E+ PWLNY        EY S  LPE+SG   NE S H  F      S+S+       +N+
Sbjct  119   EVVPWLNYPVDQSLQSEY-SDFLPELSGVAVNETSTHSNFASFDRRSQSIRDSCTVSLNN  177

Query  891   G----QRNATKL------DCSPRFGL-----LASWSSQQANPLVSG--VSDIGSSNG---  1010
             G    Q N +K+      +  PR G      L S   Q ++P +    + +IG+S G   
Sbjct  178   GAVFEQGNPSKVPTPADGEARPRSGTSQLSTLPSQLCQTSSPFLRSRILENIGNSLGHTS  237

Query  1011  ---SINLDSI---LKDSVPPQAKNQDTETTRTCPPT-LLNFSNFSRPVVLARANLQN---  1160
                +I  DSI     D   P  K Q  +    C  T L+NFS+FSRP  L +A+LQN   
Sbjct  238   THHAIGGDSIGVQASDGGLPGIKMQKQDQVAPCNNTVLMNFSHFSRPAALVKASLQNISA  297

Query  1161  --TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNLR--------------  1292
               ++E  G +EK    +  +PA T  I++    +KE   + QP +               
Sbjct  298   IASIERIGSKEKGSAASISDPADTTFIDSSIDLQKEKFSQCQPTIVLMKTDRKESKAKSL  357

Query  1293  ---TKFEQTDASREDTNDADKVH---------------GNKAVEPgacssvc-sgssaER  1415
                   E  DA  E+    +  +               G+K VEP   +S   SG+S ER
Sbjct  358   DEPVTAEPIDAICEENTPKNVKNPSQVTGESASKGLPDGDKTVEPVLAASSVCSGNSVER  417

Query  1416  ASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERR  1595
             AS+D  ++LKR++R+NEES CPSEDA+EES G KKA PARGG+G KRSRAAEVHNLSERR
Sbjct  418   ASDDPVYNLKRKSRDNEESECPSEDAEEESVGVKKAVPARGGSGSKRSRAAEVHNLSERR  477

Query  1596  RRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  478   RRDRINEKMRALQELIPNCNKVDKASMLD  506



>ref|XP_007031279.1| Phytochrome interacting factor 3, putative isoform 2 [Theobroma 
cacao]
 gb|EOY11781.1| Phytochrome interacting factor 3, putative isoform 2 [Theobroma 
cacao]
Length=731

 Score =   256 bits (655),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 212/509 (42%), Positives = 278/509 (55%), Gaps = 92/509 (18%)
 Frame = +3

Query  423   MPLSEFLKMLKNE---SGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK-  590
             MPLSE  +M + +   S ++ P+ S+  DLS +P +DF ELV ENGQI MQGQSSKA++ 
Sbjct  1     MPLSELYRMARGKLDSSQDKNPSCST--DLSFVPENDFVELVLENGQILMQGQSSKARRI  58

Query  591   -----------SDNLSRMREKCVGNA-SSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDD  734
                          +  + R+K  GN  +++++GK     SVL E+P SVPS EM L+QDD
Sbjct  59    PACNSLPSHCLPSHTPKTRDKDTGNGGTNTKMGKFGTIDSVLSEIPMSVPSAEMSLNQDD  118

Query  735   EIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGA-SKSV-------VNS  890
             E+ PWLNY        EY S  LPE+SG   NE S H  F      S+S+       +N+
Sbjct  119   EVVPWLNYPVDQSLQSEY-SDFLPELSGVAVNETSTHSNFASFDRRSQSIRDSCTVSLNN  177

Query  891   G----QRNATKL------DCSPRFGL-----LASWSSQQANPLVSG--VSDIGSSNG---  1010
             G    Q N +K+      +  PR G      L S   Q ++P +    + +IG+S G   
Sbjct  178   GAVFEQGNPSKVPTPADGEARPRSGTSQLSTLPSQLCQTSSPFLRSRILENIGNSLGHTS  237

Query  1011  ---SINLDSI---LKDSVPPQAKNQDTETTRTCPPT-LLNFSNFSRPVVLARANLQN---  1160
                +I  DSI     D   P  K Q  +    C  T L+NFS+FSRP  L +A+LQN   
Sbjct  238   THHAIGGDSIGVQASDGGLPGIKMQKQDQVAPCNNTVLMNFSHFSRPAALVKASLQNISA  297

Query  1161  --TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNLR--------------  1292
               ++E  G +EK    +  +PA T  I++    +KE   + QP +               
Sbjct  298   IASIERIGSKEKGSAASISDPADTTFIDSSIDLQKEKFSQCQPTIVLMKTDRKESKAKSL  357

Query  1293  ---TKFEQTDASREDTNDADKVH---------------GNKAVEPgacssvc-sgssaER  1415
                   E  DA  E+    +  +               G+K VEP   +S   SG+S ER
Sbjct  358   DEPVTAEPIDAICEENTPKNVKNPSQVTGESASKGLPDGDKTVEPVLAASSVCSGNSVER  417

Query  1416  ASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERR  1595
             AS+D  ++LKR++R+NEES CPSEDA+EES G KKA PARGG+G KRSRAAEVHNLSERR
Sbjct  418   ASDDPVYNLKRKSRDNEESECPSEDAEEESVGVKKAVPARGGSGSKRSRAAEVHNLSERR  477

Query  1596  RRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  478   RRDRINEKMRALQELIPNCNKVDKASMLD  506



>ref|XP_007207211.1| hypothetical protein PRUPE_ppa001899mg [Prunus persica]
 gb|EMJ08410.1| hypothetical protein PRUPE_ppa001899mg [Prunus persica]
Length=744

 Score =   256 bits (654),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 217/508 (43%), Positives = 275/508 (54%), Gaps = 99/508 (19%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
             MPLSEF +M             S+ D  P+  +DF ELVWENGQI MQGQSS+ +KS   
Sbjct  1     MPLSEFYRMAGR--------VDSSQDFEPV--NDFVELVWENGQIMMQGQSSRTRKSPTC  50

Query  603   S--------RMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNY  758
             +        + R+K VGN + ++ GK     SVLDE+P SVPS EM LS+DDE+ PWLNY
Sbjct  51    NNSLPSYTPKNRDKDVGNGNIAKTGKFGSVESVLDEIPLSVPSSEMGLSEDDEMLPWLNY  110

Query  759   SPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIG--ASKSVV------NSG-------  893
             S       EY  + LPE+S  TANE S +     +   +S S V      NS        
Sbjct  111   SIDEPLHHEYCDEFLPELSTVTANEISSNSNLASMDKRSSSSQVYRDSNTNSAHEGAYLE  170

Query  894   QRNATKL------DCS-PRFGL--LASWSSQQANPLV----SGVSDI-GSSNGSINLDSI  1031
             QRNA K+      D S PR G   L   SSQQ+  L     S VSDI G + G+    ++
Sbjct  171   QRNAPKVASIDGADVSRPRTGTSQLYPLSSQQSQSLFPSFRSRVSDIVGDNTGNATHPTV  230

Query  1032  LKDS-------VPPQAK--NQDTETTRTCPPTLLNFSNFSRPVVLARANLQN--------  1160
              K+S       V P  K   QD         +++NFS+FSRP  L ++NLQ+        
Sbjct  231   CKNSTQVSSAGVFPGIKMQRQDPVMPSNNNSSVVNFSHFSRPAALVKSNLQSIGVVAGSG  290

Query  1161  --TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQ-----------PNLRTKF  1301
               ++E  G + K     + NP ++ LI++ S   KES+ + Q           P      
Sbjct  291   LSSMEKIGNKGKVSAATSNNPPESTLIDSSSGLSKESNSQCQHITVTSNVELKPTEAKPL  350

Query  1302  E------------QTDASREDTN-------DADKV--HGNKAVEPgacssvcsgssaERA  1418
             E            Q DAS+ DTN        A++V   G K +EP   SSVCSG+S ER 
Sbjct  351   EESCAAKQSEAACQEDASKNDTNTNHIPCESANRVLRDGEKTLEPVVASSVCSGNSVERG  410

Query  1419  SNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRR  1598
             S+D +H+LKR++R+ +ES C S+D +EES G KK A ARG    KRSRAAEVHNLSERRR
Sbjct  411   SDDPTHALKRKSRDTDESECHSDDVEEESVGVKKIAHARGMGS-KRSRAAEVHNLSERRR  469

Query  1599  RDRINEKMRALQELIPNCNKADKASMLD  1682
             RDRINEKMRALQELIPNCNK DKASMLD
Sbjct  470   RDRINEKMRALQELIPNCNKVDKASMLD  497



>ref|XP_008246329.1| PREDICTED: transcription factor PIF3 [Prunus mume]
Length=729

 Score =   254 bits (648),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 217/508 (43%), Positives = 274/508 (54%), Gaps = 99/508 (19%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
             MPLSE  +M             S+ D  P+  +DF ELVWENGQI MQGQSS+ +KS   
Sbjct  1     MPLSELYRMAGR--------VDSSQDFEPV--NDFVELVWENGQIMMQGQSSRTRKSPTC  50

Query  603   S--------RMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNY  758
             +        + R+K VGN + ++ GK     SVLDE+P SVPS EM LS+DDEI PWLNY
Sbjct  51    NNSLPSYTPKNRDKDVGNGNIAKTGKFGSVESVLDEIPLSVPSSEMGLSEDDEILPWLNY  110

Query  759   SPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIG--ASKSVV------NSG-------  893
             S       EY  + LPE+S  TANE S +     +   +S S V      NS        
Sbjct  111   SIDEPLHHEYCHEFLPELSTVTANEISSNSNLASVDKRSSSSQVYRDSNTNSAHEGAYLE  170

Query  894   QRNATKL------DCS-PRFGL--LASWSSQQANPLV----SGVSDI-GSSNGSINLDSI  1031
             QRNA K+      D S P+ G   L   SSQQ+  L     S VSDI G + GS    ++
Sbjct  171   QRNAPKVTSVDGDDVSRPKTGTSQLYPLSSQQSQSLFPSFRSRVSDIVGDNTGSATHPTV  230

Query  1032  LKDS-------VPPQAK--NQDTETTRTCPPTLLNFSNFSRPVVLARANLQN--------  1160
              K+S       V P  K   QD         +++NFS+FSRP  L ++NLQ+        
Sbjct  231   CKNSTEVSSAGVFPGIKMQRQDPVMPSNNNSSVVNFSHFSRPAALVKSNLQSIGVVAGSG  290

Query  1161  --TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQ-----------PNLRTKF  1301
               ++E  G + K     +  P ++ LI++ S   KES+ + Q           P      
Sbjct  291   LSSMERIGNKGKVSAATSNKPPESTLIDSSSGLPKESNSQCQHITVTSNVELKPTEAKPL  350

Query  1302  E------------QTDASREDTN-------DADKV--HGNKAVEPgacssvcsgssaERA  1418
             E            Q DAS+ DTN        A++V   G K +EP   SSVCSG+S ERA
Sbjct  351   EESCAAKQSEAACQEDASKNDTNTNHIPCESANRVLRDGEKTLEPVVASSVCSGNSVERA  410

Query  1419  SNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRR  1598
             S+D +H+LKR++R+ +ES C S+D +EES G KK A ARG    KRSRAAEVHNLSERRR
Sbjct  411   SDDPTHALKRKSRDTDESECHSDDVEEESVGVKKIAHARGMGS-KRSRAAEVHNLSERRR  469

Query  1599  RDRINEKMRALQELIPNCNKADKASMLD  1682
             RDRINEKMRALQELIPNCNK DKASMLD
Sbjct  470   RDRINEKMRALQELIPNCNKVDKASMLD  497



>ref|XP_007031281.1| Phytochrome interacting factor 3, putative isoform 4 [Theobroma 
cacao]
 gb|EOY11783.1| Phytochrome interacting factor 3, putative isoform 4 [Theobroma 
cacao]
Length=730

 Score =   252 bits (644),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 212/510 (42%), Positives = 277/510 (54%), Gaps = 93/510 (18%)
 Frame = +3

Query  423   MPLSEFLKMLKNE---SGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK-  590
             MPLSE  +M + +   S ++ P+ S+  DLS +P +DF ELV ENGQI MQGQSSKA++ 
Sbjct  1     MPLSELYRMARGKLDSSQDKNPSCST--DLSFVPENDFVELVLENGQILMQGQSSKARRI  58

Query  591   -----------SDNLSRMREKCVGNASS-SRIGKLDLAGSVLDEMPPSVPSGEMDLSQDD  734
                          +  + R+K  GN  + +++GK     SVL E+P SVPS EM L+QDD
Sbjct  59    PACNSLPSHCLPSHTPKTRDKDTGNGGTNTKMGKFGTIDSVLSEIPMSVPSAEMSLNQDD  118

Query  735   EIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGA-SKSV-------VNS  890
             E+ PWLNY        EY S  LPE+SG   NE S H  F      S+S+       +N+
Sbjct  119   EVVPWLNYPVDQSLQSEY-SDFLPELSGVAVNETSTHSNFASFDRRSQSIRDSCTVSLNN  177

Query  891   G----QRNATKL------DCSPRFGL-----LASWSSQQANPLVSG--VSDIGSSNG---  1010
             G    Q N +K+      +  PR G      L S   Q ++P +    + +IG+S G   
Sbjct  178   GAVFEQGNPSKVPTPADGEARPRSGTSQLSTLPSQLCQTSSPFLRSRILENIGNSLGHTS  237

Query  1011  ---SINLDSI---LKDSVPPQAKNQDTETTRTCPPT-LLNFSNFSRPVVLARANLQN---  1160
                +I  DSI     D   P  K Q  +    C  T L+NFS+FSRP  L +A+LQN   
Sbjct  238   THHAIGGDSIGVQASDGGLPGIKMQKQDQVAPCNNTVLMNFSHFSRPAALVKASLQNISA  297

Query  1161  --TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNLR--------------  1292
               ++E  G +EK    +  +PA T  I++    +KE   + QP +               
Sbjct  298   IASIERIGSKEKGSAASISDPADTTFIDSSIDLQKEKFSQCQPTIVLMKTDRKESKAKSL  357

Query  1293  ---TKFEQTDASREDTNDADKVH---------------GNKAVEPgacssvc-sgssaER  1415
                   E  DA  E+    +  +               G+K VEP   +S   SG+S ER
Sbjct  358   DEPVTAEPIDAICEENTPKNVKNPSQVTGESASKGLPDGDKTVEPVLAASSVCSGNSVER  417

Query  1416  ASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERR  1595
             AS+D  ++LKR++R+NEES CPSEDA+EES G KKA PARGG+G KRSRAAEVHNLSERR
Sbjct  418   ASDDPVYNLKRKSRDNEESECPSEDAEEESVGVKKAVPARGGSGSKRSRAAEVHNLSERR  477

Query  1596  RRDRINEKMRALQELIPNCN-KADKASMLD  1682
             RRDRINEKMRALQELIPNCN K DKASMLD
Sbjct  478   RRDRINEKMRALQELIPNCNKKVDKASMLD  507



>ref|XP_010659764.1| PREDICTED: transcription factor PIF3-like isoform X1 [Vitis vinifera]
Length=709

 Score =   251 bits (640),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 205/506 (41%), Positives = 274/506 (54%), Gaps = 90/506 (18%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS---  593
             MP SE  +M K   G+ +      +DLS  P +DF ELVWE GQI MQGQSS+A+KS   
Sbjct  1     MPFSELYRMAK---GKPESVQQKTNDLSFGPENDFVELVWEGGQIMMQGQSSRARKSPLS  57

Query  594   ----DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYS  761
                  +  + R+K  G+ ++S++GK      +L++ P SVPS EM LSQDD++ PWLNY 
Sbjct  58    NSFPSHTPKPRDKDTGHGTNSKMGKFGSMDFILNDFPLSVPSAEMGLSQDDDMVPWLNYP  117

Query  762   PSNGQSQEYGSQLLPEISGTTANEPSPHDGFP----------LIGASKSV-----VNSGQ  896
                    +Y S  L E+SG T NE S H  F            I  S ++     V+  Q
Sbjct  118   IDESLQHDYCSDFLQELSGVTVNELSTHCNFASGEKRNSNNQTIKDSNTISAHNGVSLEQ  177

Query  897   RNATKLDCS------PRFGLLASWSSQQANPLV----SGVSDIGSSN-----------GS  1013
              NA+K   +      PR   L   SSQQ   L     S VSD  S+N            S
Sbjct  178   GNASKASAAGVEPSRPRSSQLYPPSSQQCQTLFPSMRSKVSDPISNNTSNAMHHTVSGNS  237

Query  1014  INLDSILKDSVPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQN----------T  1163
             I L +        + + QD   TR     L+NFS+FSRP  L +ANLQN          +
Sbjct  238   IRLPASTSGFSSTKTQKQDPGQTRNN-SGLMNFSHFSRPAALVKANLQNIGAIAGPSSSS  296

Query  1164  LEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQP-------NLRTKFEQT----  1310
              +  G ++K+   +++NPA++  +++    +K+ D  S+P       +L+    +T    
Sbjct  297   KDRIGSKDKQPAASSRNPAESRHVDSSCGLQKDVDSHSEPVMVPASVDLKPVVAKTMEEP  356

Query  1311  -----------DASREDTNDADKV----------HGNKAVEPgac-ssvcsgssaERASN  1424
                        + + ++   +++V           G K +EP    SSVCSG+S ERASN
Sbjct  357   LPAEQSPVICQEGACKNEKSSNQVLGARTAKGIPDGEKTIEPAVACSSVCSGNSVERASN  416

Query  1425  DQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRD  1604
             D  H+LKR+ R+ EES CPSED +EES G +K+APA+GGTG KRSRAAEVHNLSERRRRD
Sbjct  417   DPKHNLKRKCRDTEESECPSEDVEEESVGVRKSAPAKGGTGSKRSRAAEVHNLSERRRRD  476

Query  1605  RINEKMRALQELIPNCNKADKASMLD  1682
             RINEKMRALQELIPNCNK DKASMLD
Sbjct  477   RINEKMRALQELIPNCNKVDKASMLD  502



>ref|XP_010659765.1| PREDICTED: transcription factor PIF3-like isoform X2 [Vitis vinifera]
Length=707

 Score =   251 bits (640),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 205/506 (41%), Positives = 274/506 (54%), Gaps = 90/506 (18%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS---  593
             MP SE  +M K   G+ +      +DLS  P +DF ELVWE GQI MQGQSS+A+KS   
Sbjct  1     MPFSELYRMAK---GKPESVQQKTNDLSFGPENDFVELVWEGGQIMMQGQSSRARKSPLS  57

Query  594   ----DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYS  761
                  +  + R+K  G+ ++S++GK      +L++ P SVPS EM LSQDD++ PWLNY 
Sbjct  58    NSFPSHTPKPRDKDTGHGTNSKMGKFGSMDFILNDFPLSVPSAEMGLSQDDDMVPWLNYP  117

Query  762   PSNGQSQEYGSQLLPEISGTTANEPSPHDGFP----------LIGASKSV-----VNSGQ  896
                    +Y S  L E+SG T NE S H  F            I  S ++     V+  Q
Sbjct  118   IDESLQHDYCSDFLQELSGVTVNELSTHCNFASGEKRNSNNQTIKDSNTISAHNGVSLEQ  177

Query  897   RNATKLDCS------PRFGLLASWSSQQANPLV----SGVSDIGSSN-----------GS  1013
              NA+K   +      PR   L   SSQQ   L     S VSD  S+N            S
Sbjct  178   GNASKASAAGVEPSRPRSSQLYPPSSQQCQTLFPSMRSKVSDPISNNTSNAMHHTVSGNS  237

Query  1014  INLDSILKDSVPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQN----------T  1163
             I L +        + + QD   TR     L+NFS+FSRP  L +ANLQN          +
Sbjct  238   IRLPASTSGFSSTKTQKQDPGQTRNN-SGLMNFSHFSRPAALVKANLQNIGAIAGPSSSS  296

Query  1164  LEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQP-------NLRTKFEQT----  1310
              +  G ++K+   +++NPA++  +++    +K+ D  S+P       +L+    +T    
Sbjct  297   KDRIGSKDKQPAASSRNPAESRHVDSSCGLQKDVDSHSEPVMVPASVDLKPVVAKTMEEP  356

Query  1311  -----------DASREDTNDADKV----------HGNKAVEPgac-ssvcsgssaERASN  1424
                        + + ++   +++V           G K +EP    SSVCSG+S ERASN
Sbjct  357   LPAEQSPVICQEGACKNEKSSNQVLGARTAKGIPDGEKTIEPAVACSSVCSGNSVERASN  416

Query  1425  DQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRD  1604
             D  H+LKR+ R+ EES CPSED +EES G +K+APA+GGTG KRSRAAEVHNLSERRRRD
Sbjct  417   DPKHNLKRKCRDTEESECPSEDVEEESVGVRKSAPAKGGTGSKRSRAAEVHNLSERRRRD  476

Query  1605  RINEKMRALQELIPNCNKADKASMLD  1682
             RINEKMRALQELIPNCNK DKASMLD
Sbjct  477   RINEKMRALQELIPNCNKVDKASMLD  502



>ref|XP_007031280.1| Phytochrome interacting factor 3, putative isoform 3 [Theobroma 
cacao]
 gb|EOY11782.1| Phytochrome interacting factor 3, putative isoform 3 [Theobroma 
cacao]
Length=709

 Score =   245 bits (626),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 207/507 (41%), Positives = 272/507 (54%), Gaps = 92/507 (18%)
 Frame = +3

Query  423   MPLSEFLKMLKNE---SGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK-  590
             MPLSE  +M + +   S ++ P+ S+  DLS +P +DF ELV ENGQI MQGQSSKA++ 
Sbjct  1     MPLSELYRMARGKLDSSQDKNPSCST--DLSFVPENDFVELVLENGQILMQGQSSKARRI  58

Query  591   -----------SDNLSRMREKCVGNASS-SRIGKLDLAGSVLDEMPPSVPSGEMDLSQDD  734
                          +  + R+K  GN  + +++GK     SVL E+P SVPS EM L+QDD
Sbjct  59    PACNSLPSHCLPSHTPKTRDKDTGNGGTNTKMGKFGTIDSVLSEIPMSVPSAEMSLNQDD  118

Query  735   EIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGA-SKSV-------VNS  890
             E+ PWLNY        EY S  LPE+SG   NE S H  F      S+S+       +N+
Sbjct  119   EVVPWLNYPVDQSLQSEY-SDFLPELSGVAVNETSTHSNFASFDRRSQSIRDSCTVSLNN  177

Query  891   G----QRNATKL------DCSPRFGL-----LASWSSQQANPLVSG--VSDIGSSNG---  1010
             G    Q N +K+      +  PR G      L S   Q ++P +    + +IG+S G   
Sbjct  178   GAVFEQGNPSKVPTPADGEARPRSGTSQLSTLPSQLCQTSSPFLRSRILENIGNSLGHTS  237

Query  1011  ---SINLDSI---LKDSVPPQAKNQDTETTRTCPPT-LLNFSNFSRPVVLARANLQN---  1160
                +I  DSI     D   P  K Q  +    C  T L+NFS+FSRP  L +A+LQN   
Sbjct  238   THHAIGGDSIGVQASDGGLPGIKMQKQDQVAPCNNTVLMNFSHFSRPAALVKASLQNISA  297

Query  1161  --TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNLR--------------  1292
               ++E  G +EK    +  +PA T  I++    +KE   + QP +               
Sbjct  298   IASIERIGSKEKGSAASISDPADTTFIDSSIDLQKEKFSQCQPTIVLMKTDRKESKAKSL  357

Query  1293  ---TKFEQTDASREDTNDADKVH---------------GNKAVEPgacssvc-sgssaER  1415
                   E  DA  E+    +  +               G+K VEP   +S   SG+S ER
Sbjct  358   DEPVTAEPIDAICEENTPKNVKNPSQVTGESASKGLPDGDKTVEPVLAASSVCSGNSVER  417

Query  1416  ASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERR  1595
             AS+D  ++LKR++R+NEES CPSEDA+EES G KKA PARGG+G KRSRAAEVHNLSERR
Sbjct  418   ASDDPVYNLKRKSRDNEESECPSEDAEEESVGVKKAVPARGGSGSKRSRAAEVHNLSERR  477

Query  1596  RRDRINEKMRALQELIPNCNKADKASM  1676
             RRDRINEKMRALQELIPNCNK    SM
Sbjct  478   RRDRINEKMRALQELIPNCNKVQIMSM  504



>ref|XP_009366015.1| PREDICTED: transcription factor PIF3-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009366016.1| PREDICTED: transcription factor PIF3-like isoform X1 [Pyrus x 
bretschneideri]
Length=713

 Score =   233 bits (595),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 203/508 (40%), Positives = 259/508 (51%), Gaps = 101/508 (20%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK----  590
             MPLSE  ++             S+ DL     +DF ELVWENGQ+ MQGQSS+ +K    
Sbjct  1     MPLSELYRIAGR--------VDSSQDLE----NDFLELVWENGQVVMQGQSSRTRKNPSC  48

Query  591   ----SDNLSRMREKCVGNASSSRIGKL-DLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                 S N  + R++ VGN++  + GK   +  S LDE+P SVPS EM LS+DD++ PWLN
Sbjct  49    NSLPSYNTPKNRDRDVGNSNIGKTGKFGSVVDSGLDEIPLSVPSSEMGLSEDDDMLPWLN  108

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLI---GASKSVV-----NSG------  893
             YS       EY    LPE S  TANE S +     I    +S  V+     NS       
Sbjct  109   YSIDEPLHHEYCHDFLPEFSSATANEASSNHNLASIDKRSSSSQVLRDSNPNSAHEDASL  168

Query  894   -QRNATKL------DCS-PRFGLLASWSSQQANPLV------SGVSDIGSSNGSINLDSI  1031
              QRN  K+      D S PR G     S              S VSD    N S     +
Sbjct  169   QQRNVGKVALIGRADVSRPRTGTSQLHSLSSQQSQASYPSSRSRVSDTAGDNISATHRGV  228

Query  1032  LKDS--------VPP-QAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQN--------  1160
              K+S         P  + + QD    R   P+++NF++FSRP  LA+AN+QN        
Sbjct  229   GKNSNQISSTGGFPGMKMQRQDPVIPRNTNPSIMNFTHFSRPAALAKANVQNNGAMAGSG  288

Query  1161  --TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNL-RTKFE---------  1304
               ++E  G ++K       N  ++ LI++ S + KES+ + QP L R+  E         
Sbjct  289   SSSMEKIGDKDKFSAATRNNLPESMLIDSSSGAPKESNSQCQPILVRSSDELKPTETKTL  348

Query  1305  -------------QTDASREDTNDADKV---------HGNKAVEPgacssvcsgssaERA  1418
                          Q + S+ D N  DK           G K +EP   SSVCSG+S ER 
Sbjct  349   EEPCTAKRSEGACQEETSKNDINANDKPCESASRVSPGGEKTLEPVVASSVCSGNSVERG  408

Query  1419  SNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRR  1598
             S+D  H+LKR+ RE +ES C S+D ++ES G KK   ARG    KRSRAAEVHNLSERRR
Sbjct  409   SDDPPHALKRKCRETDESECHSDDVEDESVGVKKGVHARGTGS-KRSRAAEVHNLSERRR  467

Query  1599  RDRINEKMRALQELIPNCNKADKASMLD  1682
             RDRINEKMRALQELIPNCNK DKASMLD
Sbjct  468   RDRINEKMRALQELIPNCNKVDKASMLD  495



>ref|XP_011087566.1| PREDICTED: transcription factor PIF3 isoform X1 [Sesamum indicum]
 ref|XP_011087567.1| PREDICTED: transcription factor PIF3 isoform X1 [Sesamum indicum]
Length=743

 Score =   232 bits (591),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 201/489 (41%), Positives = 266/489 (54%), Gaps = 75/489 (15%)
 Frame = +3

Query  423   MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS-  593
             MPLSEFL++ +   ESG +KP  S   D S     D  ELVWENGQI MQGQSS+  +S 
Sbjct  1     MPLSEFLRLARGKLESGRQKPCPS---DPSSRAEGDVVELVWENGQIMMQGQSSRVTQSP  57

Query  594   ------DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                    N  R+R+  V N++S+RI K     S+LD+M P VPSG++DLSQDDE+ PWL+
Sbjct  58    VRNSFSSNTHRVRDAGVVNSTSARIEKFGGVESILDDMLPVVPSGDLDLSQDDEMVPWLS  117

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLI----GASKSVVNSGQRNATKLDCS  923
             Y   +   Q+Y S LLP ISG T N  S  + F  +      +++V NS     T    S
Sbjct  118   YPMVDALPQDYSSDLLPGISGVTTNGLSTQNSFVSVEKRSSCNQTVSNSHNGGNTLKASS  177

Query  924   PRFGLLASW---SSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTR---  1085
             P+     SW    SQ +  L SGVSDI S++ S + D I ++  P Q ++    +T    
Sbjct  178   PKTRPFFSWPPQPSQTSVALGSGVSDIISNSMSNHPDDIYRN--PAQGRDVVNNSTSMKM  235

Query  1086  --------TCPPTLLNFSNFSRPVVLARANLQNT----------LEAKGKREKEIKENAQ  1211
                     T    LLNFSNF+RP  L +AN  N+          +E  G +EK     + 
Sbjct  236   QRQNIGPATNNSNLLNFSNFTRPAGLVKANPPNSGGIPASVSSGVERMGVKEKGSAIGSS  295

Query  1212  NPAKTALIEACSTSRKESDLKS-----------QPNLRTKFEQTDASREDT--------N  1334
             NP K++ +E  ++++K+ D              +P ++   E     R +         N
Sbjct  296   NPLKSSSLERFNSTQKDIDFHGSSAMLAIVNSRKPAVKAPKESYTPDRTENLCRETSIKN  355

Query  1335  DADKV------------HGNKAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESG  1475
             D  ++             G + VEP   SS   SG SA+R S +++H+ KR+  + EES 
Sbjct  356   DKPQIVSDSANSTKAVPDGERTVEPMVASSSVGSGYSADRVSCEKAHNSKRKFGDVEESE  415

Query  1476  CPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN  1655
             C S+D + ES G KK+ PARG    KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN
Sbjct  416   CRSDDIETESVGVKKSTPARGTGS-KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN  474

Query  1656  KADKASMLD  1682
             KADKASMLD
Sbjct  475   KADKASMLD  483



>ref|XP_011087568.1| PREDICTED: transcription factor PIF3 isoform X2 [Sesamum indicum]
Length=710

 Score =   231 bits (589),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 201/489 (41%), Positives = 266/489 (54%), Gaps = 75/489 (15%)
 Frame = +3

Query  423   MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS-  593
             MPLSEFL++ +   ESG +KP  S   D S     D  ELVWENGQI MQGQSS+  +S 
Sbjct  1     MPLSEFLRLARGKLESGRQKPCPS---DPSSRAEGDVVELVWENGQIMMQGQSSRVTQSP  57

Query  594   ------DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                    N  R+R+  V N++S+RI K     S+LD+M P VPSG++DLSQDDE+ PWL+
Sbjct  58    VRNSFSSNTHRVRDAGVVNSTSARIEKFGGVESILDDMLPVVPSGDLDLSQDDEMVPWLS  117

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLI----GASKSVVNSGQRNATKLDCS  923
             Y   +   Q+Y S LLP ISG T N  S  + F  +      +++V NS     T    S
Sbjct  118   YPMVDALPQDYSSDLLPGISGVTTNGLSTQNSFVSVEKRSSCNQTVSNSHNGGNTLKASS  177

Query  924   PRFGLLASW---SSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTR---  1085
             P+     SW    SQ +  L SGVSDI S++ S + D I ++  P Q ++    +T    
Sbjct  178   PKTRPFFSWPPQPSQTSVALGSGVSDIISNSMSNHPDDIYRN--PAQGRDVVNNSTSMKM  235

Query  1086  --------TCPPTLLNFSNFSRPVVLARANLQNT----------LEAKGKREKEIKENAQ  1211
                     T    LLNFSNF+RP  L +AN  N+          +E  G +EK     + 
Sbjct  236   QRQNIGPATNNSNLLNFSNFTRPAGLVKANPPNSGGIPASVSSGVERMGVKEKGSAIGSS  295

Query  1212  NPAKTALIEACSTSRKESDLKS-----------QPNLRTKFEQTDASREDT--------N  1334
             NP K++ +E  ++++K+ D              +P ++   E     R +         N
Sbjct  296   NPLKSSSLERFNSTQKDIDFHGSSAMLAIVNSRKPAVKAPKESYTPDRTENLCRETSIKN  355

Query  1335  DADKV------------HGNKAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESG  1475
             D  ++             G + VEP   SS   SG SA+R S +++H+ KR+  + EES 
Sbjct  356   DKPQIVSDSANSTKAVPDGERTVEPMVASSSVGSGYSADRVSCEKAHNSKRKFGDVEESE  415

Query  1476  CPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN  1655
             C S+D + ES G KK+ PARG    KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN
Sbjct  416   CRSDDIETESVGVKKSTPARGTGS-KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN  474

Query  1656  KADKASMLD  1682
             KADKASMLD
Sbjct  475   KADKASMLD  483



>ref|XP_004302325.1| PREDICTED: transcription factor PIF3-like [Fragaria vesca subsp. 
vesca]
Length=710

 Score =   230 bits (586),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 195/498 (39%), Positives = 258/498 (52%), Gaps = 98/498 (20%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
             MPLSE L   +++S +         D  PL  SD  ELVWENGQI MQ QS++A+KS   
Sbjct  1     MPLSELLSRGRSDSNQ---------DFEPL--SDLVELVWENGQIMMQSQSNRARKSPTF  49

Query  603   S-------RMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYS  761
             +       R R++ +GN S+ ++GK     SV+DE+P SVPSGEM LS DD++ PWLNY+
Sbjct  50    NSLPSHTPRNRDRDLGNGSNGKMGKFGSVNSVIDEIPLSVPSGEMGLSDDDDMLPWLNYA  109

Query  762   PSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIG--------ASKSVVNSG----QRNA  905
                    EY    +PEIS  TANE S +     I           +S  NS     QRN 
Sbjct  110   LDQPLQHEYSHDFMPEISDVTANEISTNGNLTPIDKRSSSSQMYRESNTNSTPGLEQRNV  169

Query  906   TKLDCS-------PRFGL--LASWSSQQANP----LVSGVSD-IGSSNGSINLDSILKDS  1043
             +KL          PR     L   SSQQ       L S  SD +G +  S    ++ K+S
Sbjct  170   SKLSSVSAAEASRPRTSTTHLYQMSSQQPQASIPSLRSIASDMVGGNTSSAAHHAVCKNS  229

Query  1044  V-----------PPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQNTLEAKGKREK  1190
             +           P Q +N  T +      T++NFS+FSR  +L    ++N       ++K
Sbjct  230   IQASPAGGFPGIPMQKQNPPTSSNNNS--TIVNFSHFSRSSLLRVEKIKN-------KDK  280

Query  1191  EIKENAQNPAKTALIEACSTSRKES-------------DLK-------SQPNLRTKFE--  1304
                  + NP ++ LIE+     KES             D+K        +P+   + E  
Sbjct  281   VSAATSSNPPESILIESSCGLMKESTSQCQDVMAPSSVDMKPTASKPLEEPHTTKQSEAA  340

Query  1305  --QTDASREDTNDADKVHGNKAV----------EPgacssvcsgssaERASNDQSHSLKR  1448
               Q D S+ D  +++ +    A+          EP   SSVCS +S E+AS+D +  LKR
Sbjct  341   AYQEDPSKNDDRNSNHIPCESAIRPLPDVEKTTEPVVDSSVCSVNSVEKASDDPTRVLKR  400

Query  1449  RARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRA  1628
             ++R+ ++S C SED +EES G KK      GTG KRSRAAEVHNLSERRRRDRINEKMRA
Sbjct  401   KSRDTDDSECHSEDVEEESVGVKKKVAHGRGTGSKRSRAAEVHNLSERRRRDRINEKMRA  460

Query  1629  LQELIPNCNKADKASMLD  1682
             LQELIPNCNK DKASMLD
Sbjct  461   LQELIPNCNKVDKASMLD  478



>ref|XP_008370333.1| PREDICTED: transcription factor PIF3 isoform X1 [Malus domestica]
Length=715

 Score =   228 bits (581),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 201/508 (40%), Positives = 255/508 (50%), Gaps = 101/508 (20%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK----  590
             MP SE  +M             S+ D      +DF ELVWENGQ+ MQGQSS+ +K    
Sbjct  1     MPFSELYRMAGR--------VDSSQDFE----NDFLELVWENGQVVMQGQSSRTRKNPSC  48

Query  591   ----SDNLSRMREKCVGNASSSRIGKLDLA-GSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                 S N  + R++ VGN++  + GK      S LDE+P SVPS EM LS+DD+  PWLN
Sbjct  49    NTLPSYNTPKNRDRDVGNSNIGKTGKFGFVVDSELDEIPLSVPSSEMGLSEDDDXLPWLN  108

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLI----GASKSVVNSG----------  893
             YS       EY    LPE S  TANE S +     I     +S+ + +S           
Sbjct  109   YSIDEPLHHEYCHDFLPEFSSATANEASSNHNLASIDKRSSSSQVLRBSNPNSAHEDACL  168

Query  894   -QRNATKL------DCS-PRFGLLASWSSQQANP------LVSGVSDIGSSNGSINLDSI  1031
              QRN  K+      D S PR G    +S              S VSD    N S     +
Sbjct  169   QQRNVGKVAJXGRADVSRPRTGTSQLYSLSSQQSQAXYPSFRSRVSDTAGDNTSATHRDV  228

Query  1032  LKDS--------VPP-QAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQN--TLEAKG  1178
              K+S         P  + + QD    R   P+++NF++FSRP  LA+AN+QN   +   G
Sbjct  229   GKNSNQISSTGGFPGMKMQRQDPVMPRNTNPSIMNFTHFSRPAALAKANVQNNGAMAGSG  288

Query  1179  KREKEIKENA--------QNPAKTALIEACSTSRKESDLKSQPNL-RTKFE---------  1304
                 E  EN          N  ++ LI++ S + KES+ + QP L R+  E         
Sbjct  289   SSSMERIENKDKFSAATRNNLPESXLIDSSSGAPKESNSQCQPILVRSSDELKATKAKPL  348

Query  1305  -------------QTDASREDTNDADKV---------HGNKAVEPgacssvcsgssaERA  1418
                          Q + S+ D N  DK             K +EP   SSVCSG+S ER 
Sbjct  349   EEPCTAKRSEXACQEETSKNDINANDKPCESASRVSPGXEKTLEPVVASSVCSGNSVERG  408

Query  1419  SNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRR  1598
             S+D +H+LKR+ RE +ES C S+D ++ES G KK A ARG    KRSRAAEVHNLSERRR
Sbjct  409   SDDPTHALKRKCRETDESECHSDDVEDESVGVKKGAHARGKGS-KRSRAAEVHNLSERRR  467

Query  1599  RDRINEKMRALQELIPNCNKADKASMLD  1682
             RDRINEKMRALQELIPNCNK DKASMLD
Sbjct  468   RDRINEKMRALQELIPNCNKVDKASMLD  495



>ref|XP_006382253.1| Phytochrome-interacting factor 3 family protein [Populus trichocarpa]
 gb|ERP60050.1| Phytochrome-interacting factor 3 family protein [Populus trichocarpa]
Length=742

 Score =   223 bits (568),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 197/519 (38%), Positives = 265/519 (51%), Gaps = 112/519 (22%)
 Frame = +3

Query  423   MPLSEFL-KMLKNE---SGERKPTSSSADDLSPL-PGSDFSELVWENGQITMQGQSSKAK  587
             MPLSE L +M K +   S E+ P+ S+  DLS + P +DF EL+WENGQI    QSS+A+
Sbjct  1     MPLSELLYRMAKGKIDFSQEKDPSCST--DLSFVRPENDFGELIWENGQI----QSSRAR  54

Query  588   KSDNLS-------RMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAP  746
             K    S       ++R K +GN +  R GK  +  S L+E+P SVP+ EM ++QDD++ P
Sbjct  55    KIQPCSTLPCQNPKIRYKDIGNGTDIRTGKFGMMESTLNELPMSVPAVEMGVNQDDDMVP  114

Query  747   WLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGA---SKSV-------VNSG-  893
             WLNY        +Y S+ LPE+SG T N  S    FP  G    S+SV       V++G 
Sbjct  115   WLNYPLDESPQHDYCSEFLPELSGVTVNGHSSQSNFPSFGKKSFSQSVRDSRTVSVHNGL  174

Query  894   -------QRNATKLDCS---PR-----FGLLASWSSQQANPLV-------SGVSDIGSSN  1007
                     +N++  D     PR       L +S   Q + P         +G S   +++
Sbjct  175   SLEQGDVAKNSSAGDTEANRPRTSASQLYLSSSEHCQTSFPYFRSRVSAKNGDSTSNAAH  234

Query  1008  GSINLDSILKDS----VPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQNT----  1163
               +++DSI   +     P     +      T   +L+NFS+F+RP  LA+ANLQN     
Sbjct  235   HVVSVDSIRAPTSGGGFPSIKMQKQVPAQSTTNSSLMNFSHFARPAALAKANLQNIGMRA  294

Query  1164  ------LEAKGKREKEIKENAQNPAKTALIEACSTSRKES--------------------  1265
                   +E    ++K    ++ NPA+   I +CS   KE+                    
Sbjct  295   GTGISNMERTQNKDKGSIASSSNPAECTPINSCSGLLKETSSHCLPVLMPPKVDAKPSEA  354

Query  1266  -------------------DLKSQPNLRTKFEQTDASREDTNDADKVHGNKAVEPgacss  1388
                                D KS  N R  F   +++ +   D +K       EP   SS
Sbjct  355   KPAEGFVPAELPEATIPEGDSKSDRNCRQNF--CESAIKGVADVEKTK-----EPVVASS  407

Query  1389  vcsg-ssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRA  1565
                  +S ERAS+D + +LKR+ R+ EES  PSED +EES GAKK APAR G G KR+RA
Sbjct  408   SVGSDNSVERASDDPTENLKRKHRDTEESEGPSEDVEEESVGAKKQAPARAGNGSKRNRA  467

Query  1566  AEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             AEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  468   AEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  506



>ref|XP_006423961.1| hypothetical protein CICLE_v10027890mg [Citrus clementina]
 ref|XP_006423962.1| hypothetical protein CICLE_v10027890mg [Citrus clementina]
 ref|XP_006480339.1| PREDICTED: transcription factor PIF3-like [Citrus sinensis]
 gb|ESR37201.1| hypothetical protein CICLE_v10027890mg [Citrus clementina]
 gb|ESR37202.1| hypothetical protein CICLE_v10027890mg [Citrus clementina]
Length=735

 Score =   222 bits (565),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 200/509 (39%), Positives = 262/509 (51%), Gaps = 93/509 (18%)
 Frame = +3

Query  423   MPLSEFLKMLK---NESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS  593
             MPL E  +M K   + + ++ P+SS+  DLS  P +D  ELVWENGQI  QGQSS+ KKS
Sbjct  1     MPLFELYQMTKEKLDSAKQKNPSSST--DLSFEPENDLVELVWENGQILKQGQSSRTKKS  58

Query  594   DNLSRMREKCVGNASS-------SRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWL  752
                + +   C+ + +         + GK     ++L+ +  S PSGEM L+QDD++ PWL
Sbjct  59    PTSNSLPSYCLRSHTPKNRDKDLGKTGKFGTVDAMLNGIQMSDPSGEMGLNQDDDMVPWL  118

Query  753   NYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKS-----------VVNSGQR  899
             NY+      Q+Y S  L E+SG T NE S  + F       S             N G R
Sbjct  119   NYAVDESLQQDYCSDFLHELSGVTGNELSSQNNFASFDKRSSSNQFDREFNSVFGNHGAR  178

Query  900   ----NATKLD-------CSPRFGLLASW--SSQQANP----LVSGVSDIGSSNGSINL--  1022
                 N +K+          PR    + +  SSQQ       L SGVSD  +SNG  N   
Sbjct  179   LEHGNVSKVSSVGGGEATRPRSSTNSVYTSSSQQCQTSLPNLRSGVSD-STSNGIKNSTD  237

Query  1023  DSILKDSVPPQAKN--------QDTETTRTCPPTLLNFSNFSRPVVLARANLQNTLEAKG  1178
             + I + S P    N        QD   +      ++NFS+F+RPV L RANLQN     G
Sbjct  238   NGIFQGSNPTATGNLSGLKLHKQDQRLSAN-NSGVMNFSHFARPVALVRANLQNIGSMPG  296

Query  1179  KREKEIKE---------NAQNPAKTALIEACSTSRKES-----------DLKSQPNLRTK  1298
              R   I+           +++P ++ LI++    RKES           D+K Q    ++
Sbjct  297   ARLSRIERMGSKDKSSVASRSPVESPLIDSSGCLRKESSCQPAAVTSKVDVKPQEAKSSE  356

Query  1299  FEQTD----ASREDTNDADK--------------VHGNKAVEPgacssvc-sgssaERAS  1421
                ++    A RED  + DK              V   K VEP   +S   SG+S ERAS
Sbjct  357   QPVSEPPEAACREDALNNDKKPSQVHAESATKGVVESEKTVEPVVAASSVCSGNSVERAS  416

Query  1422  NDQSHSLKRRARENEESGCPSE--DADEESagakkaaparggtgQKRSRAAEVHNLSERR  1595
             +D  H++KR+  + ++S CPSE  D +EES G KK  P R GTG KRSRAAEVHNLSERR
Sbjct  417   DDLPHNVKRKHCDLDDSECPSEEQDVEEESVGVKKQVPGRVGTGSKRSRAAEVHNLSERR  476

Query  1596  RRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  477   RRDRINEKMRALQELIPNCNKVDKASMLD  505



>ref|XP_011039054.1| PREDICTED: transcription factor PIF3-like isoform X2 [Populus 
euphratica]
Length=741

 Score =   221 bits (564),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 195/511 (38%), Positives = 265/511 (52%), Gaps = 97/511 (19%)
 Frame = +3

Query  423   MPLSEFL-KMLKNE---SGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK  590
             MPLSE L +M K +   S E+ P+ S+  DLS +P +DF EL+WENGQI    QSS+A+K
Sbjct  1     MPLSELLYRMAKGKIDSSQEKDPSCST--DLSFVPENDFGELMWENGQI----QSSRARK  54

Query  591   SDNLS-------RMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPW  749
                 S       ++R K +G+ ++ R GK  +  S L+E+P SVP+ EM ++QDD++ PW
Sbjct  55    IQPCSTLTCQNPKIRYKDIGSGTNIRTGKFGMIESTLNELPMSVPAVEMGVNQDDDMVPW  114

Query  750   LNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIG---ASKSV-------VNSG--  893
             LNY        +Y S+ LPE+SG T N  S    FP  G    S+SV       V+ G  
Sbjct  115   LNYPLDESPQHDYCSEFLPELSGVTVNGHSSQSNFPSFGNKSFSQSVRDSRTVSVHDGLS  174

Query  894   ------QRNATKLDCS---PR-----FGLLASWSSQQANPLV-------SGVSDIGSSNG  1010
                    +N++  D     PR       L +S   Q + P         +G S   +++ 
Sbjct  175   LEQGDVAKNSSAGDTEANRPRTSASQLCLSSSEHCQTSFPYFRSRVSAKNGDSASNAAHH  234

Query  1011  SINLDSILKDS----VPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQN------  1160
              +++DSI   +     P     +      T   +L+NFS+F+RP  LA+ANLQN      
Sbjct  235   VVSVDSIRAPTSGGGFPSIKMQKQVPAQSTTNSSLMNFSHFARPAALAKANLQNFGMRAG  294

Query  1161  ----TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNLRT-----------  1295
                  +E    +++    ++ NPA+   I +CS   KE+     P L             
Sbjct  295   TGISNMERMQNKDRGSIASSSNPAECTPINSCSGLLKETSSHCLPVLMPPKVDAKPSEAK  354

Query  1296  ---------KFEQTDASREDTNDAD--------KVHG----NKAVEPgacssvcsg-ssa  1409
                      + E T +  +  ND +         + G     K  EP A SS     +S 
Sbjct  355   PAEGFVPAERPEATISEGDSKNDRNCRQNFCESAIKGVADVEKTKEPVAASSSVGSDNSV  414

Query  1410  ERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSE  1589
             ER S+D + +LKR+ R+ EES  PSED +EES GAKK APAR G G KR+RAAEVHNLSE
Sbjct  415   ERPSDDPTENLKRKHRDTEESEGPSEDVEEESVGAKKQAPARAGNGSKRNRAAEVHNLSE  474

Query  1590  RRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  475   RRRRDRINEKMRALQELIPNCNKVDKASMLD  505



>ref|XP_009365453.1| PREDICTED: transcription factor PIF3-like [Pyrus x bretschneideri]
 ref|XP_009335548.1| PREDICTED: transcription factor PIF3-like isoform X1 [Pyrus x 
bretschneideri]
Length=716

 Score =   219 bits (559),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 199/519 (38%), Positives = 257/519 (50%), Gaps = 122/519 (24%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
             MPLSE  +M             S+ D      +DF ELVWENGQ+ MQGQSS+ +K+ + 
Sbjct  1     MPLSELYRMAGR--------VDSSQDFE----NDFLELVWENGQVMMQGQSSRTRKNPSF  48

Query  603   SRM--------REKCVGNASSSRIGKL-DLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
             + +        R++ VGN +  + GK   +  S LDE+P SVPS EM LS+DD++ PWLN
Sbjct  49    NSLPSFSNPKNRDRDVGNGNIGKTGKFGSVVDSGLDEIPLSVPSSEMGLSEDDDMLPWLN  108

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIG--ASKSVV------NSG------  893
             YS       EY    LPE S  TANE S +     I   +S S V      NS       
Sbjct  109   YSIDEPLHHEYCHDFLPEFSSATANEASTNHNLASIDKRSSSSQVFRDSNSNSAHEGACL  168

Query  894   -QRNATKL------DCS-PRFGL-----LASWSSQQANP-LVSGVSD-------------  992
              QRN  K+      D S PR G      L+S  SQ + P   S VSD             
Sbjct  169   QQRNVGKVPLNGGADVSRPRSGATQLYSLSSQRSQASFPSFRSRVSDTAGDNTSSATHRG  228

Query  993   -------IGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARAN  1151
                    I S+ GS  +     D V P   N          P+++NFS+FSRP  LA+AN
Sbjct  229   VGKNSTHISSAGGSPGMKIPRPDPVTPSNNN----------PSIVNFSHFSRPAALAKAN  278

Query  1152  LQNTLEAKG----------KREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNL-RTK  1298
             +Q      G           ++K     + +  ++ LI++ S++ KES+ + Q  L R+ 
Sbjct  279   VQTNGVMAGSGSSSMIRIANKDKFSSATSNSLPESMLIDSSSSAPKESNSQCQQILVRSS  338

Query  1299  FE----------------------QTDASREDTND-------ADKV--HGNKAVEPgacs  1385
              E                      Q + S+ D N        A +V  +G K VEP   S
Sbjct  339   VELKPTEAKHLEEPCTAKRSEGTCQEETSKNDINSNHIPCESAVRVSPNGEKTVEPVVAS  398

Query  1386  svcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRA  1565
             SVCSG+S ER S+D + +LKR+ RE +ES C S+D +EE     K      G G KRSRA
Sbjct  399   SVCSGNSVERGSDDPTQALKRKFRETDESECHSDDVEEE-YMGVKKGAHARGMGSKRSRA  457

Query  1566  AEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             AEVHNLSER+RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  458   AEVHNLSERKRRDRINEKMRALQELIPNCNKVDKASMLD  496



>ref|XP_011039053.1| PREDICTED: transcription factor PIF3-like isoform X1 [Populus 
euphratica]
Length=742

 Score =   217 bits (552),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 195/512 (38%), Positives = 265/512 (52%), Gaps = 98/512 (19%)
 Frame = +3

Query  423   MPLSEFL-KMLKNE---SGERKPTSSSADDLSPL-PGSDFSELVWENGQITMQGQSSKAK  587
             MPLSE L +M K +   S E+ P+ S+  DLS + P +DF EL+WENGQI    QSS+A+
Sbjct  1     MPLSELLYRMAKGKIDSSQEKDPSCST--DLSFVRPENDFGELMWENGQI----QSSRAR  54

Query  588   KSDNLS-------RMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAP  746
             K    S       ++R K +G+ ++ R GK  +  S L+E+P SVP+ EM ++QDD++ P
Sbjct  55    KIQPCSTLTCQNPKIRYKDIGSGTNIRTGKFGMIESTLNELPMSVPAVEMGVNQDDDMVP  114

Query  747   WLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIG---ASKSV-------VNSG-  893
             WLNY        +Y S+ LPE+SG T N  S    FP  G    S+SV       V+ G 
Sbjct  115   WLNYPLDESPQHDYCSEFLPELSGVTVNGHSSQSNFPSFGNKSFSQSVRDSRTVSVHDGL  174

Query  894   -------QRNATKLDCS---PR-----FGLLASWSSQQANPLV-------SGVSDIGSSN  1007
                     +N++  D     PR       L +S   Q + P         +G S   +++
Sbjct  175   SLEQGDVAKNSSAGDTEANRPRTSASQLCLSSSEHCQTSFPYFRSRVSAKNGDSASNAAH  234

Query  1008  GSINLDSILKDS----VPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQN-----  1160
               +++DSI   +     P     +      T   +L+NFS+F+RP  LA+ANLQN     
Sbjct  235   HVVSVDSIRAPTSGGGFPSIKMQKQVPAQSTTNSSLMNFSHFARPAALAKANLQNFGMRA  294

Query  1161  -----TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNLRT----------  1295
                   +E    +++    ++ NPA+   I +CS   KE+     P L            
Sbjct  295   GTGISNMERMQNKDRGSIASSSNPAECTPINSCSGLLKETSSHCLPVLMPPKVDAKPSEA  354

Query  1296  ----------KFEQTDASREDTNDAD--------KVHG----NKAVEPgacssvcsg-ss  1406
                       + E T +  +  ND +         + G     K  EP A SS     +S
Sbjct  355   KPAEGFVPAERPEATISEGDSKNDRNCRQNFCESAIKGVADVEKTKEPVAASSSVGSDNS  414

Query  1407  aERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLS  1586
              ER S+D + +LKR+ R+ EES  PSED +EES GAKK APAR G G KR+RAAEVHNLS
Sbjct  415   VERPSDDPTENLKRKHRDTEESEGPSEDVEEESVGAKKQAPARAGNGSKRNRAAEVHNLS  474

Query  1587  ERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             ERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  475   ERRRRDRINEKMRALQELIPNCNKVDKASMLD  506



>ref|XP_002512587.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50039.1| conserved hypothetical protein [Ricinus communis]
Length=758

 Score =   217 bits (552),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 194/511 (38%), Positives = 259/511 (51%), Gaps = 97/511 (19%)
 Frame = +3

Query  423   MPLSEFLKML---KNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS  593
             MPLSE +  L   K +S  ++  ++ + DLS  P +DF ELVWENGQI    QSS+A+K 
Sbjct  1     MPLSELICRLSKGKFDSSSQEKNTTCSTDLSAGPENDFLELVWENGQI----QSSRARKI  56

Query  594   DN-----LSRMREK----CVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAP  746
              N      S+ R+K     +GN +++++G+       LDE+P SVPS EM L+Q+D++ P
Sbjct  57    SNGVQSQTSKFRDKDISIGIGNGNNTKMGRFGAMDFGLDEVPMSVPSVEMGLNQEDDMVP  116

Query  747   WLNYSPSNGQSQEYGSQLLPEISGTTANE------------------------PSPHDGF  854
             WLN    +   Q+Y  + L E+SG T NE                         S H+G 
Sbjct  117   WLNDPIDDSLQQDYCHEFLAELSGVTVNEHAQNSFASSDKKCNGNQSVRDSHTASVHNGL  176

Query  855   PLIGASKSVVNSGQ--------RNATKL------DCSPRFGLLASWSSQQANPLVSGVSD  992
              L       V+SG+          A++L       C   F    S  S       +  + 
Sbjct  177   SLEQGHMPRVSSGRDGDATRSRTTASQLYSSSVQQCQASFPHFRSRISANNAESTNNSTH  236

Query  993   IGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQN----  1160
             + SS   I   S      P     +      T   +L+NFS+FSRPV LA+AN +N    
Sbjct  237   VASSGDPIR-GSPSGGGFPSIKAQKQVPVLATTNSSLMNFSHFSRPVALAKANFENIGTR  295

Query  1161  ------TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNLRTK--------  1298
                   ++E  G ++K    ++ NPA++ L E  S  +KE+  + +P + +         
Sbjct  296   AGSGISSIERIGSQDKGSIASSSNPAESMLNETFSGLKKETSSRCRPVMVSSKVDDKPLD  355

Query  1299  ---------FEQTDASREDTNDADKVH-------------GNKAVEPgacssvc-sgssa  1409
                       +Q +A   D  + DK H             G K  EP   SS   SG+S 
Sbjct  356   HRPAEEPLLAKQPEAMENDCKN-DKNHCQFAASATKGLADGEKTAEPIVASSSVCSGNSM  414

Query  1410  ERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSE  1589
             ER S++   +LKR+ RE EES  PSED +EES G KKAAPARGGTG KRSRAAEVHNLSE
Sbjct  415   ERVSDEPMQNLKRKHRETEESEGPSEDVEEESVGGKKAAPARGGTGSKRSRAAEVHNLSE  474

Query  1590  RRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  475   RRRRDRINEKMRALQELIPNCNKVDKASMLD  505



>ref|XP_011039055.1| PREDICTED: transcription factor PIF3-like isoform X3 [Populus 
euphratica]
Length=740

 Score =   216 bits (551),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 195/512 (38%), Positives = 265/512 (52%), Gaps = 98/512 (19%)
 Frame = +3

Query  423   MPLSEFL-KMLKNE---SGERKPTSSSADDLSPL-PGSDFSELVWENGQITMQGQSSKAK  587
             MPLSE L +M K +   S E+ P+ S+  DLS + P +DF EL+WENGQI    QSS+A+
Sbjct  1     MPLSELLYRMAKGKIDSSQEKDPSCST--DLSFVRPENDFGELMWENGQI----QSSRAR  54

Query  588   KSDNLS-------RMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAP  746
             K    S       ++R K +G+ ++ R GK  +  S L+E+P SVP+ EM ++QDD++ P
Sbjct  55    KIQPCSTLTCQNPKIRYKDIGSGTNIRTGKFGMIESTLNELPMSVPAVEMGVNQDDDMVP  114

Query  747   WLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIG---ASKSV-------VNSG-  893
             WLNY        +Y S+ LPE+SG T N  S    FP  G    S+SV       V+ G 
Sbjct  115   WLNYPLDESPQHDYCSEFLPELSGVTVNGHSSQSNFPSFGNKSFSQSVRDSRTVSVHDGL  174

Query  894   -------QRNATKLDCS---PR-----FGLLASWSSQQANPLV-------SGVSDIGSSN  1007
                     +N++  D     PR       L +S   Q + P         +G S   +++
Sbjct  175   SLEQGDVAKNSSAGDTEANRPRTSASQLCLSSSEHCQTSFPYFRSRVSAKNGDSASNAAH  234

Query  1008  GSINLDSILKDS----VPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQN-----  1160
               +++DSI   +     P     +      T   +L+NFS+F+RP  LA+ANLQN     
Sbjct  235   HVVSVDSIRAPTSGGGFPSIKMQKQVPAQSTTNSSLMNFSHFARPAALAKANLQNFGMRA  294

Query  1161  -----TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNLRT----------  1295
                   +E    +++    ++ NPA+   I +CS   KE+     P L            
Sbjct  295   GTGISNMERMQNKDRGSIASSSNPAECTPINSCSGLLKETSSHCLPVLMPPKVDAKPSEA  354

Query  1296  ----------KFEQTDASREDTNDAD--------KVHG----NKAVEPgacssvcsg-ss  1406
                       + E T +  +  ND +         + G     K  EP A SS     +S
Sbjct  355   KPAEGFVPAERPEATISEGDSKNDRNCRQNFCESAIKGVADVEKTKEPVAASSSVGSDNS  414

Query  1407  aERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLS  1586
              ER S+D + +LKR+ R+ EES  PSED +EES GAKK APAR G G KR+RAAEVHNLS
Sbjct  415   VERPSDDPTENLKRKHRDTEESEGPSEDVEEESVGAKKQAPARAGNGSKRNRAAEVHNLS  474

Query  1587  ERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             ERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  475   ERRRRDRINEKMRALQELIPNCNKVDKASMLD  506



>gb|AEX32796.1| phytochrome-interacting factor 3 [Malus domestica]
Length=713

 Score =   215 bits (547),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 195/518 (38%), Positives = 248/518 (48%), Gaps = 121/518 (23%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK----  590
             MP SE  +M             S+ D      +DF ELVWENGQ+ MQGQSS+ +K    
Sbjct  1     MPFSELYRMAGR--------VDSSQDFE----NDFLELVWENGQVVMQGQSSRTRKNPSC  48

Query  591   ----SDNLSRMREKCVGNASSSRIGKLDLA-GSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                 S N  + R++ VGN++  + GK      S LDE+P SVPS EM LS+DD+  PWLN
Sbjct  49    NTLPSYNTPKNRDRDVGNSNIGKTGKFGFVVDSELDEIPLSVPSSEMGLSEDDDTLPWLN  108

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLI---GASKSVV-----NSG------  893
             YS       EY    LPE S  TANE S +     I    +S  V+     NS       
Sbjct  109   YSIDEPLHHEYCHDFLPEFSSATANEASSNHNLASIDKRSSSSQVLRDSNPNSAHEDACL  168

Query  894   -QRNATKL------DCS-PRFGLLASWSSQQANP------LVSGVSD-------------  992
              QRN  K+      D S PR G     S              S VSD             
Sbjct  169   QQRNVGKVALIGRADVSRPRTGTSQLHSLSSQQSQASYPSFRSRVSDTAGDNTSATHRDV  228

Query  993   ------IGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANL  1154
                   I S+ GS  +  +  D V P   N          P+++NFS+FSRP  L +AN+
Sbjct  229   GKNSTQISSAGGSPGMKILRPDPVTPSNNN----------PSIVNFSHFSRPAALVKANV  278

Query  1155  QNTLEAKG----------KREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNL-RTKF  1301
             Q      G           ++K     + N  ++  I++ S++ KES+ + Q  L R+  
Sbjct  279   QTNGVMAGSGSSSMIRIANKDKFSAATSNNLPESMPIDSSSSAPKESNSQCQQILVRSSV  338

Query  1302  E----------------------QTDASREDTND-------ADKV--HGNKAVEPgacss  1388
             E                      Q + S++D N        A +V  +G K VEP   SS
Sbjct  339   ELKPTEAKPLEEPCTAKQSEGTCQEETSKDDINSNHIPCESAVRVSPNGEKTVEPVVASS  398

Query  1389  vcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAA  1568
             VCSG+S ER S+D + +LKR+ RE +ES C S+D +EE     K      G G KRSRAA
Sbjct  399   VCSGNSVERGSDDPTQALKRKFRETDESECHSDDVEEE-YMGVKKGDHARGMGSKRSRAA  457

Query  1569  EVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             EVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  458   EVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  495



>ref|XP_008388421.1| PREDICTED: transcription factor PIF3-like [Malus domestica]
Length=708

 Score =   215 bits (547),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 193/513 (38%), Positives = 249/513 (49%), Gaps = 116/513 (23%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK--SD  596
             MPLSE  +M             S  D      +DF ELVWENGQ+ MQGQSS+ +K  S 
Sbjct  1     MPLSELYRMAGR--------VDSNQDFE----NDFLELVWENGQVMMQGQSSRTRKNPSF  48

Query  597   NLSRMREKCVGNASSSRIGKL-DLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNG  773
             N  + R++ VGN +  + GK   +  S LDE+P SVPS EM LS+DD++ PWLNYS    
Sbjct  49    NNPKNRDRDVGNGNIGKTGKFGSVLDSGLDEIPLSVPSSEMGLSEDDDMLPWLNYSIDEP  108

Query  774   QSQEYGSQLLPEISGTTANEPSPHDGFPLI----GASKSVVNSGQRNATKLDC-------  920
                E     LPE S  TANE S +     I     +S+   +S   +A +  C       
Sbjct  109   LHHEXCHDFLPEFSSATANEASTNHNLASIDKRSSSSQVFRDSNSNSAHEGACLQQXNVG  168

Query  921   -----------SPRFGL-----LASWSSQQANP-LVSGVSD-------------------  992
                         PR G      L+S  SQ + P   S VSD                   
Sbjct  169   KVPLNGGADASRPRSGATQLYSLSSQRSQASFPSFRSRVSDTAGDNTSSATHRGVGKNST  228

Query  993   -IGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQNTLE  1169
              I S+ GS  +  +  D V P   N          P+++NFS+FSRP  L +AN+Q    
Sbjct  229   QISSAGGSPXMKILRPDPVTPSNNN----------PSIVNFSHFSRPAALVKANVQTNGV  278

Query  1170  AKG----------KREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNL-RTKFE----  1304
               G           ++K       N  ++  I++ S++ KES+ + Q  L R+  E    
Sbjct  279   MAGSGSSSMIRIANKDKFSAATXNNLPESMPIDSSSSAXKESNSQCQQILVRSSVELKPT  338

Query  1305  ------------------QTDASREDTND-------ADKV--HGNKAVEPgacssvcsgs  1403
                               Q + S++D N        A +V  +G K VEP   SSVCSG+
Sbjct  339   EAKPLEEPCTAKQSEGTCQEETSKDDINSNHIPCESAVRVSPNGEKTVEPVVASSVCSGN  398

Query  1404  saERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNL  1583
             S ER S+D + +LKR+ RE +ES C S+D +EE     K      G G KRSRAAEVHNL
Sbjct  399   SVERGSDDPTQALKRKFRETDESECHSDDVEEE-YMGVKKGDHARGMGSKRSRAAEVHNL  457

Query  1584  SERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             SERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  458   SERRRRDRINEKMRALQELIPNCNKVDKASMLD  490



>emb|CBI39676.3| unnamed protein product [Vitis vinifera]
Length=573

 Score =   204 bits (519),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 177/442 (40%), Positives = 221/442 (50%), Gaps = 98/442 (22%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS---  593
             MP SE  +M K   G+ +      +DLS  P +DF ELVWE GQI MQGQSS+A+KS   
Sbjct  1     MPFSELYRMAK---GKPESVQQKTNDLSFGPENDFVELVWEGGQIMMQGQSSRARKSPLS  57

Query  594   ----DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYS  761
                  +  + R+K  G+ ++S++G                       +QDD++ PWLNY 
Sbjct  58    NSFPSHTPKPRDKDTGHGTNSKMG-----------------------NQDDDMVPWLNYP  94

Query  762   PSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPRFGLL  941
                    +Y S  L E+SG T NE S H  F    AS    NS   N T  D +      
Sbjct  95    IDESLQHDYCSDFLQELSGVTVNELSTHCNF----ASGEKRNS--NNQTIKDSN------  142

Query  942   ASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPP-------------QAKNQDTETT  1082
              + S+     L  G +   S+ G            PP             + + QD   T
Sbjct  143   -TISAHNGVSLEQGNASKASAAGVEPSRPRSSQLYPPSSQQSSTSGFSSTKTQKQDPGQT  201

Query  1083  RTCPPTLLNFSNFSRPVVLARANLQNTLEAK-GKREKEIKENAQNPAKTALIEACSTSRK  1259
             R     L+NFS+FSRP  L +ANLQN +  + G  + E   N    A+TA          
Sbjct  202   RNNS-GLMNFSHFSRPAALVKANLQNIVICQEGACKNEKSSNQVLGARTA----------  250

Query  1260  ESDLKSQPNLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvc-sgssaERASNDQSH  1436
                 K  P+                      G K +EP    S   SG+S ERASND  H
Sbjct  251   ----KGIPD----------------------GEKTIEPAVACSSVCSGNSVERASNDPKH  284

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             +LKR+ R+ EES CPSED +EES G +K+APA+GGTG KRSRAAEVHNLSERRRRDRINE
Sbjct  285   NLKRKCRDTEESECPSEDVEEESVGVRKSAPAKGGTGSKRSRAAEVHNLSERRRRDRINE  344

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIPNCNK DKASMLD
Sbjct  345   KMRALQELIPNCNKVDKASMLD  366



>ref|XP_010240811.1| PREDICTED: transcription factor PIF3-like isoform X2 [Nelumbo 
nucifera]
Length=740

 Score =   205 bits (522),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 193/529 (36%), Positives = 255/529 (48%), Gaps = 124/529 (23%)
 Frame = +3

Query  423   MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSD  596
             MPLSEF +M K   ES + K  + S D    +P  DF ELVWENGQI MQGQSSK ++S 
Sbjct  1     MPLSEFHQMAKGKLESSQSKMNNCSTDQAF-VPDHDFVELVWENGQILMQGQSSKTRRSP  59

Query  597   N-------LSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
             +       +S++++K  G+A++ +IG+      VL++   +VPSG M L+ ++E+ PWLN
Sbjct  60    SSNNLPSYISKVQDKDGGDATNLKIGRSRTEEHVLNDFTSTVPSGNMGLASEEEMVPWLN  119

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEPSP-HDGFP-------------LIGASKSVVNSG  893
             YS  +    +Y S+   E++G   N  S  ++ FP             L  AS     + 
Sbjct  120   YSLDDSLQHDYCSEFFSELTGVNLNALSTQNNSFPIDKNSSCGQISRDLNIASVYFDKNP  179

Query  894   QRNATKL------DCSPRFGLLASWSSQQAN-------PLVSGV----------------  986
             Q NA+K          P    L S S QQ         P VS +                
Sbjct  180   QGNASKGVGGNPEPIRPSSNQLRSSSLQQCQISLPSLRPRVSDLINSNTNNADKASCGNS  239

Query  987   SDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPP-------TLLNFSNFSRPVVLAR  1145
             SD  +SNG +           P  K Q  +   T PP        L+NFS+FSRP    +
Sbjct  240   SDTPTSNGGL-----------PNTKMQRQDPGPTRPPPQNNISSGLMNFSHFSRPAAFVK  288

Query  1146  ANLQN-------------TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQ--  1280
             ANL N              L + GK        + NP ++ LI++ S SR  +   +Q  
Sbjct  289   ANLHNLGAVASPGLSSIDNLRSNGKAS---AAGSSNPVESTLIDSTSGSRNATSFHNQRA  345

Query  1281  --------------------PNLRTKFEQTDASREDTND--------------ADKVHGN  1358
                                  N    F +    R+ + D                K  G 
Sbjct  346   SVPAEGEPKPSKPPKEQFSAENSEVVFREEAHRRKRSPDRVIDHTSSFAASTAVGKPDGE  405

Query  1359  KAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaapar  1535
             +AVEP   SS   S +S   AS+D  ++LKR++R+ +ES   SED +EES G KK AP+R
Sbjct  406   RAVEPAVASSSVCSVNSGGGASDDPKNTLKRKSRDGDESEYQSEDLEEESVGVKKLAPSR  465

Query  1536  ggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             GGT  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  466   GGTSAKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  514



>ref|XP_006605776.1| PREDICTED: transcription factor PIF3-like [Glycine max]
Length=722

 Score =   202 bits (513),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 175/506 (35%), Positives = 259/506 (51%), Gaps = 92/506 (18%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS---  593
             MPL E  ++ + + G ++ TS+ A DL   P +DF ELVWENGQI+ QGQSS+ ++S   
Sbjct  1     MPLYELYRLAREKLG-KETTSTRAPDLCSSPENDFFELVWENGQISSQGQSSRVRRSPSC  59

Query  594   ---------DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAP  746
                       +  ++R+K VG  +++R+GK     S L+E+P SVPS E+D   D+++ P
Sbjct  60    KSLPSHCLPSHCPKVRDKDVGYGTNTRMGKFGDLDSGLNEIPMSVPSREVDFCHDEDVLP  119

Query  747   WLNYSPSNGQSQ-EYGSQLLPEISGTT--------------ANEPSPHDGFPLIGASKSV  881
             WL+Y+  +G  Q EYGS  L   +  T              +++ S   G    G+S   
Sbjct  120   WLDYTSMDGSLQHEYGSDFLHASNSFTLLDKKSNGNMAFRDSHKTSEEQGNVFKGSSAEQ  179

Query  882   VNSGQRNATKLDCSP--RFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILK----DS  1043
             V + +  A+     P        S+ S +     S  SDI  +N + N +  +       
Sbjct  180   VETARPKASTSQLFPPSLHQCQTSFVSSR-----SRASDITENNNTSNANQDVSYGEITH  234

Query  1044  VPPQAKNQDTETTRTCPPTL---------LNFSNFSRPVVLARANLQNT-----LEAKGK  1181
             +   + +  +   + C P +         +NFS+F+RP  + RANLQN      L +   
Sbjct  235   ILSSSSDLSSAKVQKCDPPITSNGSSSTIMNFSHFARPAAMVRANLQNIGLKSGLSSARS  294

Query  1182  REKEIKE-----NAQNPAKTALIEACSTSRKESDLKSQ-------PNLR-----------  1292
                EIK       + NP ++ L+++     KE  ++ Q       P++            
Sbjct  295   DSMEIKNKGAAATSSNPPESILVDSSGECSKEPTMQCQQVVEQSKPDVNSLQPKSVEQNA  354

Query  1293  --------------TKFEQT-DASREDTNDADKVHGNKAVEPgacssvc-sgssaERASN  1424
                           TK +QT +    D+    +    K++EP   SS   SG+ A++ S+
Sbjct  355   VPSKQSEPASKESATKIDQTPNQVLGDSGTKGQTAAEKSMEPAVASSSVCSGTGADQGSD  414

Query  1425  DQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRD  1604
             + + +LKR+ ++ ++S C SED +EESAGAKK A  +GG G KRSRAAEVHNLSERRRRD
Sbjct  415   EPNQNLKRKTKDTDDSECHSEDVEEESAGAKKTAGGQGGAGSKRSRAAEVHNLSERRRRD  474

Query  1605  RINEKMRALQELIPNCNKADKASMLD  1682
             RINEKMRALQELIPNCNK DKASMLD
Sbjct  475   RINEKMRALQELIPNCNKVDKASMLD  500



>gb|KHN26204.1| Transcription factor PIF3 [Glycine soja]
Length=722

 Score =   202 bits (513),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 176/506 (35%), Positives = 259/506 (51%), Gaps = 92/506 (18%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS---  593
             MPL E  ++ + + G ++ TS+ A DL   P +DF ELVWENGQI+ QGQSS+ ++S   
Sbjct  1     MPLYELYRLAREKLG-KETTSTRAPDLCSSPENDFFELVWENGQISSQGQSSRVRRSPSC  59

Query  594   ---------DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAP  746
                       +  ++R+K VG  +++R+GK     S L+E+P SVPS E+D   D+++ P
Sbjct  60    KSLPSHCLPSHCPKVRDKDVGYGTNTRMGKFGDLDSGLNEIPMSVPSREVDFCHDEDVLP  119

Query  747   WLNYSPSNGQSQ-EYGSQLLPEISGTT--------------ANEPSPHDGFPLIGASKSV  881
             WL+Y+  +G  Q EYGS  L   +  T              +++ S   G    G+S   
Sbjct  120   WLDYTSMDGSLQHEYGSDFLHASNSFTLLDKKSNGNMAFRDSHKTSEEQGNVFKGSSAEQ  179

Query  882   VNSGQRNATKLDCSP--RFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILK----DS  1043
             V + +  A+     P        S+ S +     S  SDI  +N + N +  +       
Sbjct  180   VETARPKASTSQLFPPSLHQCQTSFVSSR-----SRASDITENNNTSNANQDVSYGEITH  234

Query  1044  VPPQAKNQDTETTRTCPPTL---------LNFSNFSRPVVLARANLQNT-----LEAKGK  1181
             +   + +  +   + C P +         +NFS+F+RP  + RANLQN      L +   
Sbjct  235   ILSSSSDLSSAKVQKCDPPITSNGSSSTIMNFSHFARPAAMVRANLQNIGLKSGLSSARS  294

Query  1182  REKEIKE-----NAQNPAKTALIEACSTSRKESDLKSQ-------PNLR-----------  1292
                EIK       + NP ++ L+++     KE  ++ Q       P++            
Sbjct  295   DSMEIKNKGAAATSSNPPESILVDSSGECSKEPTMQCQQVVEQSKPDVNSLQPKSVEQNA  354

Query  1293  --------------TKFEQT-DASREDTNDADKVHGNKAVEPgacssvc-sgssaERASN  1424
                           TK +QT +    D+    +    K++EP   SS   SG+ A++ S+
Sbjct  355   VPSKQSEPASKESATKIDQTPNQVLGDSGTKGQTAAEKSMEPAVASSSVCSGTGADQGSD  414

Query  1425  DQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRD  1604
             + + +LKR+ ++ ++S C SED +EESAGAKK A  RGG G KRSRAAEVHNLSERRRRD
Sbjct  415   EPNQNLKRKTKDTDDSECHSEDVEEESAGAKKTAGGRGGAGSKRSRAAEVHNLSERRRRD  474

Query  1605  RINEKMRALQELIPNCNKADKASMLD  1682
             RINEKMRALQELIPNCNK DKASMLD
Sbjct  475   RINEKMRALQELIPNCNKVDKASMLD  500



>ref|XP_010240809.1| PREDICTED: transcription factor PIF3-like isoform X1 [Nelumbo 
nucifera]
Length=744

 Score =   199 bits (507),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 193/533 (36%), Positives = 255/533 (48%), Gaps = 128/533 (24%)
 Frame = +3

Query  423   MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSD  596
             MPLSEF +M K   ES + K  + S D    +P  DF ELVWENGQI MQGQSSK ++S 
Sbjct  1     MPLSEFHQMAKGKLESSQSKMNNCSTDQAF-VPDHDFVELVWENGQILMQGQSSKTRRSP  59

Query  597   N-------LSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
             +       +S++++K  G+A++ +IG+      VL++   +VPSG M L+ ++E+ PWLN
Sbjct  60    SSNNLPSYISKVQDKDGGDATNLKIGRSRTEEHVLNDFTSTVPSGNMGLASEEEMVPWLN  119

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEPSP-HDGFP-------------LIGASKSVVNSG  893
             YS  +    +Y S+   E++G   N  S  ++ FP             L  AS     + 
Sbjct  120   YSLDDSLQHDYCSEFFSELTGVNLNALSTQNNSFPIDKNSSCGQISRDLNIASVYFDKNP  179

Query  894   QRNATKL------DCSPRFGLLASWSSQQAN-------PLVSGV----------------  986
             Q NA+K          P    L S S QQ         P VS +                
Sbjct  180   QGNASKGVGGNPEPIRPSSNQLRSSSLQQCQISLPSLRPRVSDLINSNTNNADKASCGNS  239

Query  987   SDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPP-------TLLNFSNFSRPVVLAR  1145
             SD  +SNG +           P  K Q  +   T PP        L+NFS+FSRP    +
Sbjct  240   SDTPTSNGGL-----------PNTKMQRQDPGPTRPPPQNNISSGLMNFSHFSRPAAFVK  288

Query  1146  ANLQN-------------TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQ--  1280
             ANL N              L + GK        + NP ++ LI++ S SR  +   +Q  
Sbjct  289   ANLHNLGAVASPGLSSIDNLRSNGKAS---AAGSSNPVESTLIDSTSGSRNATSFHNQRA  345

Query  1281  --------------------PNLRTKFEQTDASREDTND--------------ADKVHGN  1358
                                  N    F +    R+ + D                K  G 
Sbjct  346   SVPAEGEPKPSKPPKEQFSAENSEVVFREEAHRRKRSPDRVIDHTSSFAASTAVGKPDGE  405

Query  1359  KAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPSE----DADEESagakka  1523
             +AVEP   SS   S +S   AS+D  ++LKR++R+ +ES   SE    D +EES G KK 
Sbjct  406   RAVEPAVASSSVCSVNSGGGASDDPKNTLKRKSRDGDESEYQSEVSENDLEEESVGVKKL  465

Query  1524  aparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             AP+RGGT  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  466   APSRGGTSAKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  518



>ref|XP_008800313.1| PREDICTED: transcription factor PIF3-like isoform X1 [Phoenix 
dactylifera]
Length=670

 Score =   196 bits (497),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 172/485 (35%), Positives = 248/485 (51%), Gaps = 74/485 (15%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK----  590
             MPLSE  +  K ++ + K T+ S+D  S +P  +F EL+WENGQI M GQS++ +K    
Sbjct  1     MPLSEVHQTRKVDANQSKMTNCSSDLSSFIPDGEFVELLWENGQIVMHGQSNRPRKSSFP  60

Query  591   ------SDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGE--MDLSQDDEIAP  746
                   S +  R +EK   +  +S+IG+++    ++++ PP+  SG+  ++   DD++ P
Sbjct  61    TATAATSSHTGRAQEKESRDVVTSKIGQIEAVDPLVNDFPPTAASGDAGVNAQDDDDMVP  120

Query  747   WLNYSPSNGQSQEYGSQLLPEISGTTANEPSPH---------DGFPLIGAS---------  872
             W+NYS  +    +Y S+ + E  G + N  S H         +GF     S         
Sbjct  121   WINYSIEDSLQNDYCSEHMLEFPGMSLNSMSSHTNTAIADRSNGFTQTAKSSRRNVEQGR  180

Query  873   KSVVNSGQRNATKLDCSPRFGLLASWSS--QQANPLVSGVSDIGSSNGSINLDSILKDSV  1046
              S   +G  + +++  S  F     W S  Q   P  + +S  G+S+    L   L  S 
Sbjct  181   TSEELAGASDFSRIKSSQLFQASQEWQSLAQSIKPRATELSTRGTSSTHHGLAGCLLSSR  240

Query  1047  P-PQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAK  1223
             P  Q +     +  +    L+NFS+FSRP  LA+ANLQ  L+     EK     + NP +
Sbjct  241   PQKQDRAGSRSSQSSSSIDLMNFSHFSRPAALAKANLQG-LDRLRNNEKASTTTSSNPME  299

Query  1224  TALIEACSTSRKESDLKSQPNLRT---KFEQTDASREDTNDADKVHGNKAVEP-------  1373
               +I++ S  +    + + P L +   + EQ  ++R D N    V+ N ++ P       
Sbjct  300   PTVIDSISGLKS---ILATPGLASAAPEVEQRSSTRRDGN----VNNNNSILPGCINRRS  352

Query  1374  ----------------------gacssvcsgssaERASNDQSHSLKRRARENEESGCPSE  1487
                                    A SSVCSG+ A  ASN   H+ KR+  E EESG   E
Sbjct  353   SDVAVAAMPSGRNETEKGPEAVAASSSVCSGNGAGAASNGPKHTPKRKTYEGEESGNQRE  412

Query  1488  DADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADK  1667
             D ++ES G +K+A  RG +  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DK
Sbjct  413   DHEDESMGLRKSATVRGTST-KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDK  471

Query  1668  ASMLD  1682
             ASMLD
Sbjct  472   ASMLD  476



>ref|XP_008800314.1| PREDICTED: transcription factor PIF3-like isoform X2 [Phoenix 
dactylifera]
Length=666

 Score =   196 bits (497),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 172/485 (35%), Positives = 248/485 (51%), Gaps = 74/485 (15%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK----  590
             MPLSE  +  K ++ + K T+ S+D  S +P  +F EL+WENGQI M GQS++ +K    
Sbjct  1     MPLSEVHQTRKVDANQSKMTNCSSDLSSFIPDGEFVELLWENGQIVMHGQSNRPRKSSFP  60

Query  591   ------SDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGE--MDLSQDDEIAP  746
                   S +  R +EK   +  +S+IG+++    ++++ PP+  SG+  ++   DD++ P
Sbjct  61    TATAATSSHTGRAQEKESRDVVTSKIGQIEAVDPLVNDFPPTAASGDAGVNAQDDDDMVP  120

Query  747   WLNYSPSNGQSQEYGSQLLPEISGTTANEPSPH---------DGFPLIGAS---------  872
             W+NYS  +    +Y S+ + E  G + N  S H         +GF     S         
Sbjct  121   WINYSIEDSLQNDYCSEHMLEFPGMSLNSMSSHTNTAIADRSNGFTQTAKSSRRNVEQGR  180

Query  873   KSVVNSGQRNATKLDCSPRFGLLASWSS--QQANPLVSGVSDIGSSNGSINLDSILKDSV  1046
              S   +G  + +++  S  F     W S  Q   P  + +S  G+S+    L   L  S 
Sbjct  181   TSEELAGASDFSRIKSSQLFQASQEWQSLAQSIKPRATELSTRGTSSTHHGLAGCLLSSR  240

Query  1047  P-PQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAK  1223
             P  Q +     +  +    L+NFS+FSRP  LA+ANLQ  L+     EK     + NP +
Sbjct  241   PQKQDRAGSRSSQSSSSIDLMNFSHFSRPAALAKANLQG-LDRLRNNEKASTTTSSNPME  299

Query  1224  TALIEACSTSRKESDLKSQPNLRT---KFEQTDASREDTNDADKVHGNKAVEP-------  1373
               +I++ S  +    + + P L +   + EQ  ++R D N    V+ N ++ P       
Sbjct  300   PTVIDSISGLKS---ILATPGLASAAPEVEQRSSTRRDGN----VNNNNSILPGCINRRS  352

Query  1374  ----------------------gacssvcsgssaERASNDQSHSLKRRARENEESGCPSE  1487
                                    A SSVCSG+ A  ASN   H+ KR+  E EESG   E
Sbjct  353   SDVAVAAMPSGRNETEKGPEAVAASSSVCSGNGAGAASNGPKHTPKRKTYEGEESGNQRE  412

Query  1488  DADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADK  1667
             D ++ES G +K+A  RG +  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DK
Sbjct  413   DHEDESMGLRKSATVRGTST-KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDK  471

Query  1668  ASMLD  1682
             ASMLD
Sbjct  472   ASMLD  476



>gb|KHN43378.1| Transcription factor PIF3 [Glycine soja]
Length=633

 Score =   194 bits (492),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 167/467 (36%), Positives = 239/467 (51%), Gaps = 74/467 (16%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPT----SSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK  590
             MPL E  ++ K   G+  P     ++ A D S +P +D  ELVWE GQI++QGQ S+A+ 
Sbjct  1     MPLHELYRVAK---GKLDPIEMNNNTCAVDQSSVPNNDLLELVWEKGQISVQGQFSRARV  57

Query  591   SDNLSRMREKC------VGNA-----SSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDE  737
             S N   +   C      +G A     +++R+GK    G+ L+E+   VPSGE+DLS+++E
Sbjct  58    SPNCKTLPSHCLPSHTPIGYANNAISTNTRMGKCGNLGAELNEIRRLVPSGEVDLSEEEE  117

Query  738   --IAPWLNYSPSNGQSQEYGSQLLPEIS--GTTANEPSPHDGFPLIGASKSVVNSGQRNA  905
               + PW NY   +     Y +    E S  G T NE S  + F L+          +RN 
Sbjct  118   DMVMPWFNYGMEDSLQHGYSTDFFHEPSSYGVTMNELSASNNFSLLD---------RRN-  167

Query  906   TKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSN------GSINLDSILKDSVPPQAKNQ  1067
                +C+  F      SS    P+ S V+DI  +N      GS    S+  +   P   + 
Sbjct  168   ---NCTKIFRDTHKHSSYA--PVRSSVADIAENNANNVPSGSSGFSSLKMERQGPVMCSS  222

Query  1068  DTETTRTCPPTLLNFSNFSRPVVLARANLQNTLEA-----KGKREKEIKENAQNPAKTAL  1232
              +        T++NFS+F++P  + +AN++N   A     +G + K       NPA++  
Sbjct  223   SS--------TMMNFSHFAKPAAIVKANIENIGLASRSGNEGIQIKSAAATVTNPAESTK  274

Query  1233  IEACSTSRKESDLKSQPNLRTKFEQTDASREDTNDADKVH------------GNKAVEPg  1376
             +E      K+    +Q    T   + D S +D +  D+              G++AVE G
Sbjct  275   VELSGECPKKPATHNQDQDVTVSTKCDPSCKDVSKVDQNQTSNLVVGESVNKGHEAVEKG  334

Query  1377  acssvcsgssa-----ERASNDQSHSLKRRARENEESGCPSEDADEESagakkaapargg  1541
                +V S S       ER S D + +LKR++++ E+    SED +EES G  K  PAR  
Sbjct  335   VELAVVSSSVCSGNGPERGSEDPNQNLKRKSKDTEDFESQSEDVEEESVGVNKEVPARRN  394

Query  1542  tgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
                K+SR+AEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD
Sbjct  395   GA-KKSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  440



>ref|XP_006604778.1| PREDICTED: transcription factor PIF3-like isoform X1 [Glycine 
max]
 ref|XP_006604779.1| PREDICTED: transcription factor PIF3-like isoform X2 [Glycine 
max]
Length=633

 Score =   192 bits (489),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 167/467 (36%), Positives = 238/467 (51%), Gaps = 74/467 (16%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPT----SSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK  590
             MPL E  ++ K   G+  P     ++ A D S +P +D  ELVWE GQI++QGQ S+A+ 
Sbjct  1     MPLHELYRVAK---GKLDPIEMNNNTCAVDQSSVPNNDLLELVWEKGQISVQGQFSRARV  57

Query  591   SDNLSRMREKC------VGNA-----SSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDE  737
             S N   +   C      +G A     +++R+GK    G  L+E+   VPSGE+DLS+++E
Sbjct  58    SPNCKTLPSHCLPSHTPIGYANNAISTNTRMGKCGNLGVELNEIRRLVPSGEVDLSEEEE  117

Query  738   --IAPWLNYSPSNGQSQEYGSQLLPEIS--GTTANEPSPHDGFPLIGASKSVVNSGQRNA  905
               + PW NY   +     Y +    E S  G T NE S  + F L+          +RN 
Sbjct  118   DMVMPWFNYGMEDSLQHGYSTDFFHEPSSYGVTMNELSASNNFSLLD---------RRN-  167

Query  906   TKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSN------GSINLDSILKDSVPPQAKNQ  1067
                +C+  F      SS    P+ S V+DI  +N      GS    S+  +   P   + 
Sbjct  168   ---NCTKIFRDTHKHSSYA--PVRSSVADIAENNANNVPSGSSGFSSLKMERQGPVMCSS  222

Query  1068  DTETTRTCPPTLLNFSNFSRPVVLARANLQNTLEA-----KGKREKEIKENAQNPAKTAL  1232
              +        T++NFS+F++P  + +AN++N   A     +G + K       NPA++  
Sbjct  223   SS--------TMMNFSHFAKPAAIVKANIENIGLASRSGNEGIQIKSAAATVTNPAESTK  274

Query  1233  IEACSTSRKESDLKSQPNLRTKFEQTDASREDTNDADKVH------------GNKAVEPg  1376
             +E      K+    +Q    T   + D S +D +  D+              G++AVE G
Sbjct  275   VELSGECPKKPATHNQDQDVTVSTKCDPSCKDVSKVDQNQTSNLVVGESVNKGHEAVEKG  334

Query  1377  acssvcsgssa-----ERASNDQSHSLKRRARENEESGCPSEDADEESagakkaapargg  1541
                +V S S       ER S D + +LKR++++ E+    SED +EES G  K  PAR  
Sbjct  335   VELAVVSSSVCSGNGPERGSEDPNQNLKRKSKDTEDFESQSEDVEEESVGVNKEVPARRN  394

Query  1542  tgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
                K+SR+AEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD
Sbjct  395   GA-KKSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  440



>gb|KHN24194.1| Transcription factor PIF3 [Glycine soja]
Length=691

 Score =   191 bits (484),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 179/514 (35%), Positives = 249/514 (48%), Gaps = 107/514 (21%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
             MPL E  ++ + + G ++ TS+ A D    P +DF ELVWENGQI+ QGQSS+ ++S + 
Sbjct  1     MPLYELYRLAREKLG-KETTSTRAPDQCSSPENDFFELVWENGQISSQGQSSRVRRSPSC  59

Query  603   SRM------------REKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAP  746
               +            R+K VG  S +R+GK     S L+E+P SVPS E+D  QD+++ P
Sbjct  60    KSLPSHCLPSHSPKARDKDVGYGSYTRLGKFGDLDSGLNEIPMSVPSSEVDFCQDEDVLP  119

Query  747   WLNYSPSNGQ-SQEYGSQLLPEISGTT--------------ANEPSPHDGFPLIGASKSV  881
             WL+Y   +G   QEYGS  LP  +  T              + + S   G    G+S   
Sbjct  120   WLDYPSIDGSLQQEYGSDFLPASNSFTLLDKKSNGNMAFRDSQKTSEEQGNVFKGSS---  176

Query  882   VNSGQRNATKLDCSPRFGLLASWSSQQANPLVSG---VSDIGSSNGSIN---------LD  1025
               +GQ    +   S    L      Q     VS     SDI  +N + N         + 
Sbjct  177   --AGQVETARPKASSTSQLFPPSLHQCQTSFVSSRSRASDITENNNTSNANQDASYGKIT  234

Query  1026  SILKDSVPPQAKNQDTETTRTCPP--------TLLNFSNFSRPVVLARANLQNT------  1163
              IL  S    +   + +  +  PP        T++NFS+F+RP  + RANL +       
Sbjct  235   HILSSS----SDFSNAKVQKCDPPMNSNGSSSTIMNFSHFARPAAMVRANLHSVGLKSGL  290

Query  1164  -------LEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPN-----------L  1289
                    +E K    K     + NP ++ L+++     KE  ++ Q             L
Sbjct  291   SSSRSDSMEMK---NKGAAATSSNPPESILVDSSVECLKEPIIQCQQVVEQSKADVNSLL  347

Query  1290  RTKFEQTDASREDTNDADK------------VHGN----------KAVEPgacssvc-sg  1400
                 EQ     + +  A K            V G+          K+ EP   SS   SG
Sbjct  348   PKSVEQNAVPSKQSEPAGKESAAKIDLIPNQVPGDNGTKGQTAAEKSKEPAVASSSVCSG  407

Query  1401  ssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHN  1580
             +  ++ S + + +LKR+ ++ ++S C SED +EESAGAKK A  RGG G KRSRAAEVHN
Sbjct  408   NGTDQGSEEPNQNLKRKRKDTDDSECHSEDVEEESAGAKKTAGGRGGAGSKRSRAAEVHN  467

Query  1581  LSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             LSER+RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  468   LSERKRRDRINEKMRALQELIPNCNKVDKASMLD  501



>ref|XP_006589101.1| PREDICTED: transcription factor PIF3-like [Glycine max]
Length=691

 Score =   191 bits (484),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 179/514 (35%), Positives = 249/514 (48%), Gaps = 107/514 (21%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
             MPL E  ++ + + G ++ TS+ A D    P +DF ELVWENGQI+ QGQSS+ ++S + 
Sbjct  1     MPLYELYRLAREKLG-KETTSTRAPDQCSSPENDFFELVWENGQISSQGQSSRVRRSPSC  59

Query  603   SRM------------REKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAP  746
               +            R+K VG  S +R+GK     S L+E+P SVPS E+D  QD+++ P
Sbjct  60    KSLPSHCLPSHSPKARDKDVGYGSYTRLGKFGDLDSGLNEIPMSVPSSEVDFCQDEDVLP  119

Query  747   WLNYSPSNGQ-SQEYGSQLLPEISGTT--------------ANEPSPHDGFPLIGASKSV  881
             WL+Y   +G   QEYGS  LP  +  T              + + S   G    G+S   
Sbjct  120   WLDYPSIDGSLQQEYGSDFLPASNSFTLLDKKSNGNMAFRDSQKTSEEQGNVFKGSS---  176

Query  882   VNSGQRNATKLDCSPRFGLLASWSSQQANPLVSG---VSDIGSSNGSIN---------LD  1025
               +GQ    +   S    L      Q     VS     SDI  +N + N         + 
Sbjct  177   --AGQVETARPKASSTSQLFPPSLHQCQTSFVSSRSRASDITENNNTSNANQDASYGKIT  234

Query  1026  SILKDSVPPQAKNQDTETTRTCPP--------TLLNFSNFSRPVVLARANLQNT------  1163
              IL  S    +   + +  +  PP        T++NFS+F+RP  + RANL +       
Sbjct  235   HILSSS----SDFSNAKVQKCDPPMNSNGSSSTIMNFSHFARPAAMVRANLHSIGLKSGL  290

Query  1164  -------LEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPN-----------L  1289
                    +E K    K     + NP ++ L+++     KE  ++ Q             L
Sbjct  291   SSSRSDSMEMK---NKGAAATSSNPPESILVDSSVECLKEPIIQCQQVVEQSKADVNSLL  347

Query  1290  RTKFEQTDASREDTNDADK------------VHGN----------KAVEPgacssvc-sg  1400
                 EQ     + +  A K            V G+          K+ EP   SS   SG
Sbjct  348   PKSVEQNAVPSKQSEPAGKESAAKIDLIPNQVPGDNGTKGQTAAEKSKEPAVASSSVCSG  407

Query  1401  ssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHN  1580
             +  ++ S + + +LKR+ ++ ++S C SED +EESAGAKK A  RGG G KRSRAAEVHN
Sbjct  408   NGTDQGSEEPNQNLKRKRKDTDDSECHSEDVEEESAGAKKTAGGRGGAGSKRSRAAEVHN  467

Query  1581  LSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             LSER+RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  468   LSERKRRDRINEKMRALQELIPNCNKVDKASMLD  501



>gb|KDO56397.1| hypothetical protein CISIN_1g006040mg [Citrus sinensis]
Length=603

 Score =   179 bits (454),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 168/415 (40%), Positives = 213/415 (51%), Gaps = 81/415 (20%)
 Frame = +3

Query  675   VLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGF  854
             +L+ +  S PSGEM L+QDD++ PWLNY+      Q+Y S  L E+SG T NE S  + F
Sbjct  1     MLNGIQMSDPSGEMGLNQDDDMVPWLNYAVDESLQQDYCSDFLHELSGVTGNELSSQNNF  60

Query  855   PLIGASKS-----------VVNSGQR----NATKLD-------CSPRFGL--LASWSSQQ  962
                    S             N G R    N +K+          PR     L + SSQQ
Sbjct  61    ASFDKRSSSNQFDREFNSVFGNHGARLEHGNVSKVSSVGGGEATRPRSSTNPLYTSSSQQ  120

Query  963   ANP----LVSGVSDIGSSNGSINL--DSILKDSVPPQAKN--------QDTETTRTCPPT  1100
                    L SGVSD  +SNG  N   + I + S P    N        QD   + T    
Sbjct  121   CQTSLPNLRSGVSD-STSNGIKNSTDNGIFQGSNPTATGNLSGLKLHKQDQRLS-TNNSG  178

Query  1101  LLNFSNFSRPVVLARANLQNTLEAKGKREKEIKE---------NAQNPAKTALIEACSTS  1253
             ++NFS+F+RPV L RANLQN     G R   I+           +++P ++ LI++    
Sbjct  179   VMNFSHFARPVALVRANLQNIGSMPGARLSRIERMGSKDKSSVASRSPVESPLIDSSGCL  238

Query  1254  RKES-----------DLKSQPNLRTKFEQTD----ASREDTNDADK--------------  1346
             RKES           D+K Q    ++   ++    A RED  + DK              
Sbjct  239   RKESSCQPAAVTSKVDVKPQEAKSSEQPVSEPPEAACREDALNNDKKPSQVHAESATKGV  298

Query  1347  VHGNKAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPSE--DADEESagak  1517
             V   K VEP   +S   SG+S ERAS+D  H++KR+  + ++S CPSE  D +EES G K
Sbjct  299   VESEKTVEPVVAASSVCSGNSVERASDDLPHNVKRKHCDLDDSECPSEEQDVEEESVGVK  358

Query  1518  kaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             K  P R GTG KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  359   KQVPGRVGTGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  413



>gb|KDO56396.1| hypothetical protein CISIN_1g006040mg [Citrus sinensis]
Length=652

 Score =   179 bits (453),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 168/415 (40%), Positives = 213/415 (51%), Gaps = 81/415 (20%)
 Frame = +3

Query  675   VLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGF  854
             +L+ +  S PSGEM L+QDD++ PWLNY+      Q+Y S  L E+SG T NE S  + F
Sbjct  1     MLNGIQMSDPSGEMGLNQDDDMVPWLNYAVDESLQQDYCSDFLHELSGVTGNELSSQNNF  60

Query  855   PLIGASKS-----------VVNSGQR----NATKLD-------CSPRFGL--LASWSSQQ  962
                    S             N G R    N +K+          PR     L + SSQQ
Sbjct  61    ASFDKRSSSNQFDREFNSVFGNHGARLEHGNVSKVSSVGGGEATRPRSSTNPLYTSSSQQ  120

Query  963   ANP----LVSGVSDIGSSNGSINL--DSILKDSVPPQAKN--------QDTETTRTCPPT  1100
                    L SGVSD  +SNG  N   + I + S P    N        QD   + T    
Sbjct  121   CQTSLPNLRSGVSD-STSNGIKNSTDNGIFQGSNPTATGNLSGLKLHKQDQRLS-TNNSG  178

Query  1101  LLNFSNFSRPVVLARANLQNTLEAKGKREKEIKE---------NAQNPAKTALIEACSTS  1253
             ++NFS+F+RPV L RANLQN     G R   I+           +++P ++ LI++    
Sbjct  179   VMNFSHFARPVALVRANLQNIGSMPGARLSRIERMGSKDKSSVASRSPVESPLIDSSGCL  238

Query  1254  RKES-----------DLKSQPNLRTKFEQTD----ASREDTNDADK--------------  1346
             RKES           D+K Q    ++   ++    A RED  + DK              
Sbjct  239   RKESSCQPAAVTSKVDVKPQEAKSSEQPVSEPPEAACREDALNNDKKPSQVHAESATKGV  298

Query  1347  VHGNKAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPSE--DADEESagak  1517
             V   K VEP   +S   SG+S ERAS+D  H++KR+  + ++S CPSE  D +EES G K
Sbjct  299   VESEKTVEPVVAASSVCSGNSVERASDDLPHNVKRKHCDLDDSECPSEEQDVEEESVGVK  358

Query  1518  kaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             K  P R GTG KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  359   KQVPGRVGTGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  413



>gb|KDO56394.1| hypothetical protein CISIN_1g006040mg [Citrus sinensis]
 gb|KDO56395.1| hypothetical protein CISIN_1g006040mg [Citrus sinensis]
Length=643

 Score =   178 bits (452),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 168/415 (40%), Positives = 213/415 (51%), Gaps = 81/415 (20%)
 Frame = +3

Query  675   VLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGF  854
             +L+ +  S PSGEM L+QDD++ PWLNY+      Q+Y S  L E+SG T NE S  + F
Sbjct  1     MLNGIQMSDPSGEMGLNQDDDMVPWLNYAVDESLQQDYCSDFLHELSGVTGNELSSQNNF  60

Query  855   PLIGASKS-----------VVNSGQR----NATKLD-------CSPRFGL--LASWSSQQ  962
                    S             N G R    N +K+          PR     L + SSQQ
Sbjct  61    ASFDKRSSSNQFDREFNSVFGNHGARLEHGNVSKVSSVGGGEATRPRSSTNPLYTSSSQQ  120

Query  963   ANP----LVSGVSDIGSSNGSINL--DSILKDSVPPQAKN--------QDTETTRTCPPT  1100
                    L SGVSD  +SNG  N   + I + S P    N        QD   + T    
Sbjct  121   CQTSLPNLRSGVSD-STSNGIKNSTDNGIFQGSNPTATGNLSGLKLHKQDQRLS-TNNSG  178

Query  1101  LLNFSNFSRPVVLARANLQNTLEAKGKREKEIKE---------NAQNPAKTALIEACSTS  1253
             ++NFS+F+RPV L RANLQN     G R   I+           +++P ++ LI++    
Sbjct  179   VMNFSHFARPVALVRANLQNIGSMPGARLSRIERMGSKDKSSVASRSPVESPLIDSSGCL  238

Query  1254  RKES-----------DLKSQPNLRTKFEQTD----ASREDTNDADK--------------  1346
             RKES           D+K Q    ++   ++    A RED  + DK              
Sbjct  239   RKESSCQPAAVTSKVDVKPQEAKSSEQPVSEPPEAACREDALNNDKKPSQVHAESATKGV  298

Query  1347  VHGNKAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPSE--DADEESagak  1517
             V   K VEP   +S   SG+S ERAS+D  H++KR+  + ++S CPSE  D +EES G K
Sbjct  299   VESEKTVEPVVAASSVCSGNSVERASDDLPHNVKRKHCDLDDSECPSEEQDVEEESVGVK  358

Query  1518  kaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             K  P R GTG KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  359   KQVPGRVGTGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  413



>gb|KDO56393.1| hypothetical protein CISIN_1g006040mg [Citrus sinensis]
Length=663

 Score =   178 bits (452),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 168/415 (40%), Positives = 213/415 (51%), Gaps = 81/415 (20%)
 Frame = +3

Query  675   VLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGF  854
             +L+ +  S PSGEM L+QDD++ PWLNY+      Q+Y S  L E+SG T NE S  + F
Sbjct  1     MLNGIQMSDPSGEMGLNQDDDMVPWLNYAVDESLQQDYCSDFLHELSGVTGNELSSQNNF  60

Query  855   PLIGASKS-----------VVNSGQR----NATKLD-------CSPRFGL--LASWSSQQ  962
                    S             N G R    N +K+          PR     L + SSQQ
Sbjct  61    ASFDKRSSSNQFDREFNSVFGNHGARLEHGNVSKVSSVGGGEATRPRSSTNPLYTSSSQQ  120

Query  963   ANP----LVSGVSDIGSSNGSINL--DSILKDSVPPQAKN--------QDTETTRTCPPT  1100
                    L SGVSD  +SNG  N   + I + S P    N        QD   + T    
Sbjct  121   CQTSLPNLRSGVSD-STSNGIKNSTDNGIFQGSNPTATGNLSGLKLHKQDQRLS-TNNSG  178

Query  1101  LLNFSNFSRPVVLARANLQNTLEAKGKREKEIKE---------NAQNPAKTALIEACSTS  1253
             ++NFS+F+RPV L RANLQN     G R   I+           +++P ++ LI++    
Sbjct  179   VMNFSHFARPVALVRANLQNIGSMPGARLSRIERMGSKDKSSVASRSPVESPLIDSSGCL  238

Query  1254  RKES-----------DLKSQPNLRTKFEQTD----ASREDTNDADK--------------  1346
             RKES           D+K Q    ++   ++    A RED  + DK              
Sbjct  239   RKESSCQPAAVTSKVDVKPQEAKSSEQPVSEPPEAACREDALNNDKKPSQVHAESATKGV  298

Query  1347  VHGNKAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPSE--DADEESagak  1517
             V   K VEP   +S   SG+S ERAS+D  H++KR+  + ++S CPSE  D +EES G K
Sbjct  299   VESEKTVEPVVAASSVCSGNSVERASDDLPHNVKRKHCDLDDSECPSEEQDVEEESVGVK  358

Query  1518  kaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             K  P R GTG KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  359   KQVPGRVGTGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  413



>ref|XP_008807920.1| PREDICTED: transcription factor PIF3-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807921.1| PREDICTED: transcription factor PIF3-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807922.1| PREDICTED: transcription factor PIF3-like isoform X1 [Phoenix 
dactylifera]
Length=678

 Score =   177 bits (450),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 168/496 (34%), Positives = 240/496 (48%), Gaps = 86/496 (17%)
 Frame = +3

Query  423   MPLSEFLKML---KNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK-  590
             MPLS++ +     K E+ + +  + SAD L  +P  +F+EL+WENGQI MQ  SS+ KK 
Sbjct  1     MPLSQYHQYATKDKPEATQSRANNCSAD-LFTMPDHEFAELLWENGQIVMQSHSSRPKKS  59

Query  591   ------SDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDL-SQDDEIAPW  749
                   S   + +REK   +A + R  + D    ++++  PS PS ++ + +QDD++ PW
Sbjct  60    SLPTTFSSQAAGVREKDGRDAGNPRASQFDAMEPMVNDFSPSGPSADIGIDAQDDDMVPW  119

Query  750   LNYS-----PSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQ--RNAT  908
             +++      P +    +Y S+ L E  G   N PS ++       S  +   GQ  RN+ 
Sbjct  120   ISFPIEESLPKDALQNDYCSEFLNEFPGANLNSPSAYNKRTAADGSSGL---GQDIRNSH  176

Query  909   KLDCSPRFGLLASWS------SQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQD  1070
               +        A  S      + Q             S+ S   D+ + DS     +NQ+
Sbjct  177   SAEHEHALKAFAESSEPSRVRTSQLFQFSQHCQSSAPSSKSRATDTGIGDSTRTHLQNQN  236

Query  1071  TETTRTCPPTL----LNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIE  1238
               + +  PP L    LNFS+FSRP +LA+ANL   ++ K   EK       N  ++ LIE
Sbjct  237   PSSAK--PPQLNGGMLNFSHFSRPAMLAKANLHG-VDGKRTNEKASAPLNINTVESTLIE  293

Query  1239  ACSTSRKESDLKSQ-----PNLRTK-----------------FEQTDASREDTNDADKVH  1352
             +       + ++ Q     P +  +                   Q DASR+  ND++ +H
Sbjct  294   SACVFESATGVQGQSVSVPPGMELRSPVKLPQEVIPVEHSEAICQQDASRK--NDSNILH  351

Query  1353  GN-------------------------KAVEPgacssvcsgssaE-RASNDQSHSLKRRA  1454
              N                         KA E    SS    +++   ASND     KR++
Sbjct  352   NNCSKPADQPASSSVAASAALRRHKTEKAPEVAVASSSVCSANSAGAASNDPKQGDKRKS  411

Query  1455  RENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQ  1634
             RE EESG  SED ++ S   +K A  RG    KRSRAAEVHNLSERRRRDRINEKMRALQ
Sbjct  412   REGEESGYQSEDFEDVSVDLRKPATGRGMGA-KRSRAAEVHNLSERRRRDRINEKMRALQ  470

Query  1635  ELIPNCNKADKASMLD  1682
             ELIPNCNKADKASML+
Sbjct  471   ELIPNCNKADKASMLE  486



>ref|XP_008807923.1| PREDICTED: transcription factor PIF3-like isoform X2 [Phoenix 
dactylifera]
Length=672

 Score =   177 bits (450),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 168/496 (34%), Positives = 240/496 (48%), Gaps = 86/496 (17%)
 Frame = +3

Query  423   MPLSEFLKML---KNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK-  590
             MPLS++ +     K E+ + +  + SAD L  +P  +F+EL+WENGQI MQ  SS+ KK 
Sbjct  1     MPLSQYHQYATKDKPEATQSRANNCSAD-LFTMPDHEFAELLWENGQIVMQSHSSRPKKS  59

Query  591   ------SDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDL-SQDDEIAPW  749
                   S   + +REK   +A + R  + D    ++++  PS PS ++ + +QDD++ PW
Sbjct  60    SLPTTFSSQAAGVREKDGRDAGNPRASQFDAMEPMVNDFSPSGPSADIGIDAQDDDMVPW  119

Query  750   LNYS-----PSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQ--RNAT  908
             +++      P +    +Y S+ L E  G   N PS ++       S  +   GQ  RN+ 
Sbjct  120   ISFPIEESLPKDALQNDYCSEFLNEFPGANLNSPSAYNKRTAADGSSGL---GQDIRNSH  176

Query  909   KLDCSPRFGLLASWS------SQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQD  1070
               +        A  S      + Q             S+ S   D+ + DS     +NQ+
Sbjct  177   SAEHEHALKAFAESSEPSRVRTSQLFQFSQHCQSSAPSSKSRATDTGIGDSTRTHLQNQN  236

Query  1071  TETTRTCPPTL----LNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIE  1238
               + +  PP L    LNFS+FSRP +LA+ANL   ++ K   EK       N  ++ LIE
Sbjct  237   PSSAK--PPQLNGGMLNFSHFSRPAMLAKANLHG-VDGKRTNEKASAPLNINTVESTLIE  293

Query  1239  ACSTSRKESDLKSQ-----PNLRTK-----------------FEQTDASREDTNDADKVH  1352
             +       + ++ Q     P +  +                   Q DASR+  ND++ +H
Sbjct  294   SACVFESATGVQGQSVSVPPGMELRSPVKLPQEVIPVEHSEAICQQDASRK--NDSNILH  351

Query  1353  GN-------------------------KAVEPgacssvcsgssaE-RASNDQSHSLKRRA  1454
              N                         KA E    SS    +++   ASND     KR++
Sbjct  352   NNCSKPADQPASSSVAASAALRRHKTEKAPEVAVASSSVCSANSAGAASNDPKQGDKRKS  411

Query  1455  RENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQ  1634
             RE EESG  SED ++ S   +K A  RG    KRSRAAEVHNLSERRRRDRINEKMRALQ
Sbjct  412   REGEESGYQSEDFEDVSVDLRKPATGRGMGA-KRSRAAEVHNLSERRRRDRINEKMRALQ  470

Query  1635  ELIPNCNKADKASMLD  1682
             ELIPNCNKADKASML+
Sbjct  471   ELIPNCNKADKASMLE  486



>ref|XP_010941465.1| PREDICTED: transcription factor PIF3-like isoform X1 [Elaeis 
guineensis]
Length=666

 Score =   177 bits (449),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 163/489 (33%), Positives = 240/489 (49%), Gaps = 80/489 (16%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPT--SSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK--  590
             MPLSEF + +  +  E  P+  ++ + DL  +P  DF+EL+WENGQ+ MQG SS+ KK  
Sbjct  1     MPLSEFHRPMTKDKPEATPSRVNNCSSDLFSMPDPDFAELLWENGQVVMQGHSSRPKKSS  60

Query  591   -----SDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDL-SQDDEIAPWL  752
                  S + S + EK   +    +  +      ++++  PS PS ++ + +QDD++ PW+
Sbjct  61    FPTSFSSHASGVEEKDHRDVDVPKTSRYYAMDPMINDFSPSRPSADVGVNAQDDDMVPWI  120

Query  753   NYS-----PSNGQSQEYGSQLLPEISGTTAN------EPSPHDGFPLIG--ASKSVVNSG  893
             NY      P +    +Y  + L E  G   N      +P P D    +G  A K++  S 
Sbjct  121   NYPTEEPLPDDTLQNDYCLEFLNEFMGANLNAHSASSKPMPADRSSGLGQHAPKALTESK  180

Query  894   QRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDT  1073
                 +++  S  F +L    S   +    G+ D G  +G+    ++L+   P   K    
Sbjct  181   SSEPSRVRTSQLFQMLQHSQSSAPSSKSGGM-DKGIGDGA---RTLLQSKNPAGPKPLQL  236

Query  1074  ETTRTCPPTLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTS  1253
               +      +LNFS+FSRP +LA+ANL      +   +     N+ NP ++ L+E+ S  
Sbjct  237   NGS-----GMLNFSHFSRPAMLAKANLHGVDRPRSNEKLSAPSNS-NPVESTLMESTSCF  290

Query  1254  RKESDLKS-----------QPNLRTKFE-----------QTDASRED-----TNDADKVH  1352
             +  + ++            Q + +T  E           Q DASR++     TN+  ++ 
Sbjct  291   QGAAGVRGRSTSGPHKMELQSSAKTPQEVISAEHSQAICQQDASRKNIPNILTNNCSRLP  350

Query  1353  GNKAVEPgacssvcsgssaER-------------------ASNDQSHSLKRRARENEESG  1475
                A      S        E+                   ASND     KR++RE EESG
Sbjct  351   DQLASSSIMASVALRRQETEKAPEAVVASSSVCSANGAGAASNDPKQQEKRKSREGEESG  410

Query  1476  CPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN  1655
               S+D ++ S G KK AP RG +  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN
Sbjct  411   YQSDDFEDVSVGLKKPAPGRGTST-KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN  469

Query  1656  KADKASMLD  1682
             KADKASML+
Sbjct  470   KADKASMLE  478



>ref|XP_010941466.1| PREDICTED: transcription factor PIF3-like isoform X2 [Elaeis 
guineensis]
Length=660

 Score =   177 bits (448),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 163/489 (33%), Positives = 240/489 (49%), Gaps = 80/489 (16%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPT--SSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK--  590
             MPLSEF + +  +  E  P+  ++ + DL  +P  DF+EL+WENGQ+ MQG SS+ KK  
Sbjct  1     MPLSEFHRPMTKDKPEATPSRVNNCSSDLFSMPDPDFAELLWENGQVVMQGHSSRPKKSS  60

Query  591   -----SDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDL-SQDDEIAPWL  752
                  S + S + EK   +    +  +      ++++  PS PS ++ + +QDD++ PW+
Sbjct  61    FPTSFSSHASGVEEKDHRDVDVPKTSRYYAMDPMINDFSPSRPSADVGVNAQDDDMVPWI  120

Query  753   NYS-----PSNGQSQEYGSQLLPEISGTTAN------EPSPHDGFPLIG--ASKSVVNSG  893
             NY      P +    +Y  + L E  G   N      +P P D    +G  A K++  S 
Sbjct  121   NYPTEEPLPDDTLQNDYCLEFLNEFMGANLNAHSASSKPMPADRSSGLGQHAPKALTESK  180

Query  894   QRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDT  1073
                 +++  S  F +L    S   +    G+ D G  +G+    ++L+   P   K    
Sbjct  181   SSEPSRVRTSQLFQMLQHSQSSAPSSKSGGM-DKGIGDGA---RTLLQSKNPAGPKPLQL  236

Query  1074  ETTRTCPPTLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTS  1253
               +      +LNFS+FSRP +LA+ANL      +   +     N+ NP ++ L+E+ S  
Sbjct  237   NGS-----GMLNFSHFSRPAMLAKANLHGVDRPRSNEKLSAPSNS-NPVESTLMESTSCF  290

Query  1254  RKESDLKS-----------QPNLRTKFE-----------QTDASRED-----TNDADKVH  1352
             +  + ++            Q + +T  E           Q DASR++     TN+  ++ 
Sbjct  291   QGAAGVRGRSTSGPHKMELQSSAKTPQEVISAEHSQAICQQDASRKNIPNILTNNCSRLP  350

Query  1353  GNKAVEPgacssvcsgssaER-------------------ASNDQSHSLKRRARENEESG  1475
                A      S        E+                   ASND     KR++RE EESG
Sbjct  351   DQLASSSIMASVALRRQETEKAPEAVVASSSVCSANGAGAASNDPKQQEKRKSREGEESG  410

Query  1476  CPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN  1655
               S+D ++ S G KK AP RG +  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN
Sbjct  411   YQSDDFEDVSVGLKKPAPGRGTST-KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN  469

Query  1656  KADKASMLD  1682
             KADKASML+
Sbjct  470   KADKASMLE  478



>ref|XP_010909460.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor PIF3-like 
[Elaeis guineensis]
Length=702

 Score =   172 bits (436),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 157/437 (36%), Positives = 221/437 (51%), Gaps = 49/437 (11%)
 Frame = +3

Query  513   PGSDFSELVWENGQITMQGQSSKAKKS---DNLSRMREKCVGNASSSRIGKLDLAGSVLD  683
             P S+F EL+WENGQI M GQS++ +KS      SR +EK   +A  S+ G+++    +++
Sbjct  7     PDSEFVELLWENGQIVMHGQSNRPRKSFFSTTFSRAQEKDSRDAVISKTGQIEAMDPLVN  66

Query  684   EMPPSVPSGEMDL-SQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPH-----  845
             +  P+  SG   L +QDD+  PW+NYS  +    +Y    + E  G + N  S H     
Sbjct  67    DFSPTEASGNAGLNAQDDDTVPWINYSIEDSLQNDYCQDYMLEFPGASLNSVSTHTETVL  126

Query  846   ----DGFPLIGA--SKSVVN-------SGQRNATKLDCSPRFGLLASW--SSQQANPLVS  980
                  GF    A  S++V +       +G  + +++ CS  F L      S+       +
Sbjct  127   ADRSHGFTQTSAKSSRNVEHGRTCEQLAGGSDPSRIKCSQLFQLSPERRSSAPSMKSRAT  186

Query  981   GVSDIGSSNGSINLDSILKDS-VPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQ  1157
              +S   +S+    L   L  S +  Q     T +  +    L NFS+FS P  LA+ANL 
Sbjct  187   ELSTRATSSTHHGLAGYLLSSRLEKQGLASSTLSQSSGSIGLTNFSHFSGPAALAKANLL  246

Query  1158  NTLEAKGKREKEIKENAQNP--AKTALIEACSTSRKESDLKSQPNLRTKFEQTDASREDT  1331
              +L+     EK     + NP  + +  +     +     ++ +   + + E+    + D 
Sbjct  247   -SLDRLRNNEKASTTTSSNPMESTSGFLATPGLASAAPKVERRSTTKPQQERVSVEKPDA  305

Query  1332  NDADKVHGNKAVEP--------------------gacssvcsgssaERASNDQSHSLKRR  1451
             +    VH N ++ P                     A SSVCSG+ A  ASND  H  KR+
Sbjct  306   DHDGNVHNNNSIVPDCVKRQLSGRNETEKGPEAAVASSSVCSGNGAGAASNDPKHRAKRK  365

Query  1452  ARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRAL  1631
               E EESG  SED ++ES G KK+A  RG +  KRSRAAEVHNLSERRRRDRINEKMRAL
Sbjct  366   NYEGEESGNQSEDHEDESMGLKKSATVRGTST-KRSRAAEVHNLSERRRRDRINEKMRAL  424

Query  1632  QELIPNCNKADKASMLD  1682
             QELIPNCNK DKASMLD
Sbjct  425   QELIPNCNKVDKASMLD  441



>gb|KHN14203.1| Transcription factor PIF3 [Glycine soja]
Length=600

 Score =   169 bits (427),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 165/459 (36%), Positives = 237/459 (52%), Gaps = 73/459 (16%)
 Frame = +3

Query  423   MPLSEFLKMLK---NESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS  593
             MPL E  ++ K   ++  E    ++ A D S +P +D  EL+WE GQI++QGQSS+A+ S
Sbjct  1     MPLHELYRVAKGKLDDPIEMNNNTTCAVDQSSVPNNDLFELIWEKGQISVQGQSSRARVS  60

Query  594   DNLSRMREKC-VGNA-----SSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDE--IAPW  749
              N   +     +G A     +++R+GK    G+ L+E+   VPSGE+DLS+++E  + PW
Sbjct  61    PNCKTLPSHTPIGYANNAITTNTRMGKCGNLGAELNEIRRLVPSGEVDLSEEEEDMVMPW  120

Query  750   LNYSPSNGQSQE-YGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSP  926
              +Y   +   Q  Y +    E SG   NE S  + F L+          +RN    +CS 
Sbjct  121   FSYGRDDDSLQHGYSTDFFHEPSGVM-NELSASNNFSLLD---------RRN----NCSK  166

Query  927   RFGLLASWSSQQANPLVSG---VSDIGSSN------GSINLDSI-LKDSVPPQAKNQDTE  1076
              F       + + +P  S    V+DI  +N      GS    S+ ++   P    N  + 
Sbjct  167   IF-----RDTHKHSPFASVRSRVADIAENNANNVPSGSSCFSSLKMEKQGPVMCSNNSS-  220

Query  1077  TTRTCPPTLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKEN-------AQNPAKTALI  1235
                    T++NFS+F++P  +    L +   + G + K   E+        + P K A+ 
Sbjct  221   -------TMMNFSHFAKPAAIENIGLASRSGSVGIKIKSADESTKVELSRGERPKKPAI-  272

Query  1236  EACSTSRKESDL----KSQP--NLRTKFEQTDASREDTNDA-DKVH--GNKAVEPgacss  1388
                    ++ D+    K  P  N  +K +Q   S     ++ +K H    K VEP   SS
Sbjct  273   -----HNQDQDVTVSTKGDPSCNEVSKVDQNQTSNIVVGESGNKGHEAVEKGVEPAVVSS  327

Query  1389  vc-sgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRA  1565
                SG+ AER S D + +LKR++ + E+S   SED +EES G KK   ARG     R R+
Sbjct  328   SVCSGNGAERGSEDPNQNLKRKSIDTEDSESQSEDVEEESVGVKKEVHARGFGA-TRGRS  386

Query  1566  AEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             AEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD
Sbjct  387   AEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  425



>ref|XP_010659766.1| PREDICTED: transcription factor PIF3-like isoform X3 [Vitis vinifera]
Length=626

 Score =   169 bits (428),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 166/468 (35%), Positives = 230/468 (49%), Gaps = 97/468 (21%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
             MP SE  +M K   G+ +      +DLS  P +DF ELVWE GQI MQ         D L
Sbjct  1     MPFSELYRMAK---GKPESVQQKTNDLSFGPENDFVELVWEGGQIMMQ---------DFL  48

Query  603   SRMREKCVGNASSSRIGKLDLAGSVLDEMPP--SVPSGEMDLSQDDEIAPWLNYSPSNGQ  776
                                +L+G  ++E+    +  SGE   S +  I      S  NG 
Sbjct  49    Q------------------ELSGVTVNELSTHCNFASGEKRNSNNQTIKDSNTISAHNGV  90

Query  777   SQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPRFGLLASWSS  956
             S E G+      +G   + P     +P          S Q+  T         L  S  S
Sbjct  91    SLEQGNASKASAAGVEPSRPRSSQLYP---------PSSQQCQT---------LFPSMRS  132

Query  957   QQANPLVSGVSDIGS---SNGSINLDSILKDSVPPQAKNQDTETTRTCPPTLLNFSNFSR  1127
             + ++P+ +  S+      S  SI L +        + + QD   TR     L+NFS+FSR
Sbjct  133   KVSDPISNNTSNAMHHTVSGNSIRLPASTSGFSSTKTQKQDPGQTRNNS-GLMNFSHFSR  191

Query  1128  PVVLARANLQN----------TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKS  1277
             P  L +ANLQN          + +  G ++K+   +++NPA++  +++    +K+ D  S
Sbjct  192   PAALVKANLQNIGAIAGPSSSSKDRIGSKDKQPAASSRNPAESRHVDSSCGLQKDVDSHS  251

Query  1278  QP-------NLRTKFEQT---------------DASREDTNDADKV----------HGNK  1361
             +P       +L+    +T               + + ++   +++V           G K
Sbjct  252   EPVMVPASVDLKPVVAKTMEEPLPAEQSPVICQEGACKNEKSSNQVLGARTAKGIPDGEK  311

Query  1362  AVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparg  1538
              +EP    S   SG+S ERASND  H+LKR+ R+ EES CPSED +EES G +K+APA+G
Sbjct  312   TIEPAVACSSVCSGNSVERASNDPKHNLKRKCRDTEESECPSEDVEEESVGVRKSAPAKG  371

Query  1539  gtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             GTG KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  372   GTGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  419



>ref|XP_010553700.1| PREDICTED: transcription factor PIF3-like [Tarenaya hassleriana]
Length=590

 Score =   166 bits (420),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 163/457 (36%), Positives = 223/457 (49%), Gaps = 62/457 (14%)
 Frame = +3

Query  423   MPLSEFLKML--KNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSD  596
             MPL E L +   K ES + K +S   DDL         ELVWENGQI MQ QSSK++ S 
Sbjct  1     MPLFELLGLTEAKLESSQEKKSSVHEDDLV--------ELVWENGQIAMQSQSSKSRNSQ  52

Query  597   ------------NLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEI  740
                         N SR +E  +GN S +RI       S L+E+P SVP     LSQDD++
Sbjct  53    ACTNSIPRAVQSNTSRAKE--IGNGSDARIV------SPLNEIPISVPLLGPGLSQDDDL  104

Query  741   APWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDC  920
              PWLN          Y S   P++S  T  EP        +  ++S+ NS  ++ +  D 
Sbjct  105   VPWLNQPLDESLQTGYCSDFFPDVSEVTVIEPEDD-----VTRNQSLANS--QSVSVHDE  157

Query  921   SPRFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPT  1100
             S R+G   S SS   + L    S +   + + N+ ++ ++S     K      +      
Sbjct  158   STRYGRGTSQSSSSRSNLFQEPSPLYQIDRARNVQTVCEESCCLSQKQLPELPSNKL--G  215

Query  1101  LLNFSNFSRPVVLARANLQN----TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESD  1268
             L+NFS++SRP +LA+ANL      T    G        + ++  +T L+E+ +  R E  
Sbjct  216   LVNFSHYSRPAMLAKANLHGSGVVTTREMGSTSSAAATSGRDHVETRLLESGNKLRGEKS  275

Query  1269  LKSQP-------NLRT-----KFEQTDASREDTNDADKVHGNKA-------VEPgacssv  1391
               S         NL       KF  + +S +       + GN         +   + S  
Sbjct  276   FHSAKVPGDGVLNLSVASDPAKFVASGSSSKGNEKVCHILGNSCGRDQPSEMAEESYSLR  335

Query  1392  csgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAE  1571
                +S E   +  S SL R+  +  +     +D +EES  A+KAAP R G+G KRSR+AE
Sbjct  336   SGNNSLEEHYDGPSRSLNRQQLDARDMTIREQDIEEESIDARKAAPLRAGSGFKRSRSAE  395

Query  1572  VHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             VHNLSERRRRDRINEKMR LQELIPNCNK DKASMLD
Sbjct  396   VHNLSERRRRDRINEKMRVLQELIPNCNKVDKASMLD  432



>ref|XP_007145054.1| hypothetical protein PHAVU_007G206000g [Phaseolus vulgaris]
 gb|ESW17048.1| hypothetical protein PHAVU_007G206000g [Phaseolus vulgaris]
Length=724

 Score =   166 bits (421),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 179/516 (35%), Positives = 254/516 (49%), Gaps = 113/516 (22%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
             MPL E  ++ + + G     + ++D  S  P +DF ELVWENGQI+ QGQSS+ ++S + 
Sbjct  1     MPLYELYRLAREKLGTENNGTRASDQCSS-PENDFFELVWENGQISSQGQSSRVRRSPSC  59

Query  603   SRMREKCVGNAS-----------SSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPW  749
               +   C+ + S           +S++GK     S L E+  SVPS E+D  QD+++ PW
Sbjct  60    RSLPSHCLPSHSPKGRDKDVGCGASKMGKFRDLDSGLSEISMSVPSREIDFCQDEDVLPW  119

Query  750   LNYSPSNGQSQ-EYGSQLLPEISGTTANEPSPHDGFPLIGASKS---------------V  881
              +Y+  +G  Q +YGS  L   +  T  +   H    L  + K+               V
Sbjct  120   FDYAAMDGSLQHDYGSDFLATSTSFTLLDKKSHTNVALRDSHKTSEEHENAFKGSSAEQV  179

Query  882   VNSGQRNATKLDCSPRFGLL-ASWSSQQANPLVSGVSDIGSSN-----------GSI-NL  1022
              ++G +++T     P       S+ S +     S  SDI  +N           G I N 
Sbjct  180   ESTGPKSSTSQLYPPSLHHCQTSFVSSR-----SRASDITENNNTSNANQDATYGEITNF  234

Query  1023  DSILKDSVPPQAKNQDTETTRTCPP--------TLLNFSNFSRPVVLARANLQNT-----  1163
              S   D   P+ K Q+       PP        T++NFS+F+RP  + RANLQN      
Sbjct  235   LSSSSDFSSPKGKKQE-------PPLPGNGSSSTIMNFSHFARPAAMVRANLQNIGLKSG  287

Query  1164  LEAKGKREKEIKEN-----AQNPAKTALIEA---CST------------SRKESDLKSQP  1283
             L +      EIK N     + NP ++ +I++   CS             SR  +DL +  
Sbjct  288   LSSARPDSMEIKNNGAAATSSNPPESIVIDSSGECSKELTMHCQQVVDQSRSRTDLNT--  345

Query  1284  NLRTKFEQ------------TDASREDTNDADKVHGN----------KAVEPgacssvc-  1394
             +L    EQ             ++S +    AD+V G+          K++E    SS   
Sbjct  346   SLSKAVEQNAVLSKQSEPACNESSTKIDQIADQVLGDSGAKGQTTTEKSMEAAVASSSVC  405

Query  1395  sgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEV  1574
             SG+ A+R S++ + +LKR+ +        + DA+EESAG KKAA  RGG G KR+RAAEV
Sbjct  406   SGNGADRGSDEPNQNLKRKKK--TPMNLSAIDAEEESAGVKKAAGGRGGAGSKRTRAAEV  463

Query  1575  HNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             HNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  464   HNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  499



>ref|XP_006840391.1| hypothetical protein AMTR_s00045p00141060 [Amborella trichopoda]
 gb|ERN02066.1| hypothetical protein AMTR_s00045p00141060 [Amborella trichopoda]
Length=781

 Score =   166 bits (419),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 164/471 (35%), Positives = 217/471 (46%), Gaps = 98/471 (21%)
 Frame = +3

Query  513   PGSDFSELVWENGQITMQGQSSKAKK---SDNLSRMREKCVGNASS--------SRIGKL  659
             P  +F EL+WENGQI +QGQ+S+ +K   S   S    K   N +S        S+ G+ 
Sbjct  110   PDHEFVELLWENGQIVLQGQTSRNRKDASSSGYSSHPPKTHLNHNSGDAVLPVASKGGRY  169

Query  660   DLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPS  839
                 SVL +      SG   L Q+DE+ PWLNY   +   ++Y S+  PE+SG       
Sbjct  170   GTLESVLHDFSSGQASG-CPLVQEDEMVPWLNYPLDDSLERDYCSEFFPELSGVNLT---  225

Query  840   PHDGFPLIGASKSVVNSGQRNATKLDCSP--------------RFGLLASWSSQQ---AN  968
                  PL   +  VV+     A  LD +               R   L  ++SQQ   +N
Sbjct  226   -----PLSKPTNVVVS---EKACNLDTTSHKNLSMEHSSQAPSRLRALQPFNSQQGQPSN  277

Query  969   PLV-----------SGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPTLLNFS  1115
             P++            G S    +N +I + +  K   P     +  + T T    L+NFS
Sbjct  278   PILRQFPSNTHKSSCGNSSSPGANPAIGIVNS-KTEQPNHGSTRPPQPTHT---NLMNFS  333

Query  1116  NFSRPVVLARANLQNTLEAKGKREKEIKENA--QNPAKTALIEACSTSR-----------  1256
             +FSRP  L +ANLQ+   A   +    K +    NP +++++++   S+           
Sbjct  334   HFSRPAALVKANLQSMGMAGRLKNNNDKASVTDSNPVESSIVDSAVVSKSGKTKLDQQCQ  393

Query  1257  ------KESDLKSQPNLRTK------FEQTDASREDTNDADKV----------------H  1352
                   K  D+ S P    +          DAS       D+                  
Sbjct  394   ASLHPTKAKDISSSPAREKQSVEEDVMYVEDASTSQNRSPDRTLCPSSSFAASTALGISE  453

Query  1353  GNKAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaap  1529
               KAVEP   SS   SG+S  R S +  H LKR+  E EESG  SED + ES G +K A 
Sbjct  454   SVKAVEPVVASSSVCSGNSGGRVSKEPRHGLKRKVGEQEESGYQSEDVEGESVGTRKQAT  513

Query  1530  arggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
              R  T  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  514   GRSATT-KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  563



>ref|XP_010674470.1| PREDICTED: transcription factor PIF3-like [Beta vulgaris subsp. 
vulgaris]
Length=675

 Score =   164 bits (415),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 163/469 (35%), Positives = 214/469 (46%), Gaps = 81/469 (17%)
 Frame = +3

Query  486   SSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNLSRMREKC-----VGNASSSRI  650
             S++ D S  P +D  ELVWENGQ+ MQG++ K+  S+N   +  K      VGN S  R+
Sbjct  14    SNSIDPSSRPNTDCVELVWENGQLMMQGKTRKSSNSNNFQTVGPKLQDGRNVGNFS--RM  71

Query  651   GKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTAN  830
              K     S++ + P SVPS EM L QD ++ PWLNY        +Y S  L E+SG T N
Sbjct  72    TKFGTMDSLMADYPLSVPSCEMGLDQDVDLVPWLNYPMEEHLHNDYTSDFLHELSGVTIN  131

Query  831   EPSPHDGFPLIGASKSVVNSGQRNATKLDCS--------------------PRFGLLASW  950
             + S  +  P      +    G   +  L                       P+F     +
Sbjct  132   DLSTENHLPYRERKSTFHGDGHDTSVSLKHGHTSKASSSFEKDNRGGSSEVPQF----MF  187

Query  951   SSQQANPLVSGVSDI-GSSNG---------SINLDSILKDSVPPQAKNQDTETTRTCPPT  1100
               QQ+ P  SG+SDI G+S G         S N  S L      + +  D     T    
Sbjct  188   PFQQSIPR-SGISDIIGNSAGNAHHVASRDSANNPSSLSAFTSLRLQKLDAGQPSTSS-G  245

Query  1101  LLNFSNFSRPVVLARANLQNTLEAKGKRE---KEIKENAQNPAKTALIEACS--------  1247
               NF  FSRP  L+RAN Q T+    + E   K    N+ NPA + L+   S        
Sbjct  246   FTNFPYFSRPTGLSRAN-QVTVNPSKRLENIDKRCTLNSSNPANSTLVNMDSGYSQKDIV  304

Query  1248  ---------TSRKESDLKSQPNLRTKFEQTDASREDT--NDADK------------VHGN  1358
                       +R    L ++P    +       RED   N   K              G+
Sbjct  305   SHNQSIMTPANRDSEALPAKPTQEPRSADQPMDREDIAKNHVSKNQACDAPMSKVGTSGD  364

Query  1359  KAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaapar  1535
             + +EP   +S   S +SAER S++ + +LKR++ +  ES       + E           
Sbjct  365   RNMEPVVATSSVCSANSAERTSDEPARNLKRKSHDTTESE--GPSEEAEEESVGARKAGH  422

Query  1536  ggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             G  G KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD
Sbjct  423   GRNGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  471



>ref|XP_003591255.1| Transcription factor PIF3 [Medicago truncatula]
 gb|AES61506.1| phytochrome-interacting factor 3.1 [Medicago truncatula]
Length=555

 Score =   163 bits (412),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 163/512 (32%), Positives = 232/512 (45%), Gaps = 110/512 (21%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
             MPL E  ++ + +       +S AD  S  P +DF ELVWE+GQI+ QGQSS+ +KS + 
Sbjct  1     MPLYELYRLAREKLDNETNGTSVADQPSS-PENDFFELVWESGQISSQGQSSRGRKSPSC  59

Query  603   SRMREKC--------------VGNASSS---RIGKLDLAGSVLDEMPPSVPSGEMDLSQD  731
               +   C              VG   S+   +IGK     S L+E+P SVPS E+     
Sbjct  60    RSLPSHCLPSHSPRGRDKDKDVGGGFSNNNPKIGKFGDLDSGLNEIPMSVPSREV-----  114

Query  732   DEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLI----------------  863
             DE+ PWL+YS       EYGS    E+   T N+    + F L+                
Sbjct  115   DEMMPWLDYSMDGSLQHEYGSDFFHEL---TENDLPASNSFTLLDKRNNGNQIFRDSHKN  171

Query  864   ----------GASKSVVNSGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSD---IGSS  1004
                        +++ VV + +  A+     P        +S       S +++   + S 
Sbjct  172   SAEAMNVSKGSSAEQVVETARHKASASQLYPPSSNQCQTTSVTVRSRASDITENNNVSSG  231

Query  1005  NGSINLDSILKDSVPPQAKNQDTETTRTCPPTL-------LNFSNFSRPVVLARANLQNT  1163
             N  +    I +  +P  + +  +   +   P +       +NFS+F+RP  + RANLQN 
Sbjct  232   NQDVPYGDITR--IPSSSSDFSSLKAQKQDPVMPGNGSNVMNFSHFARPAAIVRANLQNI  289

Query  1164  ------------LEAKGKREKEIKENAQNPAKTALIEACSTSRKE-------------SD  1268
                          +  G + K     + NP  +AL+       KE             +D
Sbjct  290   GLKSGLNSASARSDIMGVKNKGAASTSSNPPDSALVNPSGECSKEPEMRCHKVVEPSKAD  349

Query  1269  LKS------QPNLRTKFEQTDASRED--TNDADKVH--------GNKAVEPgacssvcsg  1400
             LK       +PN     +   A +E+   ND   +         G+ A + G   +V S 
Sbjct  350   LKPLQPKSLEPNAVATKQSKPACKENGIKNDQPSIQVLGDNGAKGHAAADKGMEVAVASS  409

Query  1401  ss-----aERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRA  1565
             S      A+R S+D +  LKR++R+ E+S C SED ++ES G KK A  RG  G KRSRA
Sbjct  410   SVCSGNGADRGSDDPNRDLKRKSRDTEDSECHSEDVEDESVGVKKGAAGRGVAGSKRSRA  469

Query  1566  AEVHNLSERRRRDRINEKMRALQELIPNCNKA  1661
             AEVHNLSERRRRDRINEKMRALQELIPNCNK 
Sbjct  470   AEVHNLSERRRRDRINEKMRALQELIPNCNKV  501



>gb|KFK43254.1| phytochrome-interacting factor [Arabis alpina]
Length=529

 Score =   161 bits (408),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 159/427 (37%), Positives = 220/427 (52%), Gaps = 49/427 (11%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSD-FSELVWENGQITMQGQSSKAKKSDN  599
             MPL E L++ K           SA D +P P  D   ELVW+NGQI+ Q QS++++   N
Sbjct  1     MPLFELLRLTKA-------NLESAQDRNPSPPVDEVVELVWKNGQISTQSQSTRSR---N  50

Query  600   LSRMREKCVGNASSSRIGKLDLAG--SVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPS-N  770
             +     + +  ASSSR+ ++  +   +++DE+P SVPS    +SQDD++ PWLN+  S +
Sbjct  51    IPP--PQAIHQASSSRVREIGNSSKTTMMDEIPMSVPSLMTGMSQDDDLVPWLNHHQSLD  108

Query  771   GQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPRFGLLASW  950
             G    Y S  L ++S  T NE         I  +++V    QR     + +P     + +
Sbjct  109   G----YCSDFLQDVSPVTVNEQESD-----IVVNQTVFPLFQRQNNGNESAPPAASSSQY  159

Query  951   SSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTC-PPTLLNFSNFSR  1127
             +S Q++          S  GS            P    Q  E    C  P L+NFS+F R
Sbjct  160   NSFQSH----------SVYGSDRAREPTSQQAKPDRFTQTQEPLVACNKPGLINFSHFLR  209

Query  1128  PVVLARAN-LQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNLRTKFE  1304
             P  LA+ N LQ   E   +R   + +     AK  + +A + S   +  K   N +    
Sbjct  210   PATLAKPNNLQGGNEKSPQRSPNVFQTRVLGAKETVDKALNESVASATPKD--NQKACLI  267

Query  1305  QTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENEESGCPS  1484
               D+ R+D          KAV    CSSV SG+S +  S   S SLKR+  + ++  C S
Sbjct  268   SEDSCRKDQ------ESEKAV---VCSSVGSGNSPDGPSESPSLSLKRKHSDTQDIDCHS  318

Query  1485  EDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKA  1661
             ED +EES   +K    +R G G KRSR+AEVHNLSERRRRDRINEKMR+LQELIPNCNK 
Sbjct  319   EDVEEESGDGRKETAPSRAGNGSKRSRSAEVHNLSERRRRDRINEKMRSLQELIPNCNKV  378

Query  1662  DKASMLD  1682
             DKASMLD
Sbjct  379   DKASMLD  385



>ref|XP_010042473.1| PREDICTED: transcription factor PIF3-like [Eucalyptus grandis]
 gb|KCW85002.1| hypothetical protein EUGRSUZ_B01825 [Eucalyptus grandis]
 gb|KCW85003.1| hypothetical protein EUGRSUZ_B01825 [Eucalyptus grandis]
Length=660

 Score =   162 bits (409),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 168/470 (36%), Positives = 226/470 (48%), Gaps = 55/470 (12%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSAD-DLSPLPGSDFSELVWENGQITMQGQSSKAKKSDN  599
             MPL E  +  + +   R+    S   DLS +P   F EL+WENGQ+ MQGQSS+ KKS  
Sbjct  1     MPLFELFRRAQEKLNSRQDKGQSCSADLSFIPEDGFVELIWENGQVVMQGQSSRPKKSQP  60

Query  600   ----LSR-------MREKCVGNASSSRIGKLDL-AGSVLDEMPPSVPSGEMDLSQDDEIA  743
                 LS        + +K VGN ++S   K +    S L E P S P  EM L+ D++I 
Sbjct  61    GFGLLSEFTSQSPWISDKDVGNGAASNSKKSEAEPDSGLSEFPMSSPPREMCLTHDEDIV  120

Query  744   PWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSV-VNSGQRNATKLDC  920
             PW +   +     +Y S  LPE+SG   NE S    F     S +  V     N  K+  
Sbjct  121   PWFSCPINEPLQNDYCSDFLPELSGVPVNELSNLYSFDSTQKSNNKEVGPAGVNGAKVPS  180

Query  921   SPRFGLLASWSSQQANPLVSGVSD-IGSSNGSINLDSILKDS--VPPQAKNQDTETTRTC  1091
             +    +     +     L  GV D +GSS   I  DS   D   +P  A    +E  +  
Sbjct  181   AADVEINGMGMNTALPSLQQGVMDAMGSSKCGITYDSTFGDFSRLPRLAVGSTSEKGQAK  240

Query  1092  PPT-------LLNFSNFSRPVVLARANLQNTLEAKG----------KREKEIKEN-----  1205
               T        +NFS+F+R    + AN++N   A G          ++EK    N     
Sbjct  241   DATPSAKNSNFINFSHFARVATPSHANVENNARASGSGSLISDRAARKEKCSSTNDSIMA  300

Query  1206  ---AQNPAKTALIEA---CSTSRKESDLKSQPNLRTKFEQTDASREDTNDADK---VHGN  1358
                A N +     EA   C   R++  + S+P +     Q DA + D + AD+      +
Sbjct  301   DNLASNLSVCPRTEASSNCQVQREQLMVASKPLIC----QGDALKNDKS-ADQSCCASSS  355

Query  1359  KAVEPgacssvcsgssaERASNDQ-SHSLKRRARENEESGCPSEDADEESagakkaapar  1535
             K        +  + S++  +++D  S SLKR+      S   +ED DE+S G KKAA A 
Sbjct  356   KGSPDNEKMTELAASTSSASTSDAPSCSLKRKCPSTNNSEALAEDVDEDSVGVKKAAAAA  415

Query  1536  g-gtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
                T  KRSRAAEVHNLSER+RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  416   ARSTSSKRSRAAEVHNLSERKRRDRINEKMRALQELIPNCNKVDKASMLD  465



>ref|XP_008453043.1| PREDICTED: transcription factor PIF3 isoform X1 [Cucumis melo]
Length=706

 Score =   161 bits (407),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 171/514 (33%), Positives = 247/514 (48%), Gaps = 96/514 (19%)
 Frame = +3

Query  423   MPLSEFLKMLKNE-SGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDN  599
             MPLSE  ++ + +    +   +  A DLS  P +D  ELVWENGQI +QGQS++ +K+ N
Sbjct  1     MPLSELYRVARGKLDSTQDKNNMVASDLSMNPENDVFELVWENGQILLQGQSNRTRKNSN  60

Query  600   LSRMREKC------------VGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDE--  737
             L+  + +C            VG  +++++GK     SV+ ++  + PS +++L+ DD+  
Sbjct  61    LNTSQAQCLPTHSPRDRDRDVGYFNNAKMGKFGAIDSVVRDVMSTAPSPDVELAHDDDDD  120

Query  738   IAPWLNYSPSNGQSQ-EYGSQLLPEISG-TTANEPSPHDGFPLIGA--------------  869
             + PWL+Y P +G  Q +Y S  LPE+SG T  + PS +     IG               
Sbjct  121   MVPWLSY-PLDGHLQHDYSSDFLPELSGVTVNDFPSRNSIASSIGKASGGNQVNRERDMH  179

Query  870   --SKSVVNSGQRNATKLDCSPRFGLLASWSSQQAN-----------PLVSGVSDIGSSN-  1007
               S    N    N +KL         A  S+ Q +           P +      G+ N 
Sbjct  180   LNSMHGANLEDGNISKLSSLDVSAARARSSTNQLHSSASQQSQTSFPHLRTKCAGGTENT  239

Query  1008  -GSINLDSILKDS--VPPQAKNQDTETTRTCPPT-------LLNFSNFSRPVVLARANLQ  1157
              G I  DS++  S  VP  A +  +   +   PT       ++NFS+F RP  L ++N Q
Sbjct  240   TGKILHDSLVGHSPQVPLIASSSSSTARQKLDPTPPNNASNIINFSHFLRPAALLKSNPQ  299

Query  1158  NTLEAKGKREKEIKENAQN-------PAKTALIEACSTSRKESDLKSQ----PNLRTKF-  1301
             N         + +    +N       P +++LI      R ES+   +    P++  K  
Sbjct  300   NHGVPGTGGSRNLDSMVKNSSAANSQPRESSLIAIQGGIRNESNSGCKNAVVPSIDGKNP  359

Query  1302  ------EQTDASRE-------DTNDAD--------------KVHGNKAVEPgacssvcsg  1400
                   EQ+ A+++       D+ D D                   KAVE    +S+CS 
Sbjct  360   SDAKPPEQSQANKQPEAACLGDSADHDDRLKHCLEVGATKGYADSEKAVESVIAASLCSR  419

Query  1401  ssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHN  1580
             +S E AS+D   + KR+  + E+S   S+D  EE     K   +  GTG KRSRAAEVHN
Sbjct  420   NSVEGASDDPPLNRKRKCHDTEDSEWHSDDV-EEDCNDVKRVTSGRGTGSKRSRAAEVHN  478

Query  1581  LSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             LSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  479   LSERRRRDRINEKMRALQELIPNCNKVDKASMLD  512



>ref|XP_010458240.1| PREDICTED: transcription factor PIF3-like [Camelina sativa]
Length=533

 Score =   158 bits (399),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 162/438 (37%), Positives = 222/438 (51%), Gaps = 71/438 (16%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK----  590
             MPL E  ++ + +        S+ D+ S  P  +  ELVWENGQI+ Q QS++++     
Sbjct  1     MPLFELFRLTQAK------LESAQDNNSSPPMDEVVELVWENGQISTQSQSNRSRNIPPP  54

Query  591   --SDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSP  764
                   + +R + +GN S +         +++DE+P SVPS    LSQ+D+  PWLN+  
Sbjct  55    QAVHQPNSLRARDIGNGSKA---------TMVDEIPMSVPSLMTGLSQEDDFVPWLNH--  103

Query  765   SNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPRFGLLA  944
              N     Y S  L ++S  T NE         +  +++V    QR     D +P      
Sbjct  104   -NQSLDGYCSDFLRDVSPVTVNEQESD-----MAVNQTVFPLFQRRNNGNDSAP------  151

Query  945   SWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCP------PTLL  1106
             + SS Q N         G  + S+      +D  P Q  N D  T    P      P+L+
Sbjct  152   AASSSQYN---------GFQSHSLYGSDRARDP-PSQQTNPDRVTQTQEPLIPNNKPSLV  201

Query  1107  NFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRK---ESDLKS  1277
             NFS+F RP  LA+ N      + G +EK   ++  N  +T ++ A  T  K   ES   +
Sbjct  202   NFSHFLRPAALAKTNN----NSHGTKEKS-PQSPPNVFQTRVLGAKDTEDKVFNESVASA  256

Query  1278  QP--NLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSLKRR  1451
              P  N +      D+ R D          KAV    CSSV SG+S +  S   S SLKR+
Sbjct  257   TPMNNQKACLISEDSCRRDQ------ESEKAV---VCSSVGSGNSLDGPSESPSLSLKRK  307

Query  1452  ARENEESGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRINEKMRA  1628
               + +++ C SEDA+EES   +K A  +R G G KRSR+AEVHNLSERRRRDRINEKMRA
Sbjct  308   HSDVQDNDCHSEDAEEESGDGRKGAAPSRTGLGSKRSRSAEVHNLSERRRRDRINEKMRA  367

Query  1629  LQELIPNCNKADKASMLD  1682
             LQELIPNCNK DKASMLD
Sbjct  368   LQELIPNCNKVDKASMLD  385



>ref|XP_010549193.1| PREDICTED: transcription factor PIF3-like isoform X3 [Tarenaya 
hassleriana]
Length=572

 Score =   158 bits (399),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 163/454 (36%), Positives = 228/454 (50%), Gaps = 66/454 (15%)
 Frame = +3

Query  423   MPLSEFLKMLK---NESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS  593
             MPL E L++ K     S ERKP++   DD+         ELVWENGQIT Q QSS+++  
Sbjct  1     MPLFELLRLAKARLESSQERKPSAPDDDDVV--------ELVWENGQITTQNQSSRSR--  50

Query  594   DNLSRMREKCV------GNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
              N +  +  C         ++S R  ++   G  ++ +P  V S    LSQDD++ PWLN
Sbjct  51    -NNTHQQASCTTLVQPNSQSNSPRTKEIG-NGDSMNGIPMPVASLMPGLSQDDDLVPWLN  108

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEP---SPHDG-FPL---IGASKSVVNSGQRNATKL  914
             + P N   Q   S   P++S  T NE    +P+   FP    I  S   + +  R+ +  
Sbjct  109   H-PLNESLQ---SDFFPDVSEVTVNEEDNDAPNKTLFPFFHTINNSNHSLAANSRSVSAH  164

Query  915   DCSPRFGLLASWSS--------QQANPLV-SG-VSDIGSSNGSINLDS--ILKDSVPPQA  1058
             + S R G   S           Q+  PL  SG V ++ S + ++  +S    +   P   
Sbjct  165   NESTRGGNGTSQEGPSSRSNIFQEPPPLYQSGIVRNVASGHQTVCKESGRFTQKQEPALP  224

Query  1059  KNQDTETTRTCPPTLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIE  1238
              N+         P L+NFS+F RPV  ++AN        G      +E   N  +  L+E
Sbjct  225   SNK---------PGLMNFSHFLRPVASSKANHH------GSGATTTQEMGSNHMEDRLVE  269

Query  1239  ACSTSR--KESDLKSQPN--LRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgss  1406
             + + +R  +E  L S P   L+TK        +   + D+    KA+EP    S     +
Sbjct  270   SDNNNRLTEEKSLHSSPAKVLQTKVVSAQVPEDKVLNRDR-QSEKAMEPAVQCSSVCSGN  328

Query  1407  aERASNDQS-HSLKRRARENEESGCPSEDADEESagakkaaparggtgQ-KRSRAAEVHN  1580
             +    +D    SLKR   + +E  C SED +EES   +KAAP+R G+   KRSR+AEVHN
Sbjct  329   SLDVPSDVPLRSLKRPYSDTQEMDCQSEDVEEESTDVRKAAPSRAGSSGCKRSRSAEVHN  388

Query  1581  LSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             LSER+RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  389   LSERKRRDRINEKMRALQELIPNCNKVDKASMLD  422



>ref|XP_010549189.1| PREDICTED: transcription factor PIF3-like isoform X2 [Tarenaya 
hassleriana]
Length=573

 Score =   157 bits (397),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 162/454 (36%), Positives = 226/454 (50%), Gaps = 65/454 (14%)
 Frame = +3

Query  423   MPLSEFLKMLK---NESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS  593
             MPL E L++ K     S ERKP++   DD+         ELVWENGQIT Q QSS+++  
Sbjct  1     MPLFELLRLAKARLESSQERKPSAPDDDDVV--------ELVWENGQITTQNQSSRSR--  50

Query  594   DNLSRMREKCV------GNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
              N +  +  C         ++S R  ++   G  ++ +P  V S    LSQDD++ PWLN
Sbjct  51    -NNTHQQASCTTLVQPNSQSNSPRTKEIG-NGDSMNGIPMPVASLMPGLSQDDDLVPWLN  108

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEP---SPHDG-FPL---IGASKSVVNSGQRNATKL  914
             + P N   Q   S   P++S  T NE    +P+   FP    I  S   + +  R+ +  
Sbjct  109   H-PLNESLQ---SDFFPDVSEVTVNEEDNDAPNKTLFPFFHTINNSNHSLAANSRSVSAH  164

Query  915   DCSPRFGLLASWSS--------QQANPLV-SG-VSDIGSSNGSINLDS--ILKDSVPPQA  1058
             + S R G   S           Q+  PL  SG V ++ S + ++  +S    +   P   
Sbjct  165   NESTRGGNGTSQEGPSSRSNIFQEPPPLYQSGIVRNVASGHQTVCKESGRFTQKQEPALP  224

Query  1059  KNQDTETTRTCPPTLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIE  1238
              N+         P L+NFS+F RPV  ++AN        G      +E   N  +  L+E
Sbjct  225   SNK---------PGLMNFSHFLRPVASSKANHH------GSGATTTQEMGSNHMEDRLVE  269

Query  1239  ACSTSR--KESDLKSQPN--LRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgss  1406
             + + +R  +E  L S P   L+TK        +   +       KA+EP    S     +
Sbjct  270   SDNNNRLTEEKSLHSSPAKVLQTKVVSAQVPEDKVLNRRDRQSEKAMEPAVQCSSVCSGN  329

Query  1407  aERASNDQS-HSLKRRARENEESGCPSEDADEESagakkaaparggtgQ-KRSRAAEVHN  1580
             +    +D    SLKR   + +E  C SED +EES   +KAAP+R G+   KRSR+AEVHN
Sbjct  330   SLDVPSDVPLRSLKRPYSDTQEMDCQSEDVEEESTDVRKAAPSRAGSSGCKRSRSAEVHN  389

Query  1581  LSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             LSER+RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  390   LSERKRRDRINEKMRALQELIPNCNKVDKASMLD  423



>ref|XP_008453053.1| PREDICTED: transcription factor PIF3 isoform X2 [Cucumis melo]
Length=684

 Score =   157 bits (398),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 166/490 (34%), Positives = 236/490 (48%), Gaps = 95/490 (19%)
 Frame = +3

Query  492   ADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNLSRMREKC------------VGNA  635
             A DLS  P +D  ELVWENGQI +QGQS++ +K+ NL+  + +C            VG  
Sbjct  3     ASDLSMNPENDVFELVWENGQILLQGQSNRTRKNSNLNTSQAQCLPTHSPRDRDRDVGYF  62

Query  636   SSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDE--IAPWLNYSPSNGQSQ-EYGSQLLP  806
             +++++GK     SV+ ++  + PS +++L+ DD+  + PWL+Y P +G  Q +Y S  LP
Sbjct  63    NNAKMGKFGAIDSVVRDVMSTAPSPDVELAHDDDDDMVPWLSY-PLDGHLQHDYSSDFLP  121

Query  807   EISG-TTANEPSPHDGFPLIGA----------------SKSVVNSGQRNATKLDCSPRFG  935
             E+SG T  + PS +     IG                 S    N    N +KL       
Sbjct  122   ELSGVTVNDFPSRNSIASSIGKASGGNQVNRERDMHLNSMHGANLEDGNISKLSSLDVSA  181

Query  936   LLASWSSQQAN-----------PLVSGVSDIGSSN--GSINLDSILKDS--VPPQAKNQD  1070
               A  S+ Q +           P +      G+ N  G I  DS++  S  VP  A +  
Sbjct  182   ARARSSTNQLHSSASQQSQTSFPHLRTKCAGGTENTTGKILHDSLVGHSPQVPLIASSSS  241

Query  1071  TETTRTCPPT-------LLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQN-----  1214
             +   +   PT       ++NFS+F RP  L ++N QN         + +    +N     
Sbjct  242   STARQKLDPTPPNNASNIINFSHFLRPAALLKSNPQNHGVPGTGGSRNLDSMVKNSSAAN  301

Query  1215  --PAKTALIEACSTSRKESDLKSQ----PNLRTKF-------EQTDASRE-------DTN  1334
               P +++LI      R ES+   +    P++  K        EQ+ A+++       D+ 
Sbjct  302   SQPRESSLIAIQGGIRNESNSGCKNAVVPSIDGKNPSDAKPPEQSQANKQPEAACLGDSA  361

Query  1335  DAD--------------KVHGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENEES  1472
             D D                   KAVE    +S+CS +S E AS+D   + KR+  + E+S
Sbjct  362   DHDDRLKHCLEVGATKGYADSEKAVESVIAASLCSRNSVEGASDDPPLNRKRKCHDTEDS  421

Query  1473  GCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNC  1652
                S+D  EE     K   +  GTG KRSRAAEVHNLSERRRRDRINEKMRALQELIPNC
Sbjct  422   EWHSDDV-EEDCNDVKRVTSGRGTGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNC  480

Query  1653  NKADKASMLD  1682
             NK DKASMLD
Sbjct  481   NKVDKASMLD  490



>ref|XP_010490103.1| PREDICTED: transcription factor PIF3-like [Camelina sativa]
 ref|XP_010490108.1| PREDICTED: transcription factor PIF3-like [Camelina sativa]
Length=533

 Score =   155 bits (393),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 163/439 (37%), Positives = 222/439 (51%), Gaps = 73/439 (17%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSD-FSELVWENGQITMQGQSSKAKK---  590
             MPL E  ++ + +         SA D +P P  D   ELVWENGQI+ Q QS++++    
Sbjct  1     MPLFELFRLTQAKL-------ESAQDNNPSPPVDEVVELVWENGQISTQSQSNRSRNIPP  53

Query  591   ---SDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYS  761
                    + +R + +GN S +         +++DE+P SVPS    LSQ+D+  PWLN+ 
Sbjct  54    PQAVHQPNSLRARDIGNGSKT---------TMVDEIPMSVPSLMTGLSQEDDFVPWLNH-  103

Query  762   PSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPRFGLL  941
               N     Y S  L ++S  T NE         +  +++V    QR     + +P     
Sbjct  104   --NQSLDGYCSDFLRDVSPVTVNEQESD-----MAVNQTVFPLFQRRNNGNESAP-----  151

Query  942   ASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCP------PTL  1103
              + SS Q N         G  + S+      +D  P Q  N D  T    P      P+L
Sbjct  152   -AASSSQYN---------GFQSHSLYGSDRARDP-PSQQTNPDRVTQTQEPLIPNNKPSL  200

Query  1104  LNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRK---ESDLK  1274
             +NFS+F RP  LA+ N       +G +EK   ++  N  +T ++ A  T  K   ES   
Sbjct  201   VNFSHFLRPAALAKTNN----NPQGTKEKS-PQSPPNVFQTRVLGAKDTEDKVFNESVAS  255

Query  1275  SQP--NLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSLKR  1448
             + P  N +      D+ R D          KAV    CSSV SG+S +  S   S SLKR
Sbjct  256   ATPMNNQKACLISEDSCRRDQ------ESEKAV---VCSSVGSGNSLDGPSESPSLSLKR  306

Query  1449  RARENEESGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRINEKMR  1625
             +  + +++ C SEDA+EES   +K A  +R G G KRSR+AEVHNLSERRRRDRINEKMR
Sbjct  307   KHSDVQDNDCHSEDAEEESGDGRKGAAPSRTGLGSKRSRSAEVHNLSERRRRDRINEKMR  366

Query  1626  ALQELIPNCNKADKASMLD  1682
             ALQELIPNCNK DKASMLD
Sbjct  367   ALQELIPNCNKVDKASMLD  385



>ref|XP_010475789.1| PREDICTED: transcription factor PIF3 [Camelina sativa]
 ref|XP_010475790.1| PREDICTED: transcription factor PIF3 [Camelina sativa]
Length=534

 Score =   155 bits (391),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 165/441 (37%), Positives = 222/441 (50%), Gaps = 77/441 (17%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSD-FSELVWENGQITMQGQSSKAK----  587
             MPL E  ++ + +         SA D +P P  D   ELVWENGQI+ Q QS++++    
Sbjct  1     MPLFELFRLTQAKL-------ESAQDNNPSPPVDEVVELVWENGQISTQSQSNRSRNIPP  53

Query  588   ----KSDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                    N SR R+  +GN S +         +++DE+P SVPS    LSQ+D+  PWLN
Sbjct  54    PQAVHQPNSSRARD--IGNGSKA---------TMVDEIPMSVPSLMTGLSQEDDFVPWLN  102

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPRFG  935
             +   N     Y S  L ++S  T NE         +  +++V    QR     + +P   
Sbjct  103   H---NQSLDGYCSDFLRDVSPVTVNEQESD-----MAVNQTVFPLFQRRNNGNESAP---  151

Query  936   LLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCP------P  1097
                + SS Q N         G  + S+      +D  P Q  N D  T    P      P
Sbjct  152   ---AASSSQYN---------GFQSHSLYGSDRARDP-PSQQTNPDRVTQTQEPLIPSNRP  198

Query  1098  TLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRK---ESD  1268
             +L+NFS+F RP  L + N       +G +EK   ++  N  +T ++ A  T  K   ES 
Sbjct  199   SLVNFSHFLRPAALVKTNN----NPQGTKEKS-PQSPPNVFQTRVLGAKDTEDKVFNESV  253

Query  1269  LKSQP--NLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSL  1442
               + P  N +      D+ R D          KAV    CSSV SG+S +  S   S SL
Sbjct  254   ASATPMNNQKACLISEDSCRRDQ------ESEKAV---VCSSVGSGNSLDGPSESPSLSL  304

Query  1443  KRRARENEESGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRINEK  1619
             KR+  + +++ C SEDA+EES   +K A  +R G G KRSR+AEVHNLSERRRRDRINEK
Sbjct  305   KRKHSDVQDNDCHSEDAEEESGDGRKGAAPSRTGLGSKRSRSAEVHNLSERRRRDRINEK  364

Query  1620  MRALQELIPNCNKADKASMLD  1682
             MRALQELIPNCNK DKASMLD
Sbjct  365   MRALQELIPNCNKVDKASMLD  385



>ref|XP_009366017.1| PREDICTED: transcription factor PIF3-like isoform X2 [Pyrus x 
bretschneideri]
Length=604

 Score =   152 bits (384),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 144/248 (58%), Gaps = 43/248 (17%)
 Frame = +3

Query  1065  QDTETTRTCPPTLLNFSNFSRPVVLARANLQN----------TLEAKGKREKEIKENAQN  1214
             QD    R   P+++NF++FSRP  LA+AN+QN          ++E  G ++K       N
Sbjct  140   QDPVIPRNTNPSIMNFTHFSRPAALAKANVQNNGAMAGSGSSSMEKIGDKDKFSAATRNN  199

Query  1215  PAKTALIEACSTSRKESDLKSQPNL-RTKFE----------------------QTDASRE  1325
               ++ LI++ S + KES+ + QP L R+  E                      Q + S+ 
Sbjct  200   LPESMLIDSSSGAPKESNSQCQPILVRSSDELKPTETKTLEEPCTAKRSEGACQEETSKN  259

Query  1326  DTNDADKV---------HGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENEESGC  1478
             D N  DK           G K +EP   SSVCSG+S ER S+D  H+LKR+ RE +ES C
Sbjct  260   DINANDKPCESASRVSPGGEKTLEPVVASSVCSGNSVERGSDDPPHALKRKCRETDESEC  319

Query  1479  PSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK  1658
              S+D ++ES G KK   ARG    KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK
Sbjct  320   HSDDVEDESVGVKKGVHARGTGS-KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK  378

Query  1659  ADKASMLD  1682
              DKASMLD
Sbjct  379   VDKASMLD  386



>ref|XP_010549185.1| PREDICTED: transcription factor PIF3-like isoform X1 [Tarenaya 
hassleriana]
Length=604

 Score =   152 bits (383),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 166/479 (35%), Positives = 231/479 (48%), Gaps = 84/479 (18%)
 Frame = +3

Query  423   MPLSEFLKMLK---NESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS  593
             MPL E L++ K     S ERKP++   DD+         ELVWENGQIT Q QSS+++  
Sbjct  1     MPLFELLRLAKARLESSQERKPSAPDDDDVV--------ELVWENGQITTQNQSSRSR--  50

Query  594   DNLSRMREKCV------GNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
              N +  +  C         ++S R  ++   G  ++ +P  V S    LSQDD++ PWLN
Sbjct  51    -NNTHQQASCTTLVQPNSQSNSPRTKEIG-NGDSMNGIPMPVASLMPGLSQDDDLVPWLN  108

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEP---SPHDG-FPL---IGASKSVVNSGQRNATKL  914
             + P N   Q   S   P++S  T NE    +P+   FP    I  S   + +  R+ +  
Sbjct  109   H-PLNESLQ---SDFFPDVSEVTVNEEDNDAPNKTLFPFFHTINNSNHSLAANSRSVSAH  164

Query  915   DCSPRFGLLASWSS--------QQANPLV-SG-VSDIGSSNGSINLDS--ILKDSVPPQA  1058
             + S R G   S           Q+  PL  SG V ++ S + ++  +S    +   P   
Sbjct  165   NESTRGGNGTSQEGPSSRSNIFQEPPPLYQSGIVRNVASGHQTVCKESGRFTQKQEPALP  224

Query  1059  KNQDTETTRTCPPTLLNFSNFSRPVVLARANLQ------------NTLEAK------GKR  1184
              N+         P L+NFS+F RPV  ++AN              N +E +        R
Sbjct  225   SNK---------PGLMNFSHFLRPVASSKANHHGSGATTTQEMGSNHMEDRLVESDNNNR  275

Query  1185  EKEIKENAQNPAKTALIEACSTSRKESDL--KSQPNLRTKFEQTDASREDTNDADKVHGN  1358
               E K    +PAK    +  S    E  +  +S  +   KF  + +S +D      + GN
Sbjct  276   LTEEKSLHSSPAKVLQTKVVSAQVPEDKVLNRSVASDAAKFVTSGSSSKDNVKGCLISGN  335

Query  1359  ---------KAVEPgacssvcsgssaERASNDQS-HSLKRRARENEESGCPSEDADEESa  1508
                      KA+EP    S     ++    +D    SLKR   + +E  C SED +EES 
Sbjct  336   SCRRDRQSEKAMEPAVQCSSVCSGNSLDVPSDVPLRSLKRPYSDTQEMDCQSEDVEEEST  395

Query  1509  gakkaaparggtgQ-KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
               +KAAP+R G+   KRSR+AEVHNLSER+RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  396   DVRKAAPSRAGSSGCKRSRSAEVHNLSERKRRDRINEKMRALQELIPNCNKVDKASMLD  454



>ref|NP_172424.1| transcription factor PIF3 [Arabidopsis thaliana]
 ref|NP_849626.1| transcription factor PIF3 [Arabidopsis thaliana]
 sp|O80536.1|PIF3_ARATH RecName: Full=Transcription factor PIF3; AltName: Full=Basic 
helix-loop-helix protein 8; Short=AtbHLH8; Short=bHLH 8; AltName: 
Full=Phytochrome-associated protein 3; AltName: Full=Phytochrome-interacting 
factor 3; AltName: Full=Transcription 
factor EN 100; AltName: Full=bHLH transcription factor bHLH008 
[Arabidopsis thaliana]
 gb|AAL55715.1|AF251693_1 putative transcription factor BHLH8 [Arabidopsis thaliana]
 gb|AAC33213.1| Unknown protein [Arabidopsis thaliana]
 gb|AAC95156.1| phytochrome interacting factor 3 [Arabidopsis thaliana]
 dbj|BAC41930.1| putative transcription factor BHLH8 [Arabidopsis thaliana]
 gb|AEE28457.1| transcription factor PIF3 [Arabidopsis thaliana]
 gb|AEE28458.1| transcription factor PIF3 [Arabidopsis thaliana]
Length=524

 Score =   147 bits (372),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 169/443 (38%), Positives = 218/443 (49%), Gaps = 83/443 (19%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSD-FSELVWENGQITMQGQSSKAKK---  590
             MPL E  ++ K +         SA D +P P  D   ELVWENGQI+ Q QSS+++    
Sbjct  1     MPLFELFRLTKAKL-------ESAQDRNPSPPVDEVVELVWENGQISTQSQSSRSRNIPP  53

Query  591   -SDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPS  767
                N SR RE  +GN S +         +++DE+P SVPS    LSQDD+  PWLN+ PS
Sbjct  54    PQANSSRARE--IGNGSKT---------TMVDEIPMSVPSLMTGLSQDDDFVPWLNHHPS  102

Query  768   NGQSQEYGSQLLPEISG-TTANEPSP-----HDGFPLIGASKSVVNSGQRNATKLDCSPR  929
                   Y S  L ++S   T NE           FPL           QR     + +P 
Sbjct  103   ---LDGYCSDFLRDVSSPVTVNEQESDMAVNQTAFPLF----------QRRKDGNESAP-  148

Query  930   FGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCP-----  1094
                  + SS Q N         G  + S+      +D +P Q  N D  T    P     
Sbjct  149   -----AASSSQYN---------GFQSHSLYGSDRARD-LPSQQTNPDRFTQTQEPLITSN  193

Query  1095  -PTLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRK---E  1262
              P+L+NFS+F RP   A+    N  + K K      ++  N  +T ++ A  +  K   E
Sbjct  194   KPSLVNFSHFLRPATFAKTTNNNLHDTKEKS----PQSPPNVFQTRVLGAKDSEDKVLNE  249

Query  1263  SDLKSQP--NLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSH  1436
             S   + P  N +      D+ R+D          KAV    CSSV SG+S +  S   S 
Sbjct  250   SVASATPKDNQKACLISEDSCRKDQ------ESEKAV---VCSSVGSGNSLDGPSESPSL  300

Query  1437  SLKRRARENEESGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRIN  1613
             SLKR+    ++  C SED +EES   +K A  +R G G KRSR+AEVHNLSERRRRDRIN
Sbjct  301   SLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRIN  360

Query  1614  EKMRALQELIPNCNKADKASMLD  1682
             EKMRALQELIPNCNK DKASMLD
Sbjct  361   EKMRALQELIPNCNKVDKASMLD  383



>gb|AAC99771.1| phytochrome-associated protein 3 [Arabidopsis thaliana]
Length=524

 Score =   146 bits (369),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 169/443 (38%), Positives = 217/443 (49%), Gaps = 83/443 (19%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSD-FSELVWENGQITMQGQSSKAKK---  590
             MPL E  ++ K +         SA D +P P  D   ELVWENGQI+ Q QSS+++    
Sbjct  1     MPLFELFRLTKAKL-------DSAQDRNPSPPVDEVVELVWENGQISTQSQSSRSRNIPP  53

Query  591   -SDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPS  767
                N SR RE  +GN S +         +++DE+P SVPS    LSQDD+  PWLN+ PS
Sbjct  54    PQANSSRARE--IGNGSKT---------TMVDEIPMSVPSLMTGLSQDDDFVPWLNHHPS  102

Query  768   NGQSQEYGSQLLPEISG-TTANEPSP-----HDGFPLIGASKSVVNSGQRNATKLDCSPR  929
                   Y S  L ++S   T NE           FPL           QR     + +P 
Sbjct  103   ---LDGYCSDFLRDVSSPVTVNEQESDMAVNQTAFPLF----------QRRKDGNESAP-  148

Query  930   FGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCP-----  1094
                  + SS Q N         G  + S+      +D +P Q  N D  T    P     
Sbjct  149   -----AASSSQYN---------GFQSHSLYGSDRARD-LPSQQTNPDRFTQTQEPLITSN  193

Query  1095  -PTLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRK---E  1262
              P+L+NFS+F RP   A+    N  + K K      ++  N  +T ++ A  +  K   E
Sbjct  194   KPSLVNFSHFLRPATFAKTTNNNLHDTKEKS----PQSPPNVFQTRVLGAKDSEDKVLNE  249

Query  1263  SDLKSQP--NLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSH  1436
             S   + P  N +      D+ R+D          KAV    CSSV SG+S +  S   S 
Sbjct  250   SVASATPKDNQKACLISEDSCRKDQ------ESEKAV---VCSSVGSGNSLDGPSESPSL  300

Query  1437  SLKRRARENEESGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRIN  1613
             SLKR+    ++  C SED +EES   +K A  +R G G KRSR AEVHNLSERRRRDRIN
Sbjct  301   SLKRKHSNIQDIDCHSEDVEEESGDGRKEAGPSRTGLGSKRSRLAEVHNLSERRRRDRIN  360

Query  1614  EKMRALQELIPNCNKADKASMLD  1682
             EKMRALQELIPNCNK DKASMLD
Sbjct  361   EKMRALQELIPNCNKVDKASMLD  383



>ref|XP_008370334.1| PREDICTED: transcription factor PIF3 isoform X2 [Malus domestica]
Length=606

 Score =   146 bits (369),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 143/248 (58%), Gaps = 43/248 (17%)
 Frame = +3

Query  1065  QDTETTRTCPPTLLNFSNFSRPVVLARANLQN--TLEAKGKREKEIKENA--------QN  1214
             QD    R   P+++NF++FSRP  LA+AN+QN   +   G    E  EN          N
Sbjct  140   QDPVMPRNTNPSIMNFTHFSRPAALAKANVQNNGAMAGSGSSSMERIENKDKFSAATRNN  199

Query  1215  PAKTALIEACSTSRKESDLKSQPNL-RTKFE----------------------QTDASRE  1325
               ++ LI++ S + KES+ + QP L R+  E                      Q + S+ 
Sbjct  200   LPESXLIDSSSGAPKESNSQCQPILVRSSDELKATKAKPLEEPCTAKRSEXACQEETSKN  259

Query  1326  DTNDADKV---------HGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENEESGC  1478
             D N  DK             K +EP   SSVCSG+S ER S+D +H+LKR+ RE +ES C
Sbjct  260   DINANDKPCESASRVSPGXEKTLEPVVASSVCSGNSVERGSDDPTHALKRKCRETDESEC  319

Query  1479  PSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK  1658
              S+D ++ES G KK A ARG    KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK
Sbjct  320   HSDDVEDESVGVKKGAHARGKGS-KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK  378

Query  1659  ADKASMLD  1682
              DKASMLD
Sbjct  379   VDKASMLD  386



>gb|KHG19219.1| Transcription factor PIF3 [Gossypium arboreum]
Length=652

 Score =   144 bits (363),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 163/485 (34%), Positives = 221/485 (46%), Gaps = 126/485 (26%)
 Frame = +3

Query  423   MPLSEFLKMLKNE---SGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS  593
             MPLSE  +M + +   S ++ P+SS+  D S +P  DF ELVWEN               
Sbjct  1     MPLSELYRMARGKLDSSQDKNPSSST--DPSIVPEDDFVELVWEN---------------  43

Query  594   DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNG  773
                                            +P S PS       DD++ PWL YS    
Sbjct  44    -------------------------------VPMSAPS------HDDDVVPWLKYS----  62

Query  774   QSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVN---SGQRNATKLDCSPRFGLLA  944
               +     +LP +SG   N              +  ++   SG  NA       +   + 
Sbjct  63    --ENECCDMLPGLSGLCTNNIPTDSSLASFNQRRQSISDSFSGSLNAAADFKQGKLAKVP  120

Query  945   SWSSQQANPLVSGVSD------IGSSN-GSINLDSI--------LKDSVPPQ--------  1055
               +  +A  L SG S+      + SS  GS NL+SI         +D++  Q        
Sbjct  121   KPADDEAR-LRSGTSESPQLCQVSSSYLGSRNLESIGNKPSHAFFRDTMGVQPSDETLRC  179

Query  1056  AKNQDTETTRTCPPT-LLNFSNFSRPVVLARANLQNT--LEAKGKREKEIKENAQNPAKT  1226
              K Q  +    C  T L+NFS+FSRP  L +A+LQN   +     +E     + + P  +
Sbjct  180   VKMQKQDKVAPCNNTVLMNFSHFSRPAALVKASLQNIGAMARIESKETGFAASTRGPVGS  239

Query  1227  ALIEACSTSRKESDLKSQPN---LRTKFEQTDA---------------SREDTNDADKV-  1349
               I++    +KE+      +   ++T  +Q++A                 E    +DK+ 
Sbjct  240   KAIDSNIKLQKETFSHCHSSIVPMKTDIKQSEAKSLDEPVAAEPNNANCEEYVPKSDKIS  299

Query  1350  -------------HGNKAVEPgacssvcsgssaERASND-QSHSLKRRARENEESGCPSE  1487
                             KAVE    +SVC  ++ ERAS+D   ++LKR+  +NEE  CPSE
Sbjct  300   SQVIGENASNCLPESGKAVESVLAASVCCENNVERASDDPVVNNLKRKNHDNEEFECPSE  359

Query  1488  DADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADK  1667
             DA+EES G KKA PARGG G KRS AAEVHNLSERRRRDRINEKMRALQELIPNCNK DK
Sbjct  360   DAEEESVGVKKAVPARGGKGFKRSGAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDK  419

Query  1668  ASMLD  1682
             ASMLD
Sbjct  420   ASMLD  424



>gb|KHG19220.1| Transcription factor PIF3 [Gossypium arboreum]
Length=652

 Score =   144 bits (363),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 163/485 (34%), Positives = 221/485 (46%), Gaps = 126/485 (26%)
 Frame = +3

Query  423   MPLSEFLKMLKNE---SGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS  593
             MPLSE  +M + +   S ++ P+SS+  D S +P  DF ELVWEN               
Sbjct  1     MPLSELYRMARGKLDSSQDKNPSSST--DPSIVPEDDFVELVWEN---------------  43

Query  594   DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNG  773
                                            +P S PS       DD++ PWL YS    
Sbjct  44    -------------------------------VPMSAPS------HDDDVVPWLKYS----  62

Query  774   QSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVN---SGQRNATKLDCSPRFGLLA  944
               +     +LP +SG   N              +  ++   SG  NA       +   + 
Sbjct  63    --ENECCDMLPGLSGLCTNNIPTDSSLASFNQRRQSISDSFSGSLNAAADFKQGKLAKVP  120

Query  945   SWSSQQANPLVSGVSD------IGSSN-GSINLDSI--------LKDSVPPQ--------  1055
               +  +A  L SG S+      + SS  GS NL+SI         +D++  Q        
Sbjct  121   KPADDEAR-LRSGTSESPQLCQVSSSYLGSRNLESIGNKPSHAFFRDTMGVQPSDETLRC  179

Query  1056  AKNQDTETTRTCPPT-LLNFSNFSRPVVLARANLQNT--LEAKGKREKEIKENAQNPAKT  1226
              K Q  +    C  T L+NFS+FSRP  L +A+LQN   +     +E     + + P  +
Sbjct  180   VKMQKQDKVAPCNNTVLMNFSHFSRPAALVKASLQNIGAMARIESKETGFAASTRGPVGS  239

Query  1227  ALIEACSTSRKESDLKSQPN---LRTKFEQTDA---------------SREDTNDADKV-  1349
               I++    +KE+      +   ++T  +Q++A                 E    +DK+ 
Sbjct  240   KAIDSNIKLQKETFSHCHSSIVPMKTDIKQSEAKSLDEPVAAEPNNANCEEYVPKSDKIS  299

Query  1350  -------------HGNKAVEPgacssvcsgssaERASND-QSHSLKRRARENEESGCPSE  1487
                             KAVE    +SVC  ++ ERAS+D   ++LKR+  +NEE  CPSE
Sbjct  300   SQVIGENASNCLPESGKAVESVLAASVCCENNVERASDDPVVNNLKRKNHDNEEFECPSE  359

Query  1488  DADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADK  1667
             DA+EES G KKA PARGG G KRS AAEVHNLSERRRRDRINEKMRALQELIPNCNK DK
Sbjct  360   DAEEESVGVKKAVPARGGKGFKRSGAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDK  419

Query  1668  ASMLD  1682
             ASMLD
Sbjct  420   ASMLD  424



>ref|XP_006417565.1| hypothetical protein EUTSA_v10007343mg [Eutrema salsugineum]
 gb|ESQ35918.1| hypothetical protein EUTSA_v10007343mg [Eutrema salsugineum]
Length=530

 Score =   140 bits (354),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 160/433 (37%), Positives = 218/433 (50%), Gaps = 62/433 (14%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSD-FSELVWENGQITMQGQSSKAKKSDN  599
             MPL E  ++ K +         SA D +P P  D   ELVWENGQ++     S++ +S N
Sbjct  1     MPLFELFRLTKAKL-------ESAQDKNPSPPLDEIVELVWENGQLS---TQSQSSRSRN  50

Query  600   LSRMREKCVGNASSSRIGKLDLAG--SVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNG  773
             +  +    V  ASSSR  ++  +   +V+DE+P SVPS    LSQDD++ PWLN+  S  
Sbjct  51    IPPLH--AVHQASSSRAREIGNSSKTTVVDEIPMSVPSLMTGLSQDDDLVPWLNHHQS--  106

Query  774   QSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPRFGLLASWS  953
                 Y S  L ++S  T NE         +  ++ V    QR     + +P     A+ S
Sbjct  107   -LDGYCSDFLHDVSPVTVNEQESD-----MAVNQIVSPLFQRRNNGNESAP-----AASS  155

Query  954   SQ----QANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPTLLNFSNF  1121
             SQ    Q+  L         ++    LD   +   P    N+         P L+NFS+F
Sbjct  156   SQYNDFQSRSLYGSDRARDPASQHAKLDRFTQSQEPLVTSNK---------PGLINFSHF  206

Query  1122  SRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRK---ESDLKSQP--N  1286
              RP  L + N  +  + KG       ++  N  +T ++ A  +  K   ES   + P  N
Sbjct  207   LRPATLGKTNNLHGTKEKGP------QSPPNVFQTRVLGAKDSEDKVLNESVASAMPKDN  260

Query  1287  LRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENE  1466
              +      D+ R+D          KAV    CSSV SG+S +  S   S SLKR+  + +
Sbjct  261   QKACLISEDSGRKDQ------ESEKAV---VCSSVGSGNSPDGPSESPSLSLKRKHSDVQ  311

Query  1467  ESGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELI  1643
             +  C SED + ES   +K A  +R GTG KRSR+AEVHNLSERRRRDRINEKMRALQELI
Sbjct  312   DIDCHSEDVEGESGDGRKEAAPSRTGTGSKRSRSAEVHNLSERRRRDRINEKMRALQELI  371

Query  1644  PNCNKADKASMLD  1682
             PNCNK DKASMLD
Sbjct  372   PNCNKVDKASMLD  384



>ref|XP_006303172.1| hypothetical protein CARUB_v10008815mg [Capsella rubella]
 gb|EOA36070.1| hypothetical protein CARUB_v10008815mg [Capsella rubella]
Length=532

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 161/447 (36%), Positives = 211/447 (47%), Gaps = 90/447 (20%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSD-FSELVWENGQITMQGQSS-------  578
             MPL E  + L N   E      SA D +P P  D   ELVWENGQI+ Q QSS       
Sbjct  1     MPLFELFR-LANAKLE------SAQDNNPSPPVDEVVELVWENGQISTQSQSSRSRNIPP  53

Query  579   -KAKKSDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
              +A    N SR R+   GN S +         +++DE+P SVPS    +SQ+D+  PWLN
Sbjct  54    PQAVHQPNSSRARD--TGNGSKT---------TMVDEIPMSVPSLMTGMSQEDDFVPWLN  102

Query  756   YSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPRFG  935
             +   N     Y S  L ++S  T NE         +  +++V    QR     + +P   
Sbjct  103   H---NQSLDGYCSDFLRDVSPVTVNEQESD-----MAVNQTVFPLFQRRNNGNESAP---  151

Query  936   LLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQD--TETTRTC----PP  1097
                + SS Q N         G  + S+      +D  P Q  N D  T+T  T      P
Sbjct  152   ---AASSSQYN---------GFQSHSLYGSDRARDP-PSQQTNPDRVTQTQETLIPSNKP  198

Query  1098  TLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRK---ESD  1268
             +L+NFS+F RP  L + +        G +EK    +  N  +T ++ A  +  K   ES 
Sbjct  199   SLVNFSHFLRPATLVKID-----NPHGTKEKS-PPSPPNVFQTRVLGAKDSEDKVLNESI  252

Query  1269  LKSQP--NLRTKFEQTDASREDTNDADKV------HGNKAVEPgacssvcsgssaERASN  1424
               + P  N +      D+ R+D      V       GN    P                 
Sbjct  253   ASATPMNNQKACLMSEDSCRKDQESEKAVVCSSVGSGNSLDGPYESP-------------  299

Query  1425  DQSHSLKRRARENEESGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRR  1601
               S SLKR+  + ++  C SEDA+EES   +K A  +R G G KRSR+AEVHNLSERRRR
Sbjct  300   --SLSLKRKHSDIQDIDCHSEDAEEESGDGRKEAAPSRTGLGSKRSRSAEVHNLSERRRR  357

Query  1602  DRINEKMRALQELIPNCNKADKASMLD  1682
             DRINEKMRALQELIPNCNK DKASMLD
Sbjct  358   DRINEKMRALQELIPNCNKVDKASMLD  384



>ref|XP_010094912.1| hypothetical protein L484_022662 [Morus notabilis]
 gb|EXB57555.1| hypothetical protein L484_022662 [Morus notabilis]
Length=758

 Score =   141 bits (355),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 133/242 (55%), Gaps = 49/242 (20%)
 Frame = +3

Query  1101  LLNFSNFSRPVVLARANLQNTLEAKG----KREKEIKENAQNPAKTALIEACSTSRKESD  1268
             +LNFS+F+RP  LA+A+LQN     G     +EK    N  NP K+ LI+  S  RKE+ 
Sbjct  271   VLNFSHFTRPAALAKASLQNIGTMPGSNMPNKEKGCAANGNNPPKSGLIDTGSGLRKETS  330

Query  1269  LKSQ----------PNLRTKFEQT------------DASREDTNDADKVH--------GN  1358
                Q          P+     E+             DAS+ D N++            G 
Sbjct  331   AHCQVVASSGVNLKPSEARSLEEPCAAKDSEAVCREDASKNDINNSFPCESTNRALPDGE  390

Query  1359  KAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaapar  1535
             K +EP   SS   SG+S ERAS+D +H LKR+ R+ E+S C SED +EES G KK AP R
Sbjct  391   KNIEPVVASSSVCSGNSVERASDDPTHVLKRKFRDTEDSECHSEDVEEESVGVKKTAPPR  450

Query  1536  ggtgQKRSRAAEVHNLSER-------------RRRDRINEKMRALQELIPNCNKADKASM  1676
                  KRSRAAEVHNLSER             RRRDRINEKMRALQELIPNCNK DKASM
Sbjct  451   ASGS-KRSRAAEVHNLSERILNGFFIFHLSEQRRRDRINEKMRALQELIPNCNKVDKASM  509

Query  1677  LD  1682
             LD
Sbjct  510   LD  511


 Score = 94.4 bits (233),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 82/149 (55%), Gaps = 21/149 (14%)
 Frame = +3

Query  423  MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
            MPLSE  ++ K     R  ++   ++     G+D  ELVWENGQIT QGQSS+ +K    
Sbjct  1    MPLSELYRLAK----RRVDSNQDFEN-----GNDVFELVWENGQITTQGQSSRVRKEPTC  51

Query  603  SRM------------REKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAP  746
            + +            R+K +GN ++++ GK     SVL+E+P SVPS  + LS DD++ P
Sbjct  52   NSLPSHCLPSYTPKSRDKDLGNGTTTKTGKFGTVDSVLNEIPMSVPSDGVGLSHDDDMMP  111

Query  747  WLNYSPSNGQSQEYGSQLLPEISGTTANE  833
            WLNY        EY    LPE+SG T NE
Sbjct  112  WLNYPMDGSLQHEYCRDFLPELSGVTVNE  140



>gb|AES82347.2| phytochrome-interacting factor 3.1 [Medicago truncatula]
Length=691

 Score =   140 bits (353),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 151/493 (31%), Positives = 231/493 (47%), Gaps = 87/493 (18%)
 Frame = +3

Query  420   IMPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSS---KAKK  590
             +MPL E   M K +   ++  +S A D S +P +D  ELVW+N QI + GQSS   +AK 
Sbjct  1     MMPLHELYHMSKEKVDHKEMNNSCAPDQSSVPRNDLFELVWQNDQILVHGQSSNSNRAKM  60

Query  591   SDNLS----RMREKCVG---NASSSRIGKL-DLAGSVLDEMPPSVPSGEMDLSQDDEIA-  743
             +  L     +  +K  G   N +++RIGK  DL   + + +  SV S     SQD+++  
Sbjct  61    TPTLPSHTLKGHDKYSGQHANETNTRIGKFEDLDNGLNEIITRSVSS-----SQDEDLMT  115

Query  744   --PWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLD  917
               PWLN +  +  S  Y S  + E  G   N+ +  + F L+    + +           
Sbjct  116   MMPWLNCAMDDEHSLHYSSCFVHE-PGARTNDFAATNKFSLLDRKSNCIQV-------FS  167

Query  918   CSPRFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPP-----------QAKN  1064
              S + G+L+  SS          S++ +S   +N+ S+L+   P               N
Sbjct  168   DSHKQGILSKGSSLAVEDF--DTSELKTSTNQLNMSSLLQQCQPSFESIRFRESGLSENN  225

Query  1065  QDTETTRTCP----------PTLLNFSNFSRPVVLARANLQNT------LEAKGKREKEI  1196
                   +  P           T++NF++F++P  + +ANLQN        E  G + K+ 
Sbjct  226   TKGNANQHAPCEEISHVPSSSTVMNFTHFAKPAAIVKANLQNIGFSSSRSERVGAKNKDA  285

Query  1197  KENAQNPAKTALIE-----------ACSTSRKESDLKSQPNLRTKFEQ-----TDASRED  1328
                 +NP +++ ++            C  S + S +  +P      E+     T A +ED
Sbjct  286   AAIGRNPCESSKVDLSVECPKSSAIHCHQSVEPSRVGLKPLEPKSLEKNTTVSTSACKED  345

Query  1329  TNDADKVHGNKAVEPgacssvcsgssaE---------------RASNDQSHSLKRRAREN  1463
              +  D+       E             E               R+S+D + +LKR+  ++
Sbjct  346   VSKVDQTSNQVLSESSRKGQEVFKKCTELTVASSSVCSDNGVHRSSDDANQNLKRKNLDS  405

Query  1464  EESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELI  1643
             E+S   SED ++ES G K+    RG TG K++R+ EVHNLSERRRRDRINE+MRALQELI
Sbjct  406   EDSEWHSEDFEDESIGVKRTDHGRGVTGSKKNRSTEVHNLSERRRRDRINERMRALQELI  465

Query  1644  PNCNKADKASMLD  1682
             PNCNKADKASMLD
Sbjct  466   PNCNKADKASMLD  478



>ref|XP_002889756.1| hypothetical protein ARALYDRAFT_471048 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66015.1| hypothetical protein ARALYDRAFT_471048 [Arabidopsis lyrata subsp. 
lyrata]
Length=522

 Score =   137 bits (346),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 169/442 (38%), Positives = 222/442 (50%), Gaps = 83/442 (19%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSD-FSELVWENGQITMQGQSSKAKK---  590
             MPL E  ++ + +         SA D +P P  D   ELVWENGQI+ Q QSS+++    
Sbjct  1     MPLFELFRLTQAKL-------ESAQDNNPSPPVDEVVELVWENGQISTQSQSSRSRNIPP  53

Query  591   -SDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPS  767
                N SR+RE  + N S +         +++DE+P SVPS    LSQDD+  PWLN+ PS
Sbjct  54    PQANSSRVRE--IRNGSKA---------TMVDEIPMSVPSLMTGLSQDDDFVPWLNHHPS  102

Query  768   NGQSQEYGSQLLPEISGTTANEPSP-----HDGFPLIGASKSVVNSGQRNATKLDCSPRF  932
                   Y S  L ++S  T NE         + FPL        N G  +A+        
Sbjct  103   ---LDGYCSDFLRDMSPVTVNEQESDMAVNQNVFPLFQRR----NDGNESASAA------  149

Query  933   GLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAK-NQDTETTRTC----PP  1097
                   SS Q N         G  + S+      +D    QAK +Q T+T         P
Sbjct  150   ------SSSQYN---------GFQSQSVYGSDRARDPASLQAKPDQFTQTQEPLILSNKP  194

Query  1098  TLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRK---ESD  1268
             +L+NFS+F RP  LA+ N        G +EK   ++  N  +T ++ A  +  K   ES 
Sbjct  195   SLVNFSHFLRPATLAKTN-----NPHGSKEKS-PQSPPNVFQTRVLGAKDSEDKVLNESV  248

Query  1269  LKSQP--NLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSL  1442
               + P  N +      D+ R+D          KAV    CSSV SG+S +  S   S SL
Sbjct  249   ASAMPKDNQKACLITEDSCRKDQ------ESEKAV---VCSSVGSGNSLDGPSESPSLSL  299

Query  1443  KRRARENEESGC-PSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRINE  1616
             KR+  + ++  C  SED +EES   +K A  +R G G KRSR+AEVHNLSERRRRDRINE
Sbjct  300   KRKHSDIQDIDCRHSEDVEEESGDGRKEAGPSRTGLGSKRSRSAEVHNLSERRRRDRINE  359

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIPNCNK DKASMLD
Sbjct  360   KMRALQELIPNCNKVDKASMLD  381



>ref|XP_009335549.1| PREDICTED: transcription factor PIF3-like isoform X2 [Pyrus x 
bretschneideri]
Length=607

 Score =   136 bits (343),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 112/274 (41%), Positives = 147/274 (54%), Gaps = 53/274 (19%)
 Frame = +3

Query  987   SDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQNTL  1166
             + I S+ GS  +     D V P   N          P+++NFS+FSRP  LA+AN+Q   
Sbjct  125   THISSAGGSPGMKIPRPDPVTPSNNN----------PSIVNFSHFSRPAALAKANVQTNG  174

Query  1167  EAKG----------KREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNL-RTKFE---  1304
                G           ++K     + +  ++ LI++ S++ KES+ + Q  L R+  E   
Sbjct  175   VMAGSGSSSMIRIANKDKFSSATSNSLPESMLIDSSSSAPKESNSQCQQILVRSSVELKP  234

Query  1305  -------------------QTDASREDTND-------ADKV--HGNKAVEPgacssvcsg  1400
                                Q + S+ D N        A +V  +G K VEP   SSVCSG
Sbjct  235   TEAKHLEEPCTAKRSEGTCQEETSKNDINSNHIPCESAVRVSPNGEKTVEPVVASSVCSG  294

Query  1401  ssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHN  1580
             +S ER S+D + +LKR+ RE +ES C S+D +EE     K      G G KRSRAAEVHN
Sbjct  295   NSVERGSDDPTQALKRKFRETDESECHSDDVEEE-YMGVKKGAHARGMGSKRSRAAEVHN  353

Query  1581  LSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             LSER+RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  354   LSERKRRDRINEKMRALQELIPNCNKVDKASMLD  387



>ref|XP_009148251.1| PREDICTED: transcription factor PIF3 isoform X2 [Brassica rapa]
Length=528

 Score =   135 bits (340),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 151/444 (34%), Positives = 206/444 (46%), Gaps = 105/444 (24%)
 Frame = +3

Query  405   LCSLSIMPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKA  584
             +C  + MPL E  + L N + E      + D+ +  P  +  ELVWENGQI+ Q QSS++
Sbjct  29    VCKGTTMPLFELFR-LANANVEY-----AQDENTSPPVDEVVELVWENGQISTQSQSSRS  82

Query  585   K-----KSDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPW  749
             +     +S + +R RE   G  ++           ++DE+P SVPS    LSQDD++ PW
Sbjct  83    RNIPPPQSIHQARAREIGTGPKAT-----------MVDEIPMSVPSLMTGLSQDDDLVPW  131

Query  750   LNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPR  929
             LN  P +     Y S LL ++S  T NE    D FP         N+G  +A        
Sbjct  132   LN--PHHQSLDGYCSDLLHDVSPVTVNE-QESDAFPR-------RNNGDESA--------  173

Query  930   FGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPTLLN  1109
                  + SS Q N         G  + S+      KD   P  + Q+   T +  P LLN
Sbjct  174   ----PAASSSQFN---------GFDSHSLYGTGRAKD---PVTQRQEPLVT-SNKPGLLN  216

Query  1110  FSNFSRPVVLARAN----------LQNTLEAK--GKREKEIKENAQNPAKTALIEACSTS  1253
             FS+F R   LA+ N            N  + +  G ++K + E   N  KT L+      
Sbjct  217   FSHFLRTAALAKTNNVSKEKSPQSPPNVFQTRVLGAKDKVLNEPKDNNQKTCLVS-----  271

Query  1254  RKESDLKSQPNLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQS  1433
              ++S+ K Q + +     +  S           GN    P                    
Sbjct  272   -EDSNRKEQESEKAVVCSSVGS-----------GNSLDGPSES-----------------  302

Query  1434  HSLKRRARENEESGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRI  1610
               LKR+  + ++  C SED + ES   +K    +R G G KRSR+AEVHNLSERRRRDRI
Sbjct  303   -PLKRKRLDVQDIECHSEDVEGESGDGRKETAPSRTGIGSKRSRSAEVHNLSERRRRDRI  361

Query  1611  NEKMRALQELIPNCNKADKASMLD  1682
             NEKMRALQELIPNCNK DKASMLD
Sbjct  362   NEKMRALQELIPNCNKVDKASMLD  385



>ref|XP_009148249.1| PREDICTED: transcription factor PIF3 isoform X1 [Brassica rapa]
Length=530

 Score =   135 bits (340),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 151/444 (34%), Positives = 206/444 (46%), Gaps = 105/444 (24%)
 Frame = +3

Query  405   LCSLSIMPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKA  584
             +C  + MPL E  + L N + E      + D+ +  P  +  ELVWENGQI+ Q QSS++
Sbjct  31    VCKGTTMPLFELFR-LANANVEY-----AQDENTSPPVDEVVELVWENGQISTQSQSSRS  84

Query  585   K-----KSDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPW  749
             +     +S + +R RE   G  ++           ++DE+P SVPS    LSQDD++ PW
Sbjct  85    RNIPPPQSIHQARAREIGTGPKAT-----------MVDEIPMSVPSLMTGLSQDDDLVPW  133

Query  750   LNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPR  929
             LN  P +     Y S LL ++S  T NE    D FP         N+G  +A        
Sbjct  134   LN--PHHQSLDGYCSDLLHDVSPVTVNE-QESDAFPR-------RNNGDESA--------  175

Query  930   FGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPTLLN  1109
                  + SS Q N         G  + S+      KD   P  + Q+   T +  P LLN
Sbjct  176   ----PAASSSQFN---------GFDSHSLYGTGRAKD---PVTQRQEPLVT-SNKPGLLN  218

Query  1110  FSNFSRPVVLARAN----------LQNTLEAK--GKREKEIKENAQNPAKTALIEACSTS  1253
             FS+F R   LA+ N            N  + +  G ++K + E   N  KT L+      
Sbjct  219   FSHFLRTAALAKTNNVSKEKSPQSPPNVFQTRVLGAKDKVLNEPKDNNQKTCLVS-----  273

Query  1254  RKESDLKSQPNLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQS  1433
              ++S+ K Q + +     +  S           GN    P                    
Sbjct  274   -EDSNRKEQESEKAVVCSSVGS-----------GNSLDGPSES-----------------  304

Query  1434  HSLKRRARENEESGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRI  1610
               LKR+  + ++  C SED + ES   +K    +R G G KRSR+AEVHNLSERRRRDRI
Sbjct  305   -PLKRKRLDVQDIECHSEDVEGESGDGRKETAPSRTGIGSKRSRSAEVHNLSERRRRDRI  363

Query  1611  NEKMRALQELIPNCNKADKASMLD  1682
             NEKMRALQELIPNCNK DKASMLD
Sbjct  364   NEKMRALQELIPNCNKVDKASMLD  387



>ref|XP_008807924.1| PREDICTED: transcription factor PIF3-like isoform X3 [Phoenix 
dactylifera]
Length=588

 Score =   134 bits (337),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 135/402 (34%), Positives = 190/402 (47%), Gaps = 75/402 (19%)
 Frame = +3

Query  675   VLDEMPPSVPSGEMDL-SQDDEIAPWLNYS-----PSNGQSQEYGSQLLPEISGTTANEP  836
             ++++  PS PS ++ + +QDD++ PW+++      P +    +Y S+ L E  G   N P
Sbjct  4     MVNDFSPSGPSADIGIDAQDDDMVPWISFPIEESLPKDALQNDYCSEFLNEFPGANLNSP  63

Query  837   SPHDGFPLIGASKSVVNSGQ--RNATKLDCSPRFGLLASWS------SQQANPLVSGVSD  992
             S ++       S  +   GQ  RN+   +        A  S      + Q          
Sbjct  64    SAYNKRTAADGSSGL---GQDIRNSHSAEHEHALKAFAESSEPSRVRTSQLFQFSQHCQS  120

Query  993   IGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPTL----LNFSNFSRPVVLARANLQN  1160
                S+ S   D+ + DS     +NQ+  + +  PP L    LNFS+FSRP +LA+ANL  
Sbjct  121   SAPSSKSRATDTGIGDSTRTHLQNQNPSSAK--PPQLNGGMLNFSHFSRPAMLAKANLHG  178

Query  1161  TLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQ-----PNLRTK---------  1298
              ++ K   EK       N  ++ LIE+       + ++ Q     P +  +         
Sbjct  179   -VDGKRTNEKASAPLNINTVESTLIESACVFESATGVQGQSVSVPPGMELRSPVKLPQEV  237

Query  1299  --------FEQTDASREDTNDADKVHGN-------------------------KAVEPga  1379
                       Q DASR+  ND++ +H N                         KA E   
Sbjct  238   IPVEHSEAICQQDASRK--NDSNILHNNCSKPADQPASSSVAASAALRRHKTEKAPEVAV  295

Query  1380  cssvcsgssaE-RASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKR  1556
              SS    +++   ASND     KR++RE EESG  SED ++ S   +K A  RG    KR
Sbjct  296   ASSSVCSANSAGAASNDPKQGDKRKSREGEESGYQSEDFEDVSVDLRKPATGRGMGA-KR  354

Query  1557  SRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             SRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASML+
Sbjct  355   SRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLE  396



>emb|CDX94963.1| BnaC05g07080D [Brassica napus]
Length=498

 Score =   132 bits (331),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 149/432 (34%), Positives = 196/432 (45%), Gaps = 86/432 (20%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSD-FSELVWENGQITMQGQSSKAKK---  590
             MPL E  + L N + E       A D +P P  D   ELVWENGQI+ Q QSS+ +    
Sbjct  1     MPLFELFR-LANANVEY------AQDENPSPPVDEVVELVWENGQISTQSQSSRPRNIPP  53

Query  591   SDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSN  770
               ++ + R + +GN   +         +++DE+  SVPS    LSQDD++ PWLN   S 
Sbjct  54    PQSIHQARARELGNGPKA---------TMVDEIQMSVPSLMTGLSQDDDLVPWLNPHQS-  103

Query  771   GQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPRFGLLASW  950
                  Y S LL + S  T NE    D FP         N+G  +A             + 
Sbjct  104   --LDGYCSDLLRDASPVTVNE-QETDAFPR-------RNNGNESA------------PAA  141

Query  951   SSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPT-LLNFSNFSR  1127
             SS Q N       D  S  G+      +     P   +Q  E   T   T LLNFS+F R
Sbjct  142   SSSQFNGF-----DSHSLYGTGRAGDPVSQPAKPDRFSQRLEPLVTSNKTGLLNFSHFLR  196

Query  1128  PVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNLRTKFEQ  1307
                LA+ N        G +EK   ++  N  +T ++ A     K+       N +     
Sbjct  197   TAALAKTNNN----PPGSKEKS-PQSPPNVFQTRVLGAKDNEPKD-------NQKACLVS  244

Query  1308  TDASREDTNDADKV------HGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENEE  1469
              D++R++      V       GN    P                      LKR+  + ++
Sbjct  245   EDSNRKEQESEKAVVCSSVGSGNSLDGPSES------------------PLKRKHLDVQD  286

Query  1470  SGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIP  1646
               C SED + ES   +K A  +R   G KRSR+AEVHNLSERRRRDRINEKMRALQELIP
Sbjct  287   IDCHSEDVEGESGDGRKEAAPSRTSIGSKRSRSAEVHNLSERRRRDRINEKMRALQELIP  346

Query  1647  NCNKADKASMLD  1682
             NCNK DKASMLD
Sbjct  347   NCNKVDKASMLD  358



>gb|AEK06077.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06078.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06079.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06081.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06082.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06084.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06085.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06086.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06087.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06088.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06089.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06090.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06091.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06092.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06093.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06094.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06095.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
 gb|AEK06096.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
Length=589

 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 136/228 (60%), Gaps = 39/228 (17%)
 Frame = +3

Query  1098  TLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKS  1277
             +L+NFS+F+RP  L +ANLQN +  +        E  QN  K ++        KE+D   
Sbjct  140   SLMNFSHFARPAALVKANLQN-VGMRASSGTSSMERMQNKDKGSI-----GLPKETDSHC  193

Query  1278  QPNL---RTKFEQTDA---------------SREDTNDADK-VHGN-------------K  1361
             +PN+   + + + T+                S+E  + +D+  H N             K
Sbjct  194   RPNMMSSKVEVKPTEVKPAEGSVPAELPEEMSQEGDSKSDRNCHQNFGESAIKGLEDVEK  253

Query  1362  AVEP-gacssvcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparg  1538
               EP  A SSV SG+SAER S+D + +LKR+ R+ EES  PSEDA+EES GAKK A AR 
Sbjct  254   TTEPLVASSSVGSGNSAERPSDDPTENLKRKHRDTEESEGPSEDAEEESVGAKKPASARA  313

Query  1539  gtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             G G KR RAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  314   GNGSKRGRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  361



>gb|AEK06083.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
Length=589

 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 136/228 (60%), Gaps = 39/228 (17%)
 Frame = +3

Query  1098  TLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKS  1277
             +L+NFS+F+RP  L +ANLQN +  +        E  QN  K ++        KE+D   
Sbjct  140   SLMNFSHFARPAALVKANLQN-VGMRASSGTSSMERMQNKDKGSI-----GLPKETDSHC  193

Query  1278  QPNL---RTKFEQTDA---------------SREDTNDADK-VHGN-------------K  1361
             +PN+   + + + T+                S+E  + +D+  H N             K
Sbjct  194   RPNMMSSKVEVKPTEVKPAEGSVPAELPEEMSQEGDSKSDRNCHQNFGESAIKGLEDVEK  253

Query  1362  AVEP-gacssvcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparg  1538
               EP  A SSV SG+SAER S+D + +LKR+ R+ EES  PSEDA+EES GAKK A AR 
Sbjct  254   TTEPLVASSSVGSGNSAERPSDDPTENLKRKHRDTEESEGPSEDAEEESVGAKKPASARA  313

Query  1539  gtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             G G KR RAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  314   GNGSKRGRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  361



>gb|AEK06076.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
Length=589

 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 136/228 (60%), Gaps = 39/228 (17%)
 Frame = +3

Query  1098  TLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKS  1277
             +L+NFS+F+RP  L +ANLQN +  +        E  QN  K ++        KE+D   
Sbjct  140   SLMNFSHFARPAALVKANLQN-VGMRASSGTSSMERMQNKDKGSI-----GLPKETDSHC  193

Query  1278  QPNL---RTKFEQTDA---------------SREDTNDADK-VHGN-------------K  1361
             +PN+   + + + T+                S+E  + +D+  H N             K
Sbjct  194   RPNMMSSKVEVKPTEVKPAEGSVPAELPEEMSQEGDSKSDRNCHQNFGESAIKGLEDVEK  253

Query  1362  AVEP-gacssvcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparg  1538
               EP  A SSV SG+SAER S+D + +LKR+ R+ EES  PSEDA+EES GAKK A AR 
Sbjct  254   TTEPLVASSSVGSGNSAERPSDDPTENLKRKHRDTEESEGPSEDAEEESVGAKKPASARA  313

Query  1539  gtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             G G KR RAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  314   GNGSKRGRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  361



>emb|CDY64745.1| BnaA06g37850D [Brassica napus]
Length=502

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 146/439 (33%), Positives = 204/439 (46%), Gaps = 99/439 (23%)
 Frame = +3

Query  423   MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK--  590
             MPL E  ++     E  + + TS + D++         ELVWENGQI+ Q QSS+++   
Sbjct  1     MPLFELFRLANANVEYAQDENTSPTVDEVI--------ELVWENGQISTQSQSSRSRNIP  52

Query  591   -SDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN-YSP  764
                ++ + R + +G  S +         +++DE+P SVPS    LSQDD++ PWLN +  
Sbjct  53    PPQSIHQARAREIGTGSKA---------TMVDEIPMSVPSLMTGLSQDDDLVPWLNPHQS  103

Query  765   SNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPRFGLLA  944
              +G    Y S LL ++S  T NE    D FP         N+G  +A             
Sbjct  104   LDG----YCSDLLHDVSPVTVNE-QESDAFPR-------RNNGNESA------------P  139

Query  945   SWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPTLLNFSNFS  1124
             + SS Q N   S  S  G+       D + + + P Q   +      +  P LLNFS+F 
Sbjct  140   AASSSQFNGFDSH-SLYGTGRAR---DPVSQPAKPDQFTQRQEPLVTSNKPGLLNFSHFL  195

Query  1125  RPVVLARAN----------LQNTLEAK--GKREKEIKENAQNPAKTALIEACSTSRKESD  1268
             R   LA+ N            N  + +  G ++K + E   N  K  L+       ++S+
Sbjct  196   RTAALAKTNNVSKEKSPQSPPNVFQTRVLGAKDKVLNEPKDNNQKVCLVS------EDSN  249

Query  1269  LKSQPNLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSLKR  1448
              K Q + +     +  S           GN    P                      LKR
Sbjct  250   RKEQESEKAVVCSSVGS-----------GNSLDGPSES------------------PLKR  280

Query  1449  RARENEESGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRINEKMR  1625
             +  + ++  C SED + ES   +K A  +R G G KRSR+AEVHNLSERRRRDRINEKMR
Sbjct  281   KHLDVQDIECHSEDVEGESGDGRKEAAPSRTGMGSKRSRSAEVHNLSERRRRDRINEKMR  340

Query  1626  ALQELIPNCNKADKASMLD  1682
             ALQELIPNCNK DKASMLD
Sbjct  341   ALQELIPNCNKVDKASMLD  359



>gb|AEK06080.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
Length=589

 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 136/228 (60%), Gaps = 39/228 (17%)
 Frame = +3

Query  1098  TLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKS  1277
             +L+NFS+F+RP  L +ANLQN +  +        E  QN  K ++        KE+D   
Sbjct  140   SLMNFSHFARPAALVKANLQN-VGMRASSGTSSMERMQNKDKGSI-----GLPKETDSHC  193

Query  1278  QPNL---RTKFEQTDA---------------SREDTNDADK-VHGN-------------K  1361
             +PN+   + + + T+                S+E  + +D+  H N             K
Sbjct  194   RPNMMSSKVEVKPTEVKPAEGSVPAELPEEMSQEGDSKSDRNCHQNFGESAIKGLEDVEK  253

Query  1362  AVEP-gacssvcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparg  1538
               EP  A SSV SG+SAER S+D + +LKR+ R+ EES  PSEDA+EES GAKK A AR 
Sbjct  254   TTEPLVASSSVGSGNSAERPSDDPTENLKRKHRDTEESEGPSEDAEEESVGAKKPASARA  313

Query  1539  gtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             G G KR RAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  314   GNGSKRGRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  361



>ref|XP_009401973.1| PREDICTED: transcription factor PIF3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=585

 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 140/463 (30%), Positives = 212/463 (46%), Gaps = 96/463 (21%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSP--------LPGSDFSELVWENGQITMQGQSS  578
             MPLSEF +     S  +K  ++ ++ ++         +P ++F EL+WENG + MQG+S+
Sbjct  1     MPLSEFYQ----ASARKKFDAAQSNKMASRSSNRSSSMPDNEFVELLWENGPVVMQGKSN  56

Query  579   KAKKSD----NLSRMREKCVGNASSS-----RIGKLDLAGSVLDEMPPSVPSGEMDL--S  725
             + +K+     N S   ++  G  S++     ++G L+     +    PS PSG   +  +
Sbjct  57    RPRKTSIATTNFSLPADRAEGKDSTAIANMPKLGVLEAMDPFVSNFSPSDPSGNAGIIST  116

Query  726   QDDEIAPWLNYS-PSNGQSQEYGSQLLPEISGTT--ANEPSPHDGFPLIGASKSVVNSGQ  896
             Q D + PW+NY    +  S  Y S+   EISG +  ANE   ++ F   G S   V  G 
Sbjct  117   QFDNMVPWINYPIEEDPASSNYCSEFFSEISGISMPANE---NNSF---GHSTPYVEHG-  169

Query  897   RNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSI-NLDSILKDSVPPQAKNQDT  1073
                                      +VS   + GS   S+ ++ S +++S      + D 
Sbjct  170   -------------------------IVSKALEAGSCQSSLPSIMSRIENSPKKDVSSMD-  203

Query  1074  ETTRTCPPTLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTS  1253
                      L+N S F RP +  +ANLQ+               + N  ++ +I++CS  
Sbjct  204   ---------LMNSSLFLRPGMKGKANLQSV------ENSATATASSNRIESTVIQSCSGL  248

Query  1254  RKESDLKSQPNLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaER------  1415
             +  S ++ + N  +   +  +S E   +   V   + V           S  E+      
Sbjct  249   QSTSGIQGELNSVSSMLEMGSSAETPREIASVEPLEDVCEQDMPRKNLKSVIEKDHEAIA  308

Query  1416  -------------ASNDQSHSLKRRARENEESGCPSEDADEESagakk-aaparggtgQK  1553
                          AS D +   KR+  + EE G   ED ++ S  ++K  A A  G   K
Sbjct  309   ASSSVGSGNTAGTASGDPAQGAKRK-NQGEECGNHKEDLEDASTPSRKPDADAAKGRNAK  367

Query  1554  RSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             RSRAAEVHNLSERRRRDRINEKMRALQELIPNC+K DKASMLD
Sbjct  368   RSRAAEVHNLSERRRRDRINEKMRALQELIPNCSKVDKASMLD  410



>gb|AEK06075.1| phytochrome-interacting factor 3.1 [Populus balsamifera]
Length=589

 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 136/228 (60%), Gaps = 39/228 (17%)
 Frame = +3

Query  1098  TLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKS  1277
             +L+NFS+F+RP  L +ANLQN +  +        E  QN  K ++        KE+D   
Sbjct  140   SLMNFSHFARPAALVKANLQN-VGMRASSGTSSMERMQNKDKGSI-----GLPKETDSHC  193

Query  1278  QPNL---RTKFEQTDA---------------SREDTNDADK-VHGN-------------K  1361
             +PN+   + + + T+                S+E  + +D+  H N             K
Sbjct  194   RPNMMSSKVEVKPTEVKPAEGSVPAELPEEMSQEGDSKSDRNCHQNFGESAIKGLEDVEK  253

Query  1362  AVEP-gacssvcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparg  1538
               EP  A SSV SG+SAER S+D + +LKR+ R+ EES  PSEDA+EES GAKK A AR 
Sbjct  254   TTEPLVASSSVGSGNSAERPSDDPTENLKRKHRDTEESEGPSEDAEEESVGAKKPASARA  313

Query  1539  gtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             G G KR RAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  314   GNGSKRGRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  361



>ref|XP_009401971.1| PREDICTED: transcription factor PIF3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401972.1| PREDICTED: transcription factor PIF3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=606

 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 140/463 (30%), Positives = 212/463 (46%), Gaps = 96/463 (21%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSP--------LPGSDFSELVWENGQITMQGQSS  578
             MPLSEF +     S  +K  ++ ++ ++         +P ++F EL+WENG + MQG+S+
Sbjct  1     MPLSEFYQ----ASARKKFDAAQSNKMASRSSNRSSSMPDNEFVELLWENGPVVMQGKSN  56

Query  579   KAKKSD----NLSRMREKCVGNASSS-----RIGKLDLAGSVLDEMPPSVPSGEMDL--S  725
             + +K+     N S   ++  G  S++     ++G L+     +    PS PSG   +  +
Sbjct  57    RPRKTSIATTNFSLPADRAEGKDSTAIANMPKLGVLEAMDPFVSNFSPSDPSGNAGIIST  116

Query  726   QDDEIAPWLNYS-PSNGQSQEYGSQLLPEISGTT--ANEPSPHDGFPLIGASKSVVNSGQ  896
             Q D + PW+NY    +  S  Y S+   EISG +  ANE   ++ F   G S   V  G 
Sbjct  117   QFDNMVPWINYPIEEDPASSNYCSEFFSEISGISMPANE---NNSF---GHSTPYVEHG-  169

Query  897   RNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSI-NLDSILKDSVPPQAKNQDT  1073
                                      +VS   + GS   S+ ++ S +++S      + D 
Sbjct  170   -------------------------IVSKALEAGSCQSSLPSIMSRIENSPKKDVSSMD-  203

Query  1074  ETTRTCPPTLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTS  1253
                      L+N S F RP +  +ANLQ+               + N  ++ +I++CS  
Sbjct  204   ---------LMNSSLFLRPGMKGKANLQSV------ENSATATASSNRIESTVIQSCSGL  248

Query  1254  RKESDLKSQPNLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaER------  1415
             +  S ++ + N  +   +  +S E   +   V   + V           S  E+      
Sbjct  249   QSTSGIQGELNSVSSMLEMGSSAETPREIASVEPLEDVCEQDMPRKNLKSVIEKDHEAIA  308

Query  1416  -------------ASNDQSHSLKRRARENEESGCPSEDADEESagakk-aaparggtgQK  1553
                          AS D +   KR+  + EE G   ED ++ S  ++K  A A  G   K
Sbjct  309   ASSSVGSGNTAGTASGDPAQGAKRK-NQGEECGNHKEDLEDASTPSRKPDADAAKGRNAK  367

Query  1554  RSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             RSRAAEVHNLSERRRRDRINEKMRALQELIPNC+K DKASMLD
Sbjct  368   RSRAAEVHNLSERRRRDRINEKMRALQELIPNCSKVDKASMLD  410



>ref|XP_011023895.1| PREDICTED: transcription factor PIF3-like [Populus euphratica]
Length=710

 Score =   131 bits (330),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 131/226 (58%), Gaps = 37/226 (16%)
 Frame = +3

Query  1098  TLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKS  1277
             +L+NFS+F+RP  L +ANLQN +  +        E  QN  K +         KE+D   
Sbjct  265   SLMNFSHFARPAALVKANLQN-VGMRASSGTSSMERMQNKDKGSF-----GLPKETDSHC  318

Query  1278  QPNLR--------TKFEQTDASRE---------DTNDADKVHGN-------------KAV  1367
             +PN+         T+ +  + S E         D+      H N             K  
Sbjct  319   RPNMMSSKVEVKPTEVKPAEGSAELPEEMSQEGDSKSDRNCHQNSGESAIKGLEDVEKTT  378

Query  1368  EP-gacssvcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggt  1544
             EP  A SSV SG+SAER S+D + +LKR+ R+ EES  PSEDA+EES GAKK A AR G 
Sbjct  379   EPLVASSSVGSGNSAERPSDDPTENLKRKHRDTEESEGPSEDAEEESVGAKKPASARAGN  438

Query  1545  gQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             G KR RAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  439   GSKRGRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  484


 Score = 97.8 bits (242),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 91/154 (59%), Gaps = 16/154 (10%)
 Frame = +3

Query  423  MPLSEFL-KMLKNE---SGERKPTSSSADDLSPL-PGSDFSELVWENGQITMQGQSSKAK  587
            MPLSE L +M K +   S E+ P  S+  DLS + P +DF EL+WENGQI    Q S+A+
Sbjct  1    MPLSELLYRMAKGQTDSSQEKNPACST--DLSFVRPENDFGELIWENGQI----QYSRAR  54

Query  588  KSDNLS----RMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
            K    +    ++R+K +GN ++++ GK     S L+E+  +VP+ E+  +QDD++ PWLN
Sbjct  55   KIQTCNSLPPKIRDKDIGNGTNTKTGKFGTMESTLNELL-AVPAVEVRANQDDDMVPWLN  113

Query  756  YSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFP  857
            Y        +Y S  LPE+SG T NE S    FP
Sbjct  114  YPLDEPLQHDYCSDFLPELSGVTVNEHSSQSNFP  147



>gb|KDP23327.1| hypothetical protein JCGZ_23160 [Jatropha curcas]
Length=738

 Score =   131 bits (329),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 133/239 (56%), Gaps = 46/239 (19%)
 Frame = +3

Query  1098  TLLNFSNFSRPVVLARANLQNT----------LEAKGKREKEIKENAQNPAKTALIEACS  1247
             +L+NFS+FSRP  L +ANL N           +E  G ++K    +  NP +   ++   
Sbjct  270   SLMNFSHFSRPASLVKANLHNIGTRAGSGISNIETMGGKDKGSDTSNSNPVEPTCVDTFG  329

Query  1248  TSRKESDLKSQPNLRTKFEQTDAS--------------------REDTNDADKVH-----  1352
                K+   +SQP + +   + DA                     +ED +  D+ H     
Sbjct  330   GLPKDLSSQSQPIMVSS--KVDAKPLNHKPTEELLPAKQPEALDQEDDSKNDRSHCQIAE  387

Query  1353  --------GNKAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPSEDADEES  1505
                       K  EP   SS   SG+S ER S + +  LKR+ +E EES  PSED +EES
Sbjct  388   SAIRGLADSGKNAEPVVASSSVCSGNSVERVSEEPTQDLKRKYQEIEESEGPSEDVEEES  447

Query  1506  agakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
              GAK+AAPARG TG KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  448   VGAKRAAPARGSTGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  506


 Score =   107 bits (267),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 92/148 (62%), Gaps = 17/148 (11%)
 Frame = +3

Query  423  MPLSEFLKMLK----NESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK  590
            MPLSE +  L     + S E+ PT  +  DLS  P +DF ELVWENGQ+    QSSK +K
Sbjct  1    MPLSELVYRLAKGKFDSSQEKNPTYLT--DLSSAPENDFLELVWENGQV----QSSKGRK  54

Query  591  ---SDNL----SRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPW  749
               S+ L    S++R+K +GN S++++G+    GSVL E+P S+PS E+  +QDD++ PW
Sbjct  55   NQISNGLLSQTSKIRDKDIGNGSNNKMGRFGSMGSVLGEVPMSMPSVELGSNQDDDMVPW  114

Query  750  LNYSPSNGQSQEYGSQLLPEISGTTANE  833
            LNY   +    +Y S+ L E+SG T NE
Sbjct  115  LNYPIDDPLQHDYCSEFLTELSGVTVNE  142



>ref|XP_002319450.2| hypothetical protein POPTR_0013s00310g [Populus trichocarpa]
 gb|EEE95373.2| hypothetical protein POPTR_0013s00310g [Populus trichocarpa]
Length=713

 Score =   130 bits (328),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 131/230 (57%), Gaps = 43/230 (19%)
 Frame = +3

Query  1098  TLLNFSNFSRPVVLARANLQN----------TLEAKGKREK-------------------  1190
             +L+NFS+F+RP  L +ANLQN          ++E    ++K                   
Sbjct  264   SLINFSHFARPAALVKANLQNVGMRASSGTSSMERMQNKDKGSIGLPKETDSHCRPNMMS  323

Query  1191  ---EIKENAQNPAKTAL-IEACSTSRKESDLKSQPNLRTKF-EQTDASREDTNDADKVHG  1355
                E+K     PA+ ++  E      +E D KS  N    F E      ED         
Sbjct  324   SKVEVKPTEVKPAEGSVPAELPEEMSQEGDSKSDRNCHQNFGESAIKGLEDVE-------  376

Query  1356  NKAVEP-gacssvcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaapa  1532
              K  EP  A SSV SG+SAER S+D + +LKR+ R+ EES  PSEDA+EES GAKK A A
Sbjct  377   -KTTEPLVASSSVGSGNSAERPSDDPTENLKRKHRDTEESEGPSEDAEEESVGAKKPASA  435

Query  1533  rggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             R G G KR RAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  436   RAGNGSKRGRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  485


 Score =   102 bits (253),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 91/153 (59%), Gaps = 15/153 (10%)
 Frame = +3

Query  423  MPLSEFL-KMLKNE---SGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKK  590
            MPLSE L +M K +   S E+ P  S+  DLS +P +DF EL+WENGQI    Q S+A+K
Sbjct  1    MPLSELLYRMAKGKTDSSQEKNPACST--DLSFVPENDFGELIWENGQI----QYSRARK  54

Query  591  SDNLS----RMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNY  758
                +    ++R+K +GN ++++ GK     S L+E+  +VP+ E+  +QDD++ PWLNY
Sbjct  55   IQTCNSLPPKIRDKDIGNGTNTKTGKFGTMESTLNELL-AVPAVEVRANQDDDMVPWLNY  113

Query  759  SPSNGQSQEYGSQLLPEISGTTANEPSPHDGFP  857
                    +Y S  LPE+SG T NE S    FP
Sbjct  114  PLDEPLQHDYCSDFLPELSGVTVNEHSSQSNFP  146



>ref|XP_003626129.1| Transcription factor PIF3 [Medicago truncatula]
Length=682

 Score =   130 bits (326),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 147/484 (30%), Positives = 226/484 (47%), Gaps = 87/484 (18%)
 Frame = +3

Query  447   MLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSS---KAKKSDNLS----  605
             M K +   ++  +S A D S +P +D  ELVW+N QI + GQSS   +AK +  L     
Sbjct  1     MSKEKVDHKEMNNSCAPDQSSVPRNDLFELVWQNDQILVHGQSSNSNRAKMTPTLPSHTL  60

Query  606   RMREKCVG---NASSSRIGKL-DLAGSVLDEMPPSVPSGEMDLSQDDEIA---PWLNYSP  764
             +  +K  G   N +++RIGK  DL   + + +  SV S     SQD+++    PWLN + 
Sbjct  61    KGHDKYSGQHANETNTRIGKFEDLDNGLNEIITRSVSS-----SQDEDLMTMMPWLNCAM  115

Query  765   SNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPRFGLLA  944
              +  S  Y S  + E  G   N+ +  + F L+    + +            S + G+L+
Sbjct  116   DDEHSLHYSSCFVHE-PGARTNDFAATNKFSLLDRKSNCIQV-------FSDSHKQGILS  167

Query  945   SWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPP-----------QAKNQDTETTRTC  1091
               SS          S++ +S   +N+ S+L+   P               N      +  
Sbjct  168   KGSSLAVEDF--DTSELKTSTNQLNMSSLLQQCQPSFESIRFRESGLSENNTKGNANQHA  225

Query  1092  P----------PTLLNFSNFSRPVVLARANLQNT------LEAKGKREKEIKENAQNPAK  1223
             P           T++NF++F++P  + +ANLQN        E  G + K+     +NP +
Sbjct  226   PCEEISHVPSSSTVMNFTHFAKPAAIVKANLQNIGFSSSRSERVGAKNKDAAAIGRNPCE  285

Query  1224  TALIEA-----------CSTSRKESDLKSQPNLRTKFEQ-----TDASREDTNDADKVHG  1355
             ++ ++            C  S + S +  +P      E+     T A +ED +  D+   
Sbjct  286   SSKVDLSVECPKSSAIHCHQSVEPSRVGLKPLEPKSLEKNTTVSTSACKEDVSKVDQTSN  345

Query  1356  NKAVEPgacssvcsgssaE---------------RASNDQSHSLKRRARENEESGCPSED  1490
                 E             E               R+S+D + +LKR+  ++E+S   SED
Sbjct  346   QVLSESSRKGQEVFKKCTELTVASSSVCSDNGVHRSSDDANQNLKRKNLDSEDSEWHSED  405

Query  1491  ADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKA  1670
              ++ES G K+    RG TG K++R+ EVHNLSERRRRDRINE+MRALQELIPNCNKADKA
Sbjct  406   FEDESIGVKRTDHGRGVTGSKKNRSTEVHNLSERRRRDRINERMRALQELIPNCNKADKA  465

Query  1671  SMLD  1682
             SMLD
Sbjct  466   SMLD  469



>ref|XP_010271074.1| PREDICTED: transcription factor PIF3 isoform X2 [Nelumbo nucifera]
Length=734

 Score =   130 bits (327),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 133/246 (54%), Gaps = 55/246 (22%)
 Frame = +3

Query  1101  LLNFSNFSRPVVLARANLQ-------------NTLEAKGKREKEIKENAQNPAKTALIEA  1241
             L+NFS+FSRP  + +ANLQ             + L + GK        + NP ++ +IE+
Sbjct  277   LMNFSHFSRPAAVVKANLQSLGAVASPGLSSIDKLRSNGKVPAA---GSGNPLESIMIES  333

Query  1242  CSTSRKESDLKSQ-----------------PNLRTKFEQTDA-SRED-------------  1328
              S SR  +   +Q                 P      EQ++   RED             
Sbjct  334   TSASRSSTGFHNQLASMPVKVDTKPSVPKPPKELLSAEQSEVVCREDGLRKNISPDQFVG  393

Query  1329  -------TNDADKVHGNKAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPS  1484
                    +N  ++    K +EP   SS   S +SA  ASND   +LKR++R+ E+S C S
Sbjct  394   QTSSFAASNAVERPDTEKTMEPMVASSSVCSVNSAGGASNDLKQALKRKSRDAEDSECQS  453

Query  1485  EDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKAD  1664
             ED +EES  A+K AP R GTG KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK D
Sbjct  454   EDVEEESVDARKPAPPRVGTGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVD  513

Query  1665  KASMLD  1682
             KASMLD
Sbjct  514   KASMLD  519


 Score =   110 bits (275),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 90/145 (62%), Gaps = 11/145 (8%)
 Frame = +3

Query  423  MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS-  593
            MP SEFL M K   ES   K T S+  D+  +P ++F ELVWENGQI MQGQS +++KS 
Sbjct  1    MPYSEFLHMAKEKFESNPSKMTCSA--DVPFVPDNEFVELVWENGQILMQGQSGRSRKSP  58

Query  594  ------DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                   ++S++ EK   +A + +IG+L    SVL++   + PSG M L+QD+EI+PWLN
Sbjct  59   SCTNHSSHISKVHEKDGRDAVTPKIGRLGTIESVLNDFSTAGPSGHMGLAQDEEISPWLN  118

Query  756  YSPSNGQSQEYGSQLLPEISGTTAN  830
            YS  +    +Y S+L  E++G   N
Sbjct  119  YSLDDSLQHDYCSELFSELAGVNVN  143



>ref|XP_010233063.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor APG [Brachypodium 
distachyon]
Length=556

 Score =   127 bits (318),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 130/431 (30%), Positives = 183/431 (42%), Gaps = 89/431 (21%)
 Frame = +3

Query  516   GSDFSELVWENGQITMQG-----QSSKAKKSDNLSRMREKCVGNASSSRIGKLDLAGSVL  680
             G++F+EL+WENGQ  + G     Q S        S ++EK  G A  + +     AG   
Sbjct  4     GNEFAELLWENGQAVVHGRRKHPQPSFQPFGTGSSGVQEKHPGGAGDNMMAFTKAAGVFG  63

Query  681   DEMPPSVPSGEMDLSQDDEIAPWLNY----------SPSNGQSQEYGSQLLPEISGTTAN  830
                   + SG    + DD+  PW++Y          +P+   + +Y S    E+    AN
Sbjct  64    GMGIHDLASGLQHENGDDDAVPWIHYPIMEDDNNNNAPAL-TTADYSSDFFSELQEAAAN  122

Query  831   ----EPSPHD-----GFPLIGASKSVVNSGQRNATKLDCSPRFGLLASWSSQQANPLVSG  983
                  PS H      G P+ G+S++     Q                             
Sbjct  123   LGSLPPSNHSTNNNRGTPVAGSSRAASKEIQ-----------------------------  153

Query  984   VSDIGSSNGSINLDSILKDSVPPQAKNQDTETTRTCPPTLLNFSNFSRPVVLARANLQNT  1163
                         L ++   +  PQA+    +  R    +++NFS FSRP  LARA LQ+ 
Sbjct  154   -----------GLSALTTRTAEPQAELAAAKQPRPSD-SVMNFSLFSRPAALARATLQSA  201

Query  1164  LEAKGKREKEIKENAQNPAKTALIEACSTSR---------------KESDLKSQPNLRTK  1298
                +G  +K     A N  ++ +I+  S  R               KE      P L   
Sbjct  202   HRPQGT-DKVPNAAANNRMESTVIQTTSGPRTGPVFVDQRAAWPQQKEVRFAPAPALTAS  260

Query  1299  FE--QTDASREDTNDADKVHGNKAVE-PgacssvcsgssaERASNDQSHSLKRRARENEE  1469
                 Q + +R+  ++   VH + A + P A  +  S  S     ND+    ++R  + E 
Sbjct  261   VGNLQQEMARDKLSNNRVVHKDAARKAPDATVTTSSVCSGNGIVNDEPWHQQKRKIQAEC  320

Query  1470  SGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPN  1649
             S    ED D+ES    ++         KRSR AEVHNLSERRRRDRINEKMRALQELIPN
Sbjct  321   SASQDEDLDDESGALLRSTNRS----MKRSRTAEVHNLSERRRRDRINEKMRALQELIPN  376

Query  1650  CNKADKASMLD  1682
             CNK DKASMLD
Sbjct  377   CNKIDKASMLD  387



>ref|XP_003591254.1| Transcription factor PIF3 [Medicago truncatula]
 gb|AES61505.1| phytochrome-interacting factor 3.1 [Medicago truncatula]
Length=721

 Score =   127 bits (320),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 129/240 (54%), Gaps = 46/240 (19%)
 Frame = +3

Query  1101  LLNFSNFSRPVVLARANLQNT------------LEAKGKREKEIKENAQNPAKTALIEAC  1244
             ++NFS+F+RP  + RANLQN              +  G + K     + NP  +AL+   
Sbjct  269   VMNFSHFARPAAIVRANLQNIGLKSGLNSASARSDIMGVKNKGAASTSSNPPDSALVNPS  328

Query  1245  STSRKE-------------SDLKS------QPNLRTKFEQTDASRED--TNDADKVH---  1352
                 KE             +DLK       +PN     +   A +E+   ND   +    
Sbjct  329   GECSKEPEMRCHKVVEPSKADLKPLQPKSLEPNAVATKQSKPACKENGIKNDQPSIQVLG  388

Query  1353  -----GNKAVEPgacssvcsgss-----aERASNDQSHSLKRRARENEESGCPSEDADEE  1502
                  G+ A + G   +V S S      A+R S+D +  LKR++R+ E+S C SED ++E
Sbjct  389   DNGAKGHAAADKGMEVAVASSSVCSGNGADRGSDDPNRDLKRKSRDTEDSECHSEDVEDE  448

Query  1503  SagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             S G KK A  RG  G KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  449   SVGVKKGAAGRGVAGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  508


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 75/148 (51%), Gaps = 23/148 (16%)
 Frame = +3

Query  423  MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
            MPL E  ++ + +       +S AD  S  P +DF ELVWE+GQI+ QGQSS+ +KS + 
Sbjct  1    MPLYELYRLAREKLDNETNGTSVADQPSS-PENDFFELVWESGQISSQGQSSRGRKSPSC  59

Query  603  SRMREKC--------------VGNASSS---RIGKLDLAGSVLDEMPPSVPSGEMDLSQD  731
              +   C              VG   S+   +IGK     S L+E+P SVPS E+     
Sbjct  60   RSLPSHCLPSHSPRGRDKDKDVGGGFSNNNPKIGKFGDLDSGLNEIPMSVPSREV-----  114

Query  732  DEIAPWLNYSPSNGQSQEYGSQLLPEIS  815
            DE+ PWL+YS       EYGS    E++
Sbjct  115  DEMMPWLDYSMDGSLQHEYGSDFFHELT  142



>ref|XP_004495811.1| PREDICTED: transcription factor PIF3-like isoform X1 [Cicer arietinum]
Length=733

 Score =   126 bits (317),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 132/241 (55%), Gaps = 46/241 (19%)
 Frame = +3

Query  1098  TLLNFSNFSRPVVLARANLQNTLEAKG------------KREKEIKENAQNPAKTALIEA  1241
             +L+NFS+F+RP  + RANLQN     G             + K     + NP  + L+ +
Sbjct  270   SLMNFSHFARPAAIVRANLQNISLKSGLVSASARSDSIAVKNKGAASTSSNPPDSTLVNS  329

Query  1242  CSTSRKESD-----LKSQPNLRTKFEQ-------TDASRED---------TND--ADKVH  1352
                  KE +     +  QP +  K  Q         AS++           ND  +++V 
Sbjct  330   SGDCSKEPETRCQKVAEQPKVDLKPLQPKSLELKVVASKQSEPACKESGVKNDQPSNQVL  389

Query  1353  GN----------KAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPSEDADE  1499
             G+          K VE    SS   SG+ A+R S+D + +LKR++R+ E+S C SED ++
Sbjct  390   GDGVAKGQTTVEKGVEVAVASSSVCSGNGADRGSDDPNQNLKRKSRDTEDSECHSEDVED  449

Query  1500  ESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASML  1679
             ES   KK A  RG  G KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASML
Sbjct  450   ESVVVKKGASGRGVIGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASML  509

Query  1680  D  1682
             D
Sbjct  510   D  510


 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 82/163 (50%), Gaps = 17/163 (10%)
 Frame = +3

Query  423  MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
            MPL E  ++ +   G     +S AD  S    +DF ELVWE+GQI+ QGQSS+ +KS + 
Sbjct  1    MPLYELYRLARENLGNETNNTSVADQPSESE-NDFFELVWESGQISSQGQSSRVRKSPSC  59

Query  603  SRMREKCV---------------GNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDE  737
                  C+               G  ++ R GK     + L+E+P SVPS  +D+ QD++
Sbjct  60   RSFPSHCLPSHSPRGRDKDIGVGGYGNNPRTGKFGDLETGLNEIPMSVPSHVVDVGQDED  119

Query  738  IAPWLNYSPSNGQSQEYGSQLLPEISGTTANE-PSPHDGFPLI  863
            + PWL+YS       EYGS  L E+     N  P+  + F L+
Sbjct  120  MMPWLDYSMDGSFQNEYGSNFLHELPSVAGNNLPAASNNFTLL  162



>ref|XP_004495812.1| PREDICTED: transcription factor PIF3-like isoform X2 [Cicer arietinum]
Length=723

 Score =   126 bits (317),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 132/241 (55%), Gaps = 46/241 (19%)
 Frame = +3

Query  1098  TLLNFSNFSRPVVLARANLQNTLEAKG------------KREKEIKENAQNPAKTALIEA  1241
             +L+NFS+F+RP  + RANLQN     G             + K     + NP  + L+ +
Sbjct  270   SLMNFSHFARPAAIVRANLQNISLKSGLVSASARSDSIAVKNKGAASTSSNPPDSTLVNS  329

Query  1242  CSTSRKESD-----LKSQPNLRTKFEQ-------TDASRED---------TND--ADKVH  1352
                  KE +     +  QP +  K  Q         AS++           ND  +++V 
Sbjct  330   SGDCSKEPETRCQKVAEQPKVDLKPLQPKSLELKVVASKQSEPACKESGVKNDQPSNQVL  389

Query  1353  GN----------KAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPSEDADE  1499
             G+          K VE    SS   SG+ A+R S+D + +LKR++R+ E+S C SED ++
Sbjct  390   GDGVAKGQTTVEKGVEVAVASSSVCSGNGADRGSDDPNQNLKRKSRDTEDSECHSEDVED  449

Query  1500  ESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASML  1679
             ES   KK A  RG  G KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASML
Sbjct  450   ESVVVKKGASGRGVIGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASML  509

Query  1680  D  1682
             D
Sbjct  510   D  510


 Score = 88.2 bits (217),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 82/163 (50%), Gaps = 17/163 (10%)
 Frame = +3

Query  423  MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
            MPL E  ++ +   G     +S AD  S    +DF ELVWE+GQI+ QGQSS+ +KS + 
Sbjct  1    MPLYELYRLARENLGNETNNTSVADQPSESE-NDFFELVWESGQISSQGQSSRVRKSPSC  59

Query  603  SRMREKCV---------------GNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDE  737
                  C+               G  ++ R GK     + L+E+P SVPS  +D+ QD++
Sbjct  60   RSFPSHCLPSHSPRGRDKDIGVGGYGNNPRTGKFGDLETGLNEIPMSVPSHVVDVGQDED  119

Query  738  IAPWLNYSPSNGQSQEYGSQLLPEISGTTANE-PSPHDGFPLI  863
            + PWL+YS       EYGS  L E+     N  P+  + F L+
Sbjct  120  MMPWLDYSMDGSFQNEYGSNFLHELPSVAGNNLPAASNNFTLL  162



>ref|XP_010271069.1| PREDICTED: transcription factor PIF3 isoform X1 [Nelumbo nucifera]
 ref|XP_010271070.1| PREDICTED: transcription factor PIF3 isoform X1 [Nelumbo nucifera]
 ref|XP_010271071.1| PREDICTED: transcription factor PIF3 isoform X1 [Nelumbo nucifera]
 ref|XP_010271072.1| PREDICTED: transcription factor PIF3 isoform X1 [Nelumbo nucifera]
Length=738

 Score =   124 bits (312),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 133/250 (53%), Gaps = 59/250 (24%)
 Frame = +3

Query  1101  LLNFSNFSRPVVLARANLQ-------------NTLEAKGKREKEIKENAQNPAKTALIEA  1241
             L+NFS+FSRP  + +ANLQ             + L + GK        + NP ++ +IE+
Sbjct  277   LMNFSHFSRPAAVVKANLQSLGAVASPGLSSIDKLRSNGKVPAA---GSGNPLESIMIES  333

Query  1242  CSTSRKESDLKSQ-----------------PNLRTKFEQTDA-SRED-------------  1328
              S SR  +   +Q                 P      EQ++   RED             
Sbjct  334   TSASRSSTGFHNQLASMPVKVDTKPSVPKPPKELLSAEQSEVVCREDGLRKNISPDQFVG  393

Query  1329  -------TNDADKVHGNKAVEPgacssvc-sgssaERASNDQSHSLKRRARENEESGCPS  1484
                    +N  ++    K +EP   SS   S +SA  ASND   +LKR++R+ E+S C S
Sbjct  394   QTSSFAASNAVERPDTEKTMEPMVASSSVCSVNSAGGASNDLKQALKRKSRDAEDSECQS  453

Query  1485  E----DADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNC  1652
             E    D +EES  A+K AP R GTG KRSRAAEVHNLSERRRRDRINEKMRALQELIPNC
Sbjct  454   EVSENDVEEESVDARKPAPPRVGTGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNC  513

Query  1653  NKADKASMLD  1682
             NK DKASMLD
Sbjct  514   NKVDKASMLD  523


 Score =   110 bits (275),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 90/145 (62%), Gaps = 11/145 (8%)
 Frame = +3

Query  423  MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS-  593
            MP SEFL M K   ES   K T S+  D+  +P ++F ELVWENGQI MQGQS +++KS 
Sbjct  1    MPYSEFLHMAKEKFESNPSKMTCSA--DVPFVPDNEFVELVWENGQILMQGQSGRSRKSP  58

Query  594  ------DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                   ++S++ EK   +A + +IG+L    SVL++   + PSG M L+QD+EI+PWLN
Sbjct  59   SCTNHSSHISKVHEKDGRDAVTPKIGRLGTIESVLNDFSTAGPSGHMGLAQDEEISPWLN  118

Query  756  YSPSNGQSQEYGSQLLPEISGTTAN  830
            YS  +    +Y S+L  E++G   N
Sbjct  119  YSLDDSLQHDYCSELFSELAGVNVN  143



>gb|ABD33186.1| Helix-loop-helix DNA-binding [Medicago truncatula]
Length=689

 Score =   123 bits (308),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 147/491 (30%), Positives = 226/491 (46%), Gaps = 94/491 (19%)
 Frame = +3

Query  447   MLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSS---KAKKSDNLS----  605
             M K +   ++  +S A D S +P +D  ELVW+N QI + GQSS   +AK +  L     
Sbjct  1     MSKEKVDHKEMNNSCAPDQSSVPRNDLFELVWQNDQILVHGQSSNSNRAKMTPTLPSHTL  60

Query  606   RMREKCVG---NASSSRIGKL-DLAGSVLDEMPPSVPSGEMDLSQDDEIA---PWLNYSP  764
             +  +K  G   N +++RIGK  DL   + + +  SV S     SQD+++    PWLN + 
Sbjct  61    KGHDKYSGQHANETNTRIGKFEDLDNGLNEIITRSVSS-----SQDEDLMTMMPWLNCAM  115

Query  765   SNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSVVNSGQRNATKLDCSPRFGLLA  944
              +  S  Y S  + E  G   N+ +  + F L+    + +            S + G+L+
Sbjct  116   DDEHSLHYSSCFVHE-PGARTNDFAATNKFSLLDRKSNCIQV-------FSDSHKQGILS  167

Query  945   SWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPP-----------QAKNQDTETTRTC  1091
               SS          S++ +S   +N+ S+L+   P               N      +  
Sbjct  168   KGSSLAVEDF--DTSELKTSTNQLNMSSLLQQCQPSFESIRFRESGLSENNTKGNANQHA  225

Query  1092  P----------PTLLNFSNFSRPVVLARANLQNT------LEAKGKREKEIKENAQNPAK  1223
             P           T++NF++F++P  + +ANLQN        E  G + K+     +NP +
Sbjct  226   PCEEISHVPSSSTVMNFTHFAKPAAIVKANLQNIGFSSSRSERVGAKNKDAAAIGRNPCE  285

Query  1224  TALIEA-----------CSTSRKESDLKSQPNLRTKFEQ-----TDASREDTNDADKVHG  1355
             ++ ++            C  S + S +  +P      E+     T A +ED +  D+   
Sbjct  286   SSKVDLSVECPKSSAIHCHQSVEPSRVGLKPLEPKSLEKNTTVSTSACKEDVSKVDQTSN  345

Query  1356  NKAVEPgacssvcsgssaE---------------RASNDQSHSLKRRARENEESGCPSED  1490
                 E             E               R+S+D + +LKR+  ++E+S   SED
Sbjct  346   QVLSESSRKGQEVFKKCTELTVASSSVCSDNGVHRSSDDANQNLKRKNLDSEDSEWHSED  405

Query  1491  ADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK----  1658
              ++ES G K+    RG TG K++R+ EVHNLSERRRRDRINE+MRALQELIPNCNK    
Sbjct  406   FEDESIGVKRTDHGRGVTGSKKNRSTEVHNLSERRRRDRINERMRALQELIPNCNKVDLF  465

Query  1659  ---ADKASMLD  1682
                ADKASMLD
Sbjct  466   FLQADKASMLD  476



>ref|XP_008776593.1| PREDICTED: transcription factor PIF4-like isoform X2 [Phoenix 
dactylifera]
Length=520

 Score =   117 bits (294),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 133/418 (32%), Positives = 190/418 (45%), Gaps = 81/418 (19%)
 Frame = +3

Query  468   ERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNLSRMREKCVGNASSSR  647
             +RKP SS          ++  EL+W++G + M  Q+ +  K    +    KC G      
Sbjct  25    QRKPISSD---------NELIELLWQDGHVIMHSQTHRRSKQAQRAEPAPKCGG------  69

Query  648   IGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTA  827
                L+ +  V+ E               DE A W  Y   +   +E+ S+   E     A
Sbjct  70    --ALENSSGVIRE---------------DETASWFQYPLDDSPEKEFCSEFFCETPIADA  112

Query  828   NEPSPHDGFPLIGASKSVVNSGQRNAT-KLDCSPRFGLLASWSSQQANPLVSGVSDIGSS  1004
                        IGA+K       R+AT + + S +FG      ++    + SG SD   S
Sbjct  113   -----------IGANKM-----SRDATAEGERSIKFG------AKDETSVFSG-SDPKQS  149

Query  1005  NGSINLDSILKDSVPPQAKNQDTETTRTCP----PTLLNFSNFSRPVVLARANLQNTLEA  1172
             N         ++++PP  K+    +T+  P      L NF +FSRP+  A + L N    
Sbjct  150   NIRFQ-----ENTMPP-PKSHAISSTQQAPRFGHSNLRNFPHFSRPLK-ADSGLLNGRLG  202

Query  1173  KGKREKEIKENAQNPAKTALIEACSTSRKESDL--------KSQPNLRTKFEQTDASRED  1328
             K + EK I+  A   +   +    S S +   L             +     + DA R  
Sbjct  203   K-EFEKGIRVGAGESSMMTIGSRISGSNQTQTLADPCHTMSSDVAGVIATGSKEDAQRTS  261

Query  1329  TNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESa  1508
              ++  + H ++A    +       +  + ASN QSH  KR+ R+ EES C SE+A+ ES 
Sbjct  262   LSERVQTHTHEATVTSSSGCSFGRTGQQTASN-QSH--KRKGRDVEESECQSEEAEYESG  318

Query  1509  gakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
              A K A     T  +RSRAAEVHNLSERRRRDRINEKM+ALQELIP+CNK DKASMLD
Sbjct  319   EANKPAQQSTST--RRSRAAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLD  374



>ref|XP_008776592.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
Length=525

 Score =   117 bits (294),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 133/418 (32%), Positives = 190/418 (45%), Gaps = 81/418 (19%)
 Frame = +3

Query  468   ERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNLSRMREKCVGNASSSR  647
             +RKP SS          ++  EL+W++G + M  Q+ +  K    +    KC G      
Sbjct  25    QRKPISSD---------NELIELLWQDGHVIMHSQTHRRSKQAQRAEPAPKCGG------  69

Query  648   IGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTA  827
                L+ +  V+ E               DE A W  Y   +   +E+ S+   E     A
Sbjct  70    --ALENSSGVIRE---------------DETASWFQYPLDDSPEKEFCSEFFCETPIADA  112

Query  828   NEPSPHDGFPLIGASKSVVNSGQRNAT-KLDCSPRFGLLASWSSQQANPLVSGVSDIGSS  1004
                        IGA+K       R+AT + + S +FG      ++    + SG SD   S
Sbjct  113   -----------IGANKM-----SRDATAEGERSIKFG------AKDETSVFSG-SDPKQS  149

Query  1005  NGSINLDSILKDSVPPQAKNQDTETTRTCP----PTLLNFSNFSRPVVLARANLQNTLEA  1172
             N         ++++PP  K+    +T+  P      L NF +FSRP+  A + L N    
Sbjct  150   NIRFQ-----ENTMPP-PKSHAISSTQQAPRFGHSNLRNFPHFSRPLK-ADSGLLNGRLG  202

Query  1173  KGKREKEIKENAQNPAKTALIEACSTSRKESDLKS--------QPNLRTKFEQTDASRED  1328
             K + EK I+  A   +   +    S S +   L             +     + DA R  
Sbjct  203   K-EFEKGIRVGAGESSMMTIGSRISGSNQTQTLADPCHTMSSDVAGVIATGSKEDAQRTS  261

Query  1329  TNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESa  1508
              ++  + H ++A    +       +  + ASN QSH  KR+ R+ EES C SE+A+ ES 
Sbjct  262   LSERVQTHTHEATVTSSSGCSFGRTGQQTASN-QSH--KRKGRDVEESECQSEEAEYESG  318

Query  1509  gakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
              A K A     T  +RSRAAEVHNLSERRRRDRINEKM+ALQELIP+CNK DKASMLD
Sbjct  319   EANKPAQQSTST--RRSRAAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLD  374



>ref|XP_010070105.1| PREDICTED: transcription factor PIF3-like isoform X3 [Eucalyptus 
grandis]
Length=705

 Score =   107 bits (268),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +3

Query  1410  ERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSE  1589
             ER  +D   +LKR++ E +ES  PSED +E+    KK   A+G +  KRSRAAEVHNLSE
Sbjct  404   ERVLDDPKSNLKRKSLETDESDGPSEDVEEDPTHEKKQNSAQGTS--KRSRAAEVHNLSE  461

Query  1590  RRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  462   RRRRDRINEKMRALQELIPNCNKVDKASMLD  492


 Score = 94.0 bits (232),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 82/149 (55%), Gaps = 10/149 (7%)
 Frame = +3

Query  423  MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS-  593
            MPL E  KM K   +S   KPTSSS D LS +P ++  EL WE+GQ+ +QGQSS+AK+  
Sbjct  1    MPLFELFKMAKAKLDSSLEKPTSSSTD-LSSVPANELVELTWEHGQVVLQGQSSRAKRGP  59

Query  594  ------DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                   N S+ RE    + +  R GK      VL E P +  S E+ L Q+D++ PWL+
Sbjct  60   FSNNTPSNGSKPREGASDDDTRPRPGKFRNLECVLSEFPVTEQSSEIGLGQEDDMVPWLS  119

Query  756  YSPSNGQSQEYGSQLLPEISGTTANEPSP  842
            +  +     +Y S LL E++   AN  SP
Sbjct  120  FPVTGSLQNDYCSDLLTELTAVAANGTSP  148



>ref|XP_010070104.1| PREDICTED: transcription factor PIF3-like isoform X2 [Eucalyptus 
grandis]
Length=705

 Score =   107 bits (268),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +3

Query  1410  ERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSE  1589
             ER  +D   +LKR++ E +ES  PSED +E+    KK   A+G +  KRSRAAEVHNLSE
Sbjct  404   ERVLDDPKSNLKRKSLETDESDGPSEDVEEDPTHEKKQNSAQGTS--KRSRAAEVHNLSE  461

Query  1590  RRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  462   RRRRDRINEKMRALQELIPNCNKVDKASMLD  492


 Score = 94.0 bits (232),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 82/149 (55%), Gaps = 10/149 (7%)
 Frame = +3

Query  423  MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS-  593
            MPL E  KM K   +S   KPTSSS D LS +P ++  EL WE+GQ+ +QGQSS+AK+  
Sbjct  1    MPLFELFKMAKAKLDSSLEKPTSSSTD-LSSVPANELVELTWEHGQVVLQGQSSRAKRGP  59

Query  594  ------DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                   N S+ RE    + +  R GK      VL E P +  S E+ L Q+D++ PWL+
Sbjct  60   FSNNTPSNGSKPREGASDDDTRPRPGKFRNLECVLSEFPVTEQSSEIGLGQEDDMVPWLS  119

Query  756  YSPSNGQSQEYGSQLLPEISGTTANEPSP  842
            +  +     +Y S LL E++   AN  SP
Sbjct  120  FPVTGSLQNDYCSDLLTELTAVAANGTSP  148



>ref|XP_009591142.1| PREDICTED: transcription factor PIF3-like [Nicotiana tomentosiformis]
Length=118

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  1476  CPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCN  1655
             CPSEDA+EES G KK  P RGGTG KRSRAAEVHNLSER RR+RINEKMRALQELIPNCN
Sbjct  3     CPSEDAEEESVGIKKPCPTRGGTGSKRSRAAEVHNLSERSRRNRINEKMRALQELIPNCN  62

Query  1656  KADKASMLD  1682
             KADKASMLD
Sbjct  63    KADKASMLD  71



>ref|XP_010070103.1| PREDICTED: transcription factor PIF3-like isoform X1 [Eucalyptus 
grandis]
Length=706

 Score =   107 bits (268),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +3

Query  1410  ERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSE  1589
             ER  +D   +LKR++ E +ES  PSED +E+    KK   A+G +  KRSRAAEVHNLSE
Sbjct  404   ERVLDDPKSNLKRKSLETDESDGPSEDVEEDPTHEKKQNSAQGTS--KRSRAAEVHNLSE  461

Query  1590  RRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  462   RRRRDRINEKMRALQELIPNCNKVDKASMLD  492


 Score = 94.0 bits (232),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 82/149 (55%), Gaps = 10/149 (7%)
 Frame = +3

Query  423  MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS-  593
            MPL E  KM K   +S   KPTSSS D LS +P ++  EL WE+GQ+ +QGQSS+AK+  
Sbjct  1    MPLFELFKMAKAKLDSSLEKPTSSSTD-LSSVPANELVELTWEHGQVVLQGQSSRAKRGP  59

Query  594  ------DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                   N S+ RE    + +  R GK      VL E P +  S E+ L Q+D++ PWL+
Sbjct  60   FSNNTPSNGSKPREGASDDDTRPRPGKFRNLECVLSEFPVTEQSSEIGLGQEDDMVPWLS  119

Query  756  YSPSNGQSQEYGSQLLPEISGTTANEPSP  842
            +  +     +Y S LL E++   AN  SP
Sbjct  120  FPVTGSLQNDYCSDLLTELTAVAANGTSP  148



>ref|XP_006645783.1| PREDICTED: transcription factor PIF1-like [Oryza brachyantha]
Length=596

 Score =   107 bits (266),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 106/199 (53%), Gaps = 10/199 (5%)
 Frame = +3

Query  1101  LLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQ  1280
             ++NFS FSRP VLARA LQ+    +G  +K     A N  ++ +++  S  R        
Sbjct  190   VMNFSLFSRPAVLARATLQSAQRPQGT-DKASNGTASNRVESTVVQTASGPRSAPAFAPA  248

Query  1281  PNLRTKFE-QTDASREDTNDADKVH---GNKAVEPgacssvcsgssaERASNDQSHSLKR  1448
             P +      Q +  R+       +H     K  E    ++    S+    S+D     KR
Sbjct  249   PPMAPAINLQHETGRDRAGRTMPIHKHEARKVPEAATVATSSVCSANGAGSDDLWRPPKR  308

Query  1449  RAR-ENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMR  1625
             +++ + E S    ED D+E    +++A        KRSR AEVHNLSERRRRDRINEKMR
Sbjct  309   KSQAQTECSASQDEDLDDEPGVVRRSAARST----KRSRTAEVHNLSERRRRDRINEKMR  364

Query  1626  ALQELIPNCNKADKASMLD  1682
             ALQELIPNCNK DKASMLD
Sbjct  365   ALQELIPNCNKIDKASMLD  383



>ref|XP_010906805.1| PREDICTED: transcription factor PIF4-like isoform X1 [Elaeis 
guineensis]
Length=549

 Score =   106 bits (265),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 120/415 (29%), Positives = 175/415 (42%), Gaps = 86/415 (21%)
 Frame = +3

Query  513   PGSDFSELVWENGQITMQGQSSKAKKSDNLSRMRE--------KCVGNASSSRIGKLDLA  668
             P ++  EL+W++G + M  Q+ + K       +++        KC G   +S        
Sbjct  31    PDNELLELLWQDGHVIMHSQTHR-KSPATFGEVKQAQRAEPALKCGGALGNSS-------  82

Query  669   GSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQL---LPEISGTTANEPS  839
                             DL Q+DE A W  Y   +   +E  S+    +P +  +  N+  
Sbjct  83    ----------------DLIQEDETASWFQYPLDDSLEKELCSEFFNEMPNVDASGTNK--  124

Query  840   PHDGFPLIGASKSVVNSGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSIN  1019
                       SK     G+R         +FG         AN   S  S       +I 
Sbjct  125   ---------MSKDTTAQGERPI-------KFG---------ANDETSVFSGSDPKQSNIR  159

Query  1020  LDSILKDSVPPQAKNQDTETTRTCP----PTLLNFSNFSRPVVLARANLQNTLEAKGKRE  1187
                  ++++PP  K+     T+  P       +NFS+FSRPV     +L           
Sbjct  160   FQ---ENTMPP-PKSHVIAPTQQAPRLGNSNFVNFSHFSRPVKADLGSLNGR--RGKGSG  213

Query  1188  KEIKENAQNPAKTALIEACSTSRKESDLKSQPNLRTKFEQTDASREDTNDADKVHGNKAV  1367
             K I+  A   +   +    S S +   L    +  +       SR    DA     ++ V
Sbjct  214   KGIQVGAGESSMMTIGSRISGSNQTQALADPSHTISGDAAVVVSRGSKKDAQMTSLSERV  273

Query  1368  EPgacssvcsgs----------saERASNDQSHSLKRRARENEESGCPSEDADEESagak  1517
                   +  + S          + ++ +++QSH  KR+ R+ EES C SE+A+ ES  A 
Sbjct  274   RTHTYETTVTSSSGGSGCSFGRTGQQITSNQSH--KRKGRDAEESECQSEEAEYESVEAN  331

Query  1518  kaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             K A     T  +RSRAAEVHNLSERRRRDRINEKM+ALQELIP+CNK DKASMLD
Sbjct  332   KPAQQSTST--RRSRAAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLD  384



>ref|XP_010906815.1| PREDICTED: transcription factor PIF4-like isoform X2 [Elaeis 
guineensis]
Length=541

 Score =   106 bits (264),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 120/415 (29%), Positives = 175/415 (42%), Gaps = 86/415 (21%)
 Frame = +3

Query  513   PGSDFSELVWENGQITMQGQSSKAKKSDNLSRMRE--------KCVGNASSSRIGKLDLA  668
             P ++  EL+W++G + M  Q+ + K       +++        KC G   +S        
Sbjct  31    PDNELLELLWQDGHVIMHSQTHR-KSPATFGEVKQAQRAEPALKCGGALGNSS-------  82

Query  669   GSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQL---LPEISGTTANEPS  839
                             DL Q+DE A W  Y   +   +E  S+    +P +  +  N+  
Sbjct  83    ----------------DLIQEDETASWFQYPLDDSLEKELCSEFFNEMPNVDASGTNK--  124

Query  840   PHDGFPLIGASKSVVNSGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSIN  1019
                       SK     G+R         +FG         AN   S  S       +I 
Sbjct  125   ---------MSKDTTAQGERPI-------KFG---------ANDETSVFSGSDPKQSNIR  159

Query  1020  LDSILKDSVPPQAKNQDTETTRTCP----PTLLNFSNFSRPVVLARANLQNTLEAKGKRE  1187
                  ++++PP  K+     T+  P       +NFS+FSRPV     +L           
Sbjct  160   FQ---ENTMPP-PKSHVIAPTQQAPRLGNSNFVNFSHFSRPVKADLGSLNGR--RGKGSG  213

Query  1188  KEIKENAQNPAKTALIEACSTSRKESDLKSQPNLRTKFEQTDASREDTNDADKVHGNKAV  1367
             K I+  A   +   +    S S +   L    +  +       SR    DA     ++ V
Sbjct  214   KGIQVGAGESSMMTIGSRISGSNQTQALADPSHTISGDAAVVVSRGSKKDAQMTSLSERV  273

Query  1368  EPgacssvcsgs----------saERASNDQSHSLKRRARENEESGCPSEDADEESagak  1517
                   +  + S          + ++ +++QSH  KR+ R+ EES C SE+A+ ES  A 
Sbjct  274   RTHTYETTVTSSSGGSGCSFGRTGQQITSNQSH--KRKGRDAEESECQSEEAEYESVEAN  331

Query  1518  kaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             K A     T  +RSRAAEVHNLSERRRRDRINEKM+ALQELIP+CNK DKASMLD
Sbjct  332   KPAQQSTST--RRSRAAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLD  384



>ref|XP_010914796.1| PREDICTED: transcription factor PIF3-like isoform X1 [Elaeis 
guineensis]
Length=674

 Score =   106 bits (265),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +3

Query  1416  ASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERR  1595
             ASND     KRR+ E EESG  SED ++ S G +K A  RG +  KRSRAAEVHNLSERR
Sbjct  395   ASNDAQKGEKRRSHEGEESGYQSEDFEDMSVGLRKPATGRGTSA-KRSRAAEVHNLSERR  453

Query  1596  RRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  454   RRDRINEKMRALQELIPNCNKTDKASMLD  482


 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 86/312 (28%), Positives = 148/312 (47%), Gaps = 35/312 (11%)
 Frame = +3

Query  423   MPLSEFLKML---KNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS  593
             MPLS++ +     K E+ + +  + SAD L  +P  +F+EL+WENG I MQ   S+ K+S
Sbjct  1     MPLSQYHQSTSKDKAEAAQARMNNCSAD-LFTMPDHEFAELLWENGSIVMQAHPSRPKRS  59

Query  594   DNLSRMREKCVG-------NASSSRIGKLDLAGSVLDEMPPSVPSGEMDL-SQDDEIAPW  749
                +       G       +A S +  + D    ++++  P+ PS  + + +QDD++ PW
Sbjct  60    SFPTTFSSHAAGVHEKDGRDAGSPKASRFDAMEPMVNDFSPAAPSAHVGVNAQDDDMVPW  119

Query  750   LNYS-----PSNGQSQEYGSQLLPEISGTTANEPSPHDGFPL-----IGASKSVVNSGQR  899
             ++Y      P +    +Y S+ L E  G   N PS ++  P+      G  + + NS   
Sbjct  120   ISYPIEEPLPKDALQNDYCSEFLNEFPGANLNSPSAYNK-PIATDGSFGLGQDIRNS--H  176

Query  900   NATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSS---NGSINLDSILKDSVPPQAKNQD  1070
             N      S  F   +  S  + + L        SS   + SI  D+ + D    + +N D
Sbjct  177   NVEHERASKAFAESSEPSRDRTSHLFQFSQHCQSSAPNSESIATDTEIGDCTKTRLQNPD  236

Query  1071  TETTRTCPP----TLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIE  1238
               + +  PP    ++LNFS+FSRP +LA+ANL   ++ K   EK       N  ++ LIE
Sbjct  237   PSSPK--PPQLNGSMLNFSHFSRPTMLAKANLHG-VDGKRTDEKASAPLNGNTVESTLIE  293

Query  1239  ACSTSRKESDLK  1274
             + S  +  ++++
Sbjct  294   SASVFKSATEVR  305



>emb|CDP03833.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   106 bits (264),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE EE+ CPSED + ESA AK+ A     T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  304   KRKGRETEETDCPSEDIEFESADAKRQARGSTST--KRSRAAEVHNLSERRRRDRINEKM  361

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIP CNK+DKASMLD
Sbjct  362   RALQELIPRCNKSDKASMLD  381



>ref|XP_010914797.1| PREDICTED: transcription factor PIF3-like isoform X2 [Elaeis 
guineensis]
Length=668

 Score =   106 bits (265),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +3

Query  1416  ASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERR  1595
             ASND     KRR+ E EESG  SED ++ S G +K A  RG +  KRSRAAEVHNLSERR
Sbjct  395   ASNDAQKGEKRRSHEGEESGYQSEDFEDMSVGLRKPATGRGTSA-KRSRAAEVHNLSERR  453

Query  1596  RRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  454   RRDRINEKMRALQELIPNCNKTDKASMLD  482


 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 86/312 (28%), Positives = 148/312 (47%), Gaps = 35/312 (11%)
 Frame = +3

Query  423   MPLSEFLKML---KNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS  593
             MPLS++ +     K E+ + +  + SAD L  +P  +F+EL+WENG I MQ   S+ K+S
Sbjct  1     MPLSQYHQSTSKDKAEAAQARMNNCSAD-LFTMPDHEFAELLWENGSIVMQAHPSRPKRS  59

Query  594   DNLSRMREKCVG-------NASSSRIGKLDLAGSVLDEMPPSVPSGEMDL-SQDDEIAPW  749
                +       G       +A S +  + D    ++++  P+ PS  + + +QDD++ PW
Sbjct  60    SFPTTFSSHAAGVHEKDGRDAGSPKASRFDAMEPMVNDFSPAAPSAHVGVNAQDDDMVPW  119

Query  750   LNYS-----PSNGQSQEYGSQLLPEISGTTANEPSPHDGFPL-----IGASKSVVNSGQR  899
             ++Y      P +    +Y S+ L E  G   N PS ++  P+      G  + + NS   
Sbjct  120   ISYPIEEPLPKDALQNDYCSEFLNEFPGANLNSPSAYNK-PIATDGSFGLGQDIRNS--H  176

Query  900   NATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSS---NGSINLDSILKDSVPPQAKNQD  1070
             N      S  F   +  S  + + L        SS   + SI  D+ + D    + +N D
Sbjct  177   NVEHERASKAFAESSEPSRDRTSHLFQFSQHCQSSAPNSESIATDTEIGDCTKTRLQNPD  236

Query  1071  TETTRTCPP----TLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIE  1238
               + +  PP    ++LNFS+FSRP +LA+ANL   ++ K   EK       N  ++ LIE
Sbjct  237   PSSPK--PPQLNGSMLNFSHFSRPTMLAKANLHG-VDGKRTDEKASAPLNGNTVESTLIE  293

Query  1239  ACSTSRKESDLK  1274
             + S  +  ++++
Sbjct  294   SASVFKSATEVR  305



>ref|XP_008811817.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811818.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811819.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811820.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811821.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
Length=588

 Score =   106 bits (264),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 124/402 (31%), Positives = 176/402 (44%), Gaps = 63/402 (16%)
 Frame = +3

Query  522   DFSELVWENGQITMQGQSSKAKKSDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSV  701
             +  ELVW++G++    Q+ +                  S   IG+   A           
Sbjct  49    ELVELVWQDGRVITHSQTHRK-----------------SPPAIGEFKQAQKAEPAPKCRG  91

Query  702   PSGEM-DLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKS  878
             P G   +LSQ+DE A W  YS  +   +E+     PE      N     D       +K 
Sbjct  92    PVGIWSNLSQEDETASWFQYSLDDSLEKEF----CPEFFCGMPNV----DAIGTGKMTKD  143

Query  879   VVNSGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQA  1058
             V   G+R  TK        + A    +Q+               SI+     ++++PP  
Sbjct  144   VAAEGER-PTKFGAIEETNVFAGSDPEQS---------------SIHFK---ENTMPPPK  184

Query  1059  KNQDTETTRT-CPPT--LLNFSNFSRP--VVLARANLQNTLEAKGKREKEIKENAQNPAK  1223
              N    T +  C P+  L+NF +FSRP  V+    +L   L  +  +   +         
Sbjct  185   TNVIASTQQAPCLPSSNLVNFPHFSRPGPVMADVGSLNGQLGKESGKRIRLGAGESTSMM  244

Query  1224  TALIEACSTSRKESDLKSQPNLRTKFEQTDAS--RED---TNDADKVHGNKAVEPgacss  1388
             T     C +++ ++       + +      A   +ED   T+ +++   N        SS
Sbjct  245   TIASSICGSNQIQAQADPSHTMSSDTAGVAAIGLKEDAQMTSPSERTRTNTYDVTVTSSS  304

Query  1389  vcsgssaERASN----DQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKR  1556
               SG S  RA      +QSH  KR+ R+ EES C SE+AD E   A K A     T  +R
Sbjct  305   GGSGCSFGRAGRQSAINQSH--KRKGRDAEESECQSEEADYEYVEANKLAQRSPFT--RR  360

Query  1557  SRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             SR+AEVHNLSERRRRDRINEKM+ALQELIP+CNK DKASMLD
Sbjct  361   SRSAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLD  402



>ref|XP_008811822.1| PREDICTED: transcription factor PIF4-like isoform X2 [Phoenix 
dactylifera]
Length=575

 Score =   105 bits (263),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 124/402 (31%), Positives = 176/402 (44%), Gaps = 63/402 (16%)
 Frame = +3

Query  522   DFSELVWENGQITMQGQSSKAKKSDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSV  701
             +  ELVW++G++    Q+ +                  S   IG+   A           
Sbjct  49    ELVELVWQDGRVITHSQTHRK-----------------SPPAIGEFKQAQKAEPAPKCRG  91

Query  702   PSGEM-DLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKS  878
             P G   +LSQ+DE A W  YS  +   +E+     PE      N     D       +K 
Sbjct  92    PVGIWSNLSQEDETASWFQYSLDDSLEKEF----CPEFFCGMPNV----DAIGTGKMTKD  143

Query  879   VVNSGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQA  1058
             V   G+R  TK        + A    +Q+               SI+     ++++PP  
Sbjct  144   VAAEGER-PTKFGAIEETNVFAGSDPEQS---------------SIHFK---ENTMPPPK  184

Query  1059  KNQDTETTRT-CPPT--LLNFSNFSRP--VVLARANLQNTLEAKGKREKEIKENAQNPAK  1223
              N    T +  C P+  L+NF +FSRP  V+    +L   L  +  +   +         
Sbjct  185   TNVIASTQQAPCLPSSNLVNFPHFSRPGPVMADVGSLNGQLGKESGKRIRLGAGESTSMM  244

Query  1224  TALIEACSTSRKESDLKSQPNLRTKFEQTDAS--RED---TNDADKVHGNKAVEPgacss  1388
             T     C +++ ++       + +      A   +ED   T+ +++   N        SS
Sbjct  245   TIASSICGSNQIQAQADPSHTMSSDTAGVAAIGLKEDAQMTSPSERTRTNTYDVTVTSSS  304

Query  1389  vcsgssaERASN----DQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKR  1556
               SG S  RA      +QSH  KR+ R+ EES C SE+AD E   A K A     T  +R
Sbjct  305   GGSGCSFGRAGRQSAINQSH--KRKGRDAEESECQSEEADYEYVEANKLAQRSPFT--RR  360

Query  1557  SRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             SR+AEVHNLSERRRRDRINEKM+ALQELIP+CNK DKASMLD
Sbjct  361   SRSAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLD  402



>ref|XP_008811825.1| PREDICTED: transcription factor PIF4-like isoform X3 [Phoenix 
dactylifera]
Length=574

 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 124/402 (31%), Positives = 176/402 (44%), Gaps = 63/402 (16%)
 Frame = +3

Query  522   DFSELVWENGQITMQGQSSKAKKSDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSV  701
             +  ELVW++G++    Q+ +                  S   IG+   A           
Sbjct  49    ELVELVWQDGRVITHSQTHRK-----------------SPPAIGEFKQAQKAEPAPKCRG  91

Query  702   PSGEM-DLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKS  878
             P G   +LSQ+DE A W  YS  +   +E+     PE      N     D       +K 
Sbjct  92    PVGIWSNLSQEDETASWFQYSLDDSLEKEF----CPEFFCGMPNV----DAIGTGKMTKD  143

Query  879   VVNSGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQA  1058
             V   G+R  TK        + A    +Q+               SI+     ++++PP  
Sbjct  144   VAAEGER-PTKFGAIEETNVFAGSDPEQS---------------SIHFK---ENTMPPPK  184

Query  1059  KNQDTETTRT-CPPT--LLNFSNFSRP--VVLARANLQNTLEAKGKREKEIKENAQNPAK  1223
              N    T +  C P+  L+NF +FSRP  V+    +L   L  +  +   +         
Sbjct  185   TNVIASTQQAPCLPSSNLVNFPHFSRPGPVMADVGSLNGQLGKESGKRIRLGAGESTSMM  244

Query  1224  TALIEACSTSRKESDLKSQPNLRTKFEQTDAS--RED---TNDADKVHGNKAVEPgacss  1388
             T     C +++ ++       + +      A   +ED   T+ +++   N        SS
Sbjct  245   TIASSICGSNQIQAQADPSHTMSSDTAGVAAIGLKEDAQMTSPSERTRTNTYDVTVTSSS  304

Query  1389  vcsgssaERASN----DQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKR  1556
               SG S  RA      +QSH  KR+ R+ EES C SE+AD E   A K A     T  +R
Sbjct  305   GGSGCSFGRAGRQSAINQSH--KRKGRDAEESECQSEEADYEYVEANKLAQRSPFT--RR  360

Query  1557  SRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             SR+AEVHNLSERRRRDRINEKM+ALQELIP+CNK DKASMLD
Sbjct  361   SRSAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLD  402



>ref|XP_008811826.1| PREDICTED: transcription factor PIF4-like isoform X4 [Phoenix 
dactylifera]
 ref|XP_008811827.1| PREDICTED: transcription factor PIF4-like isoform X4 [Phoenix 
dactylifera]
 ref|XP_008811828.1| PREDICTED: transcription factor PIF4-like isoform X4 [Phoenix 
dactylifera]
 ref|XP_008811829.1| PREDICTED: transcription factor PIF4-like isoform X4 [Phoenix 
dactylifera]
Length=573

 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 124/402 (31%), Positives = 176/402 (44%), Gaps = 63/402 (16%)
 Frame = +3

Query  522   DFSELVWENGQITMQGQSSKAKKSDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSV  701
             +  ELVW++G++    Q+ +                  S   IG+   A           
Sbjct  34    ELVELVWQDGRVITHSQTHRK-----------------SPPAIGEFKQAQKAEPAPKCRG  76

Query  702   PSGEM-DLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKS  878
             P G   +LSQ+DE A W  YS  +   +E+     PE      N     D       +K 
Sbjct  77    PVGIWSNLSQEDETASWFQYSLDDSLEKEF----CPEFFCGMPNV----DAIGTGKMTKD  128

Query  879   VVNSGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQA  1058
             V   G+R  TK        + A    +Q+               SI+     ++++PP  
Sbjct  129   VAAEGER-PTKFGAIEETNVFAGSDPEQS---------------SIHFK---ENTMPPPK  169

Query  1059  KNQDTETTRT-CPPT--LLNFSNFSRP--VVLARANLQNTLEAKGKREKEIKENAQNPAK  1223
              N    T +  C P+  L+NF +FSRP  V+    +L   L  +  +   +         
Sbjct  170   TNVIASTQQAPCLPSSNLVNFPHFSRPGPVMADVGSLNGQLGKESGKRIRLGAGESTSMM  229

Query  1224  TALIEACSTSRKESDLKSQPNLRTKFEQTDAS--RED---TNDADKVHGNKAVEPgacss  1388
             T     C +++ ++       + +      A   +ED   T+ +++   N        SS
Sbjct  230   TIASSICGSNQIQAQADPSHTMSSDTAGVAAIGLKEDAQMTSPSERTRTNTYDVTVTSSS  289

Query  1389  vcsgssaERASN----DQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKR  1556
               SG S  RA      +QSH  KR+ R+ EES C SE+AD E   A K A     T  +R
Sbjct  290   GGSGCSFGRAGRQSAINQSH--KRKGRDAEESECQSEEADYEYVEANKLAQRSPFT--RR  345

Query  1557  SRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             SR+AEVHNLSERRRRDRINEKM+ALQELIP+CNK DKASMLD
Sbjct  346   SRSAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLD  387



>ref|XP_009399053.1| PREDICTED: transcription factor PIF4-like [Musa acuminata subsp. 
malaccensis]
Length=535

 Score =   104 bits (260),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 121/436 (28%), Positives = 176/436 (40%), Gaps = 126/436 (29%)
 Frame = +3

Query  513   PGSDFSELVWENGQITMQGQSSK---------AKKSDNLSRMREKCVGNASSSRIGKLDL  665
             P ++  EL+W NG + M  Q+ +         A K D + +  E+ +G++S         
Sbjct  32    PDNELVELLWRNGHVVMHSQTHRRTPVGEFKQASKPDPVQKY-EQSLGDSS---------  81

Query  666   AGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPH  845
                              +L Q+ E A W  +   +   +E+ S+                
Sbjct  82    -----------------NLIQEAEAASWFQFPLDDSFEKEFCSEF---------------  109

Query  846   DGFPLIGASKSVVN---SGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSI  1016
               FP I  + +VV+   S    A + D   +FG                     + +G+ 
Sbjct  110   --FPEITGTDTVVSEKISKDFTAEEEDRYLKFGF--------------------TDDGTA  147

Query  1017  NLDSILKDSVP-PQAKNQDTETTRTCPPT------------LLNFSNFSRPVVLARANLQ  1157
                   K SVP PQ        +     T            +LNF +FS+ V     +L 
Sbjct  148   FTAPAPKQSVPHPQDNIMPPPRSHVMGSTPQSSSLENSNSGVLNFPHFSKQVKADLGSLS  207

Query  1158  NTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPNLRTKFEQTDASREDTND  1337
               L  +G          ++   T    AC +++ ++             QTD S   +ND
Sbjct  208   CRLGHRGSGSNSKAGAQESSMMTVGSSACGSNQIQA-------------QTDPSNNISND  254

Query  1338  A---------------------DKVHGNKAVEPgacssvcsgssaERASNDQSHSLKRRA  1454
             A                      K H          S    G SA++  ++ SH  +R+A
Sbjct  255   AADIVTRLREGTGMRLLSERMQSKAHEGTVTSSSGGSGCSYGRSAQQNESNHSHK-RRKA  313

Query  1455  RENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQ  1634
             R+ EESGC SE+A+ ES    +   A   T ++RSRAAEVHNLSERRRRDRINEKM+ALQ
Sbjct  314   RDVEESGCQSEEAEYES--IDEKKQATRPTSKRRSRAAEVHNLSERRRRDRINEKMKALQ  371

Query  1635  ELIPNCNKADKASMLD  1682
             ELIP+CNK DKASMLD
Sbjct  372   ELIPHCNKTDKASMLD  387



>gb|KHN48974.1| Transcription factor PIF1 [Glycine soja]
Length=255

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE+EES   SED D ES  AKK       T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  5     KRKGREHEESEFQSEDVDFESPEAKKQVHGSTST--KRSRAAEVHNLSERRRRDRINEKM  62

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  63    KALQELIPRCNKSDKASMLD  82



>gb|KGN61033.1| hypothetical protein Csa_2G035330 [Cucumis sativus]
Length=684

 Score =   104 bits (259),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 121/233 (52%), Gaps = 40/233 (17%)
 Frame = +3

Query  1101  LLNFSNFSRPVVLARANLQ--NTLEAKGKREKEIKEN---AQN--PAKTALIEACSTSRK  1259
             ++NFS+F RP  L ++N Q        G R  +   N   A N  P +++LI      R 
Sbjct  259   IINFSHFLRPASLLKSNPQKHGVPGTGGSRNLDSMVNNSSAANSQPHESSLIAIQGGIRN  318

Query  1260  ESDLKSQ----PNLRTK-------FEQTDASRE-------DTNDADK-------------  1346
             ES+   +    P +  K        EQ+  +++       D+ D D              
Sbjct  319   ESNSGCKNAVVPTIDGKSPSDAKPLEQSQTNKQPEAACLGDSADHDDRLKHRFEVGATKG  378

Query  1347  -VHGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakka  1523
                  KAVE    +S+CS +S E AS+D  H+ KR+  + E+S   S+D  EE     K 
Sbjct  379   LADSEKAVESVFAASLCSRNSVEGASDDPPHNRKRKCHDTEDSEWHSDDV-EEDCNDVKR  437

Query  1524  aparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
               +  G G KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  438   VTSARGAGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  490


 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 79/129 (61%), Gaps = 16/129 (12%)
 Frame = +3

Query  492  ADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNLSRMREKC------------VGNA  635
            A DLS  P +D  ELVWENGQI +QGQS++ +K+ NL+  + +C            VG  
Sbjct  3    ASDLSMNPENDVFELVWENGQILLQGQSNRPRKNSNLNTSQAQCLPSHSPRDRDRDVGYF  62

Query  636  SSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQ--DDEIAPWLNYSPSNGQSQ-EYGSQLLP  806
            +++++GK     SV+ ++  + PS +++L+   DD++ PWL+Y P +G  Q +Y S  LP
Sbjct  63   NNAKMGKFGAIDSVVRDVMSTAPSPDVELAHDDDDDMVPWLSY-PLDGHLQHDYSSDFLP  121

Query  807  EISGTTANE  833
            E+SG T N+
Sbjct  122  ELSGVTVND  130



>ref|XP_004144801.1| PREDICTED: transcription factor PIF3-like [Cucumis sativus]
 ref|XP_004168508.1| PREDICTED: transcription factor PIF3-like [Cucumis sativus]
Length=696

 Score =   103 bits (258),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = +3

Query  1359  KAVEPgacssvcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparg  1538
             KAVE    +S+CS +S E AS+D  H+ KR+  + E+S   S+D  EE     K   +  
Sbjct  396   KAVESVFAASLCSRNSVEGASDDPPHNRKRKCHDTEDSEWHSDDV-EEDCNDVKRVTSAR  454

Query  1539  gtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             G G KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  455   GAGSKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  502


 Score = 84.7 bits (208),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 86/152 (57%), Gaps = 25/152 (16%)
 Frame = +3

Query  423  MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
            MPLSE  ++ + +    +  +S          +D  ELVWENGQI +QGQS++ +K+ NL
Sbjct  1    MPLSELYRVARGKLDSTQDKNSM---------NDVFELVWENGQILLQGQSNRPRKNSNL  51

Query  603  SRMREKC------------VGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQ--DDEI  740
            +  + +C            VG  +++++GK     SV+ ++  + PS +++L+   DD++
Sbjct  52   NTSQAQCLPSHSPRDRDRDVGYFNNAKMGKFGAIDSVVRDVMSTAPSPDVELAHDDDDDM  111

Query  741  APWLNYSPSNGQSQ-EYGSQLLPEISGTTANE  833
             PWL+Y P +G  Q +Y S  LPE+SG T N+
Sbjct  112  VPWLSY-PLDGHLQHDYSSDFLPELSGVTVND  142



>gb|EEC70435.1| hypothetical protein OsI_01449 [Oryza sativa Indica Group]
Length=693

 Score =   103 bits (257),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 81/216 (38%), Positives = 107/216 (50%), Gaps = 25/216 (12%)
 Frame = +3

Query  1101  LLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSR--------  1256
             ++NFS FSRP VLARA L++    +G   K     A N  ++ +++  S  R        
Sbjct  268   VMNFSLFSRPAVLARATLESAQRTQGTDNKASNVTASNRVESTVVQTASGPRSAPAFADQ  327

Query  1257  KESDLKSQPNLRTKFEQTDAS-------------REDTNDADKVHGNKAVE-Pgacssvc  1394
             + +    QP     F  T A+             R+      +VH  +A + P A  +  
Sbjct  328   RAAAWPPQPK-EMPFASTAAAPMAPAVNLHHEMDRDRAGRTMRVHKTEARKAPEATVATS  386

Query  1395  sgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEV  1574
             S  S   A +D+    ++R  + +     S+D D +             T  KRSR AEV
Sbjct  387   SVCSGNGAGSDELWRQQKRKCQAQAECSASQDDDLDDEPGVLRKSGTRST--KRSRTAEV  444

Query  1575  HNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             HNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  445   HNLSERRRRDRINEKMRALQELIPNCNKIDKASMLD  480



>dbj|BAD81566.1| putative BP-5 protein [Oryza sativa Japonica Group]
Length=565

 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 105/215 (49%), Gaps = 23/215 (11%)
 Frame = +3

Query  1101  LLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQ  1280
             ++NFS FSRP VLARA L++    +G   K     A N  ++ +++  S  R       Q
Sbjct  140   VMNFSLFSRPAVLARATLESAQRTQGTDNKASNVTASNRVESTVVQTASGPRSAPAFADQ  199

Query  1281  ------PNLR-TKFEQTDAS-------------REDTNDADKVHGNKAVE-Pgacssvcs  1397
                   P  +   F  T A+             R+       VH  +A + P A  +  S
Sbjct  200   RAAAWPPQPKEMPFASTAAAPMAPAVNLHHEMGRDRAGRTMPVHKTEARKAPEATVATSS  259

Query  1398  gssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVH  1577
               S   A +D+    ++R  + +     S+D D +             T  KRSR AEVH
Sbjct  260   VCSGNGAGSDELWRQQKRKCQAQAECSASQDDDLDDEPGVLRKSGTRST--KRSRTAEVH  317

Query  1578  NLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             NLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  318   NLSERRRRDRINEKMRALQELIPNCNKIDKASMLD  352



>ref|NP_001042775.2| Os01g0286100 [Oryza sativa Japonica Group]
 dbj|BAG95464.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04689.2| Os01g0286100 [Oryza sativa Japonica Group]
Length=637

 Score =   102 bits (255),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 105/215 (49%), Gaps = 23/215 (11%)
 Frame = +3

Query  1101  LLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQ  1280
             ++NFS FSRP VLARA L++    +G   K     A N  ++ +++  S  R       Q
Sbjct  212   VMNFSLFSRPAVLARATLESAQRTQGTDNKASNVTASNRVESTVVQTASGPRSAPAFADQ  271

Query  1281  ------PNLR-TKFEQTDAS-------------REDTNDADKVHGNKAVE-Pgacssvcs  1397
                   P  +   F  T A+             R+       VH  +A + P A  +  S
Sbjct  272   RAAAWPPQPKEMPFASTAAAPMAPAVNLHHEMGRDRAGRTMPVHKTEARKAPEATVATSS  331

Query  1398  gssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVH  1577
               S   A +D+    ++R  + +     S+D D +             T  KRSR AEVH
Sbjct  332   VCSGNGAGSDELWRQQKRKCQAQAECSASQDDDLDDEPGVLRKSGTRST--KRSRTAEVH  389

Query  1578  NLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             NLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  390   NLSERRRRDRINEKMRALQELIPNCNKIDKASMLD  424



>gb|EEE54353.1| hypothetical protein OsJ_01348 [Oryza sativa Japonica Group]
Length=705

 Score =   102 bits (255),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 105/215 (49%), Gaps = 23/215 (11%)
 Frame = +3

Query  1101  LLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQ  1280
             ++NFS FSRP VLARA L++    +G   K     A N  ++ +++  S  R       Q
Sbjct  280   VMNFSLFSRPAVLARATLESAQRTQGTDNKASNVTASNRVESTVVQTASGPRSAPAFADQ  339

Query  1281  ------PNLR-TKFEQTDAS-------------REDTNDADKVHGNKAVE-Pgacssvcs  1397
                   P  +   F  T A+             R+       VH  +A + P A  +  S
Sbjct  340   RAAAWPPQPKEMPFASTAAAPMAPAVNLHHEMGRDRAGRTMPVHKTEARKAPEATVATSS  399

Query  1398  gssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVH  1577
               S   A +D+    ++R  + +     S+D D +             T  KRSR AEVH
Sbjct  400   VCSGNGAGSDELWRQQKRKCQAQAECSASQDDDLDDEPGVLRKSGTRST--KRSRTAEVH  457

Query  1578  NLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             NLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  458   NLSERRRRDRINEKMRALQELIPNCNKIDKASMLD  492



>gb|KDO44799.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
Length=141

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 63/83 (76%), Gaps = 2/83 (2%)
 Frame = +3

Query  1434  HSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRIN  1613
             +SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRIN
Sbjct  46    NSLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRIN  103

Query  1614  EKMRALQELIPNCNKADKASMLD  1682
             EKMRALQELIP+CNK DKASMLD
Sbjct  104   EKMRALQELIPHCNKTDKASMLD  126



>ref|XP_007145052.1| hypothetical protein PHAVU_007G206000g [Phaseolus vulgaris]
 ref|XP_007145053.1| hypothetical protein PHAVU_007G206000g [Phaseolus vulgaris]
 gb|ESW17046.1| hypothetical protein PHAVU_007G206000g [Phaseolus vulgaris]
 gb|ESW17047.1| hypothetical protein PHAVU_007G206000g [Phaseolus vulgaris]
Length=527

 Score =   101 bits (252),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 99/344 (29%), Positives = 154/344 (45%), Gaps = 71/344 (21%)
 Frame = +3

Query  423   MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
             MPL E  ++ + + G     + ++D  S  P +DF ELVWENGQI+ QGQSS+ ++S + 
Sbjct  1     MPLYELYRLAREKLGTENNGTRASDQCSS-PENDFFELVWENGQISSQGQSSRVRRSPSC  59

Query  603   SRMREKCVGNAS-----------SSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPW  749
               +   C+ + S           +S++GK     S L E+  SVPS E+D  QD+++ PW
Sbjct  60    RSLPSHCLPSHSPKGRDKDVGCGASKMGKFRDLDSGLSEISMSVPSREIDFCQDEDVLPW  119

Query  750   LNYSPSNGQSQ-EYGSQLLPEISGTTANEPSPHDGFPLIGASKS---------------V  881
              +Y+  +G  Q +YGS  L   +  T  +   H    L  + K+               V
Sbjct  120   FDYAAMDGSLQHDYGSDFLATSTSFTLLDKKSHTNVALRDSHKTSEEHENAFKGSSAEQV  179

Query  882   VNSGQRNATKLDCSPRFGLL-ASWSSQQANPLVSGVSDIGSSN-----------GSI-NL  1022
              ++G +++T     P       S+ S +     S  SDI  +N           G I N 
Sbjct  180   ESTGPKSSTSQLYPPSLHHCQTSFVSSR-----SRASDITENNNTSNANQDATYGEITNF  234

Query  1023  DSILKDSVPPQAKNQDTETTRTCPP--------TLLNFSNFSRPVVLARANLQNT-----  1163
              S   D   P+ K Q+       PP        T++NFS+F+RP  + RANLQN      
Sbjct  235   LSSSSDFSSPKGKKQE-------PPLPGNGSSSTIMNFSHFARPAAMVRANLQNIGLKSG  287

Query  1164  LEAKGKREKEIKEN-----AQNPAKTALIEACSTSRKESDLKSQ  1280
             L +      EIK N     + NP ++ +I++     KE  +  Q
Sbjct  288   LSSARPDSMEIKNNGAAATSSNPPESIVIDSSGECSKELTMHCQ  331


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = +1

Query  1468  SLDAQVKMQTKNQLVRKKQLLLEEEQGKREAELQKCTIYQKGDEETGSMKRCGHCRNLYP  1647
             +L A VKM  KNQ V K+QL   E Q  RE    KC IY KG EET S +RC  C+N + 
Sbjct  430   NLSAIVKMLKKNQRVLKRQLEGVEVQVPREPVQLKCIIYLKGGEETESTRRCVRCKNSFQ  489

Query  1648  TVIRRIKLQCL  1680
               IR IK QC 
Sbjct  490   IAIRWIKPQCW  500



>ref|XP_002466767.1| hypothetical protein SORBIDRAFT_01g013843 [Sorghum bicolor]
 gb|EER93765.1| hypothetical protein SORBIDRAFT_01g013843 [Sorghum bicolor]
Length=535

 Score =   101 bits (252),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S KR+  + E+S  PSEDA+ ESA      P +  T  +RSRAAEVHNLSERRRRDRINE
Sbjct  287   SSKRKRLDTEDSESPSEDAESESAAMLARKPPQKMTTARRSRAAEVHNLSERRRRDRINE  346

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  347   KMRALQELIPHCNKTDKASMLD  368



>ref|XP_004982351.1| PREDICTED: transcription factor PIF1-like isoform X2 [Setaria 
italica]
Length=524

 Score =   101 bits (251),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S KR+  + E+S  PSEDA+ ESA        +  T  +RSRAAEVHNLSERRRRDRINE
Sbjct  281   SSKRKRLDTEDSESPSEDAESESAAMLARKLPQKLTTARRSRAAEVHNLSERRRRDRINE  340

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  341   KMRALQELIPHCNKTDKASMLD  362



>ref|XP_004982350.1| PREDICTED: transcription factor PIF1-like isoform X1 [Setaria 
italica]
Length=528

 Score =   101 bits (251),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S KR+  + E+S  PSEDA+ ESA        +  T  +RSRAAEVHNLSERRRRDRINE
Sbjct  281   SSKRKRLDTEDSESPSEDAESESAAMLARKLPQKLTTARRSRAAEVHNLSERRRRDRINE  340

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  341   KMRALQELIPHCNKTDKASMLD  362



>ref|XP_004982352.1| PREDICTED: transcription factor PIF1-like isoform X3 [Setaria 
italica]
Length=520

 Score =   101 bits (251),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S KR+  + E+S  PSEDA+ ESA        +  T  +RSRAAEVHNLSERRRRDRINE
Sbjct  281   SSKRKRLDTEDSESPSEDAESESAAMLARKLPQKLTTARRSRAAEVHNLSERRRRDRINE  340

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  341   KMRALQELIPHCNKTDKASMLD  362



>ref|XP_010904661.1| PREDICTED: transcription factor PIF4-like isoform X8 [Elaeis 
guineensis]
Length=544

 Score =   101 bits (251),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 127/426 (30%), Positives = 189/426 (44%), Gaps = 106/426 (25%)
 Frame = +3

Query  513   PGSDFSELVWENGQITMQGQSSK-----------AKKSDNLSRMREKCVGNASSSRIGKL  659
             P ++  EL+W++G++ M  Q+ +           A+K++  S+ R   +GN+S       
Sbjct  31    PDNELVELLWQDGRVIMHSQTHRKSPPTVGEFKQAQKAEPASKCR-GALGNSS-------  82

Query  660   DLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPS  839
                                +LSQ+DE A W  +S  +   +E+ S+   E     A    
Sbjct  83    -------------------NLSQEDETASWFQHSLDDSLEKEF-SEFFCETPNVDA----  118

Query  840   PHDGFPLIGAS---KSVVNSGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNG  1010
                    IG+S   K V   G+R       S  FG     ++++ N  V   SD   S  
Sbjct  119   -------IGSSKMTKDVTEEGER-------STNFG-----ANEETN--VFAASDPKQSR-  156

Query  1011  SINLDSILKDSVPPQAKNQDTETTR--TCPP--TLLNFSNFS--RPVVLARANLQNTL-E  1169
                     K++  P  K+    +T+  +C     L+NFS+F+  RPV+    +L   L +
Sbjct  157   -----ICFKENTMPPPKSHIIASTQQASCLANSNLVNFSHFTRPRPVMADVGSLNGQLGK  211

Query  1170  AKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPN--------------LRTKFEQ  1307
               GKR   I+  A     T  I +      +   ++ P+              L+   + 
Sbjct  212   ESGKR---IRAGAVESTSTMTIASSICESNQIQAQADPSHTISSDAAGVVVRGLKEDAQM  268

Query  1308  TDAS-REDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENEESGCPS  1484
             T  S R  TN  +             S    G + ++++ +QSH  KR+ R+ EE    S
Sbjct  269   TSLSERTRTNTYEAT----VTSSSGGSGCSFGRTGQQSAINQSH--KRKGRDAEEYESQS  322

Query  1485  EDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKAD  1664
             E+AD E   A K A        +RSR+AEVHNLSERRRRDRINEKM+ALQELIP+CNK D
Sbjct  323   EEADYEYVEANKLAQRSALP--RRSRSAEVHNLSERRRRDRINEKMKALQELIPHCNKTD  380

Query  1665  KASMLD  1682
             KASMLD
Sbjct  381   KASMLD  386



>ref|XP_010904660.1| PREDICTED: transcription factor PIF4-like isoform X7 [Elaeis 
guineensis]
Length=560

 Score =   101 bits (251),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 127/426 (30%), Positives = 189/426 (44%), Gaps = 106/426 (25%)
 Frame = +3

Query  513   PGSDFSELVWENGQITMQGQSSK-----------AKKSDNLSRMREKCVGNASSSRIGKL  659
             P ++  EL+W++G++ M  Q+ +           A+K++  S+ R   +GN+S       
Sbjct  31    PDNELVELLWQDGRVIMHSQTHRKSPPTVGEFKQAQKAEPASKCR-GALGNSS-------  82

Query  660   DLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPS  839
                                +LSQ+DE A W  +S  +   +E+ S+   E     A    
Sbjct  83    -------------------NLSQEDETASWFQHSLDDSLEKEF-SEFFCETPNVDA----  118

Query  840   PHDGFPLIGAS---KSVVNSGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNG  1010
                    IG+S   K V   G+R       S  FG     ++++ N  V   SD   S  
Sbjct  119   -------IGSSKMTKDVTEEGER-------STNFG-----ANEETN--VFAASDPKQSR-  156

Query  1011  SINLDSILKDSVPPQAKNQDTETTR--TCPP--TLLNFSNFS--RPVVLARANLQNTL-E  1169
                     K++  P  K+    +T+  +C     L+NFS+F+  RPV+    +L   L +
Sbjct  157   -----ICFKENTMPPPKSHIIASTQQASCLANSNLVNFSHFTRPRPVMADVGSLNGQLGK  211

Query  1170  AKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPN--------------LRTKFEQ  1307
               GKR   I+  A     T  I +      +   ++ P+              L+   + 
Sbjct  212   ESGKR---IRAGAVESTSTMTIASSICESNQIQAQADPSHTISSDAAGVVVRGLKEDAQM  268

Query  1308  TDAS-REDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENEESGCPS  1484
             T  S R  TN  +             S    G + ++++ +QSH  KR+ R+ EE    S
Sbjct  269   TSLSERTRTNTYEAT----VTSSSGGSGCSFGRTGQQSAINQSH--KRKGRDAEEYESQS  322

Query  1485  EDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKAD  1664
             E+AD E   A K A        +RSR+AEVHNLSERRRRDRINEKM+ALQELIP+CNK D
Sbjct  323   EEADYEYVEANKLAQRSALP--RRSRSAEVHNLSERRRRDRINEKMKALQELIPHCNKTD  380

Query  1665  KASMLD  1682
             KASMLD
Sbjct  381   KASMLD  386



>gb|EMT27650.1| Transcription factor PIF3 [Aegilops tauschii]
Length=321

 Score = 98.6 bits (244),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S ++R  + E+S  PSEDA+ ES   ++  P +  T  +RSRAAEVHNLSERRRRDRINE
Sbjct  101   SKRKRGLDTEDSESPSEDAESESLALERKPPQKLTTA-RRSRAAEVHNLSERRRRDRINE  159

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  160   KMRALQELIPHCNKTDKASMLD  181



>ref|XP_006576979.1| PREDICTED: transcription factor PIF1-like isoform X3 [Glycine 
max]
 ref|XP_006576980.1| PREDICTED: transcription factor PIF1-like isoform X4 [Glycine 
max]
Length=496

 Score =   100 bits (249),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 60/80 (75%), Gaps = 3/80 (4%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE EE  C SED D ES   K+   +      KRSRAAEVHNLSERRRRDRINEKM
Sbjct  272   KRKGREAEEWECQSEDVDFESEAKKQVCGSTST---KRSRAAEVHNLSERRRRDRINEKM  328

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  329   KALQELIPRCNKSDKASMLD  348



>ref|XP_003521328.1| PREDICTED: transcription factor PIF1-like isoform X1 [Glycine 
max]
 ref|XP_006576978.1| PREDICTED: transcription factor PIF1-like isoform X2 [Glycine 
max]
Length=517

 Score =   100 bits (249),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 60/80 (75%), Gaps = 3/80 (4%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE EE  C SED D ES   K+   +      KRSRAAEVHNLSERRRRDRINEKM
Sbjct  272   KRKGREAEEWECQSEDVDFESEAKKQVCGSTST---KRSRAAEVHNLSERRRRDRINEKM  328

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  329   KALQELIPRCNKSDKASMLD  348



>emb|CDY06358.1| BnaA09g48450D [Brassica napus]
Length=491

 Score =   100 bits (248),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 118/200 (59%), Gaps = 19/200 (10%)
 Frame = +3

Query  1095  PTLLNFSNFSRPVVLARANLQNTLEAKGKREK---EIKENAQNPAKTALIEACSTSRKES  1265
             P L+NFS+F RP  L ++   N   +K K  +   ++ +     AK  L E+ +++  + 
Sbjct  162   PGLINFSHFLRPATLGKSPNNNADRSKEKSPQSPPKVFQTKVLGAKEVLNESVASAMPKD  221

Query  1266  DLKSQPNLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSLK  1445
               K+           D+ R++          KAV    CSSV SG+S + AS   S S+K
Sbjct  222   SQKA------CLVSEDSGRKEQES------EKAV---VCSSVGSGNSLDGASESPSLSVK  266

Query  1446  RRARENEESGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             R+  + ++  C SED + ES   +K A  +R G+G KRSR+AEVHNLSERRRRDRINEKM
Sbjct  267   RKHSDVQDIDCHSEDVEGESGDGRKEAAPSRTGSGSKRSRSAEVHNLSERRRRDRINEKM  326

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIPNCNK DKASMLD
Sbjct  327   RALQELIPNCNKVDKASMLD  346


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 64/129 (50%), Gaps = 19/129 (15%)
 Frame = +3

Query  423  MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
            MPL E  ++ K          ++ D+ +  P  +  ELVWENGQ++ Q +S         
Sbjct  1    MPLFELFRLSK----------AAQDNNTSPPVDEVVELVWENGQVSTQSRSKNTPPPHQG  50

Query  603  SRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQ  782
            +  R + VGN+S +         +++DE+P SVPS    LSQDD+  PW+N+   +    
Sbjct  51   ASSRPREVGNSSKT---------TIMDEIPMSVPSLMTGLSQDDDFVPWINHHHPHQSLD  101

Query  783  EYGSQLLPE  809
             Y S+ L E
Sbjct  102  GYCSEFLQE  110



>ref|XP_009118315.1| PREDICTED: transcription factor PIF3-like [Brassica rapa]
 ref|XP_009118316.1| PREDICTED: transcription factor PIF3-like [Brassica rapa]
Length=492

 Score =   100 bits (248),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 118/200 (59%), Gaps = 19/200 (10%)
 Frame = +3

Query  1095  PTLLNFSNFSRPVVLARANLQNTLEAKGKREK---EIKENAQNPAKTALIEACSTSRKES  1265
             P L+NFS+F RP  L ++   N   +K K  +   ++ +     AK  L E+ +++  + 
Sbjct  162   PGLINFSHFLRPATLGKSPNNNADRSKEKSPQSPPKVFQTKVLGAKEVLNESVASAMPKD  221

Query  1266  DLKSQPNLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSLK  1445
               K+           D+ R++          KAV    CSSV SG+S + AS   S S+K
Sbjct  222   SQKA------CLVSEDSGRKEQES------EKAV---VCSSVGSGNSLDGASESPSLSVK  266

Query  1446  RRARENEESGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             R+  + ++  C SED + ES   +K A  +R GTG KRSR+AEVHNLSERRRRDRINEKM
Sbjct  267   RKHSDVQDIDCHSEDVEGESGDGRKEAAPSRTGTGSKRSRSAEVHNLSERRRRDRINEKM  326

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIPNCNK DKASMLD
Sbjct  327   RALQELIPNCNKVDKASMLD  346


 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 64/129 (50%), Gaps = 19/129 (15%)
 Frame = +3

Query  423  MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
            MPL E  ++ K          ++ D+ +  P  +  ELVWENGQ++ Q +S         
Sbjct  1    MPLFELFRLSK----------AAQDNNTSPPVDEVVELVWENGQVSTQSRSKNTPPPHQG  50

Query  603  SRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQ  782
            +  R + VGN+S +         +++DE+P SVPS    LSQDD+  PW+N+   +    
Sbjct  51   ASSRPREVGNSSKT---------TIMDEIPMSVPSLMTGLSQDDDFVPWINHHHPHQSLD  101

Query  783  EYGSQLLPE  809
             Y S+ L E
Sbjct  102  GYCSEFLQE  110



>gb|KDO44794.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
 gb|KDO44795.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
Length=286

 Score = 97.8 bits (242),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRINE
Sbjct  47    SLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRINE  104

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  105   KMRALQELIPHCNKTDKASMLD  126



>ref|XP_006594070.1| PREDICTED: transcription factor PIF1-like isoform X1 [Glycine 
max]
Length=509

 Score =   100 bits (249),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE+EES   SED D ES  AKK       T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  259   KRKGREHEESEFQSEDVDFESPEAKKQVHGSTST--KRSRAAEVHNLSERRRRDRINEKM  316

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  317   KALQELIPRCNKSDKASMLD  336



>gb|KDO44798.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
Length=327

 Score = 98.2 bits (243),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRINE
Sbjct  47    SLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRINE  104

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  105   KMRALQELIPHCNKTDKASMLD  126



>gb|KDO44796.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
 gb|KDO44797.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
Length=283

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRINE
Sbjct  47    SLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRINE  104

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  105   KMRALQELIPHCNKTDKASMLD  126



>ref|XP_007049883.1| Phytochrome interacting factor 3-like 5, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007049884.1| Phytochrome interacting factor 3-like 5, putative isoform 1 [Theobroma 
cacao]
 gb|EOX94040.1| Phytochrome interacting factor 3-like 5, putative isoform 1 [Theobroma 
cacao]
 gb|EOX94041.1| Phytochrome interacting factor 3-like 5, putative isoform 1 [Theobroma 
cacao]
Length=539

 Score =   100 bits (249),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE +++ C SEDA+ ESA  KK       T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  305   KRKGREPDDAECHSEDAEFESADTKKQTRGSTST--KRSRAAEVHNLSERRRRDRINEKM  362

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIP CNK+DKASMLD
Sbjct  363   RALQELIPRCNKSDKASMLD  382



>ref|XP_007049885.1| Phytochrome interacting factor 3-like 5, putative isoform 3 [Theobroma 
cacao]
 gb|EOX94042.1| Phytochrome interacting factor 3-like 5, putative isoform 3 [Theobroma 
cacao]
Length=516

 Score =   100 bits (248),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE +++ C SEDA+ ESA  KK       T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  282   KRKGREPDDAECHSEDAEFESADTKKQTRGSTST--KRSRAAEVHNLSERRRRDRINEKM  339

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIP CNK+DKASMLD
Sbjct  340   RALQELIPRCNKSDKASMLD  359



>gb|EYU17967.1| hypothetical protein MIMGU_mgv1a007316mg [Erythranthe guttata]
Length=411

 Score = 99.0 bits (245),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ARE +E+ C SED + E AG +      G    KRSRAA+VHNLSERRRRDRINEKM
Sbjct  186   KRKAREADENECQSEDIEFEVAGGEAKKQVCGSASTKRSRAAQVHNLSERRRRDRINEKM  245

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  246   KALQELIPRCNKSDKASMLD  265



>gb|EYU46364.1| hypothetical protein MIMGU_mgv1a007040mg [Erythranthe guttata]
Length=422

 Score = 98.6 bits (244),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ARE++++ C SED + E+  AKK +     T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  183   KRKAREDDDNECQSEDFEYEATEAKKQSRGATST--KRSRAAEVHNLSERRRRDRINEKM  240

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  241   KALQELIPRCNKSDKASMLD  260



>gb|KDO44791.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
Length=337

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRINE
Sbjct  47    SLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRINE  104

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  105   KMRALQELIPHCNKTDKASMLD  126



>gb|KDO44792.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
 gb|KDO44793.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
Length=334

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRINE
Sbjct  47    SLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRINE  104

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  105   KMRALQELIPHCNKTDKASMLD  126



>tpg|DAA50359.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04558.1| bHLH transcription factor, partial [Zea mays]
Length=562

 Score = 99.8 bits (247),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S KR+  + E+S  PSEDA+  SA      P +  T  +RSRAAEVHNLSERRRRDRINE
Sbjct  292   SSKRKRLDTEDSESPSEDAESGSAAMLARKPPQKMTTARRSRAAEVHNLSERRRRDRINE  351

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  352   KMRALQELIPHCNKTDKASMLD  373



>ref|NP_001147809.1| PIL5 [Zea mays]
 gb|ACG28763.1| PIL5 [Zea mays]
Length=539

 Score = 99.4 bits (246),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S KR+  + E+S  PSEDA+  SA      P +  T  +RSRAAEVHNLSERRRRDRINE
Sbjct  292   SSKRKRLDTEDSESPSEDAESGSAAMLARKPPQKMTTARRSRAAEVHNLSERRRRDRINE  351

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  352   KMRALQELIPHCNKTDKASMLD  373



>gb|KHG01839.1| Transcription factor PIF1 -like protein [Gossypium arboreum]
Length=542

 Score = 99.4 bits (246),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE +E+ C SE+A+ ESA  KK          KRSRAAEVHNLSERRRRDRINEKM
Sbjct  310   KRKGRELDEAECHSENAEFESADTKKQTRGSTSA--KRSRAAEVHNLSERRRRDRINEKM  367

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIP CNK+DKASMLD
Sbjct  368   RALQELIPRCNKSDKASMLD  387



>ref|XP_004967640.1| PREDICTED: transcription factor PIF3-like isoform X1 [Setaria 
italica]
 ref|XP_004967641.1| PREDICTED: transcription factor PIF3-like isoform X2 [Setaria 
italica]
 ref|XP_004967642.1| PREDICTED: transcription factor PIF3-like isoform X3 [Setaria 
italica]
 ref|XP_004967643.1| PREDICTED: transcription factor PIF3-like isoform X4 [Setaria 
italica]
 ref|XP_004967644.1| PREDICTED: transcription factor PIF3-like isoform X5 [Setaria 
italica]
Length=624

 Score = 99.8 bits (247),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 91/248 (37%), Positives = 118/248 (48%), Gaps = 55/248 (22%)
 Frame = +3

Query  1047  PPQAKNQDTETTRTCPPT--LLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPA  1220
             PPQA+   T+ TR       L+NFS FSRP  +ARA+LQ+               AQ P 
Sbjct  183   PPQAEFAATKQTRLGGGAEGLMNFSLFSRPAAMARASLQS---------------AQRPP  227

Query  1221  KTALIEA---CSTSRKESDL-------KSQPNL---RTKFEQTDASREDTNDA-------  1340
             +T   +A    +++R ES +       ++ P     RT + Q    R     A       
Sbjct  228   QTGTDKASNVTTSTRVESTVLQSSIGPRTTPVFTDQRTAWSQPKEVRFSCTAAPTAGNLQ  287

Query  1341  --------------DKVHGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENEESGC  1478
                            +V   K  E    +S     +     ND+S    +R  + E S  
Sbjct  288   QEMPRDRLGSMTLQKQVKTRKEPEAAVATSSVCSGNGAGIGNDESWRQHKRKSQAECSAS  347

Query  1479  PSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK  1658
               +D ++ES GA+++         KRSR AEVHNLSERRRRDRINEKMRALQELIPNCNK
Sbjct  348   QDDDLEDESGGARRSGSRGT----KRSRTAEVHNLSERRRRDRINEKMRALQELIPNCNK  403

Query  1659  ADKASMLD  1682
              DKASMLD
Sbjct  404   IDKASMLD  411



>gb|KHG18014.1| Transcription factor PIF1 -like protein [Gossypium arboreum]
Length=552

 Score = 99.4 bits (246),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE +++ C SEDA+ ES   KK +     T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  302   KRKGREPDDAECHSEDAEFESPETKKQSRGSSST--KRSRAAEVHNLSERRRRDRINEKM  359

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIP CNK+DKASMLD
Sbjct  360   RALQELIPRCNKSDKASMLD  379



>dbj|BAJ90328.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=209

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +3

Query  1458  ENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQE  1637
             + E+S  PSEDA+ ES    +  P +  T  +RSRAAEVHNLSERRRRDRINEKMRALQE
Sbjct  3     DTEDSESPSEDAESESLALDRKPPQKLTTA-RRSRAAEVHNLSERRRRDRINEKMRALQE  61

Query  1638  LIPNCNKADKASMLD  1682
             LIP+CNK DKASMLD
Sbjct  62    LIPHCNKTDKASMLD  76



>ref|XP_004967645.1| PREDICTED: transcription factor PIF3-like isoform X6 [Setaria 
italica]
Length=619

 Score = 99.4 bits (246),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 91/248 (37%), Positives = 118/248 (48%), Gaps = 55/248 (22%)
 Frame = +3

Query  1047  PPQAKNQDTETTRTCPPT--LLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPA  1220
             PPQA+   T+ TR       L+NFS FSRP  +ARA+LQ+               AQ P 
Sbjct  178   PPQAEFAATKQTRLGGGAEGLMNFSLFSRPAAMARASLQS---------------AQRPP  222

Query  1221  KTALIEA---CSTSRKESDL-------KSQPNL---RTKFEQTDASREDTNDA-------  1340
             +T   +A    +++R ES +       ++ P     RT + Q    R     A       
Sbjct  223   QTGTDKASNVTTSTRVESTVLQSSIGPRTTPVFTDQRTAWSQPKEVRFSCTAAPTAGNLQ  282

Query  1341  --------------DKVHGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENEESGC  1478
                            +V   K  E    +S     +     ND+S    +R  + E S  
Sbjct  283   QEMPRDRLGSMTLQKQVKTRKEPEAAVATSSVCSGNGAGIGNDESWRQHKRKSQAECSAS  342

Query  1479  PSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK  1658
               +D ++ES GA+++         KRSR AEVHNLSERRRRDRINEKMRALQELIPNCNK
Sbjct  343   QDDDLEDESGGARRSGSRGT----KRSRTAEVHNLSERRRRDRINEKMRALQELIPNCNK  398

Query  1659  ADKASMLD  1682
              DKASMLD
Sbjct  399   IDKASMLD  406



>emb|CDY22636.1| BnaC08g42700D [Brassica napus]
Length=491

 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 114/197 (58%), Gaps = 13/197 (7%)
 Frame = +3

Query  1095  PTLLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLK  1274
             P L+NFS+F RP  L ++   N       R KE  ++ Q+P K  + +      KE    
Sbjct  161   PGLINFSHFLRPATLGKSTNNNA-----DRSKE--KSPQSPPK--VFQTKVLGAKEVLND  211

Query  1275  SQPNLRTKFEQTDASREDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSLKRRA  1454
             S  +   K  Q      + +   +    KAV    CSSV SG+S +  S   S S+KR+ 
Sbjct  212   SVASAMAKDSQKACLVSEDSGRKEQESEKAV---VCSSVGSGNSLDGPSESPSLSVKRKH  268

Query  1455  RENEESGCPSEDADEESagakkaap-arggtgQKRSRAAEVHNLSERRRRDRINEKMRAL  1631
              + ++  C SED + ES   +K A  +R GTG KRSR+AEVHNLSERRRRDRINEKMRAL
Sbjct  269   SDVQDIDCHSEDVEGESGDGRKEAAPSRTGTGSKRSRSAEVHNLSERRRRDRINEKMRAL  328

Query  1632  QELIPNCNKADKASMLD  1682
             QELIPNCNK DKASMLD
Sbjct  329   QELIPNCNKVDKASMLD  345


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 58/112 (52%), Gaps = 19/112 (17%)
 Frame = +3

Query  423  MPLSEFLKMLKNESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKSDNL  602
            MPL E  ++ K          ++ D+ +  P  +  ELVWENGQ++ Q +S         
Sbjct  1    MPLFELFRLSK----------AAQDNNTSPPVDEVVELVWENGQVSTQSRSKNIPPPHQG  50

Query  603  SRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNY  758
            +  R + +GNAS +         +V+DE+P  VPS  M LSQDD+  PWLN+
Sbjct  51   TSSRPREIGNASKT---------TVMDEIPMPVPSLMMGLSQDDDFVPWLNH  93



>ref|XP_010245662.1| PREDICTED: transcription factor PIF1-like isoform X3 [Nelumbo 
nucifera]
Length=566

 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR++RE +++ C SEDA+ ES   KK          +RSRAAEVHNLSERRRRDRINEKM
Sbjct  324   KRKSREQDDNECQSEDAEFESVETKKQVRGSTSA--RRSRAAEVHNLSERRRRDRINEKM  381

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  382   KALQELIPRCNKSDKASMLD  401



>gb|KCW89801.1| hypothetical protein EUGRSUZ_A02043 [Eucalyptus grandis]
Length=405

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S KR+ R+NEES C SE A+ E AG KK A   G T  +RSRAAEVHNLSERRRRDRIN+
Sbjct  298   SHKRKGRDNEESECQSEAAEPEVAGGKKPATRSGST--RRSRAAEVHNLSERRRRDRINK  355

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KM+ALQELIP+CNK DKASMLD
Sbjct  356   KMKALQELIPHCNKTDKASMLD  377



>ref|XP_010245661.1| PREDICTED: transcription factor PIF1-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR++RE +++ C SEDA+ ES   KK          +RSRAAEVHNLSERRRRDRINEKM
Sbjct  322   KRKSREQDDNECQSEDAEFESVETKKQVRGSTSA--RRSRAAEVHNLSERRRRDRINEKM  379

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  380   KALQELIPRCNKSDKASMLD  399



>ref|XP_010245660.1| PREDICTED: transcription factor PIF1-like isoform X1 [Nelumbo 
nucifera]
Length=584

 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR++RE +++ C SEDA+ ES   KK          +RSRAAEVHNLSERRRRDRINEKM
Sbjct  324   KRKSREQDDNECQSEDAEFESVETKKQVRGSTSA--RRSRAAEVHNLSERRRRDRINEKM  381

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  382   KALQELIPRCNKSDKASMLD  401



>ref|XP_010054152.1| PREDICTED: transcription factor PIF5 [Eucalyptus grandis]
 gb|KCW89799.1| hypothetical protein EUGRSUZ_A02043 [Eucalyptus grandis]
 gb|KCW89800.1| hypothetical protein EUGRSUZ_A02043 [Eucalyptus grandis]
Length=533

 Score = 98.6 bits (244),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S KR+ R+NEES C SE A+ E AG KK A   G T  +RSRAAEVHNLSERRRRDRIN+
Sbjct  298   SHKRKGRDNEESECQSEAAEPEVAGGKKPATRSGST--RRSRAAEVHNLSERRRRDRINK  355

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KM+ALQELIP+CNK DKASMLD
Sbjct  356   KMKALQELIPHCNKTDKASMLD  377



>ref|XP_010245663.1| PREDICTED: transcription factor PIF1-like isoform X4 [Nelumbo 
nucifera]
 ref|XP_010245664.1| PREDICTED: transcription factor PIF1-like isoform X4 [Nelumbo 
nucifera]
Length=533

 Score = 98.6 bits (244),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR++RE +++ C SEDA+ ES   KK          +RSRAAEVHNLSERRRRDRINEKM
Sbjct  273   KRKSREQDDNECQSEDAEFESVETKKQVRGSTSA--RRSRAAEVHNLSERRRRDRINEKM  330

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  331   KALQELIPRCNKSDKASMLD  350



>ref|XP_007144439.1| hypothetical protein PHAVU_007G156200g [Phaseolus vulgaris]
 gb|ESW16433.1| hypothetical protein PHAVU_007G156200g [Phaseolus vulgaris]
Length=517

 Score = 98.2 bits (243),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE EES   SED D ES  AKK       T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  257   KRKGREAEESEFQSEDVDFESPEAKKHGRGSTST--KRSRAAEVHNLSERRRRDRINEKM  314

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  315   KALQELIPRCNKSDKASMLD  334



>tpg|DAA54248.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05460.1| bHLH transcription factor, partial [Zea mays]
Length=567

 Score = 98.6 bits (244),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 104/210 (50%), Gaps = 23/210 (11%)
 Frame = +3

Query  1101  LLNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQ  1280
             L+NFS FSRP  L RA+LQ     +   +K          ++ ++++ S  R       Q
Sbjct  190   LMNFSLFSRPAALVRASLQRPPPPQTGTDKVSNVTTSTRVESTVLQSASGPRIAPVFTDQ  249

Query  1281  PNLRTKFEQTDASREDTNDA---DKVHGNKAV-EPgacssvcsgssaERA----------  1418
                RT + Q+   R     A     +H +  +  PG   +       ++A          
Sbjct  250   ---RTAWSQSKEVRFSCAPALAAGNLHQDMPLGRPGNNMTPQGKMETKKACEVAVATPSL  306

Query  1419  --SNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSER  1592
                N +S   ++R  + E S    +D D+ES G + +         KRSR AEVHNLSER
Sbjct  307   CSGNGESWREQKRKSQAECSASQDDDLDDESGGMRGSGGRGT----KRSRTAEVHNLSER  362

Query  1593  RRRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  363   RRRDRINEKMRALQELIPNCNKIDKASMLD  392



>gb|AGW52145.1| PIL [Populus tomentosa]
Length=571

 Score = 98.2 bits (243),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 63/80 (79%), Gaps = 3/80 (4%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE EE+ C SEDA+ ESA A K       +  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  287   KRKGRE-EEAECHSEDAEFESADANKQIRGSMSS--KRSRAAEVHNLSERRRRDRINEKM  343

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIP CNK+DKASMLD
Sbjct  344   RALQELIPRCNKSDKASMLD  363



>gb|KCW89798.1| hypothetical protein EUGRSUZ_A02043 [Eucalyptus grandis]
Length=568

 Score = 98.2 bits (243),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S KR+ R+NEES C SE A+ E AG KK A   G T  +RSRAAEVHNLSERRRRDRIN+
Sbjct  333   SHKRKGRDNEESECQSEAAEPEVAGGKKPATRSGST--RRSRAAEVHNLSERRRRDRINK  390

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KM+ALQELIP+CNK DKASMLD
Sbjct  391   KMKALQELIPHCNKTDKASMLD  412



>ref|XP_004495025.1| PREDICTED: transcription factor PIF1-like isoform X1 [Cicer arietinum]
 ref|XP_004495026.1| PREDICTED: transcription factor PIF1-like isoform X2 [Cicer arietinum]
 ref|XP_004495027.1| PREDICTED: transcription factor PIF1-like isoform X3 [Cicer arietinum]
Length=525

 Score = 98.2 bits (243),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 59/80 (74%), Gaps = 3/80 (4%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE +ES   SED D ES   KK          KRSRAAEVHNLSERRRRDRINEKM
Sbjct  281   KRKGREPDESEFQSEDVDFESKEEKKQIRGSAS---KRSRAAEVHNLSERRRRDRINEKM  337

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  338   KALQELIPRCNKSDKASMLD  357



>ref|XP_004499538.1| PREDICTED: transcription factor PIF4-like isoform X1 [Cicer arietinum]
Length=535

 Score = 97.8 bits (242),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 117/405 (29%), Positives = 186/405 (46%), Gaps = 72/405 (18%)
 Frame = +3

Query  522   DFSELVWENGQITMQGQSSKAKKSDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSV  701
             +  EL+W+NGQ+ +  Q+++   +   SR  +K   N  S+ +   +  GS         
Sbjct  28    ELVELLWQNGQVVLHSQTNRKPIT---SRHVQK---NLQSTTLRTNETFGS---------  72

Query  702   PSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSV  881
                  +L QDDE   W++Y   +   QE  S LL E+        SP D   ++ + K +
Sbjct  73    ---SSNLIQDDETVSWIHYPLEDPLEQELCSNLLSEL--------SPCDD--VVESYKQI  119

Query  882   VNSGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAK  1061
              N  +   +KLD S         S   AN        I S   ++    + + S P Q  
Sbjct  120   RNFEEGKFSKLDAS---------SDPHAN--------INSQPSNLKPSFVQEFSKPDQRF  162

Query  1062  NQDTETTRTCPPTLLNFSNFSRPVVLAR------ANLQNTLEAKGKREKEIKENAQNPAK  1223
             +   +++      +LNFS+FSRP  ++       A+ ++ + +    + +I+E +   A 
Sbjct  163   HHAPDSSH----KILNFSHFSRPPNVSSVTGKGDAHFRDKVTSGNLSQGDIRECS---AM  215

Query  1224  TALIEACSTSRKESDLKSQPNLRTKFEQTDASREDTNDADKVH---------GNKAVEPg  1376
             T +   C ++    D             T  S E     D +H          ++ +EP 
Sbjct  216   TVVSSYCGSNHIPQDQDVSRVSSNGVWNTTLSAEPKPVKDDIHKTIPRHEKGKSEMIEPT  275

Query  1377  acssvcsgssaERAS---NDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtg  1547
               SS     S+   +   + +SH  KR+  + E+S   SED + +SA   K +   G   
Sbjct  276   VTSSSGGSGSSLGKTSSLSTRSHGQKRKIIDVEDSVEQSEDTELKSAVRNKVSQRSGSA-  334

Query  1548  QKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
              +R+RAAEVHNLSERRRRDRINEKM+ALQ+LIP+ +K DKASML+
Sbjct  335   -RRNRAAEVHNLSERRRRDRINEKMKALQQLIPHSSKTDKASMLE  378



>ref|XP_006386276.1| hypothetical protein POPTR_0002s05630g [Populus trichocarpa]
 ref|XP_002302124.2| hypothetical protein POPTR_0002s05630g [Populus trichocarpa]
 gb|ERP64073.1| hypothetical protein POPTR_0002s05630g [Populus trichocarpa]
 gb|EEE81397.2| hypothetical protein POPTR_0002s05630g [Populus trichocarpa]
Length=530

 Score = 97.8 bits (242),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+  + EES C SEDA+ +SA A K A   G T  +RSRAAEVHNLSERRRRDRINEKM
Sbjct  294   KRKTMDAEESECQSEDAELDSAVANKPAKRSGST--RRSRAAEVHNLSERRRRDRINEKM  351

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIP+CNK DKASMLD
Sbjct  352   RALQELIPHCNKTDKASMLD  371



>ref|XP_011026200.1| PREDICTED: transcription factor PIF4 [Populus euphratica]
 ref|XP_011026201.1| PREDICTED: transcription factor PIF4 [Populus euphratica]
 ref|XP_011026202.1| PREDICTED: transcription factor PIF4 [Populus euphratica]
 ref|XP_011026203.1| PREDICTED: transcription factor PIF4 [Populus euphratica]
Length=528

 Score = 97.8 bits (242),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+  + EES C SEDA+ +SA A K A   G    +RSRAAEVHNLSERRRRDRINEKM
Sbjct  294   KRKTMDAEESECQSEDAELDSAVANKPAKRSGSA--RRSRAAEVHNLSERRRRDRINEKM  351

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIP+CNK DKASMLD
Sbjct  352   RALQELIPHCNKTDKASMLD  371



>ref|XP_004499540.1| PREDICTED: transcription factor PIF4-like isoform X3 [Cicer arietinum]
Length=527

 Score = 97.8 bits (242),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 117/405 (29%), Positives = 186/405 (46%), Gaps = 72/405 (18%)
 Frame = +3

Query  522   DFSELVWENGQITMQGQSSKAKKSDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSV  701
             +  EL+W+NGQ+ +  Q+++   +   SR  +K   N  S+ +   +  GS         
Sbjct  28    ELVELLWQNGQVVLHSQTNRKPIT---SRHVQK---NLQSTTLRTNETFGS---------  72

Query  702   PSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSV  881
                  +L QDDE   W++Y   +   QE  S LL E+        SP D   ++ + K +
Sbjct  73    ---SSNLIQDDETVSWIHYPLEDPLEQELCSNLLSEL--------SPCDD--VVESYKQI  119

Query  882   VNSGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAK  1061
              N  +   +KLD S         S   AN        I S   ++    + + S P Q  
Sbjct  120   RNFEEGKFSKLDAS---------SDPHAN--------INSQPSNLKPSFVQEFSKPDQRF  162

Query  1062  NQDTETTRTCPPTLLNFSNFSRPVVLAR------ANLQNTLEAKGKREKEIKENAQNPAK  1223
             +   +++      +LNFS+FSRP  ++       A+ ++ + +    + +I+E +   A 
Sbjct  163   HHAPDSSH----KILNFSHFSRPPNVSSVTGKGDAHFRDKVTSGNLSQGDIRECS---AM  215

Query  1224  TALIEACSTSRKESDLKSQPNLRTKFEQTDASREDTNDADKVH---------GNKAVEPg  1376
             T +   C ++    D             T  S E     D +H          ++ +EP 
Sbjct  216   TVVSSYCGSNHIPQDQDVSRVSSNGVWNTTLSAEPKPVKDDIHKTIPRHEKGKSEMIEPT  275

Query  1377  acssvcsgssaERAS---NDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtg  1547
               SS     S+   +   + +SH  KR+  + E+S   SED + +SA   K +   G   
Sbjct  276   VTSSSGGSGSSLGKTSSLSTRSHGQKRKIIDVEDSVEQSEDTELKSAVRNKVSQRSGSA-  334

Query  1548  QKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
              +R+RAAEVHNLSERRRRDRINEKM+ALQ+LIP+ +K DKASML+
Sbjct  335   -RRNRAAEVHNLSERRRRDRINEKMKALQQLIPHSSKTDKASMLE  378



>ref|XP_004499539.1| PREDICTED: transcription factor PIF4-like isoform X2 [Cicer arietinum]
Length=531

 Score = 97.8 bits (242),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 117/405 (29%), Positives = 186/405 (46%), Gaps = 72/405 (18%)
 Frame = +3

Query  522   DFSELVWENGQITMQGQSSKAKKSDNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSV  701
             +  EL+W+NGQ+ +  Q+++   +   SR  +K   N  S+ +   +  GS         
Sbjct  28    ELVELLWQNGQVVLHSQTNRKPIT---SRHVQK---NLQSTTLRTNETFGS---------  72

Query  702   PSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPSPHDGFPLIGASKSV  881
                  +L QDDE   W++Y   +   QE  S LL E+        SP D   ++ + K +
Sbjct  73    ---SSNLIQDDETVSWIHYPLEDPLEQELCSNLLSEL--------SPCDD--VVESYKQI  119

Query  882   VNSGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNGSINLDSILKDSVPPQAK  1061
              N  +   +KLD S         S   AN        I S   ++    + + S P Q  
Sbjct  120   RNFEEGKFSKLDAS---------SDPHAN--------INSQPSNLKPSFVQEFSKPDQRF  162

Query  1062  NQDTETTRTCPPTLLNFSNFSRPVVLAR------ANLQNTLEAKGKREKEIKENAQNPAK  1223
             +   +++      +LNFS+FSRP  ++       A+ ++ + +    + +I+E +   A 
Sbjct  163   HHAPDSSH----KILNFSHFSRPPNVSSVTGKGDAHFRDKVTSGNLSQGDIRECS---AM  215

Query  1224  TALIEACSTSRKESDLKSQPNLRTKFEQTDASREDTNDADKVH---------GNKAVEPg  1376
             T +   C ++    D             T  S E     D +H          ++ +EP 
Sbjct  216   TVVSSYCGSNHIPQDQDVSRVSSNGVWNTTLSAEPKPVKDDIHKTIPRHEKGKSEMIEPT  275

Query  1377  acssvcsgssaERAS---NDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtg  1547
               SS     S+   +   + +SH  KR+  + E+S   SED + +SA   K +   G   
Sbjct  276   VTSSSGGSGSSLGKTSSLSTRSHGQKRKIIDVEDSVEQSEDTELKSAVRNKVSQRSGSA-  334

Query  1548  QKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
              +R+RAAEVHNLSERRRRDRINEKM+ALQ+LIP+ +K DKASML+
Sbjct  335   -RRNRAAEVHNLSERRRRDRINEKMKALQQLIPHSSKTDKASMLE  378



>gb|AHM26454.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26473.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26474.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26485.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26486.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26488.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26490.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  1551  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             KRSR+AEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  1     KRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  44



>dbj|BAJ93366.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score = 97.4 bits (241),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S ++R  + E+S  PSEDA+ ES    +  P +  T  +RSRAAEVHNLSERRRRDRINE
Sbjct  275   SKRKRGLDTEDSESPSEDAESESLALDRKPPQKLTTA-RRSRAAEVHNLSERRRRDRINE  333

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  334   KMRALQELIPHCNKTDKASMLD  355



>tpg|DAA54246.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=377

 Score = 95.9 bits (237),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 103/209 (49%), Gaps = 23/209 (11%)
 Frame = +3

Query  1104  LNFSNFSRPVVLARANLQNTLEAKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQP  1283
             +NFS FSRP  L RA+LQ     +   +K          ++ ++++ S  R       Q 
Sbjct  1     MNFSLFSRPAALVRASLQRPPPPQTGTDKVSNVTTSTRVESTVLQSASGPRIAPVFTDQ-  59

Query  1284  NLRTKFEQTDASREDTNDA---DKVHGNKAV-EPgacssvcsgssaERA-----------  1418
               RT + Q+   R     A     +H +  +  PG   +       ++A           
Sbjct  60    --RTAWSQSKEVRFSCAPALAAGNLHQDMPLGRPGNNMTPQGKMETKKACEVAVATPSLC  117

Query  1419  -SNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERR  1595
               N +S   ++R  + E S    +D D+ES G + +         KRSR AEVHNLSERR
Sbjct  118   SGNGESWREQKRKSQAECSASQDDDLDDESGGMRGSGGRGT----KRSRTAEVHNLSERR  173

Query  1596  RRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  174   RRDRINEKMRALQELIPNCNKIDKASMLD  202



>ref|XP_006437070.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
 gb|ESR50310.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
Length=592

 Score = 97.8 bits (242),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRINE
Sbjct  312   SLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRINE  369

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  370   KMRALQELIPHCNKTDKASMLD  391



>gb|AHM26463.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26471.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26472.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26475.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26477.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26478.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26479.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26480.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26481.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26482.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26483.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26484.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26487.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26489.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  1551  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             KRSR+AEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  1     KRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  44



>ref|XP_006437072.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
 gb|ESR50312.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
Length=583

 Score = 97.8 bits (242),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRINE
Sbjct  303   SLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRINE  360

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  361   KMRALQELIPHCNKTDKASMLD  382



>gb|AHM26452.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26457.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26458.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26459.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26460.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26461.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26462.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26465.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26466.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26467.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26468.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  1551  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             KRSR+AEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  1     KRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  44



>gb|AHM26451.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26453.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26464.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26469.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26470.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  1551  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             KRSR+AEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  1     KRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  44



>gb|AHM26455.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26456.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  1551  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             KRSR+AEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  1     KRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  44



>ref|XP_006437068.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
 gb|ESR50308.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
Length=551

 Score = 97.4 bits (241),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRINE
Sbjct  312   SLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRINE  369

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  370   KMRALQELIPHCNKTDKASMLD  391



>ref|XP_006437071.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
 gb|ESR50311.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
Length=580

 Score = 97.8 bits (242),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRINE
Sbjct  303   SLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRINE  360

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  361   KMRALQELIPHCNKTDKASMLD  382



>gb|AHM26476.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +3

Query  1551  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             KRSR+AEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  1     KRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  44



>ref|XP_006651623.1| PREDICTED: transcription factor PIF5-like [Oryza brachyantha]
Length=350

 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S ++R    E+S  PSEDA+ ESA   +  P +  T  +RSRAAEVHNLSERRRRDRINE
Sbjct  149   SKRKRLDTTEDSESPSEDAESESAALAQKPPPKLTTA-RRSRAAEVHNLSERRRRDRINE  207

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  208   KMRALQELIPHCNKTDKASMLD  229



>ref|XP_002278399.1| PREDICTED: transcription factor PIF4 [Vitis vinifera]
 ref|XP_010657098.1| PREDICTED: transcription factor PIF4 [Vitis vinifera]
 ref|XP_010657099.1| PREDICTED: transcription factor PIF4 [Vitis vinifera]
Length=531

 Score = 97.4 bits (241),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = +3

Query  1431  SHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRI  1610
             ++S KR+ RE EES C SE A+ ESA   KA+   G T  +RSRAAEVHNLSERRRRDRI
Sbjct  297   TNSHKRKGREAEESECQSEAAEHESAARNKASQRSGST--RRSRAAEVHNLSERRRRDRI  354

Query  1611  NEKMRALQELIPNCNKADKASMLD  1682
             NEKM+ALQELIP+ NK+DKASMLD
Sbjct  355   NEKMKALQELIPHSNKSDKASMLD  378



>ref|XP_006485005.1| PREDICTED: transcription factor PIF4-like isoform X1 [Citrus 
sinensis]
Length=548

 Score = 97.4 bits (241),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRINE
Sbjct  312   SLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRINE  369

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  370   KMRALQELIPHCNKTDKASMLD  391



>ref|XP_006485007.1| PREDICTED: transcription factor PIF4-like isoform X3 [Citrus 
sinensis]
Length=551

 Score = 97.4 bits (241),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRINE
Sbjct  312   SLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRINE  369

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  370   KMRALQELIPHCNKTDKASMLD  391



>ref|XP_006437069.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
 gb|ESR50309.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
Length=542

 Score = 97.4 bits (241),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRINE
Sbjct  303   SLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRINE  360

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  361   KMRALQELIPHCNKTDKASMLD  382



>ref|XP_006485006.1| PREDICTED: transcription factor PIF4-like isoform X2 [Citrus 
sinensis]
Length=542

 Score = 97.4 bits (241),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 62/82 (76%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             SLKR++R+  +S C SE A  ES    K A   G    +RSRAAEVHNLSERRRRDRINE
Sbjct  303   SLKRKSRDAVDSECQSEAAGFESGAGNKTAQRSGSC--RRSRAAEVHNLSERRRRDRINE  360

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  361   KMRALQELIPHCNKTDKASMLD  382



>ref|XP_011083103.1| PREDICTED: transcription factor PIF1 [Sesamum indicum]
Length=520

 Score = 97.1 bits (240),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ARE +++ C SED + E+  AKK       T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  276   KRKAREADDNECQSEDIEVEAGEAKKQGRGSTST--KRSRAAEVHNLSERRRRDRINEKM  333

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  334   KALQELIPRCNKSDKASMLD  353



>emb|CBI22065.3| unnamed protein product [Vitis vinifera]
Length=544

 Score = 97.1 bits (240),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = +3

Query  1431  SHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRI  1610
             ++S KR+ RE EES C SE A+ ESA   KA+   G T  +RSRAAEVHNLSERRRRDRI
Sbjct  297   TNSHKRKGREAEESECQSEAAEHESAARNKASQRSGST--RRSRAAEVHNLSERRRRDRI  354

Query  1611  NEKMRALQELIPNCNKADKASMLD  1682
             NEKM+ALQELIP+ NK+DKASMLD
Sbjct  355   NEKMKALQELIPHSNKSDKASMLD  378



>ref|NP_001067246.1| Os12g0610200 [Oryza sativa Japonica Group]
 gb|ABA99363.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
 gb|ABA99364.2| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF30265.1| Os12g0610200 [Oryza sativa Japonica Group]
 gb|EAY83844.1| hypothetical protein OsI_39060 [Oryza sativa Indica Group]
 dbj|BAG90115.1| unnamed protein product [Oryza sativa Japonica Group]
Length=445

 Score = 96.3 bits (238),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             K+R     ESG PSED + ESA A  +   +  T  KR RAAEVHNLSERRRRDRINEKM
Sbjct  231   KQRGGAAMESGSPSEDVEFESAAATCSPAQKTTTA-KRRRAAEVHNLSERRRRDRINEKM  289

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP+CNK DKASMLD
Sbjct  290   KALQELIPHCNKTDKASMLD  309



>gb|ABA99362.2| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=446

 Score = 96.3 bits (238),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             K+R     ESG PSED + ESA A  +   +  T  KR RAAEVHNLSERRRRDRINEKM
Sbjct  231   KQRGGAAMESGSPSEDVEFESAAATCSPAQKTTTA-KRRRAAEVHNLSERRRRDRINEKM  289

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP+CNK DKASMLD
Sbjct  290   KALQELIPHCNKTDKASMLD  309



>gb|EEC69654.1| hypothetical protein OsI_39066 [Oryza sativa Indica Group]
Length=469

 Score = 96.3 bits (238),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             K+R     ESG PSED + ESA A  +   +  T  KR RAAEVHNLSERRRRDRINEKM
Sbjct  240   KQRGAAAMESGSPSEDVEFESAAATCSPAQKTTTA-KRRRAAEVHNLSERRRRDRINEKM  298

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP+CNK DKASMLD
Sbjct  299   KALQELIPHCNKTDKASMLD  318



>ref|XP_010247965.1| PREDICTED: transcription factor PIF5-like [Nelumbo nucifera]
 ref|XP_010247966.1| PREDICTED: transcription factor PIF5-like [Nelumbo nucifera]
 ref|XP_010247967.1| PREDICTED: transcription factor PIF5-like [Nelumbo nucifera]
Length=516

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 2/82 (2%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S KR+ R+ +ES C SE+A+ ES  A K A   G     RSRAAEVHNLSERRRRDRIN+
Sbjct  289   SHKRKGRDADESECQSEEAEFESDKATKPAQRSGSAC--RSRAAEVHNLSERRRRDRIND  346

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP CNK+DKASMLD
Sbjct  347   KMRALQELIPYCNKSDKASMLD  368



>ref|XP_008777260.1| PREDICTED: transcription factor PIF3-like [Phoenix dactylifera]
Length=618

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR++ E +ESG  S+D ++ S   +K A  RG +  KRSRAAE+HNLSERRRRDRINEKM
Sbjct  352   KRKSLEGDESGYQSDDFEDVSVELEKPATGRGISA-KRSRAAEIHNLSERRRRDRINEKM  410

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIPNCNKADKASML+
Sbjct  411   RALQELIPNCNKADKASMLE  430



>tpg|DAA51720.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=523

 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +3

Query  1422  NDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRR  1601
             +D  H  KR+ R  ++S  PSEDA+ E A  +     R GT ++R+RAAEVHNLSERRRR
Sbjct  279   SDSVHVQKRKGRCRDDSDSPSEDAECEEASEETKPSRRYGT-KRRTRAAEVHNLSERRRR  337

Query  1602  DRINEKMRALQELIPNCNKADKASMLD  1682
             DRINEKMRALQELIP+CNK DKAS+LD
Sbjct  338   DRINEKMRALQELIPHCNKTDKASILD  364



>ref|XP_008665528.1| PREDICTED: transcription factor PIF5 isoform X2 [Zea mays]
Length=537

 Score = 95.9 bits (237),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 66/87 (76%), Gaps = 1/87 (1%)
 Frame = +3

Query  1422  NDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRR  1601
             +D  H  KR+ R  ++S  PSEDA+ E A  +     R GT ++R+RAAEVHNLSERRRR
Sbjct  293   SDSVHVQKRKGRCRDDSDSPSEDAECEEASEETKPSRRYGT-KRRTRAAEVHNLSERRRR  351

Query  1602  DRINEKMRALQELIPNCNKADKASMLD  1682
             DRINEKMRALQELIP+CNK DKAS+LD
Sbjct  352   DRINEKMRALQELIPHCNKTDKASILD  378



>gb|KEH42414.1| transcription factor [Medicago truncatula]
Length=534

 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE EES   SED D E    KK          KRSRAAEVHNLSER+RRDRINEKM
Sbjct  286   KRKGREPEESEFQSEDVDFECREEKKQHRGSTSA--KRSRAAEVHNLSERKRRDRINEKM  343

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  344   KALQELIPRCNKSDKASMLD  363



>ref|XP_008665523.1| PREDICTED: transcription factor PIF5 isoform X1 [Zea mays]
 ref|XP_008665524.1| PREDICTED: transcription factor PIF5 isoform X1 [Zea mays]
 ref|XP_008665525.1| PREDICTED: transcription factor PIF5 isoform X1 [Zea mays]
 ref|XP_008665526.1| PREDICTED: transcription factor PIF5 isoform X1 [Zea mays]
 ref|XP_008665527.1| PREDICTED: transcription factor PIF5 isoform X1 [Zea mays]
Length=566

 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  1422  NDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRR  1601
             +D  H  KR+ R  ++S  PSEDA+ E   +++  P+R    ++R+RAAEVHNLSERRRR
Sbjct  322   SDSVHVQKRKGRCRDDSDSPSEDAECE-EASEETKPSRRYGTKRRTRAAEVHNLSERRRR  380

Query  1602  DRINEKMRALQELIPNCNKADKASMLD  1682
             DRINEKMRALQELIP+CNK DKAS+LD
Sbjct  381   DRINEKMRALQELIPHCNKTDKASILD  407



>ref|XP_007162650.1| hypothetical protein PHAVU_001G168700g [Phaseolus vulgaris]
 ref|XP_007162651.1| hypothetical protein PHAVU_001G168700g [Phaseolus vulgaris]
 gb|ESW34644.1| hypothetical protein PHAVU_001G168700g [Phaseolus vulgaris]
 gb|ESW34645.1| hypothetical protein PHAVU_001G168700g [Phaseolus vulgaris]
Length=497

 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 59/80 (74%), Gaps = 3/80 (4%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE EE    SED D +S   K+   +      KRSRAAEVHNLSERRRRDRINEKM
Sbjct  257   KRKGREAEEWESQSEDVDFDSEAKKQVRGSTST---KRSRAAEVHNLSERRRRDRINEKM  313

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  314   KALQELIPRCNKSDKASMLD  333



>gb|ABF97814.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=481

 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S ++R    E+S  PSEDA+ ESA   +  PA+  T  +RSRAAEVHNLSERRRRDRINE
Sbjct  278   SKRKRLDTTEDSESPSEDAESESAALARKPPAKMTTA-RRSRAAEVHNLSERRRRDRINE  336

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  337   KMRALQELIPHCNKTDKASMLD  358



>gb|ABF97813.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=485

 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S ++R    E+S  PSEDA+ ESA   +  PA+  T  +RSRAAEVHNLSERRRRDRINE
Sbjct  278   SKRKRLDTTEDSESPSEDAESESAALARKPPAKMTTA-RRSRAAEVHNLSERRRRDRINE  336

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  337   KMRALQELIPHCNKTDKASMLD  358



>ref|XP_003559649.1| PREDICTED: transcription factor PIF1-like [Brachypodium distachyon]
 ref|XP_010232235.1| PREDICTED: transcription factor PIF1-like [Brachypodium distachyon]
 ref|XP_010232241.1| PREDICTED: transcription factor PIF1-like [Brachypodium distachyon]
 ref|XP_010232244.1| PREDICTED: transcription factor PIF1-like [Brachypodium distachyon]
 ref|XP_010232250.1| PREDICTED: transcription factor PIF1-like [Brachypodium distachyon]
Length=445

 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +3

Query  1452  ARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRAL  1631
             +R  + S  PSEDA+ ES    +  P       +RSRAAEVHNLSERRRRDRINEKM+AL
Sbjct  230   SRTEDYSESPSEDAESESLALIERKPPLKLPTARRSRAAEVHNLSERRRRDRINEKMKAL  289

Query  1632  QELIPNCNKADKASMLD  1682
             QELIP+CNK DKASMLD
Sbjct  290   QELIPHCNKTDKASMLD  306



>ref|XP_004493862.1| PREDICTED: transcription factor PIF1-like isoform X5 [Cicer arietinum]
Length=491

 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE EE    SED D ESA AK+       +  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  214   KRKGREAEEWEDQSEDVDFESAEAKRNICGSSSSV-KRSRAAEVHNLSERRRRDRINEKM  272

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  273   KALQELIPRCNKSDKASMLD  292



>ref|XP_002521150.1| Phytochrome-interacting factor, putative [Ricinus communis]
 gb|EEF41301.1| Phytochrome-interacting factor, putative [Ricinus communis]
Length=572

 Score = 95.5 bits (236),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE E     SED + ESA AKK A     T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  323   KRKGREEETEYYHSEDVEFESADAKKQARGSTST--KRSRAAEVHNLSERRRRDRINEKM  380

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIP CNK+DKASMLD
Sbjct  381   RALQELIPRCNKSDKASMLD  400



>ref|XP_007051317.1| Phytochrome interacting factor 3, putative [Theobroma cacao]
 gb|EOX95474.1| Phytochrome interacting factor 3, putative [Theobroma cacao]
Length=613

 Score = 95.5 bits (236),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 66/89 (74%), Gaps = 4/89 (4%)
 Frame = +3

Query  1416  ASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERR  1595
             ASN  +++LKRR  + + S    E+A EE  G  KA P+R   G KR R AEVHNLSERR
Sbjct  376   ASNCPTYTLKRRYEDTDLS----ENAMEEPEGTTKAVPSRRSKGAKRKRKAEVHNLSERR  431

Query  1596  RRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRD+INEKMRALQELIPNCNK DKASMLD
Sbjct  432   RRDKINEKMRALQELIPNCNKVDKASMLD  460



>ref|XP_004493861.1| PREDICTED: transcription factor PIF1-like isoform X4 [Cicer arietinum]
Length=506

 Score = 95.1 bits (235),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE EE    SED D ESA AK+       +  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  235   KRKGREAEEWEDQSEDVDFESAEAKRNICGSSSSV-KRSRAAEVHNLSERRRRDRINEKM  293

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  294   KALQELIPRCNKSDKASMLD  313



>gb|EAY91148.1| hypothetical protein OsI_12756 [Oryza sativa Indica Group]
Length=469

 Score = 94.7 bits (234),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +3

Query  1437  SLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             S ++R    E+S  PSEDA+ ESA   +  PA+  T  +RSRAAEVHNLSERRRRDRINE
Sbjct  259   SKRKRLDTTEDSESPSEDAESESAALARKPPAKMTTA-RRSRAAEVHNLSERRRRDRINE  317

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KMRALQELIP+CNK DKASMLD
Sbjct  318   KMRALQELIPHCNKTDKASMLD  339



>ref|XP_004493860.1| PREDICTED: transcription factor PIF1-like isoform X3 [Cicer arietinum]
Length=512

 Score = 95.1 bits (235),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE EE    SED D ESA AK+       +  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  235   KRKGREAEEWEDQSEDVDFESAEAKRNICGSSSSV-KRSRAAEVHNLSERRRRDRINEKM  293

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  294   KALQELIPRCNKSDKASMLD  313



>ref|XP_004493863.1| PREDICTED: transcription factor PIF1-like isoform X6 [Cicer arietinum]
 ref|XP_004493864.1| PREDICTED: transcription factor PIF1-like isoform X7 [Cicer arietinum]
Length=489

 Score = 94.7 bits (234),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE EE    SED D ESA AK+       +  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  235   KRKGREAEEWEDQSEDVDFESAEAKRNICGSSSSV-KRSRAAEVHNLSERRRRDRINEKM  293

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  294   KALQELIPRCNKSDKASMLD  313



>ref|XP_001764406.1| predicted protein [Physcomitrella patens]
 gb|EDQ70673.1| predicted protein [Physcomitrella patens]
Length=1015

 Score = 95.5 bits (236),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakka-aparggtgQKRSRAAEVHNLSERRRRDRINEK  1619
             KR+  E EE+ C SED ++ES   K        G+  KRSRAAEVHN SERRRRDRINEK
Sbjct  694   KRKCSEREETECQSEDGEDESVDTKHKPITTGRGSTTKRSRAAEVHNQSERRRRDRINEK  753

Query  1620  MRALQELIPNCNKADKASMLD  1682
             MRALQELIPN NK DKASMLD
Sbjct  754   MRALQELIPNSNKTDKASMLD  774



>ref|XP_010109673.1| hypothetical protein L484_015158 [Morus notabilis]
 gb|EXC24143.1| hypothetical protein L484_015158 [Morus notabilis]
Length=559

 Score = 94.4 bits (233),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+  E +++ C SED + ES   KK       T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  289   KRKGIEADDAECQSEDVEFESGDTKKQVRGTTST--KRSRAAEVHNLSERRRRDRINEKM  346

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  347   KALQELIPRCNKSDKASMLD  366



>ref|XP_008447346.1| PREDICTED: transcription factor PIF1-like isoform X2 [Cucumis 
melo]
Length=379

 Score = 92.8 bits (229),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 61/82 (74%), Gaps = 4/82 (5%)
 Frame = +3

Query  1443  KRRARENEESG--CPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             KR+ +E ++S   C S D + ES  AKK       T  KRSRAAEVHNLSERRRRDRINE
Sbjct  272   KRKGKETDDSDYLCYSTDVEFESTDAKKQVRGSTST--KRSRAAEVHNLSERRRRDRINE  329

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KM+ALQELIP CNKADKASMLD
Sbjct  330   KMKALQELIPRCNKADKASMLD  351



>gb|KGN44558.1| hypothetical protein Csa_7G333400 [Cucumis sativus]
Length=532

 Score = 94.4 bits (233),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ R  +++ C SED + ESA  KK       T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  279   KRKGRALDDTECQSEDVEYESADPKKQLRGSTST--KRSRAAEVHNLSERRRRDRINEKM  336

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK DKASMLD
Sbjct  337   KALQELIPRCNKTDKASMLD  356



>ref|XP_004139727.1| PREDICTED: transcription factor PIF1-like [Cucumis sativus]
Length=529

 Score = 94.4 bits (233),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ R  +++ C SED + ESA  KK       T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  279   KRKGRALDDTECQSEDVEYESADPKKQLRGSTST--KRSRAAEVHNLSERRRRDRINEKM  336

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK DKASMLD
Sbjct  337   KALQELIPRCNKTDKASMLD  356



>gb|KDP26428.1| hypothetical protein JCGZ_17586 [Jatropha curcas]
Length=537

 Score = 94.0 bits (232),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 62/80 (78%), Gaps = 3/80 (4%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE EE+   SED + ESA AKK       T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  288   KRKGRE-EETEYHSEDVEFESADAKKQVRGSTST--KRSRAAEVHNLSERRRRDRINEKM  344

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIP CNK+DKASMLD
Sbjct  345   RALQELIPRCNKSDKASMLD  364



>ref|XP_001764602.1| predicted protein [Physcomitrella patens]
 gb|EDQ70584.1| predicted protein [Physcomitrella patens]
Length=801

 Score = 94.4 bits (233),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparg-gtgQKRSRAAEVHNLSERRRRDRINEK  1619
             KR++ E EE  C SED ++ES   K+     G  +  KRSRAAEVHN SERRRRDRINEK
Sbjct  555   KRKSSEREEPECQSEDMEDESVDTKQKPATTGRVSTTKRSRAAEVHNQSERRRRDRINEK  614

Query  1620  MRALQELIPNCNKADKASMLD  1682
             MRALQELIPN NK DKASMLD
Sbjct  615   MRALQELIPNSNKTDKASMLD  635



>ref|XP_010936085.1| PREDICTED: transcription factor PIF1-like isoform X2 [Elaeis 
guineensis]
Length=409

 Score = 92.8 bits (229),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ARE + SGC +ED + ES   +K          +RSRAAEVHNL+ERRRRDRINEKM
Sbjct  152   KRKAREGDNSGCQNEDDEFESGDKRKDTHRSAPV--RRSRAAEVHNLAERRRRDRINEKM  209

Query  1623  RALQELIPNCNKADKASMLD  1682
             + LQELIP CNK+DKAS LD
Sbjct  210   KTLQELIPRCNKSDKASTLD  229



>ref|XP_004247109.1| PREDICTED: transcription factor PIF1-like [Solanum lycopersicum]
Length=557

 Score = 94.0 bits (232),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 3/80 (4%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE E+ G  +EDA+ ES   KK A     T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  311   KRKGREMEDEGQ-NEDAEFESPDTKKQARGSTST--KRSRAAEVHNLSERRRRDRINEKM  367

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK DKASMLD
Sbjct  368   KALQELIPRCNKTDKASMLD  387



>ref|XP_008461998.1| PREDICTED: transcription factor PIF1 [Cucumis melo]
 ref|XP_008461999.1| PREDICTED: transcription factor PIF1 [Cucumis melo]
Length=532

 Score = 93.6 bits (231),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ R  +++ C SED + ESA  KK       T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  279   KRKGRALDDTECHSEDIEYESADPKKQLRGSTST--KRSRAAEVHNLSERRRRDRINEKM  336

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK DKASMLD
Sbjct  337   KALQELIPRCNKTDKASMLD  356



>ref|XP_010936084.1| PREDICTED: transcription factor PIF1-like isoform X1 [Elaeis 
guineensis]
Length=420

 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ARE + SGC +ED + ES   +K          +RSRAAEVHNL+ERRRRDRINEKM
Sbjct  152   KRKAREGDNSGCQNEDDEFESGDKRKDTHRSAPV--RRSRAAEVHNLAERRRRDRINEKM  209

Query  1623  RALQELIPNCNKADKASMLD  1682
             + LQELIP CNK+DKAS LD
Sbjct  210   KTLQELIPRCNKSDKASTLD  229



>ref|XP_008447345.1| PREDICTED: transcription factor PIF1-like isoform X1 [Cucumis 
melo]
Length=518

 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 61/82 (74%), Gaps = 4/82 (5%)
 Frame = +3

Query  1443  KRRARENEESG--CPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             KR+ +E ++S   C S D + ES  AKK       T  KRSRAAEVHNLSERRRRDRINE
Sbjct  272   KRKGKETDDSDYLCYSTDVEFESTDAKKQVRGSTST--KRSRAAEVHNLSERRRRDRINE  329

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KM+ALQELIP CNKADKASMLD
Sbjct  330   KMKALQELIPRCNKADKASMLD  351



>gb|EYU35367.1| hypothetical protein MIMGU_mgv1a019493mg, partial [Erythranthe 
guttata]
Length=257

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  1551  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             KRSR AEVHNLSERRRRDRINEKMRALQELIPNCNK DKASMLD
Sbjct  131   KRSRVAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLD  174



>ref|XP_002981138.1| hypothetical protein SELMODRAFT_114141, partial [Selaginella 
moellendorffii]
 gb|EFJ17839.1| hypothetical protein SELMODRAFT_114141, partial [Selaginella 
moellendorffii]
Length=85

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  1551  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             KRSRAAEVHNLSERRRRDRINEKM+ALQELIPN NK DKASMLD
Sbjct  17    KRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLD  60



>ref|XP_009591396.1| PREDICTED: transcription factor PIF1-like [Nicotiana tomentosiformis]
Length=554

 Score = 93.2 bits (230),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 70/109 (64%), Gaps = 6/109 (6%)
 Frame = +3

Query  1356  NKAVEPgacssvcsgssaERASNDQSHSLKRRARENEESGCPSEDADEESagakkaapar  1535
             N + EP    +    +    ASND+    KR+ RE  +    +E+A+ ES   KK A   
Sbjct  282   NTSAEPPPSQTAALATPTAAASNDR----KRKGRETNDGDGQNEEAEFESGDTKKHARGS  337

Query  1536  ggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
               T  KRSRAAEVHNLSERRRRDRINEKMRALQELIP CNK DKASMLD
Sbjct  338   AST--KRSRAAEVHNLSERRRRDRINEKMRALQELIPRCNKTDKASMLD  384



>ref|XP_002982619.1| hypothetical protein SELMODRAFT_116654, partial [Selaginella 
moellendorffii]
 gb|EFJ16372.1| hypothetical protein SELMODRAFT_116654, partial [Selaginella 
moellendorffii]
Length=85

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  1551  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             KRSRAAEVHNLSERRRRDRINEKM+ALQELIPN NK DKASMLD
Sbjct  17    KRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLD  60



>ref|XP_007201708.1| hypothetical protein PRUPE_ppa004070mg [Prunus persica]
 gb|EMJ02907.1| hypothetical protein PRUPE_ppa004070mg [Prunus persica]
Length=531

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = +3

Query  1443  KRRARENEESG-CPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEK  1619
             KR+ RE E+ G   SED + ESA  KK A     T  KRSRAAEVHNLSERRRRDRINEK
Sbjct  284   KRKGREAEDDGEFQSEDVEFESANGKKQARGSTST--KRSRAAEVHNLSERRRRDRINEK  341

Query  1620  MRALQELIPNCNKADKASMLD  1682
             M+ALQELIP CNK+DKASMLD
Sbjct  342   MKALQELIPRCNKSDKASMLD  362



>gb|KCW58688.1| hypothetical protein EUGRSUZ_H01336 [Eucalyptus grandis]
Length=558

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 82/149 (55%), Gaps = 10/149 (7%)
 Frame = +3

Query  423  MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS-  593
            MPL E  KM K   +S   KPTSSS D LS +P ++  EL WE+GQ+ +QGQSS+AK+  
Sbjct  1    MPLFELFKMAKAKLDSSLEKPTSSSTD-LSSVPANELVELTWEHGQVVLQGQSSRAKRGP  59

Query  594  ------DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                   N S+ RE    + +  R GK      VL E P +  S E+ L Q+D++ PWL+
Sbjct  60   FSNNTPSNGSKPREGASDDDTRPRPGKFRNLECVLSEFPVTEQSSEIGLGQEDDMVPWLS  119

Query  756  YSPSNGQSQEYGSQLLPEISGTTANEPSP  842
            +  +     +Y S LL E++   AN  SP
Sbjct  120  FPVTGSLQNDYCSDLLTELTAVAANGTSP  148



>gb|KCW58687.1| hypothetical protein EUGRSUZ_H01336 [Eucalyptus grandis]
Length=559

 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 82/149 (55%), Gaps = 10/149 (7%)
 Frame = +3

Query  423  MPLSEFLKMLKN--ESGERKPTSSSADDLSPLPGSDFSELVWENGQITMQGQSSKAKKS-  593
            MPL E  KM K   +S   KPTSSS D LS +P ++  EL WE+GQ+ +QGQSS+AK+  
Sbjct  1    MPLFELFKMAKAKLDSSLEKPTSSSTD-LSSVPANELVELTWEHGQVVLQGQSSRAKRGP  59

Query  594  ------DNLSRMREKCVGNASSSRIGKLDLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLN  755
                   N S+ RE    + +  R GK      VL E P +  S E+ L Q+D++ PWL+
Sbjct  60   FSNNTPSNGSKPREGASDDDTRPRPGKFRNLECVLSEFPVTEQSSEIGLGQEDDMVPWLS  119

Query  756  YSPSNGQSQEYGSQLLPEISGTTANEPSP  842
            +  +     +Y S LL E++   AN  SP
Sbjct  120  FPVTGSLQNDYCSDLLTELTAVAANGTSP  148



>ref|XP_008235752.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor PIF1-like 
[Prunus mume]
Length=450

 Score = 92.0 bits (227),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = +3

Query  1443  KRRARENEESG-CPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEK  1619
             KR+ RE E+ G   SED + ESA  KK A     T  KRSRAAEVHNLSERRRRDRINEK
Sbjct  203   KRKGREAEDDGEFQSEDVEFESANGKKKARGSTST--KRSRAAEVHNLSERRRRDRINEK  260

Query  1620  MRALQELIPNCNKADKASMLD  1682
             M+ALQELIP CNK+DKASMLD
Sbjct  261   MKALQELIPRCNKSDKASMLD  281



>gb|KGN58326.1| hypothetical protein Csa_3G622450 [Cucumis sativus]
Length=539

 Score = 92.4 bits (228),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 61/82 (74%), Gaps = 4/82 (5%)
 Frame = +3

Query  1443  KRRARENEESG--CPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINE  1616
             KR+ +E ++S   C S D + ES  AKK       T  KRSRAAEVHNLSERRRRDRINE
Sbjct  272   KRKGKETDDSDYLCYSTDVEFESTDAKKQVRGSTST--KRSRAAEVHNLSERRRRDRINE  329

Query  1617  KMRALQELIPNCNKADKASMLD  1682
             KM+ALQELIP CNKADKASMLD
Sbjct  330   KMKALQELIPRCNKADKASMLD  351



>ref|XP_002983759.1| hypothetical protein SELMODRAFT_118904, partial [Selaginella 
moellendorffii]
 gb|EFJ15255.1| hypothetical protein SELMODRAFT_118904, partial [Selaginella 
moellendorffii]
Length=89

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +3

Query  1551  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLD  1682
             KRSRAAEVHNLSERRRRDRINEKMRALQELIPN NK DKASMLD
Sbjct  14    KRSRAAEVHNLSERRRRDRINEKMRALQELIPNSNKTDKASMLD  57



>ref|XP_008789575.1| PREDICTED: transcription factor APG-like [Phoenix dactylifera]
Length=406

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ARE + S   SEDA+ ES    K          +RS AAEVHNL+ERRRRDRINEKM
Sbjct  156   KRKAREGDNSEFQSEDAEFESGDKGKDTHRSAS--MRRSGAAEVHNLAERRRRDRINEKM  213

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK+DKASMLD
Sbjct  214   KALQELIPRCNKSDKASMLD  233



>ref|XP_006350296.1| PREDICTED: transcription factor PIF1-like isoform X2 [Solanum 
tuberosum]
Length=553

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 3/80 (4%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE ++ G  +EDA+ ES   KK A     T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  307   KRKGREKDDEGQ-NEDAEFESPDTKKQARGSTST--KRSRAAEVHNLSERRRRDRINEKM  363

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK DKASMLD
Sbjct  364   KALQELIPRCNKTDKASMLD  383



>ref|XP_010904655.1| PREDICTED: transcription factor PIF4-like isoform X2 [Elaeis 
guineensis]
Length=572

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 127/438 (29%), Positives = 189/438 (43%), Gaps = 118/438 (27%)
 Frame = +3

Query  513   PGSDFSELVWENGQITMQGQSSK-----------AKKSDNLSRMREKCVGNASSSRIGKL  659
             P ++  EL+W++G++ M  Q+ +           A+K++  S+ R   +GN+S       
Sbjct  31    PDNELVELLWQDGRVIMHSQTHRKSPPTVGEFKQAQKAEPASKCR-GALGNSS-------  82

Query  660   DLAGSVLDEMPPSVPSGEMDLSQDDEIAPWLNYSPSNGQSQEYGSQLLPEISGTTANEPS  839
                                +LSQ+DE A W  +S  +   +E+ S+   E     A    
Sbjct  83    -------------------NLSQEDETASWFQHSLDDSLEKEF-SEFFCETPNVDA----  118

Query  840   PHDGFPLIGAS---KSVVNSGQRNATKLDCSPRFGLLASWSSQQANPLVSGVSDIGSSNG  1010
                    IG+S   K V   G+R       S  FG     ++++ N  V   SD   S  
Sbjct  119   -------IGSSKMTKDVTEEGER-------STNFG-----ANEETN--VFAASDPKQSR-  156

Query  1011  SINLDSILKDSVPPQAKNQDTETTR--TCPP--TLLNFSNFS--RPVVLARANLQNTL-E  1169
                     K++  P  K+    +T+  +C     L+NFS+F+  RPV+    +L   L +
Sbjct  157   -----ICFKENTMPPPKSHIIASTQQASCLANSNLVNFSHFTRPRPVMADVGSLNGQLGK  211

Query  1170  AKGKREKEIKENAQNPAKTALIEACSTSRKESDLKSQPN--------------LRTKFEQ  1307
               GKR   I+  A     T  I +      +   ++ P+              L+   + 
Sbjct  212   ESGKR---IRAGAVESTSTMTIASSICESNQIQAQADPSHTISSDAAGVVVRGLKEDAQM  268

Query  1308  TDAS-REDTNDADKVHGNKAVEPgacssvcsgssaERASNDQSHSLKRRARENEESGCPS  1484
             T  S R  TN  +             S    G + ++++ +QSH  KR+ R+ EE    S
Sbjct  269   TSLSERTRTNTYEAT----VTSSSGGSGCSFGRTGQQSAINQSH--KRKGRDAEEYESQS  322

Query  1485  EDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNK--  1658
             E+AD E   A K A        +RSR+AEVHNLSERRRRDRINEKM+ALQELIP+CNK  
Sbjct  323   EEADYEYVEANKLAQRSALP--RRSRSAEVHNLSERRRRDRINEKMKALQELIPHCNKLL  380

Query  1659  ----------ADKASMLD  1682
                        DKASMLD
Sbjct  381   YSRNIGHRHDTDKASMLD  398



>ref|XP_006350295.1| PREDICTED: transcription factor PIF1-like isoform X1 [Solanum 
tuberosum]
Length=578

 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 3/80 (4%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE ++ G  +EDA+ ES   KK A     T  KRSRAAEVHNLSERRRRDRINEKM
Sbjct  307   KRKGREKDDEGQ-NEDAEFESPDTKKQARGSTST--KRSRAAEVHNLSERRRRDRINEKM  363

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP CNK DKASMLD
Sbjct  364   KALQELIPRCNKTDKASMLD  383



>ref|XP_009757612.1| PREDICTED: transcription factor PIF4 [Nicotiana sylvestris]
 ref|XP_009757613.1| PREDICTED: transcription factor PIF4 [Nicotiana sylvestris]
Length=483

 Score = 91.3 bits (225),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 67/89 (75%), Gaps = 4/89 (4%)
 Frame = +3

Query  1416  ASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERR  1595
             A+N QSH  KR++R+ EE  C S+  + ESAG  K+A   G    +RSRAAEVHNLSERR
Sbjct  255   ATNSQSH--KRKSRDGEEPECQSKAGELESAGGNKSAQKSGTA--RRSRAAEVHNLSERR  310

Query  1596  RRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRDRINEKM+ALQEL+P+  K DKASMLD
Sbjct  311   RRDRINEKMKALQELLPHSTKTDKASMLD  339



>ref|XP_009407100.1| PREDICTED: transcription factor PIF1-like [Musa acuminata subsp. 
malaccensis]
Length=415

 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ R+ + +   SE+A+ ES  AKKAA     T  +RSRAAEVHNLSERRRRDRINEKM
Sbjct  216   KRKQRDVQVAEYQSEEAEFESVEAKKAAQGSIST--RRSRAAEVHNLSERRRRDRINEKM  273

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP+CNK DKASMLD
Sbjct  274   KALQELIPHCNKTDKASMLD  293



>ref|XP_009602219.1| PREDICTED: transcription factor PIF4 [Nicotiana tomentosiformis]
Length=481

 Score = 91.3 bits (225),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 67/89 (75%), Gaps = 4/89 (4%)
 Frame = +3

Query  1416  ASNDQSHSLKRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERR  1595
             A+N QSH  KR++R+ EE  C S+  + ESAG  K+A   G    +RSRAAEVHNLSERR
Sbjct  253   ATNSQSH--KRKSRDGEEPECQSKAGELESAGGNKSAQKSGTA--RRSRAAEVHNLSERR  308

Query  1596  RRDRINEKMRALQELIPNCNKADKASMLD  1682
             RRDRINEKM+ALQEL+P+  K DKASMLD
Sbjct  309   RRDRINEKMKALQELLPHSTKTDKASMLD  337



>ref|XP_003625475.1| Transcription factor PIF1 [Medicago truncatula]
 gb|AES81693.1| transcription factor [Medicago truncatula]
Length=467

 Score = 90.9 bits (224),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 58/80 (73%), Gaps = 3/80 (4%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+  E EE    SED D ESA AKK          KRSRAAEVHNLSERRRRDRINEKM
Sbjct  222   KRKGIEAEEWEYQSEDVDFESAEAKKNISGSST---KRSRAAEVHNLSERRRRDRINEKM  278

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP  NK+DKASMLD
Sbjct  279   KALQELIPRSNKSDKASMLD  298



>gb|ABN08903.1| Helix-loop-helix DNA-binding [Medicago truncatula]
Length=484

 Score = 90.9 bits (224),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 58/80 (73%), Gaps = 3/80 (4%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+  E EE    SED D ESA AKK          KRSRAAEVHNLSERRRRDRINEKM
Sbjct  222   KRKGIEAEEWEYQSEDVDFESAEAKKNISGSST---KRSRAAEVHNLSERRRRDRINEKM  278

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP  NK+DKASMLD
Sbjct  279   KALQELIPRSNKSDKASMLD  298



>ref|XP_010231744.1| PREDICTED: transcription factor APG-like [Brachypodium distachyon]
Length=319

 Score = 89.0 bits (219),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 57/88 (65%), Gaps = 1/88 (1%)
 Frame = +3

Query  1422  NDQSHSLKRRARENE-ESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRR  1598
              D+SH LKR + +   E     +D D +         A G    KR R AEVHN+SERRR
Sbjct  93    GDRSHQLKRSSHQAAAEWSLSQDDEDLDDEAGGLRRSAAGARSTKRGRTAEVHNMSERRR  152

Query  1599  RDRINEKMRALQELIPNCNKADKASMLD  1682
             RDRINEKMRALQELIPNCNK DKASML+
Sbjct  153   RDRINEKMRALQELIPNCNKIDKASMLE  180



>gb|KEH23988.1| transcription factor [Medicago truncatula]
Length=461

 Score = 90.5 bits (223),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 58/80 (73%), Gaps = 3/80 (4%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+  E EE    SED D ESA AKK          KRSRAAEVHNLSERRRRDRINEKM
Sbjct  222   KRKGIEAEEWEYQSEDVDFESAEAKKNISGSST---KRSRAAEVHNLSERRRRDRINEKM  278

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP  NK+DKASMLD
Sbjct  279   KALQELIPRSNKSDKASMLD  298



>gb|ACR38655.1| unknown [Zea mays]
Length=435

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 58/80 (73%), Gaps = 4/80 (5%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+  + E S    +D D+ES G +++         KRSR AEVHNLSERRRRDRINEKM
Sbjct  146   KRKTLQAECSASQDDDPDDESGGMRRSCSRGA----KRSRTAEVHNLSERRRRDRINEKM  201

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIPNCNK DKASMLD
Sbjct  202   RALQELIPNCNKIDKASMLD  221



>ref|XP_006364548.1| PREDICTED: transcription factor PIF1-like [Solanum tuberosum]
Length=515

 Score = 90.9 bits (224),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE++++   SED + E A A+K   +      K+SRAAEVHNLSER+RRDRINEKM
Sbjct  272   KRKGRESDDNDGQSEDVEYEFADARKQVRSSTSA--KKSRAAEVHNLSERKRRDRINEKM  329

Query  1623  RALQELIPNCNKADKASMLD  1682
             +ALQELIP+CNK+DKASMLD
Sbjct  330   KALQELIPHCNKSDKASMLD  349



>ref|NP_001051465.1| Os03g0782500 [Oryza sativa Japonica Group]
 gb|ABF99196.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
 gb|ABF99198.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13379.1| Os03g0782500 [Oryza sativa Japonica Group]
 dbj|BAG97322.1| unnamed protein product [Oryza sativa Japonica Group]
Length=410

 Score = 89.7 bits (221),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 3/80 (4%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ RE+ +S   SEDA+ E+    K++  R G+ ++R+RAAEVHNLSERRRRDRINEKM
Sbjct  184   KRKGREDSDSR--SEDAECEATEETKSSSRRYGS-KRRTRAAEVHNLSERRRRDRINEKM  240

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIP+CNK DKAS+LD
Sbjct  241   RALQELIPHCNKTDKASILD  260



>ref|XP_004303901.1| PREDICTED: transcription factor PIF5-like [Fragaria vesca subsp. 
vesca]
Length=540

 Score = 90.9 bits (224),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 2/80 (3%)
 Frame = +3

Query  1443  KRRARENEESGCPSEDADEESagakkaaparggtgQKRSRAAEVHNLSERRRRDRINEKM  1622
             KR+ R+ E+S C S+ A+ ESA   K AP  G +  +R+RAAEVHNLSERRRRDRINEKM
Sbjct  306   KRKGRDAEDSECQSKAAEIESAAGNKPAPRSGSS--RRTRAAEVHNLSERRRRDRINEKM  363

Query  1623  RALQELIPNCNKADKASMLD  1682
             RALQELIP+ NK DKASMLD
Sbjct  364   RALQELIPHSNKTDKASMLD  383



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4779876462004